BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16871_g1_i2 len=716 path=[1661:0-355 366:356-394 1556:395-499
510:500-715]

Length=716
                                                                      Score     E

ref|XP_009626880.1|  PREDICTED: uncharacterized protein LOC104117521    244   4e-78   
ref|XP_006341627.1|  PREDICTED: uncharacterized protein LOC102601216    243   7e-78   
ref|XP_004235826.1|  PREDICTED: uncharacterized protein LOC101260326    243   9e-78   
ref|XP_009762360.1|  PREDICTED: uncharacterized protein LOC104214399    241   4e-77   
emb|CDO98460.1|  unnamed protein product                                241   9e-77   
ref|XP_010265218.1|  PREDICTED: uncharacterized protein LOC104603017    232   2e-73   
ref|XP_002311446.1|  hypothetical protein POPTR_0008s11660g             225   9e-71   Populus trichocarpa [western balsam poplar]
ref|XP_011097007.1|  PREDICTED: uncharacterized protein LOC105176...    224   2e-70   
ref|XP_011021774.1|  PREDICTED: uncharacterized protein LOC105123758    224   4e-70   
ref|XP_002274839.1|  PREDICTED: uncharacterized protein LOC100247572    224   4e-70   Vitis vinifera
ref|XP_002315955.2|  hypothetical protein POPTR_0010s13860g             222   2e-69   Populus trichocarpa [western balsam poplar]
ref|XP_007225975.1|  hypothetical protein PRUPE_ppa012655mg             221   4e-69   
ref|XP_010551290.1|  PREDICTED: uncharacterized protein LOC104821956    221   6e-69   
ref|XP_011008424.1|  PREDICTED: uncharacterized protein LOC105113795    221   6e-69   
ref|XP_008243187.1|  PREDICTED: uncharacterized protein LOC103341...    219   2e-68   
ref|XP_008446565.1|  PREDICTED: uncharacterized protein LOC103489...    219   2e-68   
ref|XP_009417647.1|  PREDICTED: uncharacterized protein LOC103998009    219   2e-68   
ref|XP_009336603.1|  PREDICTED: uncharacterized protein LOC103929179    218   5e-68   
ref|XP_010263121.1|  PREDICTED: uncharacterized protein LOC104601472    218   7e-68   
ref|XP_004157424.1|  PREDICTED: ATP-dependent Clp protease adapte...    217   1e-67   
ref|XP_004137466.1|  PREDICTED: ATP-dependent Clp protease adapte...    217   2e-67   
ref|XP_002281884.1|  PREDICTED: uncharacterized protein LOC100242...    216   2e-67   Vitis vinifera
ref|XP_007046287.1|  Ribosomal protein L12/ ATP-dependent Clp pro...    216   3e-67   
ref|XP_009356359.1|  PREDICTED: uncharacterized protein LOC103947...    216   4e-67   
gb|KDP29376.1|  hypothetical protein JCGZ_18297                         216   4e-67   
ref|XP_006838422.1|  hypothetical protein AMTR_s00002p00109470          216   4e-67   
ref|XP_004135108.1|  PREDICTED: ATP-dependent Clp protease adapte...    215   1e-66   
ref|XP_010906089.1|  PREDICTED: uncharacterized protein LOC105033123    214   2e-66   
ref|XP_010037358.1|  PREDICTED: uncharacterized protein LOC104426108    213   7e-66   
ref|XP_008812804.1|  PREDICTED: uncharacterized protein LOC103723618    213   7e-66   
ref|XP_009356351.1|  PREDICTED: uncharacterized protein LOC103947...    213   8e-66   
gb|KHN32015.1|  ATP-dependent Clp protease adapter protein ClpS         211   3e-65   
ref|XP_003534179.1|  PREDICTED: uncharacterized protein LOC100785379    211   4e-65   
ref|XP_008389302.1|  PREDICTED: uncharacterized protein LOC103451667    210   8e-65   
ref|XP_010695849.1|  PREDICTED: uncharacterized protein LOC104908432    210   8e-65   
gb|KCW49062.1|  hypothetical protein EUGRSUZ_K02665                     212   9e-65   
ref|XP_007209725.1|  hypothetical protein PRUPE_ppa012720mg             210   9e-65   
ref|NP_001234970.1|  uncharacterized protein LOC100527361               209   1e-64   
ref|XP_010092771.1|  ATP-dependent Clp protease adapter protein ClpS    209   1e-64   
ref|XP_008368219.1|  PREDICTED: uncharacterized protein LOC103431...    209   2e-64   
gb|AFK40356.1|  unknown                                                 209   2e-64   
ref|XP_007152795.1|  hypothetical protein PHAVU_004G160300g             209   2e-64   
ref|XP_006391113.1|  hypothetical protein EUTSA_v10019264mg             208   5e-64   
ref|XP_008351876.1|  PREDICTED: uncharacterized protein LOC103415312    207   6e-64   
ref|XP_007153355.1|  hypothetical protein PHAVU_003G028500g             207   8e-64   
ref|NP_001237811.1|  uncharacterized protein LOC100306117               207   8e-64   
ref|XP_008374733.1|  PREDICTED: uncharacterized protein LOC103437976    207   1e-63   
ref|XP_008368218.1|  PREDICTED: uncharacterized protein LOC103431...    207   1e-63   
ref|XP_010105775.1|  ATP-dependent Clp protease adapter protein ClpS    207   2e-63   
ref|XP_009346932.1|  PREDICTED: uncharacterized protein LOC103938628    206   2e-63   
ref|XP_009127660.1|  PREDICTED: uncharacterized protein LOC103852515    206   3e-63   
ref|XP_004299231.1|  PREDICTED: ATP-dependent Clp protease adapte...    205   6e-63   
ref|XP_003614502.1|  ATP-dependent Clp protease adapter protein clpS    205   7e-63   
ref|XP_009337127.1|  PREDICTED: uncharacterized protein LOC103929630    205   8e-63   
gb|ADE75982.1|  unknown                                                 205   8e-63   
ref|NP_001235414.1|  uncharacterized protein LOC100500511               204   1e-62   
ref|XP_006437722.1|  hypothetical protein CICLE_v10032968mg             204   2e-62   
emb|CAN78258.1|  hypothetical protein VITISV_026645                     202   4e-62   Vitis vinifera
ref|NP_564937.1|  protein ClpS1                                         203   5e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006484424.1|  PREDICTED: uncharacterized protein LOC102625...    202   9e-62   
ref|XP_002888676.1|  hypothetical protein ARALYDRAFT_894639             202   1e-61   
ref|XP_009105027.1|  PREDICTED: uncharacterized protein LOC103830957    201   2e-61   
ref|XP_010511878.1|  PREDICTED: uncharacterized protein LOC104787...    200   6e-61   
ref|XP_002529149.1|  ATP-dependent Clp protease adaptor protein c...    198   8e-61   Ricinus communis
emb|CDY04242.1|  BnaC06g25730D                                          199   1e-60   
ref|XP_006302940.1|  hypothetical protein CARUB_v10021079mg             199   1e-60   
emb|CDY07372.1|  BnaA07g24510D                                          198   3e-60   
ref|XP_006484423.1|  PREDICTED: uncharacterized protein LOC102625...    198   4e-60   
gb|KFK41289.1|  hypothetical protein AALP_AA2G110700                    197   6e-60   
ref|XP_008446566.1|  PREDICTED: uncharacterized protein LOC103489...    196   8e-60   
gb|AFK41868.1|  unknown                                                 197   9e-60   
ref|XP_010511877.1|  PREDICTED: uncharacterized protein LOC104787...    196   4e-59   
gb|KHG03772.1|  ATP-dependent Clp protease adapter ClpS                 194   8e-59   
ref|XP_002964066.1|  hypothetical protein SELMODRAFT_142341             190   8e-57   
ref|XP_002445542.1|  hypothetical protein SORBIDRAFT_07g021160          189   2e-56   Sorghum bicolor [broomcorn]
gb|AFK41715.1|  unknown                                                 188   3e-56   
gb|EYU24492.1|  hypothetical protein MIMGU_mgv1a012902mg                190   4e-56   
ref|XP_004973504.1|  PREDICTED: uncharacterized protein LOC101765727    187   6e-56   
ref|XP_006437721.1|  hypothetical protein CICLE_v10032968mg             186   7e-56   
emb|CDX81534.1|  BnaC02g18380D                                          185   3e-55   
ref|XP_007046288.1|  Ribosomal protein L12/ ATP-dependent Clp pro...    184   3e-55   
ref|XP_004512946.1|  PREDICTED: ATP-dependent Clp protease adapte...    185   6e-55   
ref|NP_001150373.1|  ATP-dependent Clp protease adaptor protein C...    184   8e-55   Zea mays [maize]
ref|XP_006660150.1|  PREDICTED: uncharacterized protein LOC102702777    184   2e-54   
ref|NP_001061868.1|  Os08g0432500                                       182   7e-54   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ42831.1|  hypothetical protein OsJ_27419                          182   1e-53   Oryza sativa Japonica Group [Japonica rice]
gb|ACN25974.1|  unknown                                                 179   3e-53   Zea mays [maize]
ref|NP_001148322.1|  ATP-dependent Clp protease adaptor protein C...    179   1e-52   Zea mays [maize]
gb|ACG45478.1|  ATP-dependent Clp protease adaptor protein ClpS c...    177   7e-52   Zea mays [maize]
ref|XP_010235149.1|  PREDICTED: uncharacterized protein LOC100827...    176   1e-51   
ref|XP_003574520.1|  PREDICTED: uncharacterized protein LOC100827...    175   3e-51   
gb|ACN28518.1|  unknown                                                 174   3e-51   Zea mays [maize]
emb|CAK19331.1|  putative adaptor protein ClpS                          171   7e-50   Physcomitrella patens
ref|XP_001758483.1|  predicted protein                                  168   4e-49   
gb|EMS49025.1|  ATP-dependent Clp protease adapter protein ClpS         169   1e-48   
gb|EMT14943.1|  ATP-dependent Clp protease adapter protein clpS         169   1e-48   
ref|XP_001759963.1|  predicted protein                                  166   3e-48   
ref|XP_008813528.1|  PREDICTED: uncharacterized protein LOC103724139    165   2e-47   
ref|XP_011097008.1|  PREDICTED: uncharacterized protein LOC105176...    163   7e-47   
emb|CBI27053.3|  unnamed protein product                                146   3e-40   
ref|NP_001077794.1|  protein ClpS1                                      137   1e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KFM27933.1|  ATP-dependent Clp protease adapter protein ClpS         120   6e-31   
ref|XP_005846196.1|  hypothetical protein CHLNCDRAFT_31972              117   1e-28   
ref|WP_035996409.1|  Clp protease ClpS                                  104   8e-25   
ref|WP_011610869.1|  ATP-dependent Clp protease ClpS                    104   9e-25   
ref|WP_036532992.1|  Clp protease ClpS                                  103   3e-24   
ref|WP_013190159.1|  ATP-dependent Clp protease ClpS                    103   4e-24   
ref|WP_015214561.1|  ATP-dependent Clp protease adapter protein clpS    102   8e-24   
ref|WP_007634189.1|  ATP-dependent Clp protease adaptor protein ClpS    102   8e-24   
ref|WP_009456056.1|  MULTISPECIES: ATP-dependent Clp protease ClpS      101   1e-23   
ref|WP_016860893.1|  MULTISPECIES: ATP-dependent Clp protease ClpS      101   1e-23   
ref|WP_036617496.1|  Clp protease ClpS                                  101   1e-23   
gb|EKQ67824.1|  hypothetical protein OsccyDRAFT_4115                    101   1e-23   
ref|WP_007357540.1|  MULTISPECIES: ATP-dependent Clp protease ClpS      101   2e-23   
ref|WP_013321113.1|  ATP-dependent Clp protease ClpS                    101   2e-23   
ref|XP_005650531.1|  ClpS-domain-containing protein                     102   3e-23   
ref|WP_015187925.1|  ATP-dependent Clp protease adapter protein clpS    100   5e-23   
ref|WP_026731479.1|  Clp protease ClpS                                  100   5e-23   
ref|WP_017304153.1|  ATP-dependent Clp protease ClpS                    100   5e-23   
ref|WP_017311583.1|  ATP-dependent Clp protease ClpS                    100   5e-23   
ref|WP_015143326.1|  hypothetical protein                             99.8    6e-23   
ref|WP_015140415.1|  hypothetical protein                             99.8    6e-23   
ref|WP_008054756.1|  MULTISPECIES: ATP-dependent Clp protease ClpS    99.8    6e-23   
ref|WP_011318115.1|  ATP-dependent Clp protease ClpS                  99.8    7e-23   
ref|WP_039729975.1|  Clp protease ClpS                                99.8    7e-23   
ref|WP_012599020.1|  ATP-dependent Clp protease ClpS                  99.8    7e-23   
ref|WP_017718076.1|  ATP-dependent Clp protease ClpS                  99.8    8e-23   
ref|WP_017315338.1|  ATP-dependent Clp protease ClpS                  99.4    8e-23   
gb|KEI67472.1|  ClpS                                                  99.4    9e-23   
ref|WP_026788081.1|  MULTISPECIES: Clp protease ClpS                  99.4    1e-22   
ref|WP_016922614.1|  ATP-dependent Clp protease ClpS                  99.0    1e-22   
ref|WP_002738526.1|  MULTISPECIES: ATP-dependent Clp protease ClpS    98.6    2e-22   
ref|WP_026104086.1|  Clp protease ClpS                                98.6    2e-22   
ref|WP_015156315.1|  ATP-dependent Clp protease adaptor protein ClpS  98.2    2e-22   
ref|WP_012267626.1|  ATP-dependent Clp protease ClpS                  98.2    2e-22   
ref|WP_012594501.1|  MULTISPECIES: ATP-dependent Clp protease ClpS    98.2    2e-22   
ref|WP_038075846.1|  Clp protease ClpS                                98.2    2e-22   
ref|WP_016879578.1|  ATP-dependent Clp protease ClpS                  98.2    2e-22   
ref|WP_006622078.1|  MULTISPECIES: ATP-dependent Clp protease ClpS    98.6    3e-22   
ref|WP_026100144.1|  Clp protease ClpS                                97.8    4e-22   
ref|WP_015113510.1|  ATP-dependent Clp protease adapter protein clpS  97.8    4e-22   
ref|WP_017320529.1|  ATP-dependent Clp protease ClpS                  97.4    4e-22   
ref|WP_006619677.1|  ATP-dependent Clp protease ClpS                  97.4    5e-22   
ref|WP_010998463.1|  ATP-dependent Clp protease ClpS                  97.4    5e-22   
ref|WP_029633226.1|  Clp protease ClpS [                              97.4    5e-22   
ref|WP_015225234.1|  ATP-dependent Clp protease adaptor protein ClpS  97.4    6e-22   
ref|WP_008275034.1|  MULTISPECIES: ATP-dependent Clp protease ClpS    97.4    6e-22   
ref|WP_028083373.1|  Clp protease ClpS                                97.1    7e-22   
ref|WP_035155638.1|  Clp protease ClpS                                96.7    9e-22   
ref|WP_018399985.1|  ATP-dependent Clp protease ClpS                  96.7    1e-21   
ref|WP_015160261.1|  hypothetical protein                             96.3    1e-21   
ref|WP_015210276.1|  hypothetical protein                             96.3    1e-21   
ref|WP_019498680.1|  ATP-dependent Clp protease ClpS                  96.3    1e-21   
ref|WP_019509270.1|  ATP-dependent Clp protease ClpS                  96.3    1e-21   
ref|WP_036476664.1|  Clp protease ClpS                                96.3    1e-21   
ref|WP_027401430.1|  Clp protease ClpS                                95.9    2e-21   
ref|WP_015229456.1|  hypothetical protein                             96.3    2e-21   
ref|WP_014277446.1|  ATP-dependent Clp protease adaptor protein ClpS  96.7    2e-21   
dbj|BAP18245.1|  ATP-dependent Clp protease adaptor protein ClpS      96.3    2e-21   
ref|WP_026093372.1|  Clp protease ClpS                                95.9    2e-21   
ref|WP_039742535.1|  Clp protease ClpS                                95.9    2e-21   
ref|WP_009343049.1|  ATP-dependent Clp protease ClpS                  95.5    2e-21   
ref|WP_015194671.1|  ATP-dependent Clp protease adapter protein clpS  95.5    3e-21   
ref|WP_015201995.1|  ATP-dependent Clp protease adapter protein clpS  95.1    3e-21   
ref|WP_022604067.1|  hypothetical protein                             95.5    3e-21   
ref|WP_024546425.1|  Clp protease ClpS                                95.1    4e-21   
ref|WP_015146967.1|  hypothetical protein                             94.7    4e-21   
ref|WP_012165780.1|  ATP-dependent Clp protease ClpS                  94.7    5e-21   
ref|WP_011432326.1|  ATP-dependent Clp protease ClpS                  94.7    6e-21   
ref|WP_011377684.1|  ATP-dependent Clp protease ClpS                  94.4    6e-21   
ref|WP_015172880.1|  ATP-dependent Clp protease adaptor protein ClpS  94.4    6e-21   
ref|WP_026134960.1|  Clp protease ClpS                                94.4    6e-21   
ref|WP_015200544.1|  ATP-dependent Clp protease adaptor protein ClpS  94.4    8e-21   
ref|WP_015078741.1|  ATP-dependent Clp protease adaptor protein ClpS  94.4    1e-20   
ref|WP_012307878.1|  MULTISPECIES: ATP-dependent Clp protease ClpS    94.0    1e-20   
ref|WP_021833093.1|  ATP-dependent Clp protease adaptor protein ClpS  94.0    1e-20   
ref|WP_015129168.1|  ATP-dependent Clp protease adapter protein clpS  93.6    1e-20   
dbj|BAM54852.1|  ATP-dependent Clp protease adaptor protein ClpS      93.6    1e-20   
ref|WP_010873050.1|  ATP-dependent Clp protease ClpS                  93.6    2e-20   
ref|WP_006635106.1|  ATP-dependent Clp protease ClpS                  93.2    2e-20   
ref|WP_015178019.1|  ATP-dependent Clp protease adapter protein clpS  93.2    2e-20   
ref|WP_008313876.1|  hypothetical protein                             93.2    2e-20   
ref|WP_006276044.1|  ATP-dependent Clp protease ClpS                  93.2    2e-20   
ref|WP_007306880.1|  ATP-dependent Clp protease ClpS                  93.2    2e-20   
ref|WP_010469247.1|  ATP-dependent Clp protease ClpS                  92.8    2e-20   
ref|WP_015135484.1|  ATP-dependent Clp protease adapter protein clpS  92.8    3e-20   
ref|WP_006508057.1|  hypothetical protein                             92.8    3e-20   
ref|WP_015180760.1|  hypothetical protein                             92.4    3e-20   
ref|WP_006527651.1|  hypothetical protein                             92.4    3e-20   
ref|WP_009633780.1|  hypothetical protein                             92.0    4e-20   
gb|AIE75228.1|  ATP-dependent Clp protease adaptor protein ClpS       92.0    4e-20   
ref|XP_001691804.1|  clp protease adaptor protein                     93.6    5e-20   Chlamydomonas reinhardtii
ref|WP_015123005.1|  hypothetical protein                             92.0    5e-20   
ref|WP_009625305.1|  ATP-dependent Clp protease adapter protein clpS  92.0    5e-20   
ref|WP_015165079.1|  ATP-dependent Clp protease adaptor protein ClpS  92.0    5e-20   
ref|WP_017288055.1|  ATP-dependent Clp protease ClpS                  91.7    6e-20   
ref|WP_037224400.1|  Clp protease ClpS                                91.7    6e-20   
ref|WP_024123996.1|  ATP-dependent Clp protease adaptor protein ClpS  91.3    8e-20   
ref|WP_011056066.1|  ATP-dependent Clp protease ClpS                  91.7    8e-20   
ref|WP_006456131.1|  ATP-dependent Clp protease ClpS                  91.3    1e-19   
ref|WP_011431300.1|  ATP-dependent Clp protease ClpS                  90.9    1e-19   
ref|WP_015162741.1|  hypothetical protein                             90.5    2e-19   
ref|WP_012628786.1|  ATP-dependent Clp protease ClpS                  89.7    3e-19   
ref|WP_015117501.1|  hypothetical protein                             89.4    4e-19   
ref|WP_012410249.1|  ATP-dependent Clp protease ClpS                  89.0    6e-19   
gb|KFF41350.1|  hypothetical protein ucyna2_00772                     87.8    2e-18   
ref|WP_015219544.1|  ATP-dependent Clp protease adapter protein clpS  87.4    3e-18   
ref|XP_002949013.1|  hypothetical protein VOLCADRAFT_73976            88.6    4e-18   
ref|WP_011243151.1|  ATP-dependent Clp protease ClpS                  85.9    9e-18   
ref|WP_015109461.1|  hypothetical protein                             86.3    1e-17   
ref|WP_017292606.1|  hypothetical protein                             85.9    1e-17   
ref|WP_015170011.1|  hypothetical protein                             85.1    2e-17   
ref|WP_035830954.1|  Clp protease ClpS                                85.5    2e-17   
gb|KEF42363.1|  Clp protease ClpS                                     85.9    2e-17   
ref|WP_036021073.1|  MULTISPECIES: Clp protease ClpS                  85.1    2e-17   
gb|EKV02567.1|  hypothetical protein Lepto7375DRAFT_4804              85.1    2e-17   
ref|WP_015222385.1|  ATP-dependent Clp protease adaptor protein ClpS  85.1    2e-17   
ref|WP_017297669.1|  hypothetical protein                             84.3    3e-17   
ref|WP_035994184.1|  Clp protease ClpS                                84.0    4e-17   
ref|WP_006042274.1|  ATP-dependent Clp protease ClpS                  84.0    6e-17   
ref|WP_012954369.1|  ATP-dependent Clp protease ClpS                  83.2    8e-17   
ref|WP_011932293.1|  ATP-dependent Clp protease ClpS                  83.2    1e-16   
ref|WP_011618343.1|  ATP-dependent Clp protease ClpS                  82.8    2e-16   
ref|WP_006909265.1|  ATP-dependent Clp protease ClpS                  82.8    2e-16   
gb|AII46872.1|  ATP-dependent Clp protease ClpS                       82.8    2e-16   
ref|WP_036919246.1|  MULTISPECIES: Clp protease ClpS                  82.4    2e-16   
ref|WP_006172323.1|  ATP-dependent Clp protease ClpS                  82.4    2e-16   
ref|WP_010311913.1|  ATP-dependent Clp protease ClpS                  82.4    3e-16   
ref|WP_007099822.1|  ATP-dependent Clp protease ClpS                  82.0    3e-16   
ref|WP_011936594.1|  ATP-dependent Clp protease ClpS                  81.3    5e-16   
ref|WP_006854765.1|  ATP-dependent Clp protease ClpS                  80.9    6e-16   
ref|WP_026100735.1|  Clp protease ClpS                                80.1    1e-15   
ref|WP_038001626.1|  Clp protease ClpS                                80.1    1e-15   
ref|WP_011129004.1|  ATP-dependent Clp protease ClpS                  80.1    1e-15   
ref|WP_011363337.1|  ATP-dependent Clp protease ClpS                  80.1    1e-15   
ref|WP_010314591.1|  ATP-dependent Clp protease ClpS                  80.1    2e-15   
gb|EAQ68612.1|  hypothetical protein RS9917_03483                     80.1    2e-15   Synechococcus sp. RS9917
ref|WP_011360779.1|  ATP-dependent Clp protease ClpS                  79.7    2e-15   
emb|CAE08663.1|  conserved hypothetical protein                       80.5    2e-15   Synechococcus sp. WH 8102
ref|WP_009788857.1|  MULTISPECIES: ATP-dependent Clp protease ClpS    79.3    3e-15   
gb|AHF62724.1|  Clp protease adaptor                                  79.0    3e-15   
ref|WP_038543023.1|  Clp protease ClpS                                78.6    4e-15   
ref|WP_011125804.1|  ATP-dependent Clp protease ClpS                  78.6    4e-15   
ref|WP_036892518.1|  MULTISPECIES: Clp protease ClpS                  78.6    5e-15   
ref|WP_011295410.1|  ATP-dependent Clp protease ClpS                  79.0    5e-15   
ref|WP_038551312.1|  Clp protease ClpS                                78.2    7e-15   
gb|AIQ98095.1|  ATP-dependent Clp protease adaptor protein ClpS       77.8    1e-14   
ref|WP_037991069.1|  Clp protease ClpS                                77.4    1e-14   
ref|WP_038654246.1|  Clp protease ClpS                                77.8    2e-14   
ref|WP_011131159.1|  ATP-dependent Clp protease ClpS                  77.4    2e-14   
ref|WP_011824468.1|  ATP-dependent Clp protease ClpS                  77.0    3e-14   
ref|WP_023172400.1|  ATP-dependent Clp protease adaptor protein ClpS  75.9    3e-14   
ref|WP_036915950.1|  MULTISPECIES: Clp protease ClpS                  76.3    3e-14   
gb|KGG21055.1|  ATP-dependent Clp protease adaptor protein ClpS       75.9    5e-14   
ref|WP_011826967.1|  ATP-dependent Clp protease ClpS                  76.3    5e-14   
ref|XP_005703529.1|  ATP-dependent Clp protease adaptor protein ClpS  77.0    5e-14   
ref|WP_036905703.1|  Clp protease ClpS                                75.9    6e-14   
ref|WP_036900587.1|  Clp protease ClpS                                75.1    7e-14   
ref|WP_011563999.1|  ATP-dependent Clp protease adaptor protein ClpS  75.1    8e-14   
ref|WP_009785980.1|  Clp protease adaptor protein ClpS                73.2    2e-13   
ref|WP_012196173.1|  ATP-dependent Clp protease ClpS                  74.3    2e-13   
ref|WP_036923109.1|  Clp protease ClpS                                73.9    2e-13   
ref|WP_019477806.1|  ATP-dependent Clp protease ClpS                  73.9    2e-13   
ref|WP_011140748.1|  ATP-dependent Clp protease ClpS                  73.2    3e-13   
ref|WP_038684071.1|  Clp protease ClpS                                73.2    4e-13   
gb|AHY46250.1|  hypothetical protein RradSPS_0967                     73.2    6e-13   
emb|CAH25350.1|  hypothetical protein                                 74.3    1e-12   Guillardia theta
ref|WP_023067760.1|  ATP-dependent Clp protease adaptor ClpS fami...  70.9    1e-12   
ref|XP_005822991.1|  hypothetical protein GUITHDRAFT_160172           73.9    1e-12   
ref|WP_019475402.1|  MULTISPECIES: ATP-dependent Clp protease ClpS    71.6    1e-12   
ref|XP_005537024.1|  hypothetical protein, conserved                  72.8    2e-12   
ref|WP_036930728.1|  Clp protease ClpS                                70.9    2e-12   
ref|WP_011820979.1|  ATP-dependent Clp protease ClpS                  70.5    4e-12   
ref|WP_011133127.1|  ATP-dependent Clp protease ClpS                  70.5    4e-12   
ref|WP_032513807.1|  Clp protease ClpS                                70.1    4e-12   
ref|WP_012008396.1|  ATP-dependent Clp protease ClpS                  69.7    6e-12   
ref|WP_011377133.1|  ATP-dependent Clp protease ClpS                  69.7    7e-12   
ref|WP_013191191.1|  ATP-dependent Clp protease ClpS                  69.7    8e-12   
ref|WP_025889381.1|  MULTISPECIES: Clp protease ClpS                  69.3    8e-12   
ref|WP_002806129.1|  ATP-dependent Clp protease ClpS                  69.3    8e-12   
gb|AIQ95847.1|  ATP-dependent Clp protease adaptor protein ClpS       69.3    9e-12   
ref|WP_032522039.1|  Clp protease ClpS                                68.9    1e-11   
ref|WP_025943038.1|  Clp protease ClpS                                68.9    1e-11   
ref|WP_032517831.1|  Clp protease ClpS                                68.9    1e-11   
ref|WP_025930896.1|  Clp protease ClpS                                68.9    1e-11   
ref|WP_011819113.1|  ATP-dependent Clp protease ClpS                  68.6    1e-11   
ref|WP_025935450.1|  Clp protease ClpS                                68.6    2e-11   
ref|WP_025915109.1|  MULTISPECIES: Clp protease ClpS                  68.6    2e-11   
ref|WP_032525899.1|  Clp protease ClpS                                68.2    2e-11   
ref|WP_025891167.1|  MULTISPECIES: Clp protease ClpS                  68.2    2e-11   
ref|WP_025923566.1|  Clp protease ClpS                                68.2    2e-11   
ref|WP_025928861.1|  Clp protease ClpS                                68.2    2e-11   
ref|WP_025975999.1|  Clp protease ClpS                                68.2    2e-11   
ref|WP_032525033.1|  Clp protease ClpS                                68.2    2e-11   
ref|WP_032516031.1|  Clp protease ClpS                                68.2    2e-11   
ref|WP_025946431.1|  MULTISPECIES: Clp protease ClpS                  68.2    3e-11   
ref|WP_025943409.1|  Clp protease ClpS                                67.8    3e-11   
ref|WP_025934003.1|  MULTISPECIES: Clp protease ClpS                  67.8    3e-11   
ref|WP_025972557.1|  Clp protease ClpS                                67.8    3e-11   
ref|WP_025968304.1|  Clp protease ClpS                                67.4    4e-11   
ref|WP_025956180.1|  Clp protease ClpS                                67.4    4e-11   
ref|WP_008190421.1|  Clp protease adaptor protein ClpS                66.2    4e-11   
ref|WP_015078687.1|  ATP-dependent Clp protease adaptor protein       67.0    5e-11   
ref|WP_032520105.1|  Clp protease ClpS                                67.0    5e-11   
ref|WP_006102793.1|  Clp protease adaptor protein ClpS                65.9    7e-11   
ref|WP_006196047.1|  ATP-dependent Clp protease ClpS                  66.6    8e-11   
gb|EAQ73689.1|  ATP-dependent Clp protease adaptor protein ClpS       65.5    1e-10   
ref|WP_016878136.1|  ATP-dependent Clp protease ClpS                  66.2    1e-10   
ref|WP_019499519.1|  hypothetical protein                             66.2    1e-10   
ref|WP_006511586.1|  hypothetical protein                             65.9    1e-10   
ref|WP_012410421.1|  ATP-dependent Clp protease ClpS                  65.9    1e-10   
ref|WP_017313269.1|  ATP-dependent Clp protease ClpS                  65.9    1e-10   
ref|WP_016868636.1|  ATP-dependent Clp protease ClpS                  65.9    2e-10   
ref|WP_016862940.1|  ATP-dependent Clp protease ClpS                  65.5    2e-10   
sp|Q8YZQ3.2|CLPS_NOSS1  RecName: Full=ATP-dependent Clp protease ...  65.1    2e-10   
ref|WP_013320371.1|  ATP-dependent Clp protease ClpS                  65.1    3e-10   
ref|WP_017323245.1|  ATP-dependent Clp protease ClpS                  65.1    3e-10   
ref|WP_006196415.1|  Clp protease adaptor protein ClpS                63.9    3e-10   
ref|WP_026723192.1|  Clp protease ClpS                                65.1    3e-10   
ref|WP_012307683.1|  MULTISPECIES: ATP-dependent Clp protease ClpS    64.7    3e-10   
ref|WP_010994580.1|  ATP-dependent Clp protease ClpS                  64.7    4e-10   
ref|WP_038680933.1|  hypothetical protein                             64.7    4e-10   
ref|WP_024546630.1|  Clp protease ClpS                                64.7    4e-10   
ref|WP_026732875.1|  Clp protease ClpS                                64.7    4e-10   
ref|WP_015215585.1|  ATP-dependent Clp protease adapter protein clpS  64.7    4e-10   
ref|WP_017326440.1|  hypothetical protein                             64.7    4e-10   
ref|WP_037220319.1|  Clp protease ClpS                                64.7    4e-10   
emb|CDN13426.1|  ATP-dependent Clp protease adaptor protein ClpS ...  64.3    6e-10   
ref|XP_005792785.1|  hypothetical protein EMIHUDRAFT_69753            63.2    7e-10   
ref|WP_015137274.1|  hypothetical protein                             63.9    7e-10   
gb|EHJ12427.1|  ATP-dependent Clp protease adaptor protein ClpS       63.2    7e-10   
ref|WP_010872309.1|  ATP-dependent Clp protease ClpS                  63.2    1e-09   
ref|WP_011319596.1|  ATP-dependent Clp protease ClpS                  63.5    1e-09   
ref|WP_009456757.1|  MULTISPECIES: ATP-dependent Clp protease ClpS    63.5    1e-09   
ref|WP_028083664.1|  Clp protease ClpS                                63.2    1e-09   
ref|WP_038531678.1|  Clp protease ClpS                                62.8    1e-09   
ref|WP_027401013.1|  Clp protease ClpS                                63.2    1e-09   
ref|WP_006278794.1|  ATP-dependent Clp protease ClpS                  63.2    1e-09   
gb|AIE75361.1|  ATP-dependent Clp protease adaptor protein ClpS C...  62.8    2e-09   
ref|WP_015171821.1|  ATP-dependent Clp protease adaptor protein ClpS  62.8    2e-09   
ref|WP_015166339.1|  ATP-dependent Clp protease adapter protein clpS  62.8    2e-09   
ref|WP_017659484.1|  ATP-dependent Clp protease ClpS                  62.8    2e-09   
ref|WP_015120540.1|  hypothetical protein                             62.8    2e-09   
ref|WP_009341890.1|  ATP-dependent Clp protease ClpS                  62.4    2e-09   
emb|CDN16952.1|  ATP-dependent Clp protease adaptor protein ClpS      61.2    3e-09   
ref|WP_006633998.1|  ATP-dependent Clp protease ClpS                  62.0    3e-09   
ref|WP_015178834.1|  ATP-dependent Clp protease adapter protein clpS  62.0    3e-09   
ref|WP_015956442.1|  ATP-dependent Clp protease ClpS                  62.0    3e-09   
ref|WP_026104235.1|  Clp protease ClpS                                62.0    3e-09   
ref|WP_026100091.1|  Clp protease ClpS                                61.6    5e-09   
gb|EAZ92708.1|  ATP-dependent Clp protease adaptor protein ClpS       61.2    5e-09   
ref|WP_015206456.1|  hypothetical protein                             61.6    6e-09   
ref|WP_026098426.1|  Clp protease ClpS                                61.2    6e-09   
emb|CBN74180.1|  ATP-dependent Clp protease adaptor protein ClpS      62.4    6e-09   
ref|WP_006527807.1|  hypothetical protein                             61.2    6e-09   
ref|WP_009545273.1|  MULTISPECIES: ATP-dependent Clp protease ClpS    61.2    6e-09   
ref|XP_005536834.1|  hypothetical protein, conserved                  63.2    7e-09   
ref|WP_035798539.1|  Clp protease ClpS                                61.2    7e-09   
ref|WP_017305514.1|  ATP-dependent Clp protease ClpS                  60.8    7e-09   
ref|WP_015202061.1|  ATP-dependent Clp protease adapter protein clpS  61.2    8e-09   
ref|WP_021830171.1|  ATP-dependent Clp protease adaptor protein C...  60.8    8e-09   
ref|WP_026093452.1|  Clp protease ClpS                                61.2    8e-09   
ref|WP_007312289.1|  ATP-dependent Clp protease ClpS                  60.5    1e-08   
ref|WP_007307220.1|  ATP-dependent Clp protease ClpS                  60.8    1e-08   
ref|WP_027845747.1|  Clp protease ClpS                                60.8    1e-08   
ref|WP_015123071.1|  hypothetical protein                             60.5    1e-08   
ref|WP_035994087.1|  Clp protease ClpS                                60.5    1e-08   
ref|WP_035828356.1|  Clp protease ClpS                                60.5    2e-08   
ref|WP_015129650.1|  ATP-dependent Clp protease adapter protein clpS  60.1    2e-08   
ref|WP_026788621.1|  MULTISPECIES: Clp protease ClpS                  59.7    2e-08   
ref|WP_036004016.1|  Clp protease ClpS                                59.7    2e-08   
ref|WP_002734873.1|  ATP-dependent Clp protease ClpS                  59.7    2e-08   
ref|WP_022605009.1|  hypothetical protein                             59.7    3e-08   
ref|WP_026102765.1|  Clp protease ClpS                                59.3    3e-08   
ref|WP_007911535.1|  ATP-dependent Clp protease adaptor protein ClpS  59.3    3e-08   
ref|WP_023066376.1|  ATP-dependent Clp protease adaptor ClpS fami...  59.3    3e-08   
ref|WP_017297211.1|  ATP-dependent Clp protease ClpS                  59.3    3e-08   
ref|WP_009628256.1|  ATP-dependent Clp protease adapter protein clpS  59.3    3e-08   
ref|WP_008196870.1|  ATP-dependent Clp protease ClpS                  58.9    4e-08   
ref|WP_036833864.1|  Clp protease ClpS                                59.3    4e-08   
ref|WP_006620719.1|  MULTISPECIES: ATP-dependent Clp protease ClpS    58.9    4e-08   
ref|WP_014274892.1|  ATP-dependent Clp protease adaptor protein ClpS  58.9    4e-08   
ref|WP_036481712.1|  Clp protease ClpS                                58.9    5e-08   
ref|WP_002758084.1|  ATP-dependent Clp protease ClpS                  58.9    5e-08   
ref|WP_004163137.1|  ATP-dependent Clp protease ClpS                  58.5    5e-08   
ref|WP_002765336.1|  ATP-dependent Clp protease ClpS                  58.5    5e-08   
ref|WP_029633369.1|  Clp protease ClpS [                              58.9    5e-08   
ref|WP_004269012.1|  ATP-dependent Clp protease ClpS                  58.5    5e-08   
ref|WP_017746339.1|  ATP-dependent Clp protease ClpS                  58.9    5e-08   
ref|WP_039739456.1|  Clp protease ClpS                                58.9    6e-08   
gb|KEI68194.1|  ClpS                                                  58.9    6e-08   
ref|WP_015152420.1|  ATP-dependent Clp protease adaptor protein ClpS  58.5    7e-08   
ref|WP_027268951.1|  Clp protease ClpS                                58.5    8e-08   
ref|WP_039714984.1|  Clp protease ClpS                                58.5    8e-08   
ref|WP_011430234.1|  ATP-dependent Clp protease ClpS                  58.2    8e-08   
ref|WP_007353823.1|  ATP-dependent Clp protease ClpS [                58.2    8e-08   
ref|WP_012595049.1|  MULTISPECIES: ATP-dependent Clp protease ClpS    58.2    9e-08   
ref|WP_026222121.1|  Clp protease ClpS                                58.2    9e-08   
ref|WP_011056930.1|  MULTISPECIES: ATP-dependent Clp protease ClpS    57.8    1e-07   
ref|WP_017314299.1|  ATP-dependent Clp protease ClpS                  58.2    1e-07   
ref|WP_015111185.1|  ATP-dependent Clp protease adapter protein clpS  58.2    1e-07   
ref|WP_002749280.1|  ATP-dependent Clp protease adaptor ClpS fami...  57.8    1e-07   
dbj|BAP18376.1|  putative ATP-dependent Clp protease adaptor protein  58.2    1e-07   
ref|XP_010688785.1|  PREDICTED: uncharacterized protein LOC104902634  59.7    1e-07   
ref|WP_026103601.1|  Clp protease ClpS                                58.2    1e-07   
ref|WP_015227856.1|  hypothetical protein                             57.8    1e-07   
ref|XP_010647880.1|  PREDICTED: uncharacterized protein LOC100242...  58.9    1e-07   
ref|WP_015142641.1|  hypothetical protein                             57.8    1e-07   
ref|WP_015194284.1|  ATP-dependent Clp protease adapter protein clpS  57.4    2e-07   
ref|WP_027287926.1|  Clp protease ClpS                                57.4    2e-07   
ref|WP_009632225.1|  hypothetical protein                             57.4    2e-07   
ref|WP_015224730.1|  ATP-dependent Clp protease adaptor protein ClpS  57.4    2e-07   
ref|XP_009037232.1|  hypothetical protein AURANDRAFT_17179            56.2    3e-07   
ref|WP_008186026.1|  ATP-dependent Clp protease ClpS                  56.6    4e-07   
emb|CBN76865.1|  conserved unknown protein                            58.5    4e-07   
ref|WP_009786077.1|  ATP-dependent Clp protease ClpS                  56.2    4e-07   
ref|XP_005832032.1|  hypothetical protein GUITHDRAFT_94819            57.4    6e-07   
ref|WP_011434126.1|  ATP-dependent Clp protease ClpS                  55.8    7e-07   
gb|EWM26126.1|  atp-dependent clp protease adaptor protein            57.8    7e-07   
ref|WP_012875322.1|  ATP-dependent Clp protease adaptor protein ClpS  55.5    8e-07   
ref|WP_009769024.1|  hypothetical protein                             55.5    8e-07   
ref|WP_038085164.1|  Clp protease ClpS                                55.1    1e-06   
ref|WP_017291420.1|  ATP-dependent Clp protease ClpS                  54.7    1e-06   
ref|WP_006101197.1|  ATP-dependent Clp protease ClpS                  54.7    2e-06   
ref|WP_015170035.1|  hypothetical protein                             54.3    2e-06   
ref|WP_015199741.1|  ATP-dependent Clp protease adapter protein clpS  54.3    2e-06   
ref|WP_010969875.1|  ATP-dependent Clp protease ClpS                  54.3    2e-06   
ref|WP_023073045.1|  atp-dependent clp protease adapter protein       54.3    3e-06   
ref|WP_036531422.1|  Clp protease ClpS                                53.9    3e-06   
ref|WP_015223519.1|  ATP-dependent Clp protease adaptor protein ClpS  53.9    3e-06   
ref|WP_003534512.1|  ATP-dependent Clp protease ClpS                  53.1    5e-06   
ref|WP_026099692.1|  Clp protease ClpS                                53.1    5e-06   
ref|WP_017295774.1|  hypothetical protein                             53.1    6e-06   
ref|WP_039755421.1|  Clp protease ClpS                                53.1    6e-06   
ref|WP_015180351.1|  hypothetical protein                             53.1    6e-06   
ref|WP_039730095.1|  Clp protease ClpS                                53.1    6e-06   
ref|XP_005840506.1|  hypothetical protein GUITHDRAFT_150401           54.3    7e-06   
ref|WP_012629228.1|  ATP-dependent Clp protease ClpS                  53.1    7e-06   
ref|XP_002262095.1|  ATP-dependent Clp protease adaptor protein       55.1    7e-06   
ref|XP_005828696.1|  hypothetical protein GUITHDRAFT_112132           53.5    7e-06   
ref|WP_006725606.1|  ATP-dependent Clp protease ClpS                  52.8    8e-06   
ref|WP_011555974.1|  ATP-dependent Clp protease ClpS                  53.1    8e-06   
ref|WP_013938287.1|  ATP-dependent Clp protease ClpS                  52.8    8e-06   
gb|KDO53039.1|  hypothetical protein CISIN_1g034596mg                 52.8    8e-06   
ref|WP_015188823.1|  ATP-dependent Clp protease adapter protein clpS  52.8    9e-06   
ref|WP_006516073.1|  hypothetical protein                             52.8    9e-06   
ref|XP_005787017.1|  hypothetical protein EMIHUDRAFT_455577           54.3    1e-05   
ref|XP_006437493.1|  hypothetical protein CICLE_v10032846mg           53.9    1e-05   
ref|XP_006484641.1|  PREDICTED: uncharacterized protein LOC102615525  53.9    1e-05   
ref|WP_011377592.1|  ATP-dependent Clp protease ClpS                  53.1    1e-05   
ref|WP_015218024.1|  ATP-dependent Clp protease adapter protein clpS  52.4    1e-05   
ref|WP_011243355.1|  ATP-dependent Clp protease ClpS                  53.1    1e-05   
ref|WP_010150563.1|  ATP-dependent Clp protease adapter protein clpS  52.4    1e-05   
ref|WP_014529150.1|  putative ATP-dependent Clp protease adapter ...  53.1    1e-05   
ref|WP_015148446.1|  hypothetical protein                             52.4    1e-05   
ref|XP_008778527.1|  PREDICTED: uncharacterized protein LOC103698310  51.6    1e-05   
ref|XP_005787044.1|  hypothetical protein EMIHUDRAFT_455525           53.5    2e-05   
ref|WP_015134693.1|  ATP-dependent Clp protease adapter protein clpS  51.6    2e-05   
ref|WP_002615441.1|  ATP-dependent Clp protease ClpS                  52.0    2e-05   
ref|XP_008340480.1|  PREDICTED: uncharacterized protein LOC103403...  53.1    2e-05   
ref|WP_029956376.1|  Clp protease ClpS                                51.6    2e-05   
ref|WP_028001145.1|  Clp protease ClpS                                51.6    2e-05   
ref|WP_035148937.1|  Clp protease ClpS                                51.6    2e-05   
ref|WP_014399347.1|  ATP-dependent Clp protease ClpS                  51.6    2e-05   
ref|WP_018095653.1|  ATP-dependent Clp protease ClpS                  51.6    2e-05   
ref|WP_015160273.1|  hypothetical protein                             51.6    2e-05   
ref|WP_002635856.1|  ATP-dependent Clp protease ClpS                  51.6    2e-05   
ref|XP_008814416.1|  hypothetical protein C922_00578                  53.1    2e-05   
ref|WP_006966212.1|  MULTISPECIES: ATP-dependent Clp protease ada...  51.6    3e-05   
ref|XP_009351679.1|  PREDICTED: uncharacterized protein LOC103943182  52.8    3e-05   
ref|WP_002622993.1|  ATP-dependent Clp protease adaptor protein ClpS  51.2    3e-05   
ref|WP_011935825.1|  ATP-dependent Clp protease ClpS                  50.8    4e-05   
ref|WP_021829795.1|  ATP-dependent Clp protease adaptor protein ClpS  50.1    4e-05   
ref|WP_017263271.1|  ATP-dependent Clp protease ClpS                  50.8    4e-05   
ref|WP_010044847.1|  ATP-dependent Clp protease adaptor protein ClpS  51.2    4e-05   
ref|XP_724088.1|  hypothetical protein                                51.2    4e-05   
gb|KFA89241.1|  Clp protease ClpS                                     50.8    4e-05   
ref|WP_026617948.1|  Clp protease ClpS                                50.8    4e-05   
ref|WP_008232918.1|  ATP-dependent Clp protease adaptor protein ClpS  50.1    5e-05   
ref|XP_001617126.1|  ATP-dependent Clp protease adaptor protein C...  52.4    5e-05   
ref|XP_007034078.1|  Ribosomal protein L12/ ATP-dependent Clp pro...  51.6    6e-05   
ref|WP_015352179.1|  ATP-dependent Clp protease adaptor protein ClpS  50.4    7e-05   
ref|WP_037058643.1|  Clp protease ClpS                                50.1    7e-05   
ref|WP_023172005.1|  ATP-dependent Clp protease adaptor protein ClpS  50.4    7e-05   
ref|WP_026618885.1|  Clp protease ClpS                                50.1    9e-05   
ref|XP_002315814.2|  hypothetical protein POPTR_0010s10670g           51.2    1e-04   
ref|WP_025781831.1|  Clp protease ClpS                                49.7    1e-04   
gb|EUD74258.1|  hypothetical protein YYG_00205                        51.2    1e-04   
gb|ETW34882.1|  hypothetical protein PFTANZ_04415                     49.7    1e-04   
ref|WP_027508365.1|  Clp protease ClpS                                49.3    1e-04   
emb|CCF20057.1|  ATP-dependent Clp protease adapter protein clpS 2    49.3    1e-04   
ref|XP_009392224.1|  PREDICTED: uncharacterized protein LOC103978232  50.4    1e-04   
gb|EWC87102.1|  hypothetical protein PFNF54_04281                     50.1    2e-04   
ref|XP_008623046.1|  hypothetical protein YYE_01146                   50.8    2e-04   
gb|EUT81235.1|  hypothetical protein PFAG_04452                       49.7    2e-04   
gb|AJD41983.1|  ATP-dependent Clp protease adaptor protein ClpS 2     49.3    2e-04   
ref|XP_002311579.1|  hypothetical protein POPTR_0008s14480g           50.4    2e-04   
ref|WP_022714213.1|  ATP-dependent Clp protease ClpS                  49.3    2e-04   
gb|ABK96265.1|  unknown                                               50.4    2e-04   
ref|XP_005534983.1|  hypothetical protein, conserved                  50.8    2e-04   



>ref|XP_009626880.1| PREDICTED: uncharacterized protein LOC104117521 [Nicotiana tomentosiformis]
Length=159

 Score =   244 bits (623),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWN-VMAMPIagagkggglldKPVIEKA  498
            M TAIC RV+LS + IF PKPGD    QKQW + N +MAMPIAG GKGGGLL+KPVIEK 
Sbjct  3    METAICGRVALSPHQIFQPKPGDTKPRQKQWTNRNTLMAMPIAGVGKGGGLLEKPVIEKT  62

Query  497  TPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHH  318
            TPGR+SEFDLRKSRK SPPYRV+LHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQEAH+
Sbjct  63   TPGRESEFDLRKSRKISPPYRVMLHNDNFNKREYVVQVLMKVIPGMTVDNAVNIMQEAHY  122

Query  317  NGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            NGL+VVIICAQVDAEEHCTQLRGNGLLSSIEPASGG
Sbjct  123  NGLAVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  158



>ref|XP_006341627.1| PREDICTED: uncharacterized protein LOC102601216 [Solanum tuberosum]
Length=159

 Score =   243 bits (621),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWN-VMAMPIagagkggglldKPVIEKA  498
            M TAIC RV+LS + IF PKPGDK   QKQW + N +MAM IAG+GKGGGLL+KPVIEK 
Sbjct  3    METAICGRVALSPHQIFQPKPGDKKPRQKQWTNRNALMAMSIAGSGKGGGLLEKPVIEKT  62

Query  497  TPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHH  318
            TPGR+SEFDLRKSRK SPPYRV+LHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQEAHH
Sbjct  63   TPGRESEFDLRKSRKMSPPYRVMLHNDNFNKREYVVQVLMKVIPGMTVDNAVNIMQEAHH  122

Query  317  NGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            NGL+VVIICAQ DAEEHCTQLRGNGLLSSIEPASGG
Sbjct  123  NGLAVVIICAQADAEEHCTQLRGNGLLSSIEPASGG  158



>ref|XP_004235826.1| PREDICTED: uncharacterized protein LOC101260326 [Solanum lycopersicum]
Length=159

 Score =   243 bits (620),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 140/156 (90%), Gaps = 1/156 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWN-VMAMPIagagkggglldKPVIEKA  498
            M TAIC RV+LS + IF PKPGDK   QKQW + N +MAM IAGAGKGGGLL+KPVIEK 
Sbjct  3    METAICGRVALSPHQIFQPKPGDKKPRQKQWTNRNALMAMSIAGAGKGGGLLEKPVIEKT  62

Query  497  TPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHH  318
            TPGR+SEFDLRKSRK SPPYRV+LHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQEAHH
Sbjct  63   TPGRESEFDLRKSRKMSPPYRVMLHNDNFNKREYVVQVLMKVIPGMTVDNAVNIMQEAHH  122

Query  317  NGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            NGL+VVIICAQ DAEEHCTQLRGNGLLSSIEPASGG
Sbjct  123  NGLAVVIICAQADAEEHCTQLRGNGLLSSIEPASGG  158



>ref|XP_009762360.1| PREDICTED: uncharacterized protein LOC104214399 [Nicotiana sylvestris]
Length=159

 Score =   241 bits (616),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWN-VMAMPIagagkggglldKPVIEKA  498
            M TAIC RV+LS + IF PKPGD    QKQW + N +MAMPIAG GKGGGLL+KPVIEK 
Sbjct  3    METAICGRVALSPHQIFQPKPGDTKPRQKQWTNRNTLMAMPIAGVGKGGGLLEKPVIEKT  62

Query  497  TPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHH  318
            TPGR+SEFDLRKSRK SPPYRV+LHNDN+NKREYVVQVLMKVIPGMT+D AVNIMQEAH+
Sbjct  63   TPGRESEFDLRKSRKMSPPYRVMLHNDNYNKREYVVQVLMKVIPGMTVDNAVNIMQEAHY  122

Query  317  NGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            NGL+VVIICAQ DAEEHCTQLRGNGLLSSIEPASGG
Sbjct  123  NGLAVVIICAQADAEEHCTQLRGNGLLSSIEPASGG  158



>emb|CDO98460.1| unnamed protein product [Coffea canephora]
Length=157

 Score =   241 bits (614),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 136/156 (87%), Gaps = 1/156 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASW-NVMAMPIagagkggglldKPVIEKA  498
            M T IC RV+LS N +  PKPGDK  +QKQW S  N M MPIAGAGKG G+LDKPVIE+ 
Sbjct  1    METTICSRVALSPNPLLQPKPGDKYSLQKQWRSRSNFMTMPIAGAGKGAGVLDKPVIERT  60

Query  497  TPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHH  318
             PGR+SEFDLRKSRKTSPPYRVLLHNDN+NKREYVVQVLMKVIPGMTLD AVNIMQEAH+
Sbjct  61   APGRESEFDLRKSRKTSPPYRVLLHNDNYNKREYVVQVLMKVIPGMTLDNAVNIMQEAHY  120

Query  317  NGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            NGLSVVIIC QVDAE+HC QLRGNGLLSSIEPASGG
Sbjct  121  NGLSVVIICGQVDAEDHCMQLRGNGLLSSIEPASGG  156



>ref|XP_010265218.1| PREDICTED: uncharacterized protein LOC104603017 [Nelumbo nucifera]
Length=158

 Score =   232 bits (592),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 134/156 (86%), Gaps = 2/156 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWA--SWNVMAMPIagagkggglldKPVIEK  501
            M TAIC RV+LS NH+F+PKPGDK  + K        +M+M +   GKGGGLL++P IEK
Sbjct  1    METAICGRVTLSPNHVFNPKPGDKQLLYKGSCINRGILMSMSVTSQGKGGGLLERPTIEK  60

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
            ATPGR+SEFDLRKSRKT+PPYRVLLHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  61   ATPGRESEFDLRKSRKTAPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  120

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASG  213
            +NGL+VVIICAQ DAEEHC QLRGNGLLSSIEPASG
Sbjct  121  YNGLAVVIICAQADAEEHCMQLRGNGLLSSIEPASG  156



>ref|XP_002311446.1| hypothetical protein POPTR_0008s11660g [Populus trichocarpa]
 gb|ABK92624.1| unknown [Populus trichocarpa]
 gb|EEE88813.1| hypothetical protein POPTR_0008s11660g [Populus trichocarpa]
Length=158

 Score =   225 bits (574),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 136/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWN--VMAMPIagagkggglldKPVIEK  501
            M TAIC R++LS NH+F+PKPGDK+ + +   +    +MA+    +GKGGGLL+KPVIE+
Sbjct  1    METAICGRIALSPNHVFNPKPGDKNSVCRGPCANRGILMAISTTCSGKGGGLLEKPVIER  60

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFDLRKS+K +PPYRV+LHNDN+NKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  61   TTPGRESEFDLRKSKKMAPPYRVMLHNDNYNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  120

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            +NGLSVVIICAQ DAEEHC QLRGNGLLSSIEPASGG
Sbjct  121  YNGLSVVIICAQADAEEHCMQLRGNGLLSSIEPASGG  157



>ref|XP_011097007.1| PREDICTED: uncharacterized protein LOC105176031 isoform X1 [Sesamum 
indicum]
Length=157

 Score =   224 bits (572),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 132/157 (84%), Gaps = 3/157 (2%)
 Frame = -1

Query  674  MATAICC-RVSLSANHIFHPKPGDKSHIQKQWASWN-VMAMPIagagkggglldKPVIEK  501
            M T I C RV+LS N I HP  GD+  + KQWA+ + +M MPIAG GKGG L   P+IEK
Sbjct  1    METVISCGRVALSPNQICHPTSGDRYPLHKQWANRSTLMIMPIAGQGKGGVLDK-PIIEK  59

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFDLRKSRK SPPYRVLLHNDN+NKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  60   TTPGRESEFDLRKSRKMSPPYRVLLHNDNYNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  119

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            +NGLSVVIICAQ DAEEHC QLRGNGLLSSIEPASGG
Sbjct  120  YNGLSVVIICAQADAEEHCMQLRGNGLLSSIEPASGG  156



>ref|XP_011021774.1| PREDICTED: uncharacterized protein LOC105123758 [Populus euphratica]
Length=158

 Score =   224 bits (570),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 135/157 (86%), Gaps = 2/157 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWN--VMAMPIagagkggglldKPVIEK  501
            M TAIC R++LS NH+F+PKPGDK+ + +        +MA+    +GKGGGLL+KPVIE+
Sbjct  1    METAICGRIALSPNHVFNPKPGDKNSVCRGPCVNRGILMAISTTCSGKGGGLLEKPVIER  60

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFDLRKS+K +PPYRV+LHNDN+NKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  61   TTPGRESEFDLRKSKKMAPPYRVMLHNDNYNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  120

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            +NGLSVVIICAQ DAEEHC QLRGNGLLSSIEPASGG
Sbjct  121  YNGLSVVIICAQADAEEHCMQLRGNGLLSSIEPASGG  157



>ref|XP_002274839.1| PREDICTED: uncharacterized protein LOC100247572 [Vitis vinifera]
 emb|CBI15425.3| unnamed protein product [Vitis vinifera]
Length=157

 Score =   224 bits (570),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 128/156 (82%), Gaps = 1/156 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWN-VMAMPIagagkggglldKPVIEKA  498
            M TAIC RV LS NH F  K GDK  + KQW     +M +  A  GKG G+L++P IE+ 
Sbjct  1    METAICGRVPLSPNHFFTSKSGDKHSLSKQWTHRTMLMTVSAAAPGKGSGVLERPTIERI  60

Query  497  TPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHH  318
             PGR+SEFDLRKSRK SPPYRVLLHNDN+NKREYVVQVLMKVIPGMTLD AVNIMQEAHH
Sbjct  61   MPGRESEFDLRKSRKMSPPYRVLLHNDNYNKREYVVQVLMKVIPGMTLDNAVNIMQEAHH  120

Query  317  NGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            NG+SVVIICAQVDAE+HC QLRGNGLLSSIEPASGG
Sbjct  121  NGMSVVIICAQVDAEDHCMQLRGNGLLSSIEPASGG  156



>ref|XP_002315955.2| hypothetical protein POPTR_0010s13860g [Populus trichocarpa]
 gb|EEF02126.2| hypothetical protein POPTR_0010s13860g [Populus trichocarpa]
Length=160

 Score =   222 bits (566),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 129/159 (81%), Gaps = 4/159 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagagkgggll----dKPVI  507
            M TAIC R++LS NH+F+PKPGDK+ + +   +   + M I+    G G      +KPVI
Sbjct  1    METAICGRIALSPNHVFNPKPGDKNSVCRGPCASRGILMSISATVSGKGGGGGILEKPVI  60

Query  506  EKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQE  327
            E+ TPGR+SEFDLRKS+K +PPYRV+LHNDN+NKREYVVQVLMKVIPGMTLD AVNIMQE
Sbjct  61   ERTTPGRESEFDLRKSKKMAPPYRVILHNDNYNKREYVVQVLMKVIPGMTLDNAVNIMQE  120

Query  326  AHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            AH+NGLSVVIIC Q DAEEHC QLRGNGLLSSIEPASGG
Sbjct  121  AHYNGLSVVIICTQADAEEHCMQLRGNGLLSSIEPASGG  159



>ref|XP_007225975.1| hypothetical protein PRUPE_ppa012655mg [Prunus persica]
 ref|XP_008243188.1| PREDICTED: uncharacterized protein LOC103341446 isoform X2 [Prunus 
mume]
 gb|EMJ27174.1| hypothetical protein PRUPE_ppa012655mg [Prunus persica]
Length=159

 Score =   221 bits (563),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 134/160 (84%), Gaps = 4/160 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNV---MAMPIagagkggglldKPVIE  504
            M TAIC R+ LS NH+F+PKPGD+ H   +    N+   MA+   G GKGGGLL++PVIE
Sbjct  1    METAICGRLPLSPNHVFNPKPGDR-HPLCKGPCTNLGIPMAVSATGPGKGGGLLERPVIE  59

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            K TP R SEFDLRKSRKT+PPYRV+LHNDN+NKREYVVQVLMKVIPGM+LD AVNIMQEA
Sbjct  60   KTTPARDSEFDLRKSRKTAPPYRVILHNDNYNKREYVVQVLMKVIPGMSLDNAVNIMQEA  119

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            HHNGLS+VIICAQ DAEEHC QLR NGLLSSIEPASGGGC
Sbjct  120  HHNGLSIVIICAQADAEEHCMQLRHNGLLSSIEPASGGGC  159



>ref|XP_010551290.1| PREDICTED: uncharacterized protein LOC104821956 [Tarenaya hassleriana]
Length=159

 Score =   221 bits (562),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 135/159 (85%), Gaps = 2/159 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWN--VMAMPIagagkggglldKPVIEK  501
            M +AIC R++LS + +F+ KPG+K  + K     +  VM++  +  GKGGGLLDKPVIEK
Sbjct  1    MESAICGRLALSPSTVFNSKPGEKHSLYKGPCGNHGFVMSLCASAVGKGGGLLDKPVIEK  60

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFDLRKSRK +PPYRV+LHNDNFN+REYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  61   TTPGRESEFDLRKSRKMAPPYRVILHNDNFNRREYVVQVLMKVIPGMTLDNAVNIMQEAH  120

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            HNGL+VVIICAQ DAEEHC QLRGNGLLSSIEPASGGGC
Sbjct  121  HNGLAVVIICAQADAEEHCMQLRGNGLLSSIEPASGGGC  159



>ref|XP_011008424.1| PREDICTED: uncharacterized protein LOC105113795 [Populus euphratica]
Length=161

 Score =   221 bits (562),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/160 (69%), Positives = 129/160 (81%), Gaps = 5/160 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagagkgggll-----dKPV  510
            M TAIC R++LS NH+F+PKPGDK+ + +   +   + M I+    G G       +KPV
Sbjct  1    METAICGRIALSPNHVFNPKPGDKNSVCRGPCASRGILMSISATVSGKGGGGGGILEKPV  60

Query  509  IEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQ  330
            IE+ TPGR+SEFDLRKS+K +PPYRV+LHNDN+NKREYVVQVLMKVIPGMTLD AVNIMQ
Sbjct  61   IERTTPGRESEFDLRKSKKMAPPYRVILHNDNYNKREYVVQVLMKVIPGMTLDNAVNIMQ  120

Query  329  EAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            EAH+NG+SVVIIC Q DAEEHC QLRGNGLLSSIEPASGG
Sbjct  121  EAHYNGMSVVIICTQADAEEHCMQLRGNGLLSSIEPASGG  160



>ref|XP_008243187.1| PREDICTED: uncharacterized protein LOC103341446 isoform X1 [Prunus 
mume]
Length=160

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 131/160 (82%), Gaps = 3/160 (2%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNV---MAMPIagagkggglldKPVIE  504
            M TAIC R+ LS NH+F+PKP    H   +    N+   MA+   G GKGGGLL++PVIE
Sbjct  1    METAICGRLPLSPNHVFNPKPAGDRHPLCKGPCTNLGIPMAVSATGPGKGGGLLERPVIE  60

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            K TP R SEFDLRKSRKT+PPYRV+LHNDN+NKREYVVQVLMKVIPGM+LD AVNIMQEA
Sbjct  61   KTTPARDSEFDLRKSRKTAPPYRVILHNDNYNKREYVVQVLMKVIPGMSLDNAVNIMQEA  120

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            HHNGLS+VIICAQ DAEEHC QLR NGLLSSIEPASGGGC
Sbjct  121  HHNGLSIVIICAQADAEEHCMQLRHNGLLSSIEPASGGGC  160



>ref|XP_008446565.1| PREDICTED: uncharacterized protein LOC103489260 isoform X1 [Cucumis 
melo]
Length=159

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 133/160 (83%), Gaps = 4/160 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagagkgg---glldKPVIE  504
            M  AIC ++++S NH+F+PKPGD+S + K    +N  A  +  A   G   GLL++PVIE
Sbjct  1    MEIAICGKLAVSPNHVFNPKPGDRSSMCKGLC-FNFGASVVKSAATAGRGGGLLERPVIE  59

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            KATPGR+SEFD+R+SRK +PPYRV+LHND+FNKREYVVQVLMKVIPGMTLD AVNIMQEA
Sbjct  60   KATPGRESEFDMRRSRKMTPPYRVILHNDDFNKREYVVQVLMKVIPGMTLDNAVNIMQEA  119

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            H+NGLS+VIICAQ DAEEHC QLRGNGLLSSIEPASGG C
Sbjct  120  HYNGLSLVIICAQADAEEHCMQLRGNGLLSSIEPASGGCC  159



>ref|XP_009417647.1| PREDICTED: uncharacterized protein LOC103998009 [Musa acuminata 
subsp. malaccensis]
Length=158

 Score =   219 bits (558),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 136/157 (87%), Gaps = 2/157 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDK-SHIQKQWASWNV-MAMPIagagkggglldKPVIEK  501
            M TAIC R++LS NH+ +PKPGDK S  +   A+  + MA+ ++G GKGGGLL++P IEK
Sbjct  1    METAICSRIALSPNHVVNPKPGDKLSQHRGPCANRGILMAVSVSGPGKGGGLLERPTIEK  60

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFDL+KSRK +PPYRV+LHNDN+NKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  61   TTPGRESEFDLKKSRKMAPPYRVILHNDNYNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  120

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            HNGL+VVIIC+QVDAEEHC QLRGNGL SSIEPASGG
Sbjct  121  HNGLAVVIICSQVDAEEHCMQLRGNGLHSSIEPASGG  157



>ref|XP_009336603.1| PREDICTED: uncharacterized protein LOC103929179 [Pyrus x bretschneideri]
Length=158

 Score =   218 bits (555),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 134/160 (84%), Gaps = 5/160 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNV---MAMPIagagkggglldKPVIE  504
            M TAIC R+ LS NH+F+PKPGD+ H   + A  N+   +A+  A  GKGGGLL++PV E
Sbjct  1    METAICGRIPLSPNHVFNPKPGDR-HPLCKGACTNLSIPVAVSTAVPGKGGGLLERPVRE  59

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            KATP R SEFDLRKSRKT+PPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEA
Sbjct  60   KATPARDSEFDLRKSRKTAPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEA  119

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            HHNGLSVVIICAQ DAEEHC QLR NGLLSSIEPA GGGC
Sbjct  120  HHNGLSVVIICAQADAEEHCMQLRHNGLLSSIEPA-GGGC  158



>ref|XP_010263121.1| PREDICTED: uncharacterized protein LOC104601472 [Nelumbo nucifera]
Length=159

 Score =   218 bits (555),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 132/158 (84%), Gaps = 3/158 (2%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFH-PKPGDKSHIQKQWASWN--VMAMPIagagkggglldKPVIE  504
            M TAI  R++LS NH+F   KPGDK  + K   +    VM+M     GKGGGLL++P IE
Sbjct  1    METAISGRIALSPNHVFSSTKPGDKHSLYKGPCTNRGIVMSMSAMCQGKGGGLLERPTIE  60

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            KATPGR+SEFDLRKSRKT+PPYRV+LHNDN+NKREYVVQVLMKVIP MTLD AVNIMQEA
Sbjct  61   KATPGRESEFDLRKSRKTAPPYRVILHNDNYNKREYVVQVLMKVIPAMTLDNAVNIMQEA  120

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            H+NGL+VVIICAQVDAEEHC QLRGNGLLSSIEPASGG
Sbjct  121  HYNGLAVVIICAQVDAEEHCMQLRGNGLLSSIEPASGG  158



>ref|XP_004157424.1| PREDICTED: ATP-dependent Clp protease adapter protein ClpS-like 
[Cucumis sativus]
 ref|XP_008456997.1| PREDICTED: uncharacterized protein LOC103496767 [Cucumis melo]
Length=158

 Score =   217 bits (553),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 131/157 (83%), Gaps = 2/157 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIF-HPKPGDKSHIQKQWASWN-VMAMPIagagkggglldKPVIEK  501
            M  AIC RV LS N  F   KPGDK +  KQ  + + +M + +A  GKGGGLL+KP IEK
Sbjct  1    MEAAICGRVPLSPNQFFTSTKPGDKYYFHKQCRNRSALMMISVAELGKGGGLLEKPTIEK  60

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFD+RKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  61   TTPGRESEFDVRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  120

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            +NG++VVIICAQVDAE+HC QLRGNGLLSSIEPAS G
Sbjct  121  YNGMAVVIICAQVDAEDHCMQLRGNGLLSSIEPASDG  157



>ref|XP_004137466.1| PREDICTED: ATP-dependent Clp protease adapter protein ClpS-like 
[Cucumis sativus]
 gb|KGN64109.1| hypothetical protein Csa_1G042210 [Cucumis sativus]
Length=158

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 131/157 (83%), Gaps = 2/157 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIF-HPKPGDKSHIQKQWASWN-VMAMPIagagkggglldKPVIEK  501
            M  AIC RV LS N  F   KPGDK +  KQ  + + +M + +A  GKGGGLL+KP IEK
Sbjct  1    MEAAICGRVPLSPNQFFTSTKPGDKYYFHKQCRNRSALMMISVAELGKGGGLLEKPAIEK  60

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFD+RKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  61   TTPGRESEFDVRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  120

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            +NG++VVIICAQVDAE+HC QLRGNGLLSSIEPAS G
Sbjct  121  YNGMAVVIICAQVDAEDHCMQLRGNGLLSSIEPASDG  157



>ref|XP_002281884.1| PREDICTED: uncharacterized protein LOC100242343 isoform X2 [Vitis 
vinifera]
 emb|CAN80233.1| hypothetical protein VITISV_037190 [Vitis vinifera]
Length=157

 Score =   216 bits (551),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 129/156 (83%), Gaps = 1/156 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagag-kggglldKPVIEKA  498
            M  AIC R++LS NH+F+ K GDK  + K   +     M I+ +G   GGLL++PVIEK 
Sbjct  1    MENAICGRLALSPNHVFNSKSGDKHSLLKGPCTNRSFLMAISASGPGKGGLLERPVIEKV  60

Query  497  TPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHH  318
            TPGR+SEFDLRKSRK +PPYRV+LHNDN+NKREYVVQVLMKVIPGMTLD AVNIMQEAH+
Sbjct  61   TPGRESEFDLRKSRKIAPPYRVILHNDNYNKREYVVQVLMKVIPGMTLDNAVNIMQEAHY  120

Query  317  NGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            NGLSVVIICAQ DAE+HC QLRGNGLLSSIEPASGG
Sbjct  121  NGLSVVIICAQADAEDHCMQLRGNGLLSSIEPASGG  156



>ref|XP_007046287.1| Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein 
ClpS family protein isoform 1 [Theobroma cacao]
 gb|EOY02119.1| Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein 
ClpS family protein isoform 1 [Theobroma cacao]
Length=158

 Score =   216 bits (551),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 133/157 (85%), Gaps = 2/157 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWN--VMAMPIagagkggglldKPVIEK  501
            M TAI  R++LS N +F+PKPG+K  + K   +    +MA+   GAG+G G+L+KPVIE+
Sbjct  1    METAIRGRLTLSPNTVFNPKPGEKQSLCKGPCTNRGILMAISTTGAGRGAGVLEKPVIER  60

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFD+RKSRK +PPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  61   TTPGRESEFDVRKSRKIAPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  120

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            +NGL+VVIICAQ DAEEHC QLRGNGLLSSIEPASGG
Sbjct  121  YNGLAVVIICAQADAEEHCMQLRGNGLLSSIEPASGG  157



>ref|XP_009356359.1| PREDICTED: uncharacterized protein LOC103947212 isoform X2 [Pyrus 
x bretschneideri]
Length=158

 Score =   216 bits (550),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 129/161 (80%), Gaps = 7/161 (4%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagagkgggl----ldKPVI  507
            M TAIC R+ LS NH+F+PKPGD+  + K   +   +++P+A +    G     L++PV 
Sbjct  1    METAICGRIPLSPNHVFNPKPGDRHPLCK--GTCTNLSIPVAVSAAVPGKGGGLLERPVR  58

Query  506  EKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQE  327
            EK TP R SEFDLRKSRKT+PPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQE
Sbjct  59   EKTTPARDSEFDLRKSRKTAPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQE  118

Query  326  AHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            AHHNGLSVVIICAQ DAEEHCTQLR NGLLSSIEPA G GC
Sbjct  119  AHHNGLSVVIICAQADAEEHCTQLRHNGLLSSIEPA-GDGC  158



>gb|KDP29376.1| hypothetical protein JCGZ_18297 [Jatropha curcas]
Length=158

 Score =   216 bits (550),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 132/157 (84%), Gaps = 2/157 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDK-SHIQKQWASWNV-MAMPIagagkggglldKPVIEK  501
            M TAIC R++LS N +F PK GDK S  +  W +  + MA+   G+GKGGGLL++P+IEK
Sbjct  1    MDTAICGRIALSPNQVFSPKSGDKHSLCRGTWINRGILMALSATGSGKGGGLLERPIIEK  60

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFDLRK RK +PPYRV+LHNDN+NKREYVVQVLMKVIPGMT+D AVNIMQEAH
Sbjct  61   TTPGRESEFDLRKKRKMAPPYRVILHNDNYNKREYVVQVLMKVIPGMTVDNAVNIMQEAH  120

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            +NGLSVVIIC Q DAEEHC QLRGNGLLSSIEP+SGG
Sbjct  121  YNGLSVVIICTQADAEEHCMQLRGNGLLSSIEPSSGG  157



>ref|XP_006838422.1| hypothetical protein AMTR_s00002p00109470 [Amborella trichopoda]
 gb|ERN00991.1| hypothetical protein AMTR_s00002p00109470 [Amborella trichopoda]
Length=158

 Score =   216 bits (550),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 133/159 (84%), Gaps = 3/159 (2%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWA--SWNVMAMPIagagkggglldKPVIEK  501
            M TAIC R++LSAN + +PK GDK  + K        +M +  +G GKGGGLL++P IEK
Sbjct  1    METAICGRITLSANQLLNPKSGDKLLLLKGTCPNRGTIMMVSASGPGKGGGLLERPTIEK  60

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             +PGR+SEFDLRKSRKTSPPYRVLLHNDN+NKREYVVQVLM+VIPGMTLD AVNIMQEAH
Sbjct  61   TSPGRESEFDLRKSRKTSPPYRVLLHNDNYNKREYVVQVLMRVIPGMTLDNAVNIMQEAH  120

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            +NG++VVI+CAQVDAEEHC QLRGNGLLSSIEPA G GC
Sbjct  121  YNGMAVVIVCAQVDAEEHCMQLRGNGLLSSIEPA-GDGC  158



>ref|XP_004135108.1| PREDICTED: ATP-dependent Clp protease adapter protein ClpS-like 
[Cucumis sativus]
 ref|XP_004172254.1| PREDICTED: ATP-dependent Clp protease adapter protein ClpS-like 
[Cucumis sativus]
 gb|KGN52056.1| hypothetical protein Csa_5G608440 [Cucumis sativus]
Length=159

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 131/160 (82%), Gaps = 4/160 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagagkgg---glldKPVIE  504
            M  AI  +++LS NH+F+PKPGD+S + K    +N  A  +  A   G   GLL++PVIE
Sbjct  1    MEIAIRGKLALSPNHVFNPKPGDRSSVCKGLC-FNFGASVVKSAATAGRGGGLLERPVIE  59

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            KATPGR+SEFDLR+SRK +PPYRV+LHND+FNKREYVVQVLMKVIPGMTLD AVNIMQEA
Sbjct  60   KATPGRESEFDLRRSRKMTPPYRVILHNDDFNKREYVVQVLMKVIPGMTLDNAVNIMQEA  119

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            H+NGLS+VIICAQ DAE HC QLRGNGLLSSIEPASGG C
Sbjct  120  HYNGLSLVIICAQADAEGHCMQLRGNGLLSSIEPASGGCC  159



>ref|XP_010906089.1| PREDICTED: uncharacterized protein LOC105033123 [Elaeis guineensis]
Length=158

 Score =   214 bits (545),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 133/157 (85%), Gaps = 2/157 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWN--VMAMPIagagkggglldKPVIEK  501
            M TAIC R++LS  H+ +PK GD+  + K   +    ++A+  AG GKGGGLL++P IEK
Sbjct  1    METAICSRIALSPGHVLNPKSGDRFSLYKGHCANRGILVAVLAAGPGKGGGLLERPTIEK  60

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFDLRKS+KT+PPYRV+LHNDN+NKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  61   TTPGRESEFDLRKSKKTAPPYRVILHNDNYNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  120

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            +NGL+VVIIC+Q DAEEHC QLRGNGLLSSIEPASGG
Sbjct  121  YNGLAVVIICSQADAEEHCMQLRGNGLLSSIEPASGG  157



>ref|XP_010037358.1| PREDICTED: uncharacterized protein LOC104426108 [Eucalyptus grandis]
Length=155

 Score =   213 bits (541),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 129/156 (83%), Gaps = 3/156 (2%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWA-SWNVMAMPIagagkggglldKPVIEKA  498
            M TAIC RV+LS +H+F  K GDK +  KQ +   ++  M     GKGGGLL++P IE  
Sbjct  1    METAICGRVALSPHHVF-SKSGDKHYFNKQCSYRSSLTTMSTTALGKGGGLLERPTIE-T  58

Query  497  TPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHH  318
            TPGR+SEFD+RKSRKT+PPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEAH+
Sbjct  59   TPGRESEFDVRKSRKTAPPYRVMLHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEAHY  118

Query  317  NGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            NGLSVVIIC Q DAEEHC QLRGNGLLSSIEPASGG
Sbjct  119  NGLSVVIICTQADAEEHCMQLRGNGLLSSIEPASGG  154



>ref|XP_008812804.1| PREDICTED: uncharacterized protein LOC103723618 [Phoenix dactylifera]
Length=158

 Score =   213 bits (541),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 135/156 (87%), Gaps = 2/156 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQK-QWASWNVM-AMPIagagkggglldKPVIEK  501
            M TAIC RV+LS NH+++P+ GDK  + K  +A+  ++ A+   G GKGGGLL++P IEK
Sbjct  1    METAICGRVALSPNHVWNPRSGDKLSLYKGHYANRGILVAISATGPGKGGGLLERPTIEK  60

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFDLRKSRKT+PP+RV+LHNDN+NKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  61   TTPGRESEFDLRKSRKTAPPFRVILHNDNYNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  120

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASG  213
            +NGL+VVIIC+Q DAEEHC QLRG+GL+SSIEPASG
Sbjct  121  YNGLAVVIICSQADAEEHCMQLRGSGLISSIEPASG  156



>ref|XP_009356351.1| PREDICTED: uncharacterized protein LOC103947212 isoform X1 [Pyrus 
x bretschneideri]
Length=159

 Score =   213 bits (541),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 126/161 (78%), Gaps = 6/161 (4%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagagkgggl----ldKPVI  507
            M TAIC R+ LS NH+F+PKP    H   +    N +++P+A +    G     L++PV 
Sbjct  1    METAICGRIPLSPNHVFNPKPAGDRHPLCKGTCTN-LSIPVAVSAAVPGKGGGLLERPVR  59

Query  506  EKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQE  327
            EK TP R SEFDLRKSRKT+PPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQE
Sbjct  60   EKTTPARDSEFDLRKSRKTAPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQE  119

Query  326  AHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            AHHNGLSVVIICAQ DAEEHCTQLR NGLLSSIEPA G GC
Sbjct  120  AHHNGLSVVIICAQADAEEHCTQLRHNGLLSSIEPA-GDGC  159



>gb|KHN32015.1| ATP-dependent Clp protease adapter protein ClpS [Glycine soja]
Length=160

 Score =   211 bits (537),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 125/161 (78%), Gaps = 5/161 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHP-KPGDKSHIQKQWASWNVMAMPIagagkggglldK---PVI  507
            M  A+C  ++LS N +F+   PGDK ++  +++    + M +A  G  G        P I
Sbjct  1    MEAALCSALALSPNQVFNAANPGDK-NVPLKYSKDRSVVMTVAATGILGKGGGLLERPTI  59

Query  506  EKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQE  327
            E  +PGR+SEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQE
Sbjct  60   ETTSPGRESEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTIDSAVNIMQE  119

Query  326  AHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            AH+NGL+VVI+CAQVDAE+HC QLRGNGLLSSIEPA GGGC
Sbjct  120  AHYNGLAVVIVCAQVDAEDHCMQLRGNGLLSSIEPADGGGC  160



>ref|XP_003534179.1| PREDICTED: uncharacterized protein LOC100785379 [Glycine max]
 gb|KHN20711.1| ATP-dependent Clp protease adapter protein ClpS [Glycine soja]
Length=160

 Score =   211 bits (536),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 125/161 (78%), Gaps = 5/161 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHP-KPGDKSHIQKQWASWNVMAMPIagagkggglldK---PVI  507
            M  A+C  ++LS N +F+   PGDK ++  +++    + M +A  G  G        P I
Sbjct  1    MEAALCSALALSPNQVFNAANPGDK-NVPLKYSKDRSVVMTVAATGILGKGGGLLERPTI  59

Query  506  EKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQE  327
            E  +PGR+SEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQE
Sbjct  60   ETTSPGRESEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTIDNAVNIMQE  119

Query  326  AHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            AH+NGL+VVI+CAQVDAE+HC QLRGNGLLSSIEPA GGGC
Sbjct  120  AHYNGLAVVIVCAQVDAEDHCMQLRGNGLLSSIEPADGGGC  160



>ref|XP_008389302.1| PREDICTED: uncharacterized protein LOC103451667 [Malus domestica]
 ref|XP_008367016.1| PREDICTED: uncharacterized protein LOC103430643 [Malus domestica]
Length=158

 Score =   210 bits (534),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 131/160 (82%), Gaps = 5/160 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNV---MAMPIagagkggglldKPVIE  504
            M TAIC R+ LS NH+F+ KPGD+ H   + A  N+   +A+  A  GKGGGLL++PV E
Sbjct  1    METAICGRIPLSPNHVFNXKPGDR-HPLCKGACTNLSIPVAVSTAVPGKGGGLLERPVRE  59

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            KA P R SEFDLRKSRKT+PPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEA
Sbjct  60   KAAPARDSEFDLRKSRKTAPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEA  119

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            HHNGLSVVIICAQ DAEEHC QLR NGLLSSIEPA G GC
Sbjct  120  HHNGLSVVIICAQADAEEHCMQLRHNGLLSSIEPA-GDGC  158



>ref|XP_010695849.1| PREDICTED: uncharacterized protein LOC104908432 [Beta vulgaris 
subsp. vulgaris]
Length=157

 Score =   210 bits (534),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 126/158 (80%), Gaps = 2/158 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagagkggg-lldKPVIEKA  498
            M TAI  R+SLS NH+ +   GD+ +  K   +   + +P++  G   G +LD+PVIEK 
Sbjct  1    METAIIGRLSLSPNHVINRNSGDRHYFYKGLCNHRGLLVPVSATGSSKGGVLDRPVIEKT  60

Query  497  TPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHH  318
             PGR+SEFDLRKSRK SPPYRVLLHNDNFNKREYVVQVLMKVIPGMT+DIAVNIMQEAHH
Sbjct  61   NPGRESEFDLRKSRKISPPYRVLLHNDNFNKREYVVQVLMKVIPGMTVDIAVNIMQEAHH  120

Query  317  NGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            NG++VVIICAQ DAE+HC QLR NGLLSS+EPA G GC
Sbjct  121  NGMAVVIICAQADAEDHCMQLRSNGLLSSVEPA-GSGC  157



>gb|KCW49062.1| hypothetical protein EUGRSUZ_K02665, partial [Eucalyptus grandis]
Length=228

 Score =   212 bits (540),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 130/157 (83%), Gaps = 3/157 (2%)
 Frame = -1

Query  677  SMATAICCRVSLSANHIFHPKPGDKSHIQKQWA-SWNVMAMPIagagkggglldKPVIEK  501
            +M TAIC RV+LS +H+F  K GDK +  KQ +   ++  M     GKGGGLL++P IE 
Sbjct  73   AMETAICGRVALSPHHVFS-KSGDKHYFNKQCSYRSSLTTMSTTALGKGGGLLERPTIE-  130

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFD+RKSRKT+PPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  131  TTPGRESEFDVRKSRKTAPPYRVMLHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  190

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            +NGLSVVIIC Q DAEEHC QLRGNGLLSSIEPASGG
Sbjct  191  YNGLSVVIICTQADAEEHCMQLRGNGLLSSIEPASGG  227



>ref|XP_007209725.1| hypothetical protein PRUPE_ppa012720mg [Prunus persica]
 ref|XP_008244019.1| PREDICTED: uncharacterized protein LOC103342192 [Prunus mume]
 gb|EMJ10924.1| hypothetical protein PRUPE_ppa012720mg [Prunus persica]
Length=157

 Score =   210 bits (534),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 127/154 (82%), Gaps = 2/154 (1%)
 Frame = -1

Query  665  AICCRVSLSANHIFH-PKPGDKSHIQKQWASWNV-MAMPIagagkggglldKPVIEKATP  492
            AIC RV+LS N  F+  K GDK +  KQ +S ++ M       GKGGGLL+KP IEK TP
Sbjct  3    AICGRVALSPNQGFNLAKSGDKHYFHKQCSSRSILMTASSTRLGKGGGLLEKPTIEKTTP  62

Query  491  GRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNG  312
             R SEFDLRKSRK SPPYRV+LHNDN+NKREYVVQVLMKVIPGMT+DIAVNIMQEAHHNG
Sbjct  63   SRDSEFDLRKSRKMSPPYRVMLHNDNYNKREYVVQVLMKVIPGMTVDIAVNIMQEAHHNG  122

Query  311  LSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            L+VVI+CAQVDAE+HC QLRGNGLLSS+EPAS G
Sbjct  123  LAVVIVCAQVDAEDHCMQLRGNGLLSSVEPASDG  156



>ref|NP_001234970.1| uncharacterized protein LOC100527361 [Glycine max]
 gb|ACU16445.1| unknown [Glycine max]
 gb|KHN27178.1| ATP-dependent Clp protease adapter protein ClpS [Glycine soja]
Length=155

 Score =   209 bits (533),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 134/157 (85%), Gaps = 5/157 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQ-WASWNV-MAMPIagagkggglldKPVIEK  501
            M +AIC R+ LS NH+F  KPGD   I K  +++  V MA+   G GKGGG+L+KPVIEK
Sbjct  1    MKSAICGRI-LSPNHVF--KPGDTHSICKGPYSNLCVPMAVLATGPGKGGGVLEKPVIEK  57

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFDL+KSRK++PPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  58   VTPGRESEFDLKKSRKSAPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  117

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            +NGLSVVIIC Q DAE+HCTQLRGNGLLSSIEPASGG
Sbjct  118  YNGLSVVIICDQADAEDHCTQLRGNGLLSSIEPASGG  154



>ref|XP_010092771.1| ATP-dependent Clp protease adapter protein ClpS [Morus notabilis]
 gb|EXB52181.1| ATP-dependent Clp protease adapter protein ClpS [Morus notabilis]
Length=158

 Score =   209 bits (533),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 128/157 (82%), Gaps = 2/157 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHP-KPGDKSHIQKQWASWN-VMAMPIagagkggglldKPVIEK  501
            MATAI  RV LS NH F+P K GD+S+  KQ +  N +M +     GKGGGLL+KP IEK
Sbjct  1    MATAIRGRVPLSPNHAFNPPKSGDRSYFHKQCSIRNFLMTLSTTALGKGGGLLEKPTIEK  60

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
              PGR+SEFD R+SRK SPPY VLLHNDNFNKREYVVQVLMKVIP MTLD AVNIMQEAH
Sbjct  61   TKPGRKSEFDKRRSRKMSPPYCVLLHNDNFNKREYVVQVLMKVIPEMTLDNAVNIMQEAH  120

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            +NG+SVVIICAQVDAEEHC QLRGNGLLSSIEPAS G
Sbjct  121  YNGMSVVIICAQVDAEEHCMQLRGNGLLSSIEPASDG  157



>ref|XP_008368219.1| PREDICTED: uncharacterized protein LOC103431829 isoform X2 [Malus 
domestica]
Length=158

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 127/161 (79%), Gaps = 7/161 (4%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagagkgggl----ldKPVI  507
            M TAI  R+ LS NH+F+PKPGD+  + K   +   +++P+A +    G     L++PV 
Sbjct  1    METAIXGRIPLSPNHVFNPKPGDRHPLCKGKCTN--ISIPVAVSAAVPGKGGGLLERPVR  58

Query  506  EKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQE  327
            EK TP R SEFDLRKSRK +PPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQE
Sbjct  59   EKTTPARDSEFDLRKSRKPAPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQE  118

Query  326  AHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            AHHNGLSVVIICAQ DAEEHC QLR NGLLSSIEPA GGGC
Sbjct  119  AHHNGLSVVIICAQADAEEHCMQLRHNGLLSSIEPA-GGGC  158



>gb|AFK40356.1| unknown [Lotus japonicus]
Length=156

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 131/160 (82%), Gaps = 7/160 (4%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNV---MAMPIagagkggglldKPVIE  504
            M +AIC R+ LS NH+F   PGDK        S NV   MA    G GKGGGLL+KPVIE
Sbjct  1    MKSAICGRMGLSPNHVF--APGDKYSFCVGPCS-NVCIPMAALATGPGKGGGLLEKPVIE  57

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            K +PGR+SEFDL+KSRK+SPPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEA
Sbjct  58   KVSPGRESEFDLKKSRKSSPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEA  117

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            HHNGLSVVIICAQ DAE+HC QLRGNGLLSSIEPA GGGC
Sbjct  118  HHNGLSVVIICAQADAEDHCMQLRGNGLLSSIEPA-GGGC  156



>ref|XP_007152795.1| hypothetical protein PHAVU_004G160300g [Phaseolus vulgaris]
 gb|ESW24789.1| hypothetical protein PHAVU_004G160300g [Phaseolus vulgaris]
Length=160

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 126/160 (79%), Gaps = 3/160 (2%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHP-KPGDKSHIQKQWASWNVMAM--PIagagkggglldKPVIE  504
            M  A+   ++LS N +F+   PGDK+   K      V+         GKGGGL ++P IE
Sbjct  1    MEAALSTALALSPNQVFNAVNPGDKNFGLKYCKDRTVVVTMAATGILGKGGGLAERPTIE  60

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            K TPGR+SEFDLRKSRKTSPP+RVLLHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQEA
Sbjct  61   KTTPGRESEFDLRKSRKTSPPFRVLLHNDNFNKREYVVQVLMKVIPGMTIDNAVNIMQEA  120

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            HHNGL+VVIICAQVDAE+HC QLRG+GLLSSIEPA GGGC
Sbjct  121  HHNGLAVVIICAQVDAEDHCMQLRGSGLLSSIEPADGGGC  160



>ref|XP_006391113.1| hypothetical protein EUTSA_v10019264mg [Eutrema salsugineum]
 gb|ESQ28399.1| hypothetical protein EUTSA_v10019264mg [Eutrema salsugineum]
Length=158

 Score =   208 bits (529),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 130/159 (82%), Gaps = 3/159 (2%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQ--WASWNVMAMPIagagkggglldKPVIEK  501
            M TAIC R++L+ + +F+ K GDK  I K        +MAM  +  GKGGG+LDKP+IEK
Sbjct  1    METAICGRLALAPSTLFNSKSGDKHSISKGPCLNRGLLMAMSTSAMGKGGGVLDKPIIEK  60

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFDLRKS+K +PPYRV+LHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQEAH
Sbjct  61   TTPGRESEFDLRKSKKMAPPYRVILHNDNFNKREYVVQVLMKVIPGMTVDNAVNIMQEAH  120

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
             NGL+VVI+CAQ DAE+HC QLRGNGLLSS+EP  GGGC
Sbjct  121  INGLAVVIVCAQADAEQHCMQLRGNGLLSSVEP-DGGGC  158



>ref|XP_008351876.1| PREDICTED: uncharacterized protein LOC103415312 [Malus domestica]
 ref|XP_008360898.1| PREDICTED: uncharacterized protein LOC103424584 [Malus domestica]
Length=157

 Score =   207 bits (528),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 126/154 (82%), Gaps = 2/154 (1%)
 Frame = -1

Query  665  AICCRVSLSANHIFH-PKPGDKSHIQKQWASWNV-MAMPIagagkggglldKPVIEKATP  492
            AIC RV LS NH F+  K GDK +  +Q  + ++ M       G GGG+LDKP IEK TP
Sbjct  3    AICGRVPLSPNHGFNLNKSGDKHYFHRQSPNRSILMTASSTRLGTGGGVLDKPTIEKTTP  62

Query  491  GRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNG  312
            GR SEFD+RKSRK SPPYRV+LHNDN+NKREYVVQVLMKVIPGMT+DIAVN+MQEAHHNG
Sbjct  63   GRDSEFDVRKSRKMSPPYRVMLHNDNYNKREYVVQVLMKVIPGMTVDIAVNVMQEAHHNG  122

Query  311  LSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            L+VVI+CAQVDAE+HC QLRGNGLLSS+EPAS G
Sbjct  123  LAVVIVCAQVDAEDHCMQLRGNGLLSSVEPASDG  156



>ref|XP_007153355.1| hypothetical protein PHAVU_003G028500g [Phaseolus vulgaris]
 gb|ESW25349.1| hypothetical protein PHAVU_003G028500g [Phaseolus vulgaris]
Length=155

 Score =   207 bits (528),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 133/157 (85%), Gaps = 5/157 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDK-SHIQKQWASWNV-MAMPIagagkggglldKPVIEK  501
            M +AIC R+ LS NH+F  KPGD  S  +  +++  V MA+   G GKGGGLL+KPVIE+
Sbjct  1    MKSAICGRI-LSPNHVF--KPGDTPSFCKGPYSNLCVPMAVVATGPGKGGGLLEKPVIER  57

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFDL+KSRKT+PPYRV+LHNDN+NKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  58   VTPGRESEFDLKKSRKTAPPYRVILHNDNYNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  117

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            HNGLSVVIICAQ DAE+HC QLRGNGLLSSIEPA GG
Sbjct  118  HNGLSVVIICAQSDAEDHCMQLRGNGLLSSIEPADGG  154



>ref|NP_001237811.1| uncharacterized protein LOC100306117 [Glycine max]
 gb|ACU14144.1| unknown [Glycine max]
Length=160

 Score =   207 bits (528),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 124/161 (77%), Gaps = 5/161 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHP-KPGDKSHIQKQWASWNVMAMPIagagkggglldK---PVI  507
            M  A+C  ++ S N +F+   PGDK ++  +++    + M +A  G  G        P I
Sbjct  1    MEAALCSALAPSPNQVFNAANPGDK-NVPLKYSKDRSVVMTVAATGILGKGGGLLERPTI  59

Query  506  EKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQE  327
            E  +PGR+SEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQE
Sbjct  60   ETTSPGRESEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTIDNAVNIMQE  119

Query  326  AHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            AH+NGL+VVI+CAQVDAE+HC QLRGNGLLSSIEPA GGGC
Sbjct  120  AHYNGLAVVIVCAQVDAEDHCMQLRGNGLLSSIEPADGGGC  160



>ref|XP_008374733.1| PREDICTED: uncharacterized protein LOC103437976 [Malus domestica]
Length=157

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 125/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  665  AICCRVSLSANHIFH-PKPGDKSHIQKQWASWNVM-AMPIagagkggglldKPVIEKATP  492
            AIC RV LS NH F+  K GDK +  +Q  + ++M        G GGG+LDKP IEK TP
Sbjct  3    AICGRVPLSTNHGFNLTKSGDKHYFHRQSPNRSIMMTTSSTRLGTGGGVLDKPTIEKTTP  62

Query  491  GRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNG  312
             R SEFD+RKSRK SPPYRV+LHNDN+NKREYVVQVLMKVIPGMT+DIAVN+MQEAHHNG
Sbjct  63   SRDSEFDVRKSRKMSPPYRVMLHNDNYNKREYVVQVLMKVIPGMTVDIAVNVMQEAHHNG  122

Query  311  LSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            L+VVI+CAQVDAE+HC QLRGNGLLSS+EPAS G
Sbjct  123  LAVVIVCAQVDAEDHCMQLRGNGLLSSVEPASDG  156



>ref|XP_008368218.1| PREDICTED: uncharacterized protein LOC103431829 isoform X1 [Malus 
domestica]
Length=159

 Score =   207 bits (526),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 127/160 (79%), Gaps = 4/160 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNV---MAMPIagagkggglldKPVIE  504
            M TAI  R+ LS NH+F+PKP    H   +    N+   +A+  A  GKGGGLL++PV E
Sbjct  1    METAIXGRIPLSPNHVFNPKPAGDRHPLCKGKCTNISIPVAVSAAVPGKGGGLLERPVRE  60

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            K TP R SEFDLRKSRK +PPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEA
Sbjct  61   KTTPARDSEFDLRKSRKPAPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEA  120

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            HHNGLSVVIICAQ DAEEHC QLR NGLLSSIEPA GGGC
Sbjct  121  HHNGLSVVIICAQADAEEHCMQLRHNGLLSSIEPA-GGGC  159



>ref|XP_010105775.1| ATP-dependent Clp protease adapter protein ClpS [Morus notabilis]
 gb|EXC06060.1| ATP-dependent Clp protease adapter protein ClpS [Morus notabilis]
Length=157

 Score =   207 bits (526),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 131/157 (83%), Gaps = 3/157 (2%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHI-QKQWASWNV-MAMPIagagkggglldKPVIEK  501
            M TAIC +++LS NH+ +PKPGDK  + +    S  + +A+   G GKGGG+L++P I K
Sbjct  1    METAICGKLALSPNHVINPKPGDKQSLCRGPCPSIGIHVAVSTTGPGKGGGVLERPAIGK  60

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TP R+SEFD+RKSRKT+PPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  61   -TPARESEFDVRKSRKTAPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  119

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            +NGLSVVIIC Q DAEEHC QLRGNGLLSSIEPASGG
Sbjct  120  YNGLSVVIICDQADAEEHCMQLRGNGLLSSIEPASGG  156



>ref|XP_009346932.1| PREDICTED: uncharacterized protein LOC103938628 [Pyrus x bretschneideri]
Length=157

 Score =   206 bits (524),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 126/156 (81%), Gaps = 3/156 (2%)
 Frame = -1

Query  665  AICCRVSLSANHIFH-PKPGDKSHIQKQWASWNV-MAMPIagagkggglldKPVIEKATP  492
            AIC RV LS NH F+  K GDK +  +Q  + ++ M       G GGG+LDKP IEK TP
Sbjct  3    AICGRVPLSTNHGFNLTKSGDKHYFHRQSPNRSILMTTSSTRLGTGGGVLDKPTIEKTTP  62

Query  491  GRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNG  312
             R SEFD+RKSRK SPPYRV+LHNDN+NKREYVVQVLMKVIPGMT+DIAVN+MQEAHHNG
Sbjct  63   SRDSEFDVRKSRKMSPPYRVMLHNDNYNKREYVVQVLMKVIPGMTVDIAVNVMQEAHHNG  122

Query  311  LSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            L+VVI+CAQVDAE+HC QLRGNGLLSS+EPA G GC
Sbjct  123  LAVVIVCAQVDAEDHCMQLRGNGLLSSVEPA-GDGC  157



>ref|XP_009127660.1| PREDICTED: uncharacterized protein LOC103852515 [Brassica rapa]
 emb|CDY54504.1| BnaA02g35670D [Brassica napus]
Length=157

 Score =   206 bits (524),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 131/158 (83%), Gaps = 2/158 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQ-WASWNVMAMPIagagkggglldKPVIEKA  498
            M +AIC R++L+ + +F+ K GDK  + K  W +   + M ++  GKGGG+LDKP+IEK 
Sbjct  1    MESAICGRLALAPSSLFNSKSGDKHSVSKGPWVNNRGVLMIMSAMGKGGGVLDKPIIEKT  60

Query  497  TPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHH  318
            TPGR+SEFDLRKS+K +PPYRV+LHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQEAH 
Sbjct  61   TPGRESEFDLRKSKKMAPPYRVILHNDNFNKREYVVQVLMKVIPGMTVDNAVNIMQEAHI  120

Query  317  NGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            NGL+VVI+CAQ DAE+HC QLRGNGLLSS+EP  GGGC
Sbjct  121  NGLAVVIVCAQADAEQHCMQLRGNGLLSSVEP-DGGGC  157



>ref|XP_004299231.1| PREDICTED: ATP-dependent Clp protease adapter protein ClpS-like 
[Fragaria vesca subsp. vesca]
Length=158

 Score =   205 bits (522),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 126/157 (80%), Gaps = 4/157 (3%)
 Frame = -1

Query  665  AICCRVSLSANHIFH--PKPGDKSHIQKQWASWN-VMAMPIagagkggglldKPVIEKAT  495
            A+C RV LS   +F+     GDK +  KQ  + + VM       GKGGGLL+KP IEK T
Sbjct  3    ALCGRVPLSPTQVFNLSKSGGDKPYFHKQCPNRSTVMTATTTVLGKGGGLLEKPTIEKTT  62

Query  494  PGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHN  315
            PGR SEFDLRKS+K SPPYRV+LHNDNFNKREYVVQVLMKVIPGMT+DIAVN+MQEAHHN
Sbjct  63   PGRDSEFDLRKSKKMSPPYRVMLHNDNFNKREYVVQVLMKVIPGMTVDIAVNVMQEAHHN  122

Query  314  GLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            GL+VVI+CAQVDAE+HC QLRGNGLLSS+EPA G GC
Sbjct  123  GLAVVIVCAQVDAEDHCMQLRGNGLLSSVEPA-GDGC  158



>ref|XP_003614502.1| ATP-dependent Clp protease adapter protein clpS [Medicago truncatula]
 gb|AES97460.1| ATP-dependent Clp protease adaptor protein ClpS [Medicago truncatula]
Length=156

 Score =   205 bits (521),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 134/159 (84%), Gaps = 5/159 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDK-SHIQKQWASWNV-MAMPIagagkggglldKPVIEK  501
            M +AIC  + LS NH+F    GD+ S  +  +++  V MA+   G+GKGGG+L+KPVIEK
Sbjct  1    MKSAICRSMGLSPNHLF--ISGDRYSFCKGPYSNLCVPMAVLTKGSGKGGGILEKPVIEK  58

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
            ATPGR+SEFDL+KSRKT+PPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  59   ATPGRESEFDLKKSRKTAPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  118

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            HNG+SVVIICAQ DAE+HC QLRGNGLLSSIEPA G GC
Sbjct  119  HNGMSVVIICAQADAEDHCMQLRGNGLLSSIEPA-GDGC  156



>ref|XP_009337127.1| PREDICTED: uncharacterized protein LOC103929630 [Pyrus x bretschneideri]
 ref|XP_009337330.1| PREDICTED: uncharacterized protein LOC103929811 [Pyrus x bretschneideri]
Length=157

 Score =   205 bits (521),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 125/154 (81%), Gaps = 2/154 (1%)
 Frame = -1

Query  665  AICCRVSLSANHIFH-PKPGDKSHIQKQWASWNV-MAMPIagagkggglldKPVIEKATP  492
            AIC RV LS NH F+  K GDK +  +Q  + ++ M       G GGG+LDKP IEK TP
Sbjct  3    AICGRVPLSPNHGFNLNKSGDKHYFYRQSPNRSILMTASSTRLGTGGGVLDKPTIEKTTP  62

Query  491  GRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNG  312
             R SEFD+RKSRK SPPYRV+LHNDN+NKREYVVQVLMKVIPGMT+DIAVN+MQEAHHNG
Sbjct  63   NRDSEFDVRKSRKMSPPYRVMLHNDNYNKREYVVQVLMKVIPGMTVDIAVNVMQEAHHNG  122

Query  311  LSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            L+VVI+CAQVDAE+HC QLRGNGLLSS+EPAS G
Sbjct  123  LAVVIVCAQVDAEDHCMQLRGNGLLSSVEPASDG  156



>gb|ADE75982.1| unknown [Picea sitchensis]
Length=158

 Score =   205 bits (521),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 125/158 (79%), Gaps = 4/158 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagag---kggglldKPVIE  504
            MA+ I  R+ L    ++  K G+K   Q + A  N +   I       KGGGLL++P IE
Sbjct  1    MASVIYSRLILPQPQLYQQKSGEKIS-QSKGACMNRVFSAIRSTSPGGKGGGLLERPTIE  59

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            K TPGR+SEFDLRKSRKTSPPYRVLLHNDN+NKREYVVQVLMKVIPGMTLD AVNIMQEA
Sbjct  60   KTTPGRESEFDLRKSRKTSPPYRVLLHNDNYNKREYVVQVLMKVIPGMTLDTAVNIMQEA  119

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            H+NGL+VVIICAQVDAEEHCTQLRGNGLLSSIEPAS G
Sbjct  120  HYNGLAVVIICAQVDAEEHCTQLRGNGLLSSIEPASDG  157



>ref|NP_001235414.1| uncharacterized protein LOC100500511 [Glycine max]
 gb|ACU15612.1| unknown [Glycine max]
 gb|KHN45832.1| ATP-dependent Clp protease adapter protein ClpS [Glycine soja]
Length=155

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 128/157 (82%), Gaps = 5/157 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagag--kggglldKPVIEK  501
            M +AIC R+ LS NH+F  KPGD   I K   S   + M +   G   GGG+L+KPVIEK
Sbjct  1    MKSAICGRI-LSPNHVF--KPGDTHSICKGPYSNLCVPMVVLATGPGIGGGVLEKPVIEK  57

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFDL+KSRK++PPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  58   VTPGRESEFDLKKSRKSAPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  117

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            +NGLSVVIIC Q DAE+HC QLRGNGLLSSIEPA+GG
Sbjct  118  YNGLSVVIICDQADAEDHCMQLRGNGLLSSIEPANGG  154



>ref|XP_006437722.1| hypothetical protein CICLE_v10032968mg [Citrus clementina]
 gb|ESR50962.1| hypothetical protein CICLE_v10032968mg [Citrus clementina]
Length=156

 Score =   204 bits (518),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 127/157 (81%), Gaps = 4/157 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagag--kggglldKPVIEK  501
            M TAIC R++LS + +F+ KPGDKS +         + M +  +   KGGGLL++PVI  
Sbjct  1    METAICGRLALSPHTVFNSKPGDKSLLCGGSCINRSVLMTVLASAPGKGGGLLERPVI--  58

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
              PGR+SEFDL+K RKTSPPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  59   TAPGRESEFDLKKKRKTSPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  118

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            +NGLSVVI+C+Q DAEEHC QLRGNGLLSSIEPASGG
Sbjct  119  YNGLSVVIVCSQADAEEHCMQLRGNGLLSSIEPASGG  155



>emb|CAN78258.1| hypothetical protein VITISV_026645 [Vitis vinifera]
Length=135

 Score =   202 bits (514),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 113/157 (72%), Gaps = 25/157 (16%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPK--PGDKSHIQKQWASWNVMAMPIagagkggglldKPVIEK  501
            M TAIC RV LS N  F  K  PG  S + ++                       P IE+
Sbjct  1    METAICGRVPLSPNXFFTSKSAPGKGSGVLER-----------------------PTIER  37

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
              PGR+SEFDLRKSRK SPPYRVLLHNDN+NKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  38   IMPGRESEFDLRKSRKMSPPYRVLLHNDNYNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  97

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            HNG+SVVIICAQVDAE HC QLRGNGLLSSIEPASGG
Sbjct  98   HNGMSVVIICAQVDAEXHCMQLRGNGLLSSIEPASGG  134



>ref|NP_564937.1| protein ClpS1 [Arabidopsis thaliana]
 gb|AAD49977.1|AC008075_10 ESTs gb|T41781 and gb|AA586096 come from this gene [Arabidopsis 
thaliana]
 gb|AAG54002.1|AF336921_1 unknown protein [Arabidopsis thaliana]
 gb|AAK73973.1| At1g68660/F24J5_4 [Arabidopsis thaliana]
 gb|AAM52239.1| At1g68660/F24J5_4 [Arabidopsis thaliana]
 gb|AAM63011.1| unknown [Arabidopsis thaliana]
 gb|AEE34824.1| ribosomal protein L12/ ATP-dependent Clp protease adaptor protein 
ClpS family protein [Arabidopsis thaliana]
Length=159

 Score =   203 bits (516),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 126/160 (79%), Gaps = 4/160 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagagkggg---lldKPVIE  504
            M TAIC R++L+ + +F+ K GDK  + K       + M ++ +   G    +LDKP+IE
Sbjct  1    METAICGRLALAPSSLFNSKSGDKHLVSKGPCVNRSILMTLSTSAALGKGGGVLDKPIIE  60

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            K TPGR+SEFDLRKS+K +PPYRV+LHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQEA
Sbjct  61   KTTPGRESEFDLRKSKKIAPPYRVILHNDNFNKREYVVQVLMKVIPGMTVDNAVNIMQEA  120

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            H NGL+VVI+CAQ DAE+HC QLRGNGLLSS+EP  GGGC
Sbjct  121  HINGLAVVIVCAQADAEQHCMQLRGNGLLSSVEP-DGGGC  159



>ref|XP_006484424.1| PREDICTED: uncharacterized protein LOC102625837 isoform X2 [Citrus 
sinensis]
Length=156

 Score =   202 bits (514),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 126/157 (80%), Gaps = 4/157 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagag--kggglldKPVIEK  501
            M TAIC R++LS + +F+ KPGDKS +         + M +  +   KGGGLL++PVI  
Sbjct  1    METAICGRLALSPHTVFNSKPGDKSLLCGGSCINRSVLMTVLASAPGKGGGLLERPVI--  58

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
              PGR+SEFDL+K RKTSPPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEAH
Sbjct  59   TAPGRESEFDLKKKRKTSPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEAH  118

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
             NGLSVVIIC+Q DAEEHC QLRGNGLLSSIEPASGG
Sbjct  119  CNGLSVVIICSQADAEEHCMQLRGNGLLSSIEPASGG  155



>ref|XP_002888676.1| hypothetical protein ARALYDRAFT_894639 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64935.1| hypothetical protein ARALYDRAFT_894639 [Arabidopsis lyrata subsp. 
lyrata]
Length=159

 Score =   202 bits (513),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 125/160 (78%), Gaps = 4/160 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagagkggg---lldKPVIE  504
            M TAIC R++L+ + +F+ K GDK  + K       + M ++     G    +LDKP+IE
Sbjct  1    METAICGRLALAPSSLFNSKSGDKHLVSKGPCVNRGVLMTLSTYAALGKGGGVLDKPIIE  60

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            K TPGR+SEFDLRKS+K +PPYRV+LHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQEA
Sbjct  61   KTTPGRESEFDLRKSKKMAPPYRVILHNDNFNKREYVVQVLMKVIPGMTVDNAVNIMQEA  120

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            H NGL+VVI+CAQ DAE+HC QLRGNGLLSS+EP  GGGC
Sbjct  121  HINGLAVVIVCAQADAEQHCMQLRGNGLLSSVEP-DGGGC  159



>ref|XP_009105027.1| PREDICTED: uncharacterized protein LOC103830957 [Brassica rapa]
Length=159

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 128/160 (80%), Gaps = 4/160 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWN---VMAMPIagagkggglldKPVIE  504
            M TAIC R++L+   +F+   GDK  + K     N   ++ M  +  GKGGG+LDKP+IE
Sbjct  1    METAICGRLALAPTTLFNSISGDKHSVSKGPCVNNRGVLITMSTSVVGKGGGVLDKPIIE  60

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            K TPGR+SEFDLRKS+K +PPYRV+LHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQEA
Sbjct  61   KTTPGRESEFDLRKSKKMAPPYRVILHNDNFNKREYVVQVLMKVIPGMTVDNAVNIMQEA  120

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            H NG++VVI+CAQ DAE+HC QLRGNGLLSS+EP  GGGC
Sbjct  121  HINGMAVVIVCAQADAEQHCMQLRGNGLLSSVEP-DGGGC  159



>ref|XP_010511878.1| PREDICTED: uncharacterized protein LOC104787915 isoform X2 [Camelina 
sativa]
 ref|XP_010470825.1| PREDICTED: uncharacterized protein LOC104750685 [Camelina sativa]
Length=159

 Score =   200 bits (509),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 125/160 (78%), Gaps = 4/160 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagagkggg---lldKPVIE  504
            M T IC R++L+ + +F+ K GDK  + K       + M ++ +   G    +LDKP+IE
Sbjct  1    METTICGRLALAPSTLFNSKSGDKHSLSKGPCLSRGVLMTLSTSAALGKGGGVLDKPIIE  60

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            K TPGR+SEFDLRKS+K +PPYRV+LHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQEA
Sbjct  61   KTTPGRESEFDLRKSKKMAPPYRVILHNDNFNKREYVVQVLMKVIPGMTVDNAVNIMQEA  120

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            H NG++VVI+CAQ DAE+HC QLRGNGLLSS+EP  GGGC
Sbjct  121  HINGIAVVIVCAQADAEQHCMQLRGNGLLSSVEP-DGGGC  159



>ref|XP_002529149.1| ATP-dependent Clp protease adaptor protein clpS, putative [Ricinus 
communis]
 gb|EEF33262.1| ATP-dependent Clp protease adaptor protein clpS, putative [Ricinus 
communis]
Length=120

 Score =   198 bits (504),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = -1

Query  515  PVIEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNI  336
            PVIEK TPGR+SEFDLRKSRKT+PPYRV+LHNDN+NKREYVVQVLMKVIPGMTLD AVNI
Sbjct  18   PVIEKTTPGRESEFDLRKSRKTAPPYRVILHNDNYNKREYVVQVLMKVIPGMTLDNAVNI  77

Query  335  MQEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            MQEAH+NGLSVVIICAQ DAE+HC QLRGNGLLSSIEPASGG
Sbjct  78   MQEAHYNGLSVVIICAQADAEDHCMQLRGNGLLSSIEPASGG  119



>emb|CDY04242.1| BnaC06g25730D [Brassica napus]
Length=160

 Score =   199 bits (507),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 125/161 (78%), Gaps = 5/161 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWN---VMAMPIagagkggg-lldKPVI  507
            M TAIC R++L+   +F+   GDK  + K     N   +M M    A   GG +LDKP+I
Sbjct  1    METAICGRLALAPTTLFNSISGDKHSVSKGPCVNNRGVLMTMSTYAALGKGGGVLDKPII  60

Query  506  EKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQE  327
            EK TPGR+SEFDLRKS+K +PPYRV+LHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQE
Sbjct  61   EKTTPGRESEFDLRKSKKMAPPYRVILHNDNFNKREYVVQVLMKVIPGMTVDNAVNIMQE  120

Query  326  AHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            AH NGL+VVI+CAQ DAE+HC QLRGNGLLSS+EP  GGGC
Sbjct  121  AHINGLAVVIVCAQADAEQHCMQLRGNGLLSSVEP-DGGGC  160



>ref|XP_006302940.1| hypothetical protein CARUB_v10021079mg [Capsella rubella]
 gb|EOA35838.1| hypothetical protein CARUB_v10021079mg [Capsella rubella]
Length=159

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 124/160 (78%), Gaps = 4/160 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagagkggg---lldKPVIE  504
            M T IC R++L+ + +F  K GDK  + K       + M ++ +   G    +LDKP+IE
Sbjct  1    MDTTICGRLALAPSTLFSSKSGDKHSLSKGPCLNRGVLMTLSTSAALGKGGGVLDKPIIE  60

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            K TPGR+SEFDLRKS+K +PPYRV+LHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQEA
Sbjct  61   KTTPGRESEFDLRKSKKMAPPYRVILHNDNFNKREYVVQVLMKVIPGMTVDNAVNIMQEA  120

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            H NG++VVI+CAQ DAE+HC QLRGNGLLSS+EP  GGGC
Sbjct  121  HINGMAVVIVCAQADAEQHCMQLRGNGLLSSVEP-DGGGC  159



>emb|CDY07372.1| BnaA07g24510D [Brassica napus]
Length=160

 Score =   198 bits (504),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 126/161 (78%), Gaps = 5/161 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWN----VMAMPIagagkggglldKPVI  507
            M TAIC R++L+   +F+   GDK  + K     N    +     A  GKGGG+LDKP+I
Sbjct  1    METAICGRLALAPTTLFNSISGDKHSVSKGPCVNNRGVLITMSTYAALGKGGGVLDKPII  60

Query  506  EKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQE  327
            EK TPGR+SEFDLRKS+K +PPYRV+LHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQE
Sbjct  61   EKTTPGRESEFDLRKSKKMAPPYRVILHNDNFNKREYVVQVLMKVIPGMTVDNAVNIMQE  120

Query  326  AHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            AH NGL+VVI+CAQ DAE+HC QLRGNGLLSS+EP  GGGC
Sbjct  121  AHINGLAVVIVCAQADAEQHCMQLRGNGLLSSVEP-DGGGC  160



>ref|XP_006484423.1| PREDICTED: uncharacterized protein LOC102625837 isoform X1 [Citrus 
sinensis]
Length=157

 Score =   198 bits (503),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 126/158 (80%), Gaps = 5/158 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKP-GDKSHIQKQWASWNVMAMPIagag--kggglldKPVIE  504
            M TAIC R++LS + +F+ KP GDKS +         + M +  +   KGGGLL++PVI 
Sbjct  1    METAICGRLALSPHTVFNSKPAGDKSLLCGGSCINRSVLMTVLASAPGKGGGLLERPVI-  59

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
               PGR+SEFDL+K RKTSPPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNIMQEA
Sbjct  60   -TAPGRESEFDLKKKRKTSPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNIMQEA  118

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            H NGLSVVIIC+Q DAEEHC QLRGNGLLSSIEPASGG
Sbjct  119  HCNGLSVVIICSQADAEEHCMQLRGNGLLSSIEPASGG  156



>gb|KFK41289.1| hypothetical protein AALP_AA2G110700 [Arabis alpina]
Length=156

 Score =   197 bits (502),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 125/157 (80%), Gaps = 1/157 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagagkggglldKPVIEKAT  495
            M TAIC R++L+ + + + K GDK            M +  +  GKGGG+LDKP+IEK T
Sbjct  1    METAICGRLALAPSSLINSKSGDKLSKGPCVNRCVFMNLSTSALGKGGGVLDKPIIEKTT  60

Query  494  PGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHN  315
            PGR+SEFDLRKS+K +PPYRV+LHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQEAH N
Sbjct  61   PGRESEFDLRKSKKMAPPYRVILHNDNFNKREYVVQVLMKVIPGMTVDNAVNIMQEAHIN  120

Query  314  GLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            G++VVI+CAQ DAE+HC QLRGNGLLSS+EP  GGGC
Sbjct  121  GIAVVIVCAQADAEQHCMQLRGNGLLSSVEP-DGGGC  156



>ref|XP_008446566.1| PREDICTED: uncharacterized protein LOC103489260 isoform X2 [Cucumis 
melo]
Length=133

 Score =   196 bits (499),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = -1

Query  515  PVIEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNI  336
            PVIEKATPGR+SEFD+R+SRK +PPYRV+LHND+FNKREYVVQVLMKVIPGMTLD AVNI
Sbjct  30   PVIEKATPGRESEFDMRRSRKMTPPYRVILHNDDFNKREYVVQVLMKVIPGMTLDNAVNI  89

Query  335  MQEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            MQEAH+NGLS+VIICAQ DAEEHC QLRGNGLLSSIEPASGG C
Sbjct  90   MQEAHYNGLSLVIICAQADAEEHCMQLRGNGLLSSIEPASGGCC  133



>gb|AFK41868.1| unknown [Medicago truncatula]
 gb|KEH27072.1| ATP-dependent Clp protease adaptor protein ClpS [Medicago truncatula]
Length=160

 Score =   197 bits (501),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 114/146 (78%), Gaps = 1/146 (1%)
 Frame = -1

Query  644  LSANHIFHPK-PGDKSHIQKQWASWNVMAMPIagagkggglldKPVIEKATPGRQSEFDL  468
            +S N + +   PGDK    K     + +   +A    GG L   P IEK TPGR+SEFDL
Sbjct  14   ISPNQLLNASTPGDKYFGFKYSKDRSTVMTMVASGKGGGLLEKPPTIEKTTPGRESEFDL  73

Query  467  RKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICA  288
            RKS+KTSPPYRV+LHNDN+NKREYVVQVLMKVIPGMT+DIAVN+MQEAH NGL+VVIICA
Sbjct  74   RKSKKTSPPYRVMLHNDNYNKREYVVQVLMKVIPGMTVDIAVNVMQEAHINGLAVVIICA  133

Query  287  QVDAEEHCTQLRGNGLLSSIEPASGG  210
            QVDAE+HC QLRGNGLLSSIEPA GG
Sbjct  134  QVDAEDHCMQLRGNGLLSSIEPADGG  159



>ref|XP_010511877.1| PREDICTED: uncharacterized protein LOC104787915 isoform X1 [Camelina 
sativa]
 ref|XP_010415494.1| PREDICTED: uncharacterized protein LOC104701499 [Camelina sativa]
Length=160

 Score =   196 bits (497),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 125/161 (78%), Gaps = 5/161 (3%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPG-DKSHIQKQWASWNVMAMPIagagkggg---lldKPVI  507
            M T IC R++L+ + +F+ K G DK  + K       + M ++ +   G    +LDKP+I
Sbjct  1    METTICGRLALAPSTLFNSKSGGDKHSLSKGPCLSRGVLMTLSTSAALGKGGGVLDKPII  60

Query  506  EKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQE  327
            EK TPGR+SEFDLRKS+K +PPYRV+LHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQE
Sbjct  61   EKTTPGRESEFDLRKSKKMAPPYRVILHNDNFNKREYVVQVLMKVIPGMTVDNAVNIMQE  120

Query  326  AHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            AH NG++VVI+CAQ DAE+HC QLRGNGLLSS+EP  GGGC
Sbjct  121  AHINGIAVVIVCAQADAEQHCMQLRGNGLLSSVEP-DGGGC  160



>gb|KHG03772.1| ATP-dependent Clp protease adapter ClpS [Gossypium arboreum]
Length=154

 Score =   194 bits (494),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -1

Query  515  PVIEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNI  336
            PVIE+ TPGR+SEFDLRKSRK +PPYRV+LHNDN+NKREYVVQVLMKVIPGMTLD AVNI
Sbjct  52   PVIERTTPGRESEFDLRKSRKIAPPYRVMLHNDNYNKREYVVQVLMKVIPGMTLDNAVNI  111

Query  335  MQEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            MQEAH+NGL+VVIICAQ DAEEHC QLRGNGLLSSIEPASGG
Sbjct  112  MQEAHYNGLAVVIICAQADAEEHCMQLRGNGLLSSIEPASGG  153



>ref|XP_002964066.1| hypothetical protein SELMODRAFT_142341 [Selaginella moellendorffii]
 ref|XP_002975455.1| hypothetical protein SELMODRAFT_150531 [Selaginella moellendorffii]
 gb|EFJ23656.1| hypothetical protein SELMODRAFT_150531 [Selaginella moellendorffii]
 gb|EFJ34399.1| hypothetical protein SELMODRAFT_142341 [Selaginella moellendorffii]
Length=164

 Score =   190 bits (482),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 1/105 (1%)
 Frame = -1

Query  515  PVIEKA-TPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVN  339
            P IE A TPGR+SEFDLRK +K +PPYRV+LHNDNFN+REYVVQVLMKVIPGMTLD AVN
Sbjct  60   PAIETAPTPGRESEFDLRKKKKMAPPYRVILHNDNFNRREYVVQVLMKVIPGMTLDNAVN  119

Query  338  IMQEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            IMQEAHHNGLSVVI+C+Q DAEEHCTQLR NGLLSSIEPASGG C
Sbjct  120  IMQEAHHNGLSVVIVCSQEDAEEHCTQLRANGLLSSIEPASGGSC  164



>ref|XP_002445542.1| hypothetical protein SORBIDRAFT_07g021160 [Sorghum bicolor]
 gb|EES15037.1| hypothetical protein SORBIDRAFT_07g021160 [Sorghum bicolor]
Length=159

 Score =   189 bits (479),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 117/158 (74%), Gaps = 3/158 (2%)
 Frame = -1

Query  674  MATAICCRVSLSANHIF---HPKPGDKSHIQKQWASWNVMAMPIagagkggglldKPVIE  504
            M  A+  RV+LSA       H   GD+S + K       + M ++ A  G G +    +E
Sbjct  1    MEAAVPSRVALSAASRLPNRHAVAGDRSFVYKGRCQSLAIPMALSAAAPGKGGVLDRPVE  60

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            K TPGRQSEFD++KSRK SPPYRV+LHNDN+N+REYVVQVLMKVIPGMT+D AVNIMQEA
Sbjct  61   KTTPGRQSEFDVKKSRKMSPPYRVILHNDNYNRREYVVQVLMKVIPGMTVDNAVNIMQEA  120

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            H NGLSVVI+C+Q +AEEHCT LRGNGL SSIEPASGG
Sbjct  121  HVNGLSVVIVCSQSEAEEHCTSLRGNGLRSSIEPASGG  158



>gb|AFK41715.1| unknown [Lotus japonicus]
Length=158

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 123/157 (78%), Gaps = 2/157 (1%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKP-GDKSHIQKQWASWNV-MAMPIagagkggglldKPVIEK  501
            M  A+C  ++LS + +F+    GDK    K     +V M +   GAGKGGGLL++P IE 
Sbjct  1    MEAALCSSLALSPHQVFNAANHGDKMFAFKYGKDRSVVMTVAATGAGKGGGLLERPTIET  60

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             +PGR+SEFDLRK RKTSPPY VLLHNDN+NKREYV QVLMKVIPGMT+D AVNIMQEAH
Sbjct  61   TSPGRESEFDLRKLRKTSPPYGVLLHNDNYNKREYVGQVLMKVIPGMTVDNAVNIMQEAH  120

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
             NG++VVIICAQVDAE+HC QLRGNGLLSSIEPA GG
Sbjct  121  INGMAVVIICAQVDAEDHCMQLRGNGLLSSIEPADGG  157



>gb|EYU24492.1| hypothetical protein MIMGU_mgv1a012902mg [Erythranthe guttata]
Length=236

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 113/135 (84%), Gaps = 9/135 (7%)
 Frame = -1

Query  608  DKSHIQKQWASWNVMAMPIagagkggglldKPVIEKAT--PGRQSEFDLRKSRKTSPPYR  435
            D+  +  QWA        I G GKGGG+LDKPVIEK    PGR+SEFDLRKSRK SPPYR
Sbjct  108  DRYRVDNQWAI-------IGGVGKGGGVLDKPVIEKTNQNPGRESEFDLRKSRKMSPPYR  160

Query  434  VLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVDAEEHCTQL  255
            V+LHNDNFNKREYVVQVLMKVIPGMT+D AVNIMQEAH NGL+VVIICAQ DAEEHCTQL
Sbjct  161  VMLHNDNFNKREYVVQVLMKVIPGMTVDNAVNIMQEAHINGLAVVIICAQPDAEEHCTQL  220

Query  254  RGNGLLSSIEPASGG  210
            RGNGLLSSIEPASGG
Sbjct  221  RGNGLLSSIEPASGG  235



>ref|XP_004973504.1| PREDICTED: uncharacterized protein LOC101765727 [Setaria italica]
Length=159

 Score =   187 bits (476),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 117/158 (74%), Gaps = 3/158 (2%)
 Frame = -1

Query  674  MATAICCRVSLSANHIF---HPKPGDKSHIQKQWASWNVMAMPIagagkggglldKPVIE  504
            M  A+  RV+LSA   F   H   GD+S I K       + M ++ A  G G +    +E
Sbjct  1    MEAAVPSRVALSAASRFPNRHAVAGDRSTIYKGRCQSLAIPMALSAAAPGKGGVLDRPVE  60

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            K TPGRQSEFD++K RK +PPYRV+LHNDN+N+REYVV+VLMKVIPGMT+D AVNIMQEA
Sbjct  61   KTTPGRQSEFDVKKKRKMTPPYRVILHNDNYNRREYVVKVLMKVIPGMTVDNAVNIMQEA  120

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            H NGLSVVI+C+Q +AEEHCT LRGNGL SSIEPASGG
Sbjct  121  HVNGLSVVIVCSQSEAEEHCTSLRGNGLRSSIEPASGG  158



>ref|XP_006437721.1| hypothetical protein CICLE_v10032968mg [Citrus clementina]
 ref|XP_006437723.1| hypothetical protein CICLE_v10032968mg [Citrus clementina]
 gb|ESR50961.1| hypothetical protein CICLE_v10032968mg [Citrus clementina]
 gb|ESR50963.1| hypothetical protein CICLE_v10032968mg [Citrus clementina]
Length=118

 Score =   186 bits (471),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 94/102 (92%), Gaps = 2/102 (2%)
 Frame = -1

Query  515  PVIEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNI  336
            PVI    PGR+SEFDL+K RKTSPPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNI
Sbjct  18   PVI--TAPGRESEFDLKKKRKTSPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNI  75

Query  335  MQEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            MQEAH+NGLSVVI+C+Q DAEEHC QLRGNGLLSSIEPASGG
Sbjct  76   MQEAHYNGLSVVIVCSQADAEEHCMQLRGNGLLSSIEPASGG  117



>emb|CDX81534.1| BnaC02g18380D [Brassica napus]
Length=139

 Score =   185 bits (469),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 115/136 (85%), Gaps = 2/136 (1%)
 Frame = -1

Query  608  DKSHIQKQ-WASWNVMAMPIagagkggglldKPVIEKATPGRQSEFDLRKSRKTSPPYRV  432
            DK  + K  W +   + M ++  GKGGG+LDKP+IEK TPGR+SEFDLRKS+K +PPYRV
Sbjct  5    DKHSVSKGPWVNNRGVLMTMSAMGKGGGVLDKPIIEKTTPGRESEFDLRKSKKMAPPYRV  64

Query  431  LLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVDAEEHCTQLR  252
            +LHNDNFNKR+YVVQVLMKVIPGMT+D AVNIMQEAH NGL+VVI+CAQ DAE+HC QLR
Sbjct  65   ILHNDNFNKRKYVVQVLMKVIPGMTVDNAVNIMQEAHINGLAVVIVCAQADAEQHCMQLR  124

Query  251  GNGLLSSIEPASGGGC  204
            GNGLLSS+EP  GGGC
Sbjct  125  GNGLLSSVEP-DGGGC  139



>ref|XP_007046288.1| Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein 
ClpS family protein isoform 2 [Theobroma cacao]
 gb|EOY02120.1| Ribosomal protein L12/ ATP-dependent Clp protease adaptor protein 
ClpS family protein isoform 2 [Theobroma cacao]
Length=117

 Score =   184 bits (467),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/102 (85%), Positives = 94/102 (92%), Gaps = 3/102 (3%)
 Frame = -1

Query  515  PVIEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNI  336
            PVIE+ TPGR+SEFD+RK    +PPYRV+LHNDNFNKREYVVQVLMKVIPGMTLD AVNI
Sbjct  18   PVIERTTPGRESEFDVRK---IAPPYRVILHNDNFNKREYVVQVLMKVIPGMTLDNAVNI  74

Query  335  MQEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            MQEAH+NGL+VVIICAQ DAEEHC QLRGNGLLSSIEPASGG
Sbjct  75   MQEAHYNGLAVVIICAQADAEEHCMQLRGNGLLSSIEPASGG  116



>ref|XP_004512946.1| PREDICTED: ATP-dependent Clp protease adapter protein ClpS-like 
[Cicer arietinum]
Length=161

 Score =   185 bits (469),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = -1

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
            ++PGR+SEFDLRKS+KTSPPYRV+LHNDN+NKREYVVQVLMKVIPGMT+D AVNIMQEAH
Sbjct  64   SSPGRESEFDLRKSKKTSPPYRVMLHNDNYNKREYVVQVLMKVIPGMTVDNAVNIMQEAH  123

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            +NGL+VVIICAQVDAE+HC QLRGNGLLSSIEPA GG
Sbjct  124  YNGLAVVIICAQVDAEDHCMQLRGNGLLSSIEPADGG  160



>ref|NP_001150373.1| ATP-dependent Clp protease adaptor protein ClpS containing protein 
[Zea mays]
 gb|ACF84882.1| unknown [Zea mays]
 gb|ACG27182.1| ATP-dependent Clp protease adaptor protein ClpS containing protein 
[Zea mays]
 gb|ACG38841.1| ATP-dependent Clp protease adaptor protein ClpS containing protein 
[Zea mays]
 tpg|DAA49011.1| TPA: ATP-dependent Clp protease adaptor protein ClpS containing 
protein [Zea mays]
Length=160

 Score =   184 bits (468),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 126/160 (79%), Gaps = 6/160 (4%)
 Frame = -1

Query  674  MATAICCRVSLSANHIF---HPKPGDKSHIQK-QWASWNV-MAMPIagagkggglldKPV  510
            M  A+  RV+LSA       H   GD+S I K +  S  + MA+  A  GKGGG+LD+PV
Sbjct  1    MEAAVPSRVALSAASRLPNPHAVTGDRSFIYKGRCQSLAIPMALSAAAPGKGGGVLDRPV  60

Query  509  IEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQ  330
             EK TPGRQSEFD++KSRK SPPYRV+LHNDN+N+REYVV+VLMKVIPGMT+D AVNIMQ
Sbjct  61   -EKTTPGRQSEFDVKKSRKMSPPYRVILHNDNYNRREYVVKVLMKVIPGMTVDNAVNIMQ  119

Query  329  EAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            EAH NGLSVVI+C+Q +AEEHCT LRGNGL SSIEPASGG
Sbjct  120  EAHVNGLSVVIVCSQSEAEEHCTSLRGNGLRSSIEPASGG  159



>ref|XP_006660150.1| PREDICTED: uncharacterized protein LOC102702777 [Oryza brachyantha]
Length=164

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = -1

Query  509  IEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQ  330
            IEK TPGRQSEFD++KSRK SPPYRVLLHNDN+N+REYVVQVLMKVIPGMT+D AVNIMQ
Sbjct  64   IEKVTPGRQSEFDVKKSRKMSPPYRVLLHNDNYNRREYVVQVLMKVIPGMTVDNAVNIMQ  123

Query  329  EAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            EAH NGLSVVIIC+Q++AEEHCT LRGNGL SSIEPASGG
Sbjct  124  EAHVNGLSVVIICSQLEAEEHCTSLRGNGLRSSIEPASGG  163



>ref|NP_001061868.1| Os08g0432500 [Oryza sativa Japonica Group]
 dbj|BAC99353.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD09826.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF23782.1| Os08g0432500 [Oryza sativa Japonica Group]
 gb|EAZ07085.1| hypothetical protein OsI_29332 [Oryza sativa Indica Group]
 dbj|BAG97614.1| unnamed protein product [Oryza sativa Japonica Group]
Length=162

 Score =   182 bits (462),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = -1

Query  509  IEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQ  330
            IEK TPGRQSEFD+RKSRK +PPYRVLLHNDN+N+REYVVQVLMKVIPGMT+D AVNIMQ
Sbjct  62   IEKVTPGRQSEFDVRKSRKMTPPYRVLLHNDNYNRREYVVQVLMKVIPGMTVDNAVNIMQ  121

Query  329  EAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            EAH NGLSVVIIC+Q +AEEHCT LRGNGL SSIEPASGG
Sbjct  122  EAHVNGLSVVIICSQSEAEEHCTSLRGNGLRSSIEPASGG  161



>gb|EAZ42831.1| hypothetical protein OsJ_27419 [Oryza sativa Japonica Group]
Length=160

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = -1

Query  509  IEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQ  330
            IEK TPGRQSEFD+RKSRK +PPYRVLLHNDN+N+REYVVQVLMKVIPGMT+D AVNIMQ
Sbjct  60   IEKVTPGRQSEFDVRKSRKMTPPYRVLLHNDNYNRREYVVQVLMKVIPGMTVDNAVNIMQ  119

Query  329  EAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            EAH NGLSVVIIC+Q +AEEHCT LRGNGL SSIEPASGG
Sbjct  120  EAHVNGLSVVIICSQSEAEEHCTSLRGNGLRSSIEPASGG  159



>gb|ACN25974.1| unknown [Zea mays]
Length=119

 Score =   179 bits (454),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/100 (82%), Positives = 93/100 (93%), Gaps = 0/100 (0%)
 Frame = -1

Query  509  IEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQ  330
            +EK TPGRQSEFD++KSRK SPPYRV+LHNDN+N+REYVV+VLMKVIPGMT+D AVNIMQ
Sbjct  19   VEKTTPGRQSEFDVKKSRKMSPPYRVILHNDNYNRREYVVKVLMKVIPGMTVDNAVNIMQ  78

Query  329  EAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            EAH NGLSVVI+C+Q +AEEHCT LRGNGL SSIEPASGG
Sbjct  79   EAHVNGLSVVIVCSQSEAEEHCTSLRGNGLRSSIEPASGG  118



>ref|NP_001148322.1| ATP-dependent Clp protease adaptor protein ClpS containing protein 
[Zea mays]
 gb|ACF84700.1| unknown [Zea mays]
 gb|ACG30624.1| ATP-dependent Clp protease adaptor protein ClpS containing protein 
[Zea mays]
 gb|AFW62263.1| ATP-dependent Clp protease adaptor protein ClpS containing protein 
[Zea mays]
Length=160

 Score =   179 bits (453),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 126/160 (79%), Gaps = 6/160 (4%)
 Frame = -1

Query  674  MATAICCRVSLSANHIF---HPKPGDKSHIQKQ-WASWNV-MAMPIagagkggglldKPV  510
            M  ++  RV+LSA       H   GD+S I K+   S ++ MA+  A  GKGGG+LD+PV
Sbjct  1    MMASVPSRVALSAASRLPNLHAVAGDRSFIYKRRCPSLSIPMALSAAAPGKGGGVLDRPV  60

Query  509  IEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQ  330
             EK TPGRQSEFD++KSRK +PP+RV+LHNDN N+REYVVQVLMKVIPGMT+D A+NIMQ
Sbjct  61   -EKITPGRQSEFDVKKSRKMTPPFRVILHNDNHNRREYVVQVLMKVIPGMTVDNALNIMQ  119

Query  329  EAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            EAH NGLSVVI+C+Q +AEEHCT LRGNGL SSIEPASGG
Sbjct  120  EAHVNGLSVVIVCSQSEAEEHCTSLRGNGLRSSIEPASGG  159



>gb|ACG45478.1| ATP-dependent Clp protease adaptor protein ClpS containing protein 
[Zea mays]
Length=160

 Score =   177 bits (449),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 126/160 (79%), Gaps = 6/160 (4%)
 Frame = -1

Query  674  MATAICCRVSLSANHIF---HPKPGDKSHIQKQ-WASWNV-MAMPIagagkggglldKPV  510
            M  ++  RV+LSA       H   GD+S I K+   S ++ MA+  A  GKGGG+LD+PV
Sbjct  1    MMASVPSRVALSAASRLPNLHAVAGDRSFIYKRRCPSLSIPMALSAAAPGKGGGVLDRPV  60

Query  509  IEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQ  330
             EK TPGRQSEFD++KSRK +PP+RV+LHNDN N+REYVVQVLMKVIPGMT+D A++IMQ
Sbjct  61   -EKITPGRQSEFDVKKSRKMTPPFRVILHNDNHNRREYVVQVLMKVIPGMTVDNALSIMQ  119

Query  329  EAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            EAH NGLSVVI+C+Q +AEEHCT LRGNGL SSIEPASGG
Sbjct  120  EAHVNGLSVVIVCSQSEAEEHCTSLRGNGLRSSIEPASGG  159



>ref|XP_010235149.1| PREDICTED: uncharacterized protein LOC100827598 isoform X2 [Brachypodium 
distachyon]
Length=156

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 117/160 (73%), Gaps = 10/160 (6%)
 Frame = -1

Query  674  MATAICCRVSLSA---NHIFHPKPGDKSHIQKQWASWNVMAMPIagagkggglldK--PV  510
            M  A+  R++LSA   NH  H   G +S I +    +  +A+PI     G G      P 
Sbjct  1    MEAAVPSRIALSARIMNH--HVVAGGRSSIYR--GRYPNIAIPIVVTAAGKGGGVLDRPA  56

Query  509  IEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQ  330
             EK +PGRQSEFD++KSRK SPPYRV+LHNDN N+REYVVQVLMKVIPGMT+D AVNIMQ
Sbjct  57   -EKISPGRQSEFDVKKSRKMSPPYRVVLHNDNENRREYVVQVLMKVIPGMTVDNAVNIMQ  115

Query  329  EAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            EAH NGL+VVI+C+Q +AEEHCT LRGNGL SSIEPASGG
Sbjct  116  EAHVNGLAVVIVCSQSEAEEHCTSLRGNGLRSSIEPASGG  155



>ref|XP_003574520.1| PREDICTED: uncharacterized protein LOC100827598 isoform X1 [Brachypodium 
distachyon]
Length=157

 Score =   175 bits (444),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 116/159 (73%), Gaps = 7/159 (4%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFH--PKPGDKSHIQKQWASWNVMAMPIagagkggglldK--PVI  507
            M  A+  R++LSA  + H     G +S I +    +  +A+PI     G G      P  
Sbjct  1    MEAAVPSRIALSARIMNHHVVAAGGRSSIYR--GRYPNIAIPIVVTAAGKGGGVLDRPA-  57

Query  506  EKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQE  327
            EK +PGRQSEFD++KSRK SPPYRV+LHNDN N+REYVVQVLMKVIPGMT+D AVNIMQE
Sbjct  58   EKISPGRQSEFDVKKSRKMSPPYRVVLHNDNENRREYVVQVLMKVIPGMTVDNAVNIMQE  117

Query  326  AHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            AH NGL+VVI+C+Q +AEEHCT LRGNGL SSIEPASGG
Sbjct  118  AHVNGLAVVIVCSQSEAEEHCTSLRGNGLRSSIEPASGG  156



>gb|ACN28518.1| unknown [Zea mays]
Length=119

 Score =   174 bits (441),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = -1

Query  509  IEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQ  330
            +EK TPGRQSEFD++KSRK +PP+RV+LHNDN N+REYVVQVLMKVIPGMT+D A+NIMQ
Sbjct  19   VEKITPGRQSEFDVKKSRKMTPPFRVILHNDNHNRREYVVQVLMKVIPGMTVDNALNIMQ  78

Query  329  EAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            EAH NGLSVVI+C+Q +AEEHCT LRGNGL SSIEPASGG
Sbjct  79   EAHVNGLSVVIVCSQSEAEEHCTSLRGNGLRSSIEPASGG  118



>emb|CAK19331.1| putative adaptor protein ClpS [Physcomitrella patens]
Length=155

 Score =   171 bits (434),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 89/100 (89%), Gaps = 0/100 (0%)
 Frame = -1

Query  515  PVIEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNI  336
            P I+K TPGR+SEFDL+K +K SPPYRV+LHNDNFNKREYVVQVLMK IPGMT+DIAVN+
Sbjct  55   PTIDKPTPGRESEFDLKKKKKISPPYRVMLHNDNFNKREYVVQVLMKAIPGMTVDIAVNV  114

Query  335  MQEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPAS  216
            M EAH NGL+VVI+C Q DAE++C QLR NGLLSSIEPAS
Sbjct  115  MNEAHINGLAVVIVCPQEDAEDYCMQLRTNGLLSSIEPAS  154



>ref|XP_001758483.1| predicted protein [Physcomitrella patens]
 gb|EDQ76885.1| predicted protein [Physcomitrella patens]
Length=106

 Score =   168 bits (425),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  515  PVIEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNI  336
            P I+K TPGR+SEFDL+K +K SPPYRV+LHNDNFNKREYVVQVLMK IPGMT+DIAVN+
Sbjct  9    PTIDKPTPGRESEFDLKKKKKMSPPYRVMLHNDNFNKREYVVQVLMKAIPGMTVDIAVNV  68

Query  335  MQEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
            M EAH NGL+VVI+C Q DAE++C QLR NGLLSSIEP
Sbjct  69   MNEAHINGLAVVIVCPQEDAEDYCMQLRTNGLLSSIEP  106



>gb|EMS49025.1| ATP-dependent Clp protease adapter protein ClpS [Triticum urartu]
Length=162

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = -1

Query  506  EKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQE  327
            EK +PGRQSEFD +KSRK SPP+RV+LHNDN N+REYVVQVLMKVIPGMT+D AVNIMQE
Sbjct  63   EKVSPGRQSEFDKKKSRKMSPPFRVVLHNDNENRREYVVQVLMKVIPGMTVDNAVNIMQE  122

Query  326  AHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            AH NG++VVI+C+Q +AEEHCT LRGNGL SSIEPASGG
Sbjct  123  AHVNGMAVVIVCSQPEAEEHCTALRGNGLRSSIEPASGG  161



>gb|EMT14943.1| ATP-dependent Clp protease adapter protein clpS [Aegilops tauschii]
Length=162

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 90/99 (91%), Gaps = 0/99 (0%)
 Frame = -1

Query  506  EKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQE  327
            EK +PGRQSEFD +KSRK SPP+RV+LHNDN N+REYVVQVLMKVIPGMT+D AVNIMQE
Sbjct  63   EKVSPGRQSEFDKKKSRKMSPPFRVVLHNDNENRREYVVQVLMKVIPGMTVDNAVNIMQE  122

Query  326  AHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            AH NG++VVI+C+Q +AEEHCT LRGNGL SSIEPASGG
Sbjct  123  AHVNGMAVVIVCSQPEAEEHCTALRGNGLRSSIEPASGG  161



>ref|XP_001759963.1| predicted protein [Physcomitrella patens]
 gb|EDQ75088.1| predicted protein [Physcomitrella patens]
Length=112

 Score =   166 bits (420),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -1

Query  515  PVIEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNI  336
            P I+K TPGR+SEFDL+K +K SPPYRV+LHNDNFNKREYVVQVL+K IPGMT+DIAVN+
Sbjct  14   PTIDKPTPGRESEFDLKKKKKMSPPYRVMLHNDNFNKREYVVQVLLKAIPGMTVDIAVNV  73

Query  335  MQEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
            M EAH NG++VVI+C Q DAE++C QLR NGLLSSIEP
Sbjct  74   MNEAHINGIAVVIVCPQEDAEDYCMQLRTNGLLSSIEP  111



>ref|XP_008813528.1| PREDICTED: uncharacterized protein LOC103724139 [Phoenix dactylifera]
Length=135

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 83/86 (97%), Gaps = 0/86 (0%)
 Frame = -1

Query  467  RKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICA  288
            RKSRKT+PPYRV+LHNDN+NKREYVVQVLMKVIPGMTLD AVNIMQEAH+NGL+VVIIC+
Sbjct  49   RKSRKTAPPYRVILHNDNYNKREYVVQVLMKVIPGMTLDNAVNIMQEAHYNGLAVVIICS  108

Query  287  QVDAEEHCTQLRGNGLLSSIEPASGG  210
            Q DAEEHC QLRGNGLLSSIEPASGG
Sbjct  109  QADAEEHCMQLRGNGLLSSIEPASGG  134



>ref|XP_011097008.1| PREDICTED: uncharacterized protein LOC105176031 isoform X2 [Sesamum 
indicum]
Length=139

 Score =   163 bits (413),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 110/157 (70%), Gaps = 21/157 (13%)
 Frame = -1

Query  674  MATAICC-RVSLSANHIFHPKPGDKSHIQKQWASWN-VMAMPIagagkggglldKPVIEK  501
            M T I C RV+LS N I HP  GD+  + KQWA+ + +M MPIAG GKGG L   P+IEK
Sbjct  1    METVISCGRVALSPNQICHPTSGDRYPLHKQWANRSTLMIMPIAGQGKGGVLDK-PIIEK  59

Query  500  ATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
             TPGR+SEFDLR   +                   V QVLMKVIPGMTLD AVNIMQEAH
Sbjct  60   TTPGRESEFDLRYGYQN------------------VNQVLMKVIPGMTLDNAVNIMQEAH  101

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
            +NGLSVVIICAQ DAEEHC QLRGNGLLSSIEPASGG
Sbjct  102  YNGLSVVIICAQADAEEHCMQLRGNGLLSSIEPASGG  138



>emb|CBI27053.3| unnamed protein product [Vitis vinifera]
Length=127

 Score =   146 bits (368),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 100/156 (64%), Gaps = 31/156 (20%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagag-kggglldKPVIEKA  498
            M  AIC R++LS NH+F+ K GDK  + K   +     M I+ +G   GGLL++PVIEK 
Sbjct  1    MENAICGRLALSPNHVFNSKSGDKHSLLKGPCTNRSFLMAISASGPGKGGLLERPVIEKV  60

Query  497  TPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHH  318
            TPGR+SEFDLRKSRK +PPYRV+LHNDN+NKREYVVQVLMK                   
Sbjct  61   TPGRESEFDLRKSRKIAPPYRVILHNDNYNKREYVVQVLMK-------------------  101

Query  317  NGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGG  210
                        DAE+HC QLRGNGLLSSIEPASGG
Sbjct  102  -----------ADAEDHCMQLRGNGLLSSIEPASGG  126



>ref|NP_001077794.1| protein ClpS1 [Arabidopsis thaliana]
 gb|AEE34825.1| ribosomal protein L12/ ATP-dependent Clp protease adaptor protein 
ClpS family protein [Arabidopsis thaliana]
Length=129

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 98/160 (61%), Gaps = 34/160 (21%)
 Frame = -1

Query  674  MATAICCRVSLSANHIFHPKPGDKSHIQKQWASWNVMAMPIagagkggg---lldKPVIE  504
            M TAIC R++L+ + +F+ K GDK  + K       + M ++ +   G    +LDKP+IE
Sbjct  1    METAICGRLALAPSSLFNSKSGDKHLVSKGPCVNRSILMTLSTSAALGKGGGVLDKPIIE  60

Query  503  KATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            K TPGR+SEFDLRKS+K +PPYRV+LHNDNFNKREYVVQVLMK                 
Sbjct  61   KTTPGRESEFDLRKSKKIAPPYRVILHNDNFNKREYVVQVLMK-----------------  103

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
                          DAE+HC QLRGNGLLSS+EP  GGGC
Sbjct  104  -------------ADAEQHCMQLRGNGLLSSVEP-DGGGC  129



>gb|KFM27933.1| ATP-dependent Clp protease adapter protein ClpS, partial [Auxenochlorella 
protothecoides]
Length=92

 Score =   120 bits (302),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = -1

Query  464  KSRKTSPP-YRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICA  288
            KS+   PP YRVLLHNDN N+R+YVV+VLM+VI G T++ AVN+MQEAH NGL++V  CA
Sbjct  3    KSKGKQPPIYRVLLHNDNVNRRDYVVKVLMRVIDGYTMEDAVNVMQEAHMNGLALVTACA  62

Query  287  QVDAEEHCTQLRGNGLLSSIEPASGGG  207
            Q  AEE+C QLRG GL++S+EP  GGG
Sbjct  63   QETAEEYCEQLRGAGLIASLEPDGGGG  89



>ref|XP_005846196.1| hypothetical protein CHLNCDRAFT_31972 [Chlorella variabilis]
 gb|EFN54094.1| hypothetical protein CHLNCDRAFT_31972 [Chlorella variabilis]
Length=166

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -1

Query  446  PPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVDAEEH  267
            P YRVLLHNDN+N+REYVVQVLMKV+ G T+D AVNIMQEAH NGL++V  CAQ  AE +
Sbjct  80   PSYRVLLHNDNYNRREYVVQVLMKVVEGTTVDDAVNIMQEAHINGLAMVTQCAQDKAELY  139

Query  266  CTQLRGNGLLSSIEPASGGG  207
            C  LR NGL+++IEPA  GG
Sbjct  140  CESLRLNGLIATIEPAGTGG  159



>ref|WP_035996409.1| Clp protease ClpS [Leptolyngbya sp. JSC-1]
Length=93

 Score =   104 bits (260),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND+FN  EYVVQVLMK +P +T+  AVNIM EAH NG+++VI CAQ 
Sbjct  12   ARKLAPRYRVLLHNDDFNSMEYVVQVLMKTVPSLTIPQAVNIMMEAHTNGIALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ + L S+IEP
Sbjct  72   HAEFYCETLKNHSLTSTIEP  91



>ref|WP_011610869.1| ATP-dependent Clp protease ClpS [Trichodesmium erythraeum]
 ref|YP_720956.1| ATP-dependent Clp protease adaptor protein ClpS [Trichodesmium 
erythraeum IMS101]
 gb|ABG50483.1| ATP-dependent Clp protease adaptor protein ClpS [Trichodesmium 
erythraeum IMS101]
Length=95

 Score =   104 bits (260),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RKT+P YRVLLHND+FN  EYVVQ LMK +P +T   AVNIM EAH NG+++VIICA   
Sbjct  15   RKTAPHYRVLLHNDDFNSMEYVVQTLMKTVPSLTQPQAVNIMMEAHSNGIALVIICALEP  74

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL S+IEP
Sbjct  75   AEFYCENLKNHGLTSTIEP  93



>ref|WP_036532992.1| Clp protease ClpS [Neosynechococcus sphagnicola]
 gb|KGF72750.1| Clp protease ClpS [Neosynechococcus sphagnicola sy1]
Length=93

 Score =   103 bits (256),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND++N  EYVVQVL+  IP ++   AVNIM EAH NGL+VVIICAQ  
Sbjct  13   RKIAPRYRVLLHNDDYNSMEYVVQVLITTIPNLSEPQAVNIMMEAHTNGLAVVIICAQEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  LR +GL S+IEP
Sbjct  73   AEFYCETLRSHGLSSTIEP  91



>ref|WP_013190159.1| ATP-dependent Clp protease ClpS [Trichormus azollae]
 ref|YP_003720264.1| ATP-dependent Clp protease adaptor protein ClpS ['Nostoc azollae' 
0708]
 gb|ADI63141.1| ATP-dependent Clp protease adaptor protein ClpS ['Nostoc azollae' 
0708]
Length=92

 Score =   103 bits (256),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND++N  EYVVQVLM  +P +T   AVNIM EAH++GL++VI CAQ 
Sbjct  12   TRKLAPQYRVLLHNDDYNSMEYVVQVLMTSVPSITQPQAVNIMMEAHNSGLALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+G+GL S+IEP
Sbjct  72   HAEFYCETLKGHGLSSTIEP  91



>ref|WP_015214561.1| ATP-dependent Clp protease adapter protein clpS [Anabaena cylindrica]
 ref|YP_007156835.1| ATP-dependent Clp protease adapter protein clpS [Anabaena cylindrica 
PCC 7122]
 gb|AFZ57925.1| ATP-dependent Clp protease adapter protein clpS [Anabaena cylindrica 
PCC 7122]
Length=93

 Score =   102 bits (253),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND++N  EYVVQVLM  +P +T   AV+IM EAH NGL++VI CAQ 
Sbjct  12   SRKLAPQYRVLLHNDDYNSMEYVVQVLMTTVPSITQPQAVSIMMEAHSNGLALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   PAEFYCETLKSHGLSSTIEP  91



>ref|WP_007634189.1| ATP-dependent Clp protease adaptor protein ClpS [Geitlerinema 
sp. PCC 7105]
 gb|EDL71122.1| ATP-dependent Clp protease adaptor protein ClpS [Leptolyngbya 
valderiana BDU 20041]
Length=93

 Score =   102 bits (253),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQ L+K +PG+T   AV+IM EAH NG+++VI CAQ  
Sbjct  13   RKHAPRYRVLLHNDDFNTMEYVVQTLVKTVPGLTQPQAVSIMMEAHTNGMALVITCAQEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  LR +GL SSIEP
Sbjct  73   AEFYCETLRRHGLSSSIEP  91



>ref|WP_009456056.1| MULTISPECIES: ATP-dependent Clp protease ClpS [Fischerella]
 gb|EHC16087.1| ATP-dependent Clp protease adapter protein clpS [Fischerella 
sp. JSC-11]
Length=93

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND++N  EYVVQVL+  +P +T   AV+IM EAH NGL++VI CAQ 
Sbjct  12   SRKLAPQYRVLLHNDDYNTMEYVVQVLLTTVPSLTQPQAVSIMMEAHSNGLALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   PAEFYCETLKNHGLTSTIEP  91



>ref|WP_016860893.1| MULTISPECIES: ATP-dependent Clp protease ClpS [Fischerella]
Length=93

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND++N  EYVVQVL+  +P +T   AV+IM EAH NG+++VI CAQ 
Sbjct  12   SRKLAPQYRVLLHNDDYNTMEYVVQVLLTTVPSLTQPQAVSIMMEAHSNGIALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL+S+IEP
Sbjct  72   PAEFYCETLKNHGLISTIEP  91



>ref|WP_036617496.1| Clp protease ClpS [Oscillatoriales cyanobacterium JSC-12]
Length=93

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQVLM  +P +T   AV+IM EAH NGL++VI CAQ  
Sbjct  13   RKLAPRYRVLLHNDDFNPMEYVVQVLMSTVPSLTQPQAVDIMMEAHTNGLALVITCAQEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL S+IEP
Sbjct  73   AEFYCETLKNHGLTSTIEP  91



>gb|EKQ67824.1| hypothetical protein OsccyDRAFT_4115 [Oscillatoriales cyanobacterium 
JSC-12]
Length=94

 Score =   101 bits (252),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQVLM  +P +T   AV+IM EAH NGL++VI CAQ  
Sbjct  14   RKLAPRYRVLLHNDDFNPMEYVVQVLMSTVPSLTQPQAVDIMMEAHTNGLALVITCAQEH  73

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL S+IEP
Sbjct  74   AEFYCETLKNHGLTSTIEP  92



>ref|WP_007357540.1| MULTISPECIES: ATP-dependent Clp protease ClpS [Kamptonema]
 emb|CBN58362.1| ATP-dependent Clp protease adaptor protein ClpS [ [[Oscillatoria] 
sp. PCC 6506]
Length=93

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQ LM  +P +T   AVNIM EAH NGL+VVIICAQ  
Sbjct  13   RKIAPRYRVLLHNDDFNSMEYVVQTLMHTVPSLTQPQAVNIMMEAHTNGLAVVIICAQEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +   L  +GL+S+IEP
Sbjct  73   AEFYSETLNNHGLISTIEP  91



>ref|WP_013321113.1| ATP-dependent Clp protease ClpS [Cyanothece sp. PCC 7822]
 ref|YP_003886280.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. 
PCC 7822]
 gb|ADN13005.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. 
PCC 7822]
Length=99

 Score =   101 bits (251),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQ LMK + GMT   AVNIM EAH NG+++VI C    
Sbjct  19   RKPAPRYRVLLHNDDFNSMEYVVQTLMKTVAGMTQPQAVNIMMEAHTNGMALVITCTLEH  78

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL S+IEP
Sbjct  79   AEFYCETLKAHGLTSTIEP  97



>ref|XP_005650531.1| ClpS-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25987.1| ClpS-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=169

 Score =   102 bits (255),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = -1

Query  512  VIEKATPGRQSEFDLRKSRKTSPP--YRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVN  339
            V+++ T      FDL K+     P  YRV+LHND+FN+REYVV+VL+KV+   T++ A+N
Sbjct  55   VLDRPTTIGLPGFDLGKATTRQRPRFYRVMLHNDDFNRREYVVKVLLKVLDNFTMEDAIN  114

Query  338  IMQEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIE  225
             MQEAH NG++ ++ C Q DAE++C  LR NGL+S+IE
Sbjct  115  CMQEAHTNGVACLVSCPQEDAEKYCEGLRTNGLISTIE  152



>ref|WP_015187925.1| ATP-dependent Clp protease adapter protein clpS [Gloeocapsa sp. 
PCC 7428]
 ref|YP_007127210.1| ATP-dependent Clp protease adapter protein clpS [Gloeocapsa sp. 
PCC 7428]
 gb|AFZ30050.1| ATP-dependent Clp protease adapter protein clpS [Gloeocapsa sp. 
PCC 7428]
Length=93

 Score =   100 bits (248),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND++N  EYVVQVLM+ +P +T   AV+IM EAH NG+++VI CAQ 
Sbjct  12   NRKLAPRYRVLLHNDDYNSMEYVVQVLMQTVPSITQPQAVSIMMEAHTNGMALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKNHGLTSTIEP  91



>ref|WP_026731479.1| Clp protease ClpS [Fischerella sp. PCC 9605]
Length=93

 Score =   100 bits (248),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND++N  EYVVQVL+  +P +T   AV+IM EAH NG+++VI CAQ 
Sbjct  12   SRKLAPQYRVLLHNDDYNAMEYVVQVLLTTVPSLTQPQAVSIMMEAHTNGIALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKKHGLTSTIEP  91



>ref|WP_017304153.1| ATP-dependent Clp protease ClpS [Spirulina subsalsa]
Length=99

 Score =   100 bits (248),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 66/97 (68%), Gaps = 4/97 (4%)
 Frame = -1

Query  512  VIEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIM  333
            VI+K + G +S      +RK +P YRVLLHND+FN  EYVVQ LM  + G+T   AV+IM
Sbjct  5    VIDKPSLGEKS----STARKHAPRYRVLLHNDDFNSMEYVVQTLMSTVAGLTQPQAVSIM  60

Query  332  QEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
             EAH NGL++VI CA   AE +C  L+ +GL S+IEP
Sbjct  61   MEAHTNGLALVITCALEHAEFYCETLKNHGLTSTIEP  97



>ref|WP_017311583.1| ATP-dependent Clp protease ClpS [Fischerella sp. PCC 9339]
Length=93

 Score =   100 bits (248),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND++N  EYVVQVL+  +P +T   AV+IM EAH +G+++VI CAQ 
Sbjct  12   SRKLAPQYRVLLHNDDYNTMEYVVQVLLTTVPSLTQPQAVSIMMEAHSSGIALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL+S+IEP
Sbjct  72   PAEFYCETLKNHGLISTIEP  91



>ref|WP_015143326.1| hypothetical protein [Pleurocapsa minor]
 ref|YP_007080578.1| hypothetical protein Ple7327_1658 [Pleurocapsa sp. PCC 7327]
 gb|AFY77021.1| hypothetical protein Ple7327_1658 [Pleurocapsa sp. PCC 7327]
Length=95

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQ LMK + GMT   AVNIM EAH NG+++VI CA   
Sbjct  15   RKPAPRYRVLLHNDDFNTMEYVVQTLMKTVAGMTQPQAVNIMMEAHTNGVALVITCALEP  74

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL S+IEP
Sbjct  75   AEFYCETLKNHGLSSTIEP  93



>ref|WP_015140415.1| hypothetical protein [Nostoc sp. PCC 7524]
 ref|YP_007077599.1| hypothetical protein Nos7524_4241 [Nostoc sp. PCC 7524]
 gb|AFY50002.1| hypothetical protein Nos7524_4241 [Nostoc sp. PCC 7524]
Length=93

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND++N  EYVVQVL+  +P +T   AV+IM EAH NGL++VI CAQ 
Sbjct  12   TRKLAPRYRVLLHNDDYNSMEYVVQVLLTTVPSLTQPQAVSIMMEAHTNGLALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKSHGLSSTIEP  91



>ref|WP_008054756.1| MULTISPECIES: ATP-dependent Clp protease ClpS [Arthrospira]
 emb|CCE19020.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrospira 
sp. PCC 8005]
Length=93

 Score = 99.8 bits (247),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND++N  EYVVQVLM  +PG+T   AV+IM EAH NGL++VI CA  
Sbjct  12   NRKLAPRYRVLLHNDDYNPMEYVVQVLMSTVPGLTQPQAVSIMMEAHTNGLALVITCALE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKNHGLTSTIEP  91



>ref|WP_011318115.1| ATP-dependent Clp protease ClpS [Anabaena variabilis]
 ref|YP_321794.1| ATP-dependent Clp protease adaptor protein ClpS [Anabaena variabilis 
ATCC 29413]
 gb|ABA20899.1| ATP-dependent Clp protease adaptor protein ClpS [Anabaena variabilis 
ATCC 29413]
Length=93

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND++N  EYVVQVL+  +P +T   AV+IM EAH NGL++VI CAQ 
Sbjct  12   SRKLAPRYRVLLHNDDYNSMEYVVQVLITTVPSLTQPQAVSIMMEAHTNGLALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKDHGLSSTIEP  91



>ref|WP_039729975.1| Clp protease ClpS [Lyngbya confervoides]
 gb|KIF16880.1| Clp protease ClpS [Aphanocapsa montana BDHKU210001]
 gb|KIF41890.1| Clp protease ClpS [Lyngbya confervoides BDU141951]
Length=95

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVV+ LMKV+P +++  AVN+M +AH + + VVI+CAQ  
Sbjct  15   RKPAPRYRVLLHNDDFNSMEYVVESLMKVVPSLSMPQAVNVMMQAHVSEVGVVIVCAQEH  74

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+G GL SSIEP
Sbjct  75   AEFYCEGLKGKGLTSSIEP  93



>ref|WP_012599020.1| ATP-dependent Clp protease ClpS [Cyanothece sp. PCC 7424]
 ref|YP_002376944.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. 
PCC 7424]
 gb|ACK70076.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. 
PCC 7424]
Length=97

 Score = 99.8 bits (247),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 62/97 (64%), Gaps = 8/97 (8%)
 Frame = -1

Query  512  VIEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIM  333
            VIEK+T            RK +P YRVLLHND+FN  EYVVQ LMK + GMT   AVNIM
Sbjct  7    VIEKSTTS--------TVRKPAPRYRVLLHNDDFNSMEYVVQTLMKTVAGMTQPQAVNIM  58

Query  332  QEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
             EAH NG ++VI C    AE +C  L+ +GL S+IEP
Sbjct  59   MEAHTNGTALVITCTLEHAEFYCETLKNHGLTSTIEP  95



>ref|WP_017718076.1| ATP-dependent Clp protease ClpS [Oscillatoria sp. PCC 10802]
Length=93

 Score = 99.8 bits (247),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVV+ LMK +PG+T   AV+IM EAH NG+++VI CA   
Sbjct  13   RKLAPRYRVLLHNDDFNSMEYVVKTLMKTVPGLTQPQAVSIMMEAHTNGMALVITCALEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL S+IEP
Sbjct  73   AEFYCETLKNHGLTSTIEP  91



>ref|WP_017315338.1| ATP-dependent Clp protease ClpS [Mastigocladopsis repens]
Length=93

 Score = 99.4 bits (246),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND +N  EYVVQVL+  +P +T   AV+IM EAH NGL++VI CAQ 
Sbjct  12   SRKLAPRYRVLLHNDEYNPMEYVVQVLLTTVPNLTQPQAVSIMMEAHTNGLALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKNHGLTSTIEP  91



>gb|KEI67472.1| ClpS [Planktothrix agardhii NIVA-CYA 126/8]
Length=93

 Score = 99.4 bits (246),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND++N  EYVVQVLM  +P +T   AV+IM EAH N L++VI CAQ  
Sbjct  13   RKIAPRYRVLLHNDDYNSMEYVVQVLMTTVPSLTQPQAVSIMMEAHTNNLALVITCAQEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL+S+IEP
Sbjct  73   AEFYCETLKNHGLISTIEP  91



>ref|WP_026788081.1| MULTISPECIES: Clp protease ClpS [Planktothrix]
Length=93

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND++N  EYVVQVLM  +P +T   AV+IM EAH N L++VI CAQ  
Sbjct  13   RKIAPRYRVLLHNDDYNSMEYVVQVLMTTVPSLTQPQAVSIMMEAHTNNLALVITCAQEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL+S+IEP
Sbjct  73   AEFYCETLKTHGLISTIEP  91



>ref|WP_016922614.1| ATP-dependent Clp protease ClpS [Prochlorothrix hollandica]
Length=93

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  E+VVQ LM+ +P +T   AVNIM EAH NGL++VI CA   
Sbjct  13   RKLAPRYRVLLHNDDFNPMEHVVQSLMQTVPSLTQPQAVNIMMEAHTNGLALVITCALEP  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+G+GL SSIEP
Sbjct  73   AEFYCETLKGHGLSSSIEP  91



>ref|WP_002738526.1| MULTISPECIES: ATP-dependent Clp protease ClpS [Microcystis]
 emb|CAO90801.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 emb|CCH94362.1| ATP-dependent Clp protease adapter protein ClpS [Microcystis 
aeruginosa PCC 9432]
 emb|CCH97504.1| ATP-dependent Clp protease adapter protein ClpS [Microcystis 
aeruginosa PCC 9717]
 emb|CCI03866.1| ATP-dependent Clp protease adapter protein ClpS [Microcystis 
aeruginosa PCC 9443]
 emb|CCI08500.1| ATP-dependent Clp protease adapter protein ClpS [Microcystis 
aeruginosa PCC 7941]
 emb|CCI14776.1| ATP-dependent Clp protease adapter protein ClpS [Microcystis 
aeruginosa PCC 9806]
 emb|CCI16908.1| ATP-dependent Clp protease adapter protein ClpS [Microcystis 
aeruginosa PCC 9807]
 emb|CCI22954.1| ATP-dependent Clp protease adapter protein ClpS [Microcystis 
aeruginosa PCC 9808]
 emb|CCI22374.1| ATP-dependent Clp protease adapter protein ClpS [Microcystis 
aeruginosa PCC 9809]
 emb|CCI30355.1| ATP-dependent Clp protease adapter protein ClpS [Microcystis 
sp. T1-4]
 emb|CCI35645.1| ATP-dependent Clp protease adapter protein ClpS [Microcystis 
aeruginosa PCC 9701]
 gb|ELP52639.1| ATP-dependent Clp protease adaptor ClpS family protein [Microcystis 
aeruginosa TAIHU98]
 gb|ELS45138.1| ATP-dependent Clp protease adaptor ClpS family protein [Microcystis 
aeruginosa DIANCHI905]
 gb|EPF24047.1| ATP-dependent Clp protease adaptor protein ClpS [Microcystis 
aeruginosa SPC777]
 dbj|GAL92703.1| ATP-dependent Clp protease adaptor protein ClpS [Microcystis 
aeruginosa NIES-44]
Length=95

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQ LM+ I GMT   AV+IM EAH NG ++VI C Q  
Sbjct  15   RKPAPRYRVLLHNDDFNSMEYVVQSLMQTIAGMTQPQAVDIMMEAHTNGTALVITCIQEH  74

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+  GL SSIEP
Sbjct  75   AEFYCETLKNKGLTSSIEP  93



>ref|WP_026104086.1| Clp protease ClpS [Anabaena sp. PCC 7108]
Length=93

 Score = 98.6 bits (244),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND++N  EYVVQVLM  +P +T   AV+IM EAH NGL++VI CA  
Sbjct  12   SRKLAPRYRVLLHNDDYNPMEYVVQVLMTTVPSITQPQAVSIMMEAHQNGLALVITCALE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKSHGLSSTIEP  91



>ref|WP_015156315.1| ATP-dependent Clp protease adaptor protein ClpS [Chroococcidiopsis 
thermalis]
 ref|YP_007093644.1| ATP-dependent Clp protease adaptor protein ClpS [Chroococcidiopsis 
thermalis PCC 7203]
 gb|AFY89775.1| ATP-dependent Clp protease adaptor protein ClpS [Chroococcidiopsis 
thermalis PCC 7203]
 gb|KIF21646.1| Clp protease ClpS [Scytonema millei VB511283]
Length=93

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  E+VVQVLM+ +P +T   AV+IM EAH NG+++VI CAQ  
Sbjct  13   RKLAPRYRVLLHNDDFNPMEHVVQVLMQTVPSLTQPQAVDIMMEAHTNGIALVITCAQEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL S+IEP
Sbjct  73   AEFYCETLKNHGLTSTIEP  91



>ref|WP_012267626.1| ATP-dependent Clp protease ClpS [Microcystis aeruginosa]
 ref|YP_001660259.1| ATP-dependent Clp protease adaptor protein ClpS [Microcystis 
aeruginosa NIES-843]
 dbj|BAG05067.1| ATP-dependent Clp protease adaptor protein [Microcystis aeruginosa 
NIES-843]
Length=91

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQ LM+ I GMT   AV+IM EAH NG ++VI C Q  
Sbjct  11   RKPAPRYRVLLHNDDFNSMEYVVQSLMQTIAGMTQPQAVDIMMEAHTNGTALVITCIQEH  70

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+  GL SSIEP
Sbjct  71   AEFYCETLKNKGLTSSIEP  89



>ref|WP_012594501.1| MULTISPECIES: ATP-dependent Clp protease ClpS [Cyanothece]
 ref|YP_002371383.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. 
PCC 8801]
 ref|YP_003136950.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. 
PCC 8802]
 gb|ACK65227.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. 
PCC 8801]
 gb|ACV00115.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. 
PCC 8802]
Length=97

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQ LM+ + GMT   AV+IM EAH NG ++VI CA   
Sbjct  17   RKPAPRYRVLLHNDDFNSMEYVVQTLMQTVAGMTQPQAVDIMMEAHTNGTALVITCALEH  76

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL SSIEP
Sbjct  77   AEFYCETLKNHGLTSSIEP  95



>ref|WP_038075846.1| Clp protease ClpS [Tolypothrix bouteillei]
 gb|KIE07519.1| Clp protease ClpS [Tolypothrix bouteillei VB521301]
Length=93

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P Y+VLLHND +N  EYVVQVL+  +P +T   AV+IM EAH NGL++VI CAQ 
Sbjct  12   SRKLAPRYKVLLHNDEYNPMEYVVQVLLTTVPNLTQPQAVSIMMEAHTNGLALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKNHGLTSTIEP  91



>ref|WP_016879578.1| ATP-dependent Clp protease ClpS [Chlorogloeopsis fritschii]
Length=93

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            S K +P YRVLLHND++N  EYVVQVL+  +P +T   AV+IM EAH NG+++VI CAQ 
Sbjct  12   SSKLAPQYRVLLHNDDYNSMEYVVQVLLTTVPSLTQPQAVSIMMEAHTNGIALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKNHGLTSTIEP  91



>ref|WP_006622078.1| MULTISPECIES: ATP-dependent Clp protease ClpS [Arthrospira]
 gb|EDZ95973.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrospira 
maxima CS-328]
 emb|CCE17411.1| ATP-dependent Clp protease adapter protein ClpS [Arthrospira 
sp. PCC 8005]
 gb|EKD10269.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrospira 
platensis C1]
 emb|CDM92548.1| ATP-dependent Clp protease adapter protein ClpS [Arthrospira 
sp. PCC 8005]
Length=117

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND++N  EYVVQVLM  +PG+T   AV+IM EAH NGL++VI CA  
Sbjct  36   NRKLAPRYRVLLHNDDYNPMEYVVQVLMSTVPGLTQPQAVSIMMEAHTNGLALVITCALE  95

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  96   HAEFYCETLKNHGLTSTIEP  115



>ref|WP_026100144.1| Clp protease ClpS [Microchaete sp. PCC 7126]
Length=93

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND++N  E+VVQ L+  +P +T   AV+IM EAH NG+++VI CAQ 
Sbjct  12   SRKLAPRYRVLLHNDDYNSMEHVVQALLTTVPSLTQPQAVSIMMEAHTNGIALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+G+GL S+IEP
Sbjct  72   HAEFYCETLKGHGLSSTIEP  91



>ref|WP_015113510.1| ATP-dependent Clp protease adapter protein clpS [Nostoc sp. PCC 
7107]
 ref|YP_007050447.1| ATP-dependent Clp protease adapter protein clpS [Nostoc sp. PCC 
7107]
 gb|AFY43297.1| ATP-dependent Clp protease adapter protein clpS [Nostoc sp. PCC 
7107]
Length=93

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND +N  EYVVQVL+  +P +T   AV+IM EAH NGL++VI CA  
Sbjct  12   SRKLAPRYRVLLHNDEYNSMEYVVQVLLTTVPSLTQPQAVSIMMEAHTNGLALVITCALE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL SSIEP
Sbjct  72   HAEFYCETLKTHGLSSSIEP  91



>ref|WP_017320529.1| ATP-dependent Clp protease ClpS [cyanobacterium PCC 7702]
Length=93

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            S K +P YRVLLHND++N  EYVVQVL+  +P +T   AV+IM EAH NG+++VI CAQ 
Sbjct  12   SSKLAPRYRVLLHNDDYNSMEYVVQVLLTTVPSLTQPQAVSIMMEAHTNGIALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKNHGLTSTIEP  91



>ref|WP_006619677.1| ATP-dependent Clp protease ClpS [Arthrospira platensis]
 gb|KDR58939.1| Clp protease ClpS [Arthrospira platensis str. Paraca]
Length=93

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND+ N  EYVVQVLM  +PG+T   AV+IM EAH NGL++VI CA  
Sbjct  12   NRKLAPRYRVLLHNDDHNPMEYVVQVLMSTVPGLTQPQAVSIMMEAHTNGLALVITCALE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKNHGLTSTIEP  91



>ref|WP_010998463.1| ATP-dependent Clp protease ClpS [Nostoc sp. PCC 7120]
 ref|NP_488365.1| ATP-dependent Clp protease adaptor protein ClpS [Nostoc sp. PCC 
7120]
 dbj|BAB76024.1| asl4325 [Nostoc sp. PCC 7120]
Length=93

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND+ N  EYVVQVL+  +P +T   AV+IM EAH NGL++VI CAQ 
Sbjct  12   SRKLAPRYRVLLHNDDHNSMEYVVQVLITTVPSLTQPQAVSIMMEAHTNGLALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKDHGLSSTIEP  91



>ref|WP_029633226.1| Clp protease ClpS [[Scytonema hofmanni] UTEX B 1581]
Length=93

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND+FN  E+VV+VL+  +P +T   AV+IM EAH NGL++VI CAQ 
Sbjct  12   SRKLAPQYRVLLHNDDFNPMEHVVKVLITTVPNLTQPQAVSIMMEAHTNGLALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKNHGLTSTIEP  91



>ref|WP_015225234.1| ATP-dependent Clp protease adaptor protein ClpS [Halothece sp. 
PCC 7418]
 ref|YP_007167571.1| ATP-dependent Clp protease adaptor protein ClpS [Halothece sp. 
PCC 7418]
 gb|AFZ43357.1| ATP-dependent Clp protease adaptor protein ClpS [Halothece sp. 
PCC 7418]
Length=101

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = -1

Query  494  PGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHN  315
            P  Q+    +  RK +P YRVLLHND+FN  EYVVQ L++ +P +T   AV+IM EAH++
Sbjct  9    PAIQTVEKNQTVRKPAPRYRVLLHNDDFNGMEYVVQTLLQTVPSLTQPQAVDIMMEAHNS  68

Query  314  GLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
            G+S+VI CAQ  AE +C  L+ +GL S+IEP
Sbjct  69   GVSLVITCAQEHAEFYCETLKNHGLTSTIEP  99



>ref|WP_008275034.1| MULTISPECIES: ATP-dependent Clp protease ClpS [Cyanothece]
 ref|YP_001803654.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. 
ATCC 51142]
 gb|EAZ91962.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. 
CCY0110]
 gb|ACB51588.1| putative ATP-dependent Clp protease, adaptor protein [Cyanothece 
sp. ATCC 51142]
Length=97

 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQ LM+ + GMT   AV+IM EAH NG ++VI CA   
Sbjct  17   RKPAPRYRVLLHNDDFNSMEYVVQTLMQTVSGMTQPQAVDIMMEAHTNGTALVITCALEP  76

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL S+IEP
Sbjct  77   AEFYCETLKNHGLTSTIEP  95



>ref|WP_028083373.1| Clp protease ClpS [Dolichospermum circinale]
Length=93

 Score = 97.1 bits (240),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SR+ +P YRVLLHND++N  EYVV+VLM  +  ++   AV+IM EAHHNGL++VI CAQ 
Sbjct  12   SRRLAPRYRVLLHNDDYNSMEYVVKVLMTTVTSISQPQAVSIMMEAHHNGLALVISCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L  +GL+S+IEP
Sbjct  72   HAEFYCETLTNHGLISTIEP  91



>ref|WP_035155638.1| Clp protease ClpS [Calothrix sp. 336/3]
 gb|KFB84925.1| Clp protease ClpS [Calothrix sp. 336/3]
Length=93

 Score = 96.7 bits (239),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND +N  E+VV  L+  +P +T   AV+IM EAH NGL++VI CAQ 
Sbjct  12   SRKLAPQYRVLLHNDTYNSMEFVVHTLLTTVPSLTQPQAVSIMMEAHTNGLALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKSHGLTSTIEP  91



>ref|WP_018399985.1| ATP-dependent Clp protease ClpS [filamentous cyanobacterium ESFC-1]
Length=97

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQ +MK + G+T   AVNIM EAH++G+++VI CA   
Sbjct  17   RKHAPRYRVLLHNDDFNSMEYVVQTIMKTVAGITQPQAVNIMMEAHNSGVALVITCALEH  76

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL S+IEP
Sbjct  77   AEFYCETLKNHGLTSTIEP  95



>ref|WP_015160261.1| hypothetical protein [Chamaesiphon minutus]
 ref|YP_007097646.1| hypothetical protein Cha6605_3097 [Chamaesiphon minutus PCC 6605]
 gb|AFY94119.1| hypothetical protein Cha6605_3097 [Chamaesiphon minutus PCC 6605]
Length=93

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND+FN  E+VVQVLM  IP M+   A+++M EAH N +++VI+C Q 
Sbjct  12   SRKLAPNYRVLLHNDDFNSMEHVVQVLMTNIPHMSETKAISVMMEAHQNEMALVIVCNQE  71

Query  281  DAEEHCTQLRGNGLLSSIEPA  219
             AE +C  L+ +GL S+IEPA
Sbjct  72   HAEHYCDVLKSHGLTSTIEPA  92



>ref|WP_015210276.1| hypothetical protein [Cylindrospermum stagnale]
 ref|YP_007149719.1| hypothetical protein Cylst_4988 [Cylindrospermum stagnale PCC 
7417]
 gb|AFZ27039.1| hypothetical protein Cylst_4988 [Cylindrospermum stagnale PCC 
7417]
Length=93

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND++N  EYVVQVL+  +P +T   AV+IM EAH NGL++VI C   
Sbjct  12   SRKLAPRYRVLLHNDDYNPMEYVVQVLITTVPNLTQPQAVSIMMEAHTNGLALVITCEME  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL+S+IEP
Sbjct  72   HAEFYCETLKSHGLISTIEP  91



>ref|WP_019498680.1| ATP-dependent Clp protease ClpS [Pseudanabaena sp. PCC 6802]
Length=93

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 58/82 (71%), Gaps = 0/82 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND+FN  EYVVQ LM+V+ GMT   AV+IM EAH N  ++VI C   
Sbjct  12   TRKIAPRYRVLLHNDDFNSMEYVVQTLMQVVNGMTQPQAVDIMMEAHTNNCALVITCVME  71

Query  281  DAEEHCTQLRGNGLLSSIEPAS  216
             AE +C  L+  GL+S+IEP S
Sbjct  72   HAEFYCEGLQSKGLISTIEPES  93



>ref|WP_019509270.1| ATP-dependent Clp protease ClpS [Pleurocapsa sp. PCC 7319]
Length=97

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P Y+VLLHND+FN  EYVVQVLM+ I GMT   AVNIM E H+NG+ +VI CA   
Sbjct  17   RKHAPRYKVLLHNDDFNSMEYVVQVLMQTIGGMTQPQAVNIMMETHNNGIGLVITCALEP  76

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L  +GL S+IEP
Sbjct  77   AEFYCETLGNHGLTSTIEP  95



>ref|WP_036476664.1| Clp protease ClpS [Myxosarcina sp. GI1]
Length=97

 Score = 96.3 bits (238),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQ LM+ + GMT   AVNIM E H NG+ +VI CA   
Sbjct  17   RKLAPRYRVLLHNDDFNSMEYVVQTLMQTVAGMTQPQAVNIMMETHTNGIGLVITCALEH  76

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L  +GL S+IEP
Sbjct  77   AEFYCETLGNHGLTSTIEP  95



>ref|WP_027401430.1| Clp protease ClpS [Aphanizomenon flos-aquae]
 gb|KHG40009.1| Clp protease ClpS [Aphanizomenon flos-aquae 2012/KM/D3]
Length=93

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND++N  EYVVQVLM  +  +T   AV+IM EAHHNGL++VI CAQ 
Sbjct  12   SRKLAPQYRVLLHNDDYNPMEYVVQVLMTTVNSITQPQAVSIMMEAHHNGLALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +   L  +GL S+IEP
Sbjct  72   HAEFYSETLNNHGLSSTIEP  91



>ref|WP_015229456.1| hypothetical protein [Dactylococcopsis salina]
 ref|YP_007171816.1| hypothetical protein Dacsa_1801 [Dactylococcopsis salina PCC 
8305]
 gb|AFZ50459.1| hypothetical protein Dacsa_1801 [Dactylococcopsis salina PCC 
8305]
Length=101

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 60/79 (76%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQ L++ +P +T   AV+IM EAH++G+++VI CAQ  
Sbjct  21   RKPAPRYRVLLHNDDFNGMEYVVQTLLQTVPSLTQPQAVDIMMEAHNSGVALVITCAQEH  80

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL S+IEP
Sbjct  81   AEFYCEMLKNHGLTSTIEP  99



>ref|WP_014277446.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrospira 
platensis]
 ref|YP_005072747.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrospira 
platensis NIES-39]
 dbj|BAI94209.1| ATP-dependent Clp protease adaptor protein ClpS [Arthrospira 
platensis NIES-39]
Length=117

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND+ N  EYVVQVLM  +PG+T   AV+IM EAH NGL++VI CA  
Sbjct  36   NRKLAPRYRVLLHNDDHNPMEYVVQVLMSTVPGLTQPQAVSIMMEAHTNGLALVITCALE  95

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  96   HAEFYCETLKNHGLTSTIEP  115



>dbj|BAP18245.1| ATP-dependent Clp protease adaptor protein ClpS [cyanobacterium 
endosymbiont of Epithemia turgida isolate EtSB Lake Yunoko]
Length=97

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQ L + + GMT   AV+IM EAH+NG+++VI CA   
Sbjct  17   RKPAPRYRVLLHNDDFNSMEYVVQTLTQTVAGMTQSQAVDIMMEAHNNGIALVIACALEH  76

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+  GL S+IEP
Sbjct  77   AEFYCETLKNYGLTSTIEP  95



>ref|WP_026093372.1| Clp protease ClpS [Calothrix sp. PCC 7103]
Length=93

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND+FN  E+VVQ L+  +P +T   AV+IM EAH NGL++VI CA  
Sbjct  12   TRKLAPRYRVLLHNDDFNSMEHVVQSLITTVPSLTQPQAVSIMMEAHTNGLALVITCALE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+G+GL S+IEP
Sbjct  72   HAEFYCETLKGHGLTSTIEP  91



>ref|WP_039742535.1| Clp protease ClpS [Hassallia byssoidea]
 gb|KIF35446.1| Clp protease ClpS [Hassallia byssoidea VB512170]
Length=93

 Score = 95.9 bits (237),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND+FN  E+VVQVL+  +P ++   AV+IM EAH NGL++VI CAQ 
Sbjct  12   TRKLAPRYRVLLHNDDFNPMEHVVQVLITTVPNLSQPQAVSIMMEAHTNGLALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKNHGLTSTIEP  91



>ref|WP_009343049.1| ATP-dependent Clp protease ClpS [Raphidiopsis brookii]
 gb|EFA72561.1| ATP-dependent Clp protease adaptor protein ClpS [Raphidiopsis 
brookii D9]
Length=93

 Score = 95.5 bits (236),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND++N  EYVVQVL+  IP +T   AV IM EAH NGL++VI CA  
Sbjct  12   TRKLAPRYRVLLHNDDYNSMEYVVQVLLSTIPSLTQPQAVTIMMEAHSNGLALVISCALE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L  +GL S+IEP
Sbjct  72   HAEFYCESLNNHGLTSTIEP  91



>ref|WP_015194671.1| ATP-dependent Clp protease adapter protein clpS [Stanieria cyanosphaera]
 ref|YP_007133975.1| ATP-dependent Clp protease adapter protein clpS [Stanieria cyanosphaera 
PCC 7437]
 gb|AFZ37009.1| ATP-dependent Clp protease adapter protein clpS [Stanieria cyanosphaera 
PCC 7437]
Length=97

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVV+ LM+ I GMT   AVNIM EAH NG+ +VIIC    
Sbjct  17   RKPAPRYRVLLHNDDFNSMEYVVETLMQTIAGMTQPQAVNIMMEAHTNGVGLVIICTLEH  76

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L  +GL S+IEP
Sbjct  77   AEFYCETLCNHGLTSTIEP  95



>ref|WP_015201995.1| ATP-dependent Clp protease adapter protein clpS [Crinalium epipsammum]
 ref|YP_007141383.1| ATP-dependent Clp protease adapter protein clpS [Crinalium epipsammum 
PCC 9333]
 gb|AFZ11873.1| ATP-dependent Clp protease adapter protein clpS [Crinalium epipsammum 
PCC 9333]
Length=93

 Score = 95.1 bits (235),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND+FN  EYVVQVL+  +P +T   AVNIM EAH++G ++VI CA  
Sbjct  12   SRKIAPRYRVLLHNDDFNPMEYVVQVLITTVPNLTQPQAVNIMMEAHNSGTALVITCALE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L  +GL S+IEP
Sbjct  72   HAEFYCETLNNHGLTSTIEP  91



>ref|WP_022604067.1| hypothetical protein [Rubidibacter lacunae]
 gb|ERN43000.1| hypothetical protein KR51_00003110 [Rubidibacter lacunae KORDI 
51-2]
Length=101

 Score = 95.5 bits (236),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQVL++ +PG+T   AV+IM EAH+ G+++VI CA   
Sbjct  21   RKPAPRYRVLLHNDDFNPMEYVVQVLIQTVPGLTQPQAVSIMMEAHNTGVALVITCALEH  80

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+  GL S+IEP
Sbjct  81   AEFYCETLQNKGLASTIEP  99



>ref|WP_024546425.1| Clp protease ClpS [Synechococcus sp. NKBG15041c]
Length=95

 Score = 95.1 bits (235),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  E+VVQ LM+ + G+T   AV+IM EAH NGL++VI C Q  
Sbjct  15   RKPAPRYRVLLHNDDFNSMEHVVQTLMQTVAGLTQPQAVSIMMEAHTNGLALVITCVQEH  74

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL S+IEP
Sbjct  75   AEFYCETLKMHGLTSTIEP  93



>ref|WP_015146967.1| hypothetical protein [Oscillatoria acuminata]
 ref|YP_007084237.1| hypothetical protein Oscil6304_0576 [Oscillatoria acuminata PCC 
6304]
 gb|AFY80317.1| hypothetical protein Oscil6304_0576 [Oscillatoria acuminata PCC 
6304]
Length=93

 Score = 94.7 bits (234),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  E+VVQ LM+ +P +T   AV+IM EAH NG+++VI CA   
Sbjct  13   RKIAPRYRVLLHNDDFNSMEHVVQTLMQTVPSLTQPQAVSIMMEAHSNGIALVITCALEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL S+IEP
Sbjct  73   AEFYCETLKNHGLTSTIEP  91



>ref|WP_012165780.1| ATP-dependent Clp protease ClpS [Acaryochloris marina]
 ref|YP_001519879.1| ATP-dependent Clp protease adaptor protein ClpS [Acaryochloris 
marina MBIC11017]
 gb|ABW30560.1| ATP-dependent Clp protease adaptor protein ClpS [Acaryochloris 
marina MBIC11017]
Length=93

 Score = 94.7 bits (234),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND+FN  E+VVQVL++ +P +T   AV++M EAH NG+++VI CA  
Sbjct  12   SRKLAPKYRVLLHNDDFNSMEHVVQVLIQTVPNLTQPQAVSVMMEAHTNGIALVITCAFE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKMHGLTSTIEP  91



>ref|WP_011432326.1| ATP-dependent Clp protease ClpS [Synechococcus sp. JA-2-3B'a(2-13)]
 ref|YP_476931.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. JA-2-3B'a(2-13)]
 gb|ABD01668.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. JA-2-3B'a(2-13)]
Length=93

 Score = 94.7 bits (234),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/78 (62%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -1

Query  455  KTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVDA  276
            K  P YRVLLHND+ N  EYVVQVL+KVIP M    A  IM EAHHNG++VVI+  +  A
Sbjct  14   KHMPMYRVLLHNDDVNTMEYVVQVLVKVIPAMMPPQATEIMLEAHHNGVAVVIVVPREHA  73

Query  275  EEHCTQLRGNGLLSSIEP  222
            E +C QLR +GL SSIEP
Sbjct  74   EFYCEQLRQHGLTSSIEP  91



>ref|WP_011377684.1| ATP-dependent Clp protease ClpS [Synechococcus elongatus]
 ref|YP_399709.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
elongatus PCC 7942]
 sp|Q31QE7.1|CLPS_SYNE7 RecName: Full=ATP-dependent Clp protease adapter protein ClpS 
[Synechococcus elongatus PCC 7942]
 gb|ABB56722.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
 gb|AJD58736.1| Clp protease ClpS [Synechococcus sp. UTEX 2973]
Length=95

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVV VLM+ +P +T   AV+IM EAH NG  +VI C    
Sbjct  15   RKIAPRYRVLLHNDDFNPMEYVVMVLMQTVPSLTQPQAVDIMMEAHTNGTGLVITCDIEP  74

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C QL+ +GL SSIEP
Sbjct  75   AEFYCEQLKSHGLSSSIEP  93



>ref|WP_015172880.1| ATP-dependent Clp protease adaptor protein ClpS [Geitlerinema 
sp. PCC 7407]
 ref|YP_007110368.1| ATP-dependent Clp protease adaptor protein ClpS [Geitlerinema 
sp. PCC 7407]
 gb|AFY67316.1| ATP-dependent Clp protease adaptor protein ClpS [Geitlerinema 
sp. PCC 7407]
Length=93

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND+FN  EYVVQVL++ +  +T   AV+IM EAH NGL++VI CAQ 
Sbjct  12   ARKHAPRYRVLLHNDDFNPMEYVVQVLLQTVASLTQPQAVSIMMEAHTNGLALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +   L+ +GL SSIEP
Sbjct  72   HAEFYSETLKNHGLSSSIEP  91



>ref|WP_026134960.1| Clp protease ClpS [Scytonema hofmanni]
Length=93

 Score = 94.4 bits (233),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P Y+VLLHND++N  E+VV+VL+  +P +T   AV+IM EAH NGL++VI CAQ 
Sbjct  12   SRKLAPRYKVLLHNDDYNPMEHVVRVLLTTVPNLTQPQAVSIMMEAHTNGLALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKNHGLTSTIEP  91



>ref|WP_015200544.1| ATP-dependent Clp protease adaptor protein ClpS [Calothrix parietina]
 ref|YP_007139905.1| ATP-dependent Clp protease adaptor protein ClpS [Calothrix sp. 
PCC 6303]
 gb|AFZ03933.1| ATP-dependent Clp protease adaptor protein ClpS [Calothrix sp. 
PCC 6303]
Length=102

 Score = 94.4 bits (233),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 59/80 (74%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND+FN  E+VV VL+  IP +T   AV+IM EAH NG+++VI CA  
Sbjct  21   TRKLAPRYRVLLHNDSFNAMEHVVHVLITTIPQLTEPQAVSIMMEAHTNGIALVITCALE  80

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+G+GL S+IEP
Sbjct  81   HAEFYCETLKGHGLTSTIEP  100



>ref|WP_015078741.1| ATP-dependent Clp protease adaptor protein ClpS [Anabaena sp. 
90]
 ref|YP_006995390.1| ATP-dependent Clp protease adaptor protein ClpS [Anabaena sp. 
90]
 gb|AFW93577.1| ATP-dependent Clp protease adaptor protein ClpS [Anabaena sp. 
90]
Length=114

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND++N  EYVVQVLM  +  +T   AV+IM EAHHNGL++VI CAQ 
Sbjct  33   SRKLAPQYRVLLHNDDYNPMEYVVQVLMTTVNSITQPQAVSIMMEAHHNGLALVIRCAQE  92

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +   L  +GL S+IEP
Sbjct  93   HAEFYSETLNNHGLSSTIEP  112



>ref|WP_012307878.1| MULTISPECIES: ATP-dependent Clp protease ClpS [Synechococcus]
 ref|YP_001735515.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. PCC 7002]
 gb|ACB00260.1| ATP-dependent Clp protease adaptor protein [Synechococcus sp. 
PCC 7002]
Length=95

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  E+VVQ LM+ + G+T   AV+IM EAH NG+++VI C Q  
Sbjct  15   RKPAPRYRVLLHNDDFNSMEHVVQTLMQTVAGLTQPQAVSIMMEAHTNGIALVITCVQEH  74

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL S+IEP
Sbjct  75   AEFYCETLKMHGLTSTIEP  93



>ref|WP_021833093.1| ATP-dependent Clp protease adaptor protein ClpS [Crocosphaera 
watsonii]
 emb|CCQ56217.1| ATP-dependent Clp protease adaptor protein ClpS [Crocosphaera 
watsonii WH 0005]
 emb|CCQ67545.1| ATP-dependent Clp protease adaptor protein ClpS [Crocosphaera 
watsonii WH 0402]
Length=97

 Score = 94.0 bits (232),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQ LM+++P +T   AV+IM EAH NG ++VI CA   
Sbjct  17   RKPAPRYRVLLHNDDFNSMEYVVQTLMQIVPSITQPQAVDIMMEAHSNGTALVITCALEP  76

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +   L+ +GL S+IEP
Sbjct  77   AEFYSETLKNHGLTSTIEP  95



>ref|WP_015129168.1| ATP-dependent Clp protease adapter protein clpS [Calothrix sp. 
PCC 7507]
 ref|YP_007066192.1| ATP-dependent Clp protease adapter protein clpS [Calothrix sp. 
PCC 7507]
 gb|AFY33358.1| ATP-dependent Clp protease adapter protein clpS [Calothrix sp. 
PCC 7507]
Length=93

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND++N  E+VVQ L+  +  +T   AV+IM EAH NGL++VI CAQ 
Sbjct  12   SRKLAPRYRVLLHNDDYNSMEHVVQALLTTVSSLTQPQAVSIMMEAHTNGLALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKSHGLSSTIEP  91



>dbj|BAM54852.1| ATP-dependent Clp protease adaptor protein ClpS [Bacillus subtilis 
BEST7613]
Length=95

 Score = 93.6 bits (231),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  E+VVQ L++ + GMT   AV+IM EAH NG+S+VI C    
Sbjct  15   RKHAPRYRVLLHNDDFNSMEHVVQTLIQTVAGMTQPQAVDIMMEAHFNGMSLVITCELEH  74

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  LR +GL S+IEP
Sbjct  75   AEFYCETLRSHGLSSTIEP  93



>ref|WP_010873050.1| ATP-dependent Clp protease ClpS [Synechocystis sp. PCC 6803]
 ref|NP_441749.1| ATP-dependent Clp protease adaptor protein ClpS [Synechocystis 
sp. PCC 6803]
 ref|YP_005383617.1| hypothetical protein SYNGTI_1855 [Synechocystis sp. PCC 6803 
substr. GT-I]
 ref|YP_005386786.1| hypothetical protein SYNPCCP_1854 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 ref|YP_005409493.1| hypothetical protein SYNPCCN_1854 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 ref|YP_005651808.1| hypothetical protein SYNGTS_1855 [Synechocystis sp. PCC 6803]
 ref|YP_007451631.1| hypothetical protein MYO_118720 [Synechocystis sp. PCC 6803]
 dbj|BAA18429.1| ssr2723 [Synechocystis sp. PCC 6803]
 dbj|BAK50603.1| hypothetical protein SYNGTS_1855 [Synechocystis sp. PCC 6803]
 dbj|BAL29602.1| hypothetical protein SYNGTI_1855 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL32771.1| hypothetical protein SYNPCCN_1854 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL35940.1| hypothetical protein SYNPCCP_1854 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 gb|AGF52117.1| hypothetical protein MYO_118720 [Synechocystis sp. PCC 6803]
Length=96

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  E+VVQ L++ + GMT   AV+IM EAH NG+S+VI C    
Sbjct  16   RKHAPRYRVLLHNDDFNSMEHVVQTLIQTVAGMTQPQAVDIMMEAHFNGMSLVITCELEH  75

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  LR +GL S+IEP
Sbjct  76   AEFYCETLRSHGLSSTIEP  94



>ref|WP_006635106.1| ATP-dependent Clp protease ClpS [Microcoleus vaginatus]
 gb|EGK84626.1| ATP-dependent Clp protease adapter protein clpS [Microcoleus 
vaginatus FGP-2]
Length=93

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQ LM  +P +T   AVN+M EAH NG+ +VI+CA   
Sbjct  13   RKLAPRYRVLLHNDDFNPMEYVVQTLMATVPSLTQPQAVNVMMEAHTNGMGLVIVCALEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +   L  +GL SSIEP
Sbjct  73   AEFYAETLNNHGLSSSIEP  91



>ref|WP_015178019.1| ATP-dependent Clp protease adapter protein clpS [Oscillatoria 
nigro-viridis]
 ref|YP_007117195.1| ATP-dependent Clp protease adapter protein clpS [Oscillatoria 
nigro-viridis PCC 7112]
 gb|AFZ08779.1| ATP-dependent Clp protease adapter protein clpS [Oscillatoria 
nigro-viridis PCC 7112]
Length=93

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQ LM  +P +T   AVN+M EAH NG+ +VI+CA   
Sbjct  13   RKLAPRYRVLLHNDDFNPMEYVVQTLMATVPSLTQPQAVNVMMEAHTNGMGLVIVCALEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +   L  +GL SSIEP
Sbjct  73   AEFYAETLNNHGLSSSIEP  91



>ref|WP_008313876.1| hypothetical protein [Leptolyngbya sp. PCC 6406]
Length=95

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVV+ L+KV+P +T   AV+IM +AH  G +VVI+CA   
Sbjct  15   RKPAPRYRVLLHNDDFNSMEYVVESLLKVVPSLTTPQAVDIMMQAHSAGKAVVIVCALEH  74

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+  GL SSIEP
Sbjct  75   AEFYCEGLQSCGLTSSIEP  93



>ref|WP_006276044.1| ATP-dependent Clp protease ClpS [Cylindrospermopsis raciborskii]
 gb|EFA71083.1| ATP-dependent Clp protease adaptor protein ClpS [Cylindrospermopsis 
raciborskii CS-505]
Length=93

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND++N  EYVVQVL+  IP +T   AV+IM EAH +GL++VI CA  
Sbjct  12   TRKLAPRYRVLLHNDDYNSMEYVVQVLLSTIPSLTQPQAVSIMMEAHSHGLALVISCALE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L   GL S+IEP
Sbjct  72   HAEFYCESLNNYGLTSTIEP  91



>ref|WP_007306880.1| ATP-dependent Clp protease ClpS [Crocosphaera watsonii]
 gb|EAM49379.1| ATP-dependent Clp protease adaptor protein ClpS [Crocosphaera 
watsonii WH 8501]
 emb|CCQ60409.1| ATP-dependent Clp protease adaptor protein ClpS [Crocosphaera 
watsonii WH 0401]
Length=97

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVVQ LM+ +P +T   AV+IM EAH NG ++VI CA   
Sbjct  17   RKPAPRYRVLLHNDDFNSMEYVVQTLMQTVPSITQPQAVDIMMEAHSNGTALVITCALEP  76

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +   L+ +GL S+IEP
Sbjct  77   AEFYSETLKNHGLTSTIEP  95



>ref|WP_010469247.1| ATP-dependent Clp protease ClpS [Acaryochloris sp. CCMEE 5410]
Length=93

 Score = 92.8 bits (229),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  E+VVQVL++ +P +T   AV++M EAH NG+++VI CA   
Sbjct  13   RKLAPKYRVLLHNDDFNSMEHVVQVLIQTVPNLTQPQAVSVMMEAHTNGIALVITCAFEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL S+IEP
Sbjct  73   AEFYCETLKMHGLTSTIEP  91



>ref|WP_015135484.1| ATP-dependent Clp protease adapter protein clpS [Leptolyngbya 
sp. PCC 7376]
 ref|YP_007072580.1| ATP-dependent Clp protease adapter protein clpS [Leptolyngbya 
sp. PCC 7376]
 gb|AFY39746.1| ATP-dependent Clp protease adapter protein clpS [Leptolyngbya 
sp. PCC 7376]
Length=95

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  E+VVQ L++ + G+T   AV+IM EAH NGL++VI C Q  
Sbjct  15   RKPAPRYRVLLHNDDFNPMEHVVQTLIQTVAGLTQPQAVSIMMEAHTNGLALVITCVQEH  74

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL S+IEP
Sbjct  75   AEFYCETLKSHGLSSTIEP  93



>ref|WP_006508057.1| hypothetical protein [Xenococcus sp. PCC 7305]
 gb|ELS04835.1| hypothetical protein Xen7305DRAFT_00045710 [Xenococcus sp. PCC 
7305]
Length=97

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK  P Y+VLLHND+FN  E+VVQ LM  + GMT   AV+IM EAH NG+++VI CA   
Sbjct  17   RKHPPRYKVLLHNDDFNSMEHVVQTLMTTVGGMTQPQAVSIMMEAHTNGMALVITCALEH  76

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  LR +GL S+IEP
Sbjct  77   AEFYCETLRSHGLSSTIEP  95



>ref|WP_015180760.1| hypothetical protein [Microcoleus sp. PCC 7113]
 ref|YP_007120003.1| hypothetical protein Mic7113_0684 [Microcoleus sp. PCC 7113]
 gb|AFZ16597.1| hypothetical protein Mic7113_0684 [Microcoleus sp. PCC 7113]
Length=93

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  E+VVQ LM  +  +T   AVNIM EAH  G+ +VI CAQ  
Sbjct  13   RKHAPRYRVLLHNDDFNSMEHVVQTLMTTVASLTQPQAVNIMMEAHMTGIGLVITCAQEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL S+IEP
Sbjct  73   AEFYCETLKNHGLTSTIEP  91



>ref|WP_006527651.1| hypothetical protein [Gloeocapsa sp. PCC 73106]
 gb|ELR99531.1| hypothetical protein GLO73106DRAFT_00033830 [Gloeocapsa sp. PCC 
73106]
Length=95

 Score = 92.4 bits (228),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 54/79 (68%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            +K +P YRVLLHND+ N  EYVVQ LM+ I GMT   AVNIM EAH NG+ +VIICA   
Sbjct  15   KKQAPRYRVLLHNDDVNSMEYVVQTLMQTIAGMTQPQAVNIMMEAHTNGIGLVIICALEH  74

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +   L   GL S+IEP
Sbjct  75   AEFYAETLNNYGLTSTIEP  93



>ref|WP_009633780.1| hypothetical protein [Synechocystis sp. PCC 7509]
Length=93

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 58/79 (73%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  E+VV+VLM+ +  +T   AV+IM EAH NG+++VI CAQ  
Sbjct  13   RKIAPRYRVLLHNDDFNSMEFVVKVLMETVSSITQPQAVSIMMEAHSNGIALVITCAQEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  +  +GL S+IEP
Sbjct  73   AEFYCETMNNHGLQSTIEP  91



>gb|AIE75228.1| ATP-dependent Clp protease adaptor protein ClpS [Synechocystis 
sp. PCC 6714]
Length=95

 Score = 92.0 bits (227),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  E+VVQ L++ + GMT   AV+IM EAH NG+S+VI C    
Sbjct  15   RKHAPRYRVLLHNDDFNSMEHVVQTLIQTVAGMTQPQAVDIMMEAHVNGMSLVITCELEH  74

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  LR +GL S+IEP
Sbjct  75   AEFYCETLRSHGLSSTIEP  93



>ref|XP_001691804.1| clp protease adaptor protein [Chlamydomonas reinhardtii]
 gb|EDP04912.1| clp protease adaptor protein [Chlamydomonas reinhardtii]
Length=147

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 73/103 (71%), Gaps = 3/103 (3%)
 Frame = -1

Query  512  VIEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIM  333
            V++  T  +Q    + +S+K  P Y+VLLHNDN+NKREYVV+VL+KV+  +T+D AV  M
Sbjct  48   VMDAPTTTQQPASGVERSQKRPPIYKVLLHNDNYNKREYVVKVLLKVVEQITVDDAVTCM  107

Query  332  QEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPASGGGC  204
            QEAH  G+++V+ C Q +AE +C  LR NGL S+IEP   GGC
Sbjct  108  QEAHETGVALVVACPQDNAERYCEGLRLNGLTSTIEP---GGC  147



>ref|WP_015123005.1| hypothetical protein [Synechococcus sp. PCC 6312]
 ref|YP_007060004.1| hypothetical protein Syn6312_0220 [Synechococcus sp. PCC 6312]
 gb|AFY59461.1| hypothetical protein Syn6312_0220 [Synechococcus sp. PCC 6312]
Length=93

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  E+VV+ L+K +P +T   AV+IM EAH NG+++VI CA   
Sbjct  13   RKLAPRYRVLLHNDDFNSMEHVVETLLKTVPSLTQPQAVDIMMEAHTNGVALVITCALEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+  GL S+IEP
Sbjct  73   AEFYCEALKMAGLTSTIEP  91



>ref|WP_009625305.1| ATP-dependent Clp protease adapter protein clpS [Pseudanabaena 
biceps]
 gb|ELS34495.1| ATP-dependent Clp protease adapter protein clpS [Pseudanabaena 
biceps PCC 7429]
Length=93

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 0/81 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND++N  EYVVQ LM+V+ G+T   AV+IM  AH +G ++VI C Q  
Sbjct  13   RKIAPRYRVLLHNDDYNSMEYVVQTLMQVVNGLTQPQAVDIMMAAHASGCALVITCVQEH  72

Query  278  AEEHCTQLRGNGLLSSIEPAS  216
            AE +C  L+  GL S+IEP S
Sbjct  73   AEFYCEGLQSKGLTSTIEPES  93



>ref|WP_015165079.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudanabaena 
sp. PCC 7367]
 ref|YP_007102541.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudanabaena 
sp. PCC 7367]
 gb|AFY70113.1| ATP-dependent Clp protease adaptor protein ClpS [Pseudanabaena 
sp. PCC 7367]
Length=92

 Score = 92.0 bits (227),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  E+VVQ LM V+ G+T   AV+IM EAH NG ++VI C Q  
Sbjct  13   RKIAPRYRVLLHNDDFNSMEHVVQSLMTVVNGLTQPQAVDIMMEAHTNGCALVITCVQEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+  GL S+IEP
Sbjct  73   AEFYCEGLKMKGLTSTIEP  91



>ref|WP_017288055.1| ATP-dependent Clp protease ClpS [Leptolyngbya boryana]
Length=93

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND++N  EYVVQ LM+ +P +T   AVNIM E H++G+ +VI CAQ 
Sbjct  12   TRKLAPRYRVLLHNDDYNTMEYVVQALMETVPSLTQPQAVNIMMETHNSGVGLVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +   L+  GL S+IEP
Sbjct  72   HAEFYSETLKMKGLDSTIEP  91



>ref|WP_037224400.1| Clp protease ClpS [Richelia intracellularis]
Length=93

 Score = 91.7 bits (226),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            SRK +P YRVLLHND+F+  EYVV  L+  +P +T   AV+IM EAH N +++VI CAQ 
Sbjct  12   SRKLAPRYRVLLHNDDFHSMEYVVGTLLTTVPSLTQPQAVSIMMEAHTNSIALVISCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L+ +GL S+IEP
Sbjct  72   HAEFYCETLKNHGLTSTIEP  91



>ref|WP_024123996.1| ATP-dependent Clp protease adaptor protein ClpS [Thermosynechococcus 
sp. NK55a]
 ref|YP_008899090.1| ATP-dependent Clp protease adaptor protein ClpS [Thermosynechococcus 
sp. NK55a]
 gb|AHB87577.1| ATP-dependent Clp protease adaptor protein ClpS [Thermosynechococcus 
sp. NK55a]
Length=93

 Score = 91.3 bits (225),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHNDN N  EYVV+VL+K +P +T   AV+IM EAH  G+++VI CA   
Sbjct  13   RKLAPRYRVLLHNDNVNSMEYVVEVLLKTVPSLTQPQAVDIMMEAHLTGVALVITCALEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+  GL S+IEP
Sbjct  73   AEFYCEGLKMAGLTSTIEP  91



>ref|WP_011056066.1| ATP-dependent Clp protease ClpS [Thermosynechococcus elongatus]
 ref|NP_681002.1| ATP-dependent Clp protease adaptor protein ClpS [Thermosynechococcus 
elongatus BP-1]
 dbj|BAC07764.1| tll0211 [Thermosynechococcus elongatus BP-1]
Length=99

 Score = 91.7 bits (226),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHNDN N  EYVV+VL+K +P +T   AV+IM EAH  G+++VI CA   
Sbjct  19   RKLAPRYRVLLHNDNVNSMEYVVEVLLKTVPSLTQPQAVDIMMEAHLTGVALVITCALEH  78

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+  GL S+IEP
Sbjct  79   AEFYCEGLKMAGLTSTIEP  97



>ref|WP_006456131.1| ATP-dependent Clp protease ClpS [Synechococcus sp. PCC 7335]
 gb|EDX86365.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. PCC 7335]
Length=97

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVV+ L++ +P +T   A++IM + H+ G+ +VI+C    
Sbjct  17   RKIAPRYRVLLHNDDFNSMEYVVEALIETVPSLTAPQAIDIMMQTHNTGIGLVIVCEMEH  76

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+G GL S+IEP
Sbjct  77   AEFYCEGLKGKGLTSTIEP  95



>ref|WP_011431300.1| ATP-dependent Clp protease ClpS [Synechococcus sp. JA-3-3Ab]
 ref|YP_475890.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. JA-3-3Ab]
 gb|ABD00627.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. JA-3-3Ab]
Length=93

 Score = 90.9 bits (224),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = -1

Query  455  KTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVDA  276
            K  P YRVLLHND+ N  EYVVQVL+KVIP M    A  IM EAH+NG++VVI+  +  A
Sbjct  14   KHMPMYRVLLHNDDVNTMEYVVQVLVKVIPSMLPPQATEIMLEAHNNGVAVVIVVPREHA  73

Query  275  EEHCTQLRGNGLLSSIEP  222
            E +C QLR +GL SSIEP
Sbjct  74   EFYCEQLRQHGLTSSIEP  91



>ref|WP_015162741.1| hypothetical protein [Chamaesiphon minutus]
 ref|YP_007100193.1| hypothetical protein Cha6605_5813 [Chamaesiphon minutus PCC 6605]
 gb|AFY96666.1| hypothetical protein Cha6605_5813 [Chamaesiphon minutus PCC 6605]
Length=94

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND+FN  E+VV+VL+  IP ++   A+NIM EAH  G+++VI C Q 
Sbjct  13   ARKLAPNYRVLLHNDDFNAMEHVVEVLITTIPNLSAPQAINIMMEAHQYGMALVITCNQE  72

Query  281  DAEEHCTQLRGNGLLSSIEPA  219
             AE +   L+ +GL S+IEPA
Sbjct  73   HAEHYSDVLKSHGLTSTIEPA  93



>ref|WP_012628786.1| ATP-dependent Clp protease ClpS [Cyanothece sp. PCC 7425]
 ref|YP_002484086.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. 
PCC 7425]
 gb|ACL45725.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanothece sp. 
PCC 7425]
Length=93

 Score = 89.7 bits (221),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+ N  E+VV+VL+K +P +T   AV+IM EAH NG+++VI CA   
Sbjct  13   RKLAPRYRVLLHNDDVNSMEHVVEVLLKTVPSLTQPQAVDIMMEAHVNGIALVITCALEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+  GL S+IEP
Sbjct  73   AEFYCESLKLGGLTSTIEP  91



>ref|WP_015117501.1| hypothetical protein [Rivularia sp. PCC 7116]
 ref|YP_007054471.1| hypothetical protein Riv7116_1359 [Rivularia sp. PCC 7116]
 gb|AFY53924.1| hypothetical protein Riv7116_1359 [Rivularia sp. PCC 7116]
Length=93

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND++N  EYVV++L+  +P ++   AV+IM EAH NG ++VI CAQ 
Sbjct  12   TRKHAPRYRVLLHNDDYNAMEYVVEILITTVPSLSQPQAVSIMMEAHTNGFALVITCAQE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +   L+ +GL S+IEP
Sbjct  72   HAEFYSETLKTHGLNSTIEP  91



>ref|WP_012410249.1| ATP-dependent Clp protease ClpS [Nostoc punctiforme]
 ref|YP_001867223.1| ATP-dependent Clp protease adaptor protein ClpS [Nostoc punctiforme 
PCC 73102]
 gb|ACC82280.1| ATP-dependent Clp protease adaptor protein ClpS [Nostoc punctiforme 
PCC 73102]
Length=93

 Score = 89.0 bits (219),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
            +RK +P YRVLLHND++N  E+VVQ L+  +P +T   AV+IM EAH NGL++VI CA  
Sbjct  12   TRKLAPRYRVLLHNDDYNSMEHVVQSLIATVPSLTQPQAVSIMMEAHTNGLALVITCALE  71

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +C  L  +GL S+IEP
Sbjct  72   HAEFYCETLISHGLSSTIEP  91



>gb|KFF41350.1| hypothetical protein ucyna2_00772 [Candidatus Atelocyanobacterium 
thalassa isolate SIO64986]
Length=97

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            +K  P Y+VLLHND+FN  +YVVQ+LM+ I G+T   A  IM EAH NG ++VI CA   
Sbjct  17   QKPVPRYKVLLHNDDFNPMDYVVQILMQTISGITRPQAAEIMMEAHMNGTALVITCAFEP  76

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+ +GL+S+IEP
Sbjct  77   AEFYCETLKNHGLISTIEP  95



>ref|WP_015219544.1| ATP-dependent Clp protease adapter protein clpS [Cyanobacterium 
aponinum]
 ref|YP_007161861.1| ATP-dependent Clp protease adapter protein clpS [Cyanobacterium 
aponinum PCC 10605]
 gb|AFZ53817.1| ATP-dependent Clp protease adapter protein clpS [Cyanobacterium 
aponinum PCC 10605]
Length=96

 Score = 87.4 bits (215),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            +K  P YRVLLHND+FN  EYVV+ LM+ + GM+   AV++M EAH NG+ +V +CA   
Sbjct  17   KKHHPGYRVLLHNDSFNTMEYVVETLMETV-GMSEPQAVSVMMEAHTNGVGLVTVCALEH  75

Query  278  AEEHCTQLRGNGLLSSIEPA  219
            AE +C  L+  GL S+IEPA
Sbjct  76   AEFYCESLKSKGLTSTIEPA  95



>ref|XP_002949013.1| hypothetical protein VOLCADRAFT_73976 [Volvox carteri f. nagariensis]
 gb|EFJ49948.1| hypothetical protein VOLCADRAFT_73976 [Volvox carteri f. nagariensis]
Length=160

 Score = 88.6 bits (218),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = -1

Query  464  KSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQ  285
            ++ K  P Y+V LHNDN+NKREYVV+VL+KV+  +T+D AV +MQEAH  G+++V+ C Q
Sbjct  77   RAYKRPPIYKVFLHNDNYNKREYVVKVLLKVVEEITVDDAVTVMQEAHETGVALVVACPQ  136

Query  284  VDAEEHCTQLRGNGLLSSIEPAS  216
             +AE +C  LR NGL S+IEPA 
Sbjct  137  ENAERYCEGLRLNGLTSTIEPAG  159



>ref|WP_011243151.1| ATP-dependent Clp protease ClpS [Synechococcus elongatus]
 ref|YP_171549.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
elongatus PCC 6301]
 sp|Q5N3U1.1|CLPS_SYNP6 RecName: Full=ATP-dependent Clp protease adapter protein ClpS 
[Synechococcus elongatus PCC 6301]
 dbj|BAD79029.1| hypothetical protein [Synechococcus elongatus PCC 6301]
Length=91

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND+FN  EYVV VLM+ +P +T   AV+IM EAH NG  +VI C    
Sbjct  15   RKIAPRYRVLLHNDDFNPMEYVVMVLMQTVPSLTQPQAVDIMMEAHTNGTGLVITCDIEP  74

Query  278  AEEHCTQLRGNGL  240
            AE +C QL+ +GL
Sbjct  75   AEFYCEQLKSHGL  87



>ref|WP_015109461.1| hypothetical protein [Cyanobium gracile]
 ref|YP_007046353.1| hypothetical protein Cyagr_1875 [Cyanobium gracile PCC 6307]
 gb|AFY29012.1| hypothetical protein Cyagr_1875 [Cyanobium gracile PCC 6307]
Length=119

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 60/99 (61%), Gaps = 9/99 (9%)
 Frame = -1

Query  512  VIEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIM  333
            VIEKA           + RKTSP Y+VLLHND  N  EYVV  L +V+P ++   A+ +M
Sbjct  30   VIEKAP---------ERVRKTSPRYKVLLHNDPVNSMEYVVNTLRQVVPSLSEQDAIAVM  80

Query  332  QEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPAS  216
             EAH+ G+ +VI+C    AE +C  L+  GL S+IEP S
Sbjct  81   LEAHNTGVGLVIVCDLEPAEFYCETLKAKGLTSTIEPES  119



>ref|WP_017292606.1| hypothetical protein [Geminocystis herdmanii]
Length=96

 Score = 85.9 bits (211),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK    YRVLLHND+FN  EYVVQVLM+ + GM    AV++M E H NG+ +V  CA   
Sbjct  17   RKHDSGYRVLLHNDSFNSMEYVVQVLMETV-GMNEPQAVSVMMETHTNGIGLVTTCALEH  75

Query  278  AEEHCTQLRGNGLLSSIEPA  219
            AE +C  L+ +GL S+IEPA
Sbjct  76   AEFYCETLKSHGLTSTIEPA  95



>ref|WP_015170011.1| hypothetical protein [Synechococcus sp. PCC 7502]
 ref|YP_007107495.1| hypothetical protein Syn7502_03520 [Synechococcus sp. PCC 7502]
 gb|AFY75360.1| hypothetical protein Syn7502_03520 [Synechococcus sp. PCC 7502]
Length=93

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK +P YRVLLHND++N  EYVVQ LM+V+  +T   AV+IM  AH++G ++VI C Q  
Sbjct  13   RKIAPRYRVLLHNDDYNSMEYVVQSLMEVVNSVTQPQAVDIMMAAHNDGCALVITCVQEH  72

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +   L+  GL SSIEP
Sbjct  73   AEFYSEGLKSKGLSSSIEP  91



>ref|WP_035830954.1| Clp protease ClpS [Cyanobium sp. CACIAM 14]
Length=110

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 59/97 (61%), Gaps = 9/97 (9%)
 Frame = -1

Query  512  VIEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIM  333
            VIEKA           + RKTSP YRVLLHND  N  +YVV  L +V+P ++   AV +M
Sbjct  21   VIEKAP---------ERVRKTSPRYRVLLHNDPVNSMDYVVTTLRQVVPSLSEQDAVAVM  71

Query  332  QEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
             EAH+ G+ +VI+C    AE +C  L+  GL S+IEP
Sbjct  72   LEAHNTGVGLVIVCDLEPAEFYCESLKAKGLTSTIEP  108



>gb|KEF42363.1| Clp protease ClpS [Cyanobium sp. CACIAM 14]
Length=121

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 59/97 (61%), Gaps = 9/97 (9%)
 Frame = -1

Query  512  VIEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIM  333
            VIEKA           + RKTSP YRVLLHND  N  +YVV  L +V+P ++   AV +M
Sbjct  32   VIEKAP---------ERVRKTSPRYRVLLHNDPVNSMDYVVTTLRQVVPSLSEQDAVAVM  82

Query  332  QEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
             EAH+ G+ +VI+C    AE +C  L+  GL S+IEP
Sbjct  83   LEAHNTGVGLVIVCDLEPAEFYCESLKAKGLTSTIEP  119



>ref|WP_036021073.1| MULTISPECIES: Clp protease ClpS [Leptolyngbya]
Length=95

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            R+ +P YRVLLHND+FN  EYVV+ L+K +P +++  AV+IM +AH+ G+ +VI+C    
Sbjct  15   RQHAPRYRVLLHNDDFNSMEYVVESLVKTVPSLSVPQAVDIMMQAHNAGVGLVIVCELEH  74

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +   LR  GL S+IEP
Sbjct  75   AEFYSEMLRSKGLTSTIEP  93



>gb|EKV02567.1| hypothetical protein Lepto7375DRAFT_4804 [Leptolyngbya sp. PCC 
7375]
 gb|ESA31983.1| atp-dependent clp protease adaptor protein [Leptolyngbya sp. 
Heron Island J]
Length=96

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            R+ +P YRVLLHND+FN  EYVV+ L+K +P +++  AV+IM +AH+ G+ +VI+C    
Sbjct  16   RQHAPRYRVLLHNDDFNSMEYVVESLVKTVPSLSVPQAVDIMMQAHNAGVGLVIVCELEH  75

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +   LR  GL S+IEP
Sbjct  76   AEFYSEMLRSKGLTSTIEP  94



>ref|WP_015222385.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanobacterium 
stanieri]
 ref|YP_007164716.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanobacterium 
stanieri PCC 7202]
 gb|AFZ47067.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanobacterium 
stanieri PCC 7202]
Length=96

 Score = 85.1 bits (209),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            R+  P YRVLLHNDN+N  EYVVQVLM+ +  ++   AV++M E H NG+ +V  CA   
Sbjct  17   RRHDPGYRVLLHNDNYNTMEYVVQVLMETV-SLSEPQAVSVMMETHQNGIGLVTTCALEH  75

Query  278  AEEHCTQLRGNGLLSSIEPA  219
            AE +C  L+  GL S+IEPA
Sbjct  76   AEFYCESLKSRGLTSTIEPA  95



>ref|WP_017297669.1| hypothetical protein [Nodosilinea nodulosa]
Length=95

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            +K +P YRVLLHND+FN  EYVV+ L+KV+P +T+  AV+IM +AH  G+++VI CA   
Sbjct  15   KKPAPRYRVLLHNDDFNSMEYVVESLIKVVPSLTMPQAVDIMMQAHTAGVALVITCAMEH  74

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +   L   GL S+IEP
Sbjct  75   AEFYSEGLCNLGLSSTIEP  93



>ref|WP_035994184.1| Clp protease ClpS [Leptolyngbya sp. KIOST-1]
Length=90

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            +K +P YRVLLHND+FN  EYVV+ L+KV+P +T+  AV+IM +AH  G+++VI CA   
Sbjct  10   QKPAPRYRVLLHNDDFNSMEYVVESLIKVVPSLTMAQAVDIMMQAHTAGVALVITCAMEH  69

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +   L   GL S+IEP
Sbjct  70   AEFYSEGLCNLGLSSTIEP  88



>ref|WP_006042274.1| ATP-dependent Clp protease ClpS [Synechococcus sp. WH 7805]
 gb|EAR19149.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. WH 7805]
Length=104

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 59/94 (63%), Gaps = 2/94 (2%)
 Frame = -1

Query  497  TPGRQSEFDL--RKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            TPG  +  D    + RK SP Y+VLLHND  N  EYVV  L +V+P ++   A+ +M EA
Sbjct  9    TPGGAAVLDKAPERVRKQSPRYKVLLHNDPVNSMEYVVSTLRQVVPQLSEQDAMAVMLEA  68

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
            H+ G+ +VI+C    AE +C  L+G GL S++EP
Sbjct  69   HNTGVGLVIVCDLEPAEFYCETLKGKGLTSTLEP  102



>ref|WP_012954369.1| ATP-dependent Clp protease ClpS [Candidatus Atelocyanobacterium 
thalassa]
 ref|YP_003422063.1| hypothetical protein UCYN_10070 [Candidatus Atelocyanobacterium 
thalassa]
 gb|ADB95682.1| uncharacterized conserved protein [Candidatus Atelocyanobacterium 
thalassa isolate ALOHA]
Length=97

 Score = 83.2 bits (204),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 61/97 (63%), Gaps = 6/97 (6%)
 Frame = -1

Query  512  VIEKATPGRQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIM  333
            VIEK +       +   ++K  P Y+VLLHND+FN  +YVVQ+LM+ I GMT   A  IM
Sbjct  5    VIEKIS------LNTSTTKKPVPRYKVLLHNDDFNPMDYVVQILMQTISGMTRPQAAEIM  58

Query  332  QEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
             EAH +G ++VI CA   AE +   L+ +GL SSIEP
Sbjct  59   MEAHISGTALVITCAFEPAEFYRETLKNHGLSSSIEP  95



>ref|WP_011932293.1| ATP-dependent Clp protease ClpS [Synechococcus sp. WH 7803]
 ref|YP_001224092.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. WH 7803]
 emb|CAK22795.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. WH 7803]
Length=106

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 59/94 (63%), Gaps = 2/94 (2%)
 Frame = -1

Query  497  TPGRQSEFDL--RKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            TPG  +  +    + RK SP Y+VLLHND  N  EYVV  L +V+P ++   A+ +M EA
Sbjct  11   TPGGAAVLEKAPERVRKQSPRYKVLLHNDPVNSMEYVVSTLRQVVPQLSEQDAMAVMLEA  70

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
            H+ G+ +VI+C    AE +C  L+G GL S+IEP
Sbjct  71   HNTGVGLVIVCDLEPAEFYCETLKGKGLTSTIEP  104



>ref|WP_011618343.1| ATP-dependent Clp protease ClpS [Synechococcus sp. CC9311]
 ref|YP_729603.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. CC9311]
 gb|ABI46551.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. CC9311]
Length=103

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = -1

Query  497  TPGRQSEFD--LRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            +PG  +  D    + RKTSP Y+VLLHND  N  EYVV  L +V+P ++   A+ +M E 
Sbjct  8    SPGGAAVLDKQTERVRKTSPRYKVLLHNDPVNSMEYVVVTLQQVVPQLSEQDAMAVMLET  67

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPAS  216
            H+ G+ +VI+C    AE +C  L+  GL S+IEP S
Sbjct  68   HNTGIGLVIVCDIEPAEFYCETLKNKGLTSTIEPES  103



>ref|WP_006909265.1| ATP-dependent Clp protease ClpS [Cyanobium sp. PCC 7001]
 gb|EDY37362.1| ATP-dependent Clp protease adaptor protein ClpS [Cyanobium sp. 
PCC 7001]
Length=113

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 59/97 (61%), Gaps = 5/97 (5%)
 Frame = -1

Query  497  TPGRQS-----EFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIM  333
            TP R+S     E    + RK SP Y+VLLHND  N  EYVV  L +V+P ++   A+ +M
Sbjct  15   TPSRESGAAVMEKAPERVRKPSPRYKVLLHNDPVNSMEYVVTTLRQVVPSLSEQDAIAVM  74

Query  332  QEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
             EAH+ G+ +VI+C    AE +C  L+  GL S++EP
Sbjct  75   LEAHNTGVGLVIVCDLEPAEFYCETLKAKGLTSTLEP  111



>gb|AII46872.1| ATP-dependent Clp protease ClpS [Synechococcus sp. KORDI-49]
Length=112

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -1

Query  467  RKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICA  288
             + RK SP Y+VLLHND  N  EYVV  L +V+P ++   A+ +M EAH+ G+ +VI+C 
Sbjct  29   ERVRKQSPRYKVLLHNDPVNTMEYVVTTLQQVVPQLSEQDAMAVMMEAHNTGVGLVIVCD  88

Query  287  QVDAEEHCTQLRGNGLLSSIEPAS  216
               AE +C  L+  GL S+IEP S
Sbjct  89   LEPAEFYCETLKAKGLTSTIEPES  112



>ref|WP_036919246.1| MULTISPECIES: Clp protease ClpS [Prochlorococcus]
 gb|KGG15833.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus 
sp. MIT 0603]
Length=103

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 59/89 (66%), Gaps = 4/89 (4%)
 Frame = -1

Query  488  RQSEFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGL  309
            RQ+E    K RK SP Y+VLLHND  N  +YVV+ L +V+P ++   A+++M E H+NG+
Sbjct  17   RQTE----KVRKISPRYKVLLHNDPINSMDYVVKTLREVVPQLSEQDAMSVMLETHNNGI  72

Query  308  SVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
             +VI C    AE +C  L+  GL+S+IEP
Sbjct  73   GLVITCDLEPAEFYCESLKSRGLISTIEP  101



>ref|WP_006172323.1| ATP-dependent Clp protease ClpS [Synechococcus sp. WH 5701]
 gb|EAQ75403.1| hypothetical protein WH5701_01105 [Synechococcus sp. WH 5701]
Length=109

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = -1

Query  479  EFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVV  300
            E ++++ RK SP YRVLLHND  N  EYVV  L +V+P ++   A+ +M EAH+ G+ +V
Sbjct  22   EKEVQRVRKPSPRYRVLLHNDPVNSMEYVVTTLRQVVPSLSEQDAIAVMLEAHNTGVGLV  81

Query  299  IICAQVDAEEHCTQLRGNGLLSSIEPAS  216
            I+C    AE +   L+  GL S+IEP S
Sbjct  82   IVCDLEPAEFYSETLKAKGLSSTIEPES  109



>ref|WP_010311913.1| ATP-dependent Clp protease ClpS [Synechococcus sp. CB0101]
Length=121

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 60/100 (60%), Gaps = 6/100 (6%)
 Frame = -1

Query  497  TPGRQS------EFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNI  336
            TPGR+S      E    + RK SP Y+VLLHND  N  EYVV  L +V+P ++   A+ +
Sbjct  22   TPGRESGGGAVMEKAPERVRKPSPRYKVLLHNDPVNTMEYVVGTLRQVVPSLSEQDAIAV  81

Query  335  MQEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPAS  216
            M EAH+ G+ +VI+C    AE +   L+  GL S+IEP S
Sbjct  82   MLEAHNTGVGLVIVCDIEPAEFYSETLKAKGLTSTIEPES  121



>ref|WP_007099822.1| ATP-dependent Clp protease ClpS [Synechococcus sp. RS9916]
 gb|EAU72769.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. RS9916]
Length=104

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 59/95 (62%), Gaps = 2/95 (2%)
 Frame = -1

Query  494  PGRQSEFD--LRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
            PG  +  D    + RK SP Y+VLLHND  N  EYVV  L +V+P ++   A+ +M EAH
Sbjct  10   PGGAAVLDKQTERVRKRSPRYKVLLHNDPVNSMEYVVSTLQQVVPQLSEQDAMAVMLEAH  69

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPAS  216
            ++G+ +VI+C    AE +C  L+  GL S++EP S
Sbjct  70   NSGVGLVIVCDLEPAEFYCETLKAKGLTSTLEPES  104



>ref|WP_011936594.1| ATP-dependent Clp protease ClpS [Synechococcus sp. RCC307]
 ref|YP_001228436.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. RCC307]
 emb|CAK29083.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. RCC307]
Length=107

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = -1

Query  458  RKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQVD  279
            RK SP YRVLLHND  N  EYVV  L +V+P ++   A+ +M EAH++G+ +VI+C    
Sbjct  27   RKPSPRYRVLLHNDPVNSMEYVVTSLREVVPSLSEQDAMAVMLEAHNSGVGLVIVCDIEP  86

Query  278  AEEHCTQLRGNGLLSSIEP  222
            AE +C  L+  GL S+IEP
Sbjct  87   AEFYCESLKAKGLTSTIEP  105



>ref|WP_006854765.1| ATP-dependent Clp protease ClpS [Synechococcus sp. WH 8016]
 gb|EHA59262.1| ATP-dependent Clp protease adapter protein clpS [Synechococcus 
sp. WH 8016]
Length=103

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = -1

Query  497  TPGRQSEFD--LRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            +PG  +  D    + RKTSP Y+VLLHND  N  EYVV  L +V+P ++   A+ +M E 
Sbjct  8    SPGGAAVLDKQTERVRKTSPRYKVLLHNDPVNSMEYVVVTLQQVVPQLSEQDAMAVMLET  67

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
            H+ G+ +VI+C    AE +C  L+  GL S+IEP
Sbjct  68   HNTGVGLVIVCDIEPAEFYCETLKNKGLTSTIEP  101



>ref|WP_026100735.1| Clp protease ClpS [Synechococcus sp. PCC 7336]
Length=94

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -1

Query  461  SRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQV  282
             RK  P YRVLLHND++   EYV++VL++ IP M    A  IM EAH NG +VVI+  + 
Sbjct  13   DRKPMPMYRVLLHNDDYTPMEYVIEVLVQTIPAMQPPQAREIMLEAHTNGSAVVIVVPKE  72

Query  281  DAEEHCTQLRGNGLLSSIEP  222
             AE +  QL+ +GL+S+IEP
Sbjct  73   HAEFYKEQLQNHGLISTIEP  92



>ref|WP_038001626.1| Clp protease ClpS [Synechococcus sp. RS9917]
Length=104

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = -1

Query  500  ATPGRQSEFD--LRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQE  327
             +PG  +  D    + RK SP Y+VLLHND  N  EYVV  L +V+P ++   A+ +M E
Sbjct  8    TSPGGAAVLDKQTERVRKHSPRYKVLLHNDPVNTMEYVVTTLRQVVPQLSEQDAMAVMLE  67

Query  326  AHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPAS  216
            AH+ G+ +VI+C    AE +C  L+  GL S++EP +
Sbjct  68   AHNTGVGLVIVCDLEPAEFYCETLKAKGLTSTLEPET  104



>ref|WP_011129004.1| ATP-dependent Clp protease ClpS [Synechococcus sp. WH 8102]
 ref|NP_898239.2| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. WH 8102]
Length=106

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -1

Query  464  KSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQ  285
            + RK SP Y+VLLHND  N  EYVV  L +V+P ++   A+ +M EAH+ G+ +VI+C  
Sbjct  24   RVRKQSPRYKVLLHNDPVNTMEYVVTTLRQVVPQLSEQDAMAVMIEAHNTGVGLVIVCDL  83

Query  284  VDAEEHCTQLRGNGLLSSIEPAS  216
              AE +C  L+  GL S+IEP +
Sbjct  84   EPAEFYCETLKAKGLTSTIEPET  106



>ref|WP_011363337.1| ATP-dependent Clp protease ClpS [Synechococcus sp. CC9605]
 ref|YP_380641.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. CC9605]
 gb|ABB34086.1| conserved hypothetical protein [Synechococcus sp. CC9605]
Length=106

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = -1

Query  494  PGRQSEFDL--RKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
            PG  +  D    K RK SP Y+VLLHND  N  EYVV  L +V+P ++    + +M EAH
Sbjct  12   PGGAAVLDKAPEKVRKRSPRYKVLLHNDPVNSMEYVVATLQQVVPQLSEQDCMAVMLEAH  71

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
            + G+ +VI+C    AE +C  L+  GL SSIEP
Sbjct  72   NTGVGLVIVCDIEPAEFYCETLKSKGLTSSIEP  104



>ref|WP_010314591.1| ATP-dependent Clp protease ClpS [Synechococcus sp. CB0205]
Length=106

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 58/97 (60%), Gaps = 6/97 (6%)
 Frame = -1

Query  494  PGRQS------EFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIM  333
            PGR+S      E    + RK SP Y+VLLHND  N  EYVV  L +V+P ++   A+ +M
Sbjct  8    PGRESGGAAVMEKAPERVRKPSPRYKVLLHNDPVNTMEYVVSTLRQVVPSLSEQDAIAVM  67

Query  332  QEAHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
             EAH+ G+ +VI+C    AE +   L+  GL S+IEP
Sbjct  68   MEAHNTGVGLVIVCDIEPAEFYSETLKAKGLSSTIEP  104



>gb|EAQ68612.1| hypothetical protein RS9917_03483 [Synechococcus sp. RS9917]
Length=111

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = -1

Query  500  ATPGRQSEFD--LRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQE  327
             +PG  +  D    + RK SP Y+VLLHND  N  EYVV  L +V+P ++   A+ +M E
Sbjct  15   TSPGGAAVLDKQTERVRKHSPRYKVLLHNDPVNTMEYVVTTLRQVVPQLSEQDAMAVMLE  74

Query  326  AHHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPAS  216
            AH+ G+ +VI+C    AE +C  L+  GL S++EP +
Sbjct  75   AHNTGVGLVIVCDLEPAEFYCETLKAKGLTSTLEPET  111



>ref|WP_011360779.1| ATP-dependent Clp protease ClpS [Synechococcus sp. CC9902]
 ref|YP_378033.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. CC9902]
 sp|Q3AUR5.1|CLPS_SYNS9 RecName: Full=ATP-dependent Clp protease adapter protein ClpS 
[Synechococcus sp. CC9902]
 gb|ABB26990.1| conserved hypothetical protein [Synechococcus sp. CC9902]
Length=104

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = -1

Query  497  TPGRQSEFDL--RKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            +PG  +  D    + RK SP Y+VLLHND  N  EYV+  L +V+P ++   A+ +M EA
Sbjct  9    SPGGAAVLDKAPERVRKRSPRYKVLLHNDPVNSMEYVMTTLRQVVPQLSEQDAMAVMLEA  68

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
            H+ G+ +VI+C    AE +C  L+  GL SSIEP
Sbjct  69   HNTGVGLVIVCDIEPAEFYCETLKSKGLTSSIEP  102



>emb|CAE08663.1| conserved hypothetical protein [Synechococcus sp. WH 8102]
Length=154

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -1

Query  464  KSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQ  285
            + RK SP Y+VLLHND  N  EYVV  L +V+P ++   A+ +M EAH+ G+ +VI+C  
Sbjct  72   RVRKQSPRYKVLLHNDPVNTMEYVVTTLRQVVPQLSEQDAMAVMIEAHNTGVGLVIVCDL  131

Query  284  VDAEEHCTQLRGNGLLSSIEPAS  216
              AE +C  L+  GL S+IEP +
Sbjct  132  EPAEFYCETLKAKGLTSTIEPET  154



>ref|WP_009788857.1| MULTISPECIES: ATP-dependent Clp protease ClpS [Synechococcus]
 gb|EAU71501.1| ATP-dependent Clp protease adaptor protein ClpS [Synechococcus 
sp. BL107]
Length=104

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = -1

Query  497  TPGRQSEFDL--RKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            +PG  +  D    + RK SP Y+VLLHND  N  EYV+  L +V+P ++   A+ +M EA
Sbjct  9    SPGGAAVLDKAPERVRKRSPRYKVLLHNDPVNSMEYVMATLRQVVPQLSEQDAMAVMLEA  68

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
            H+ G+ +VI+C    AE +C  L+  GL S+IEP
Sbjct  69   HNTGIGLVIVCDIEPAEFYCETLKSKGLTSTIEP  102



>gb|AHF62724.1| Clp protease adaptor [Synechococcus sp. WH 8109]
Length=104

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = -1

Query  494  PGRQSEFDL--RKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
            PG  +  D    + RK SP Y+VLLHND  N  EYVV  L +V+P ++    + +M EAH
Sbjct  10   PGGAAVLDKAPERVRKRSPRYKVLLHNDPVNSMEYVVATLQQVVPQLSEQDCMAVMLEAH  69

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
            + G+ +VI+C    AE +C  L+  GL SSIEP
Sbjct  70   NTGVGLVIVCDIEPAEFYCEMLKSKGLTSSIEP  102



>ref|WP_038543023.1| Clp protease ClpS [Synechococcus sp. KORDI-100]
 gb|AII42357.1| ATP-dependent Clp protease ClpS [Synechococcus sp. KORDI-100]
Length=106

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = -1

Query  467  RKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICA  288
             + RK SP Y+VLLHND  N  EYVV  L +V+P ++   A+ +M EAH+ G+ +VI+C 
Sbjct  23   ERVRKRSPRYKVLLHNDPVNTMEYVVGTLCEVVPQLSEQDAMAVMLEAHNTGVGLVIVCD  82

Query  287  QVDAEEHCTQLRGNGLLSSIEP  222
               AE +C  L+  GL S+IEP
Sbjct  83   LEPAEFYCETLKSKGLTSTIEP  104



>ref|WP_011125804.1| ATP-dependent Clp protease ClpS [Prochlorococcus marinus]
 ref|NP_876045.1| Uncharacterized conserved protein [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gb|AAQ00698.1| Uncharacterized conserved protein [Prochlorococcus marinus subsp. 
marinus str. CCMP1375]
 gb|KGG10806.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus 
marinus str. LG]
 gb|KGG20384.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus 
marinus str. SS2]
 gb|KGG24054.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus 
marinus str. SS35]
 gb|KGG31687.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus 
marinus str. SS51]
 gb|KGG34754.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus 
sp. SS52]
Length=103

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -1

Query  494  PGRQSEFD--LRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
            PG  +  D    + RKTSP Y+VLLHND  N  +YVV  L +V+P ++   A+ +M E H
Sbjct  9    PGGAAVVDKQTERVRKTSPRYKVLLHNDPVNTMDYVVTTLRQVVPQLSEQDAMAVMLETH  68

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPAS  216
            + G+ +VI C    AE +   L+G GL S+IEP S
Sbjct  69   NTGIGLVITCDLEPAEFYSESLKGKGLTSTIEPES  103



>ref|WP_036892518.1| MULTISPECIES: Clp protease ClpS [Prochlorococcus]
Length=106

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -1

Query  494  PGRQSEFD--LRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
            PG  +  D    + RKTSP Y+VLLHND  N  +YVV  L +V+P ++   A+ +M E H
Sbjct  12   PGGAAVVDKQTERVRKTSPRYKVLLHNDPVNTMDYVVTTLRQVVPQLSEQDAMAVMLETH  71

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPAS  216
            + G+ +VI C    AE +   L+G GL S+IEP S
Sbjct  72   NTGIGLVITCDLEPAEFYSESLKGKGLTSTIEPES  106



>ref|WP_011295410.1| ATP-dependent Clp protease ClpS [Prochlorococcus marinus]
 ref|YP_292258.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus 
marinus str. NATL2A]
 gb|AAZ58555.1| conserved hypothetical protein [Prochlorococcus marinus str. 
NATL2A]
Length=123

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = -1

Query  497  TPGRQSEFD--LRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            T G  +  D  +++ RK SP Y+VLLHND  N  +YVV++L +V+P ++   A+NIM E 
Sbjct  28   TDGDTAVIDREVQRVRKISPKYKVLLHNDPVNTMDYVVEILRQVVPQLSEQDALNIMLET  87

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPAS  216
            H+NG+ +VI C    AE +   L+  GL S+IE  S
Sbjct  88   HNNGVGLVITCDLEPAEFYSESLKAKGLTSTIELES  123



>ref|WP_038551312.1| Clp protease ClpS [Synechococcus sp. KORDI-52]
 gb|AII47725.1| ATP-dependent Clp protease ClpS [Synechococcus sp. KORDI-52]
Length=106

 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = -1

Query  494  PGRQSEFDL--RKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAH  321
            PG  +  D    + RK SP Y+VLLHND  N  EYVV  L +V+P ++    + +M EAH
Sbjct  12   PGGAAVLDKAPERVRKRSPRYKVLLHNDPVNSMEYVVATLQQVVPQLSEQDCMAVMLEAH  71

Query  320  HNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEP  222
            + G+ +VI+C    AE +C  L+  GL S+IEP
Sbjct  72   NTGVGLVIVCDIEPAEFYCEMLKSKGLTSTIEP  104



>gb|AIQ98095.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus 
sp. MIT 0801]
Length=119

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = -1

Query  497  TPGRQSEFD--LRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            T G  +  D  +++ RK SP Y+VLLHND  N  +YVV+ L +V+P ++   A+NIM E 
Sbjct  24   TDGDTAVIDREVQRVRKISPKYKVLLHNDPVNTMDYVVETLRQVVPQLSEQDALNIMLET  83

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPAS  216
            H+NG+ +VI C    AE +   L+  GL S+IE  S
Sbjct  84   HNNGVGLVITCDLEPAEFYSESLKAKGLTSTIELES  119



>ref|WP_037991069.1| Clp protease ClpS [Synechococcus sp. CC9616]
Length=106

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = -1

Query  464  KSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEAHHNGLSVVIICAQ  285
            + RK SP Y+VLLHND  N  EYVV  L +V+P ++    + +M EAH+ G+ +VI+C  
Sbjct  24   RVRKRSPRYKVLLHNDPVNSMEYVVTTLRQVVPQLSEQDCMAVMLEAHNTGVGLVIVCDL  83

Query  284  VDAEEHCTQLRGNGLLSSIEP  222
              AE +C  L+  GL S+IEP
Sbjct  84   EPAEFYCETLKSKGLTSTIEP  104



>ref|WP_038654246.1| Clp protease ClpS [Prochlorococcus sp. MIT 0801]
Length=123

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = -1

Query  497  TPGRQSEFD--LRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            T G  +  D  +++ RK SP Y+VLLHND  N  +YVV+ L +V+P ++   A+NIM E 
Sbjct  28   TDGDTAVIDREVQRVRKISPKYKVLLHNDPVNTMDYVVETLRQVVPQLSEQDALNIMLET  87

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIEPAS  216
            H+NG+ +VI C    AE +   L+  GL S+IE  S
Sbjct  88   HNNGVGLVITCDLEPAEFYSESLKAKGLTSTIELES  123



>ref|WP_011131159.1| ATP-dependent Clp protease ClpS [Prochlorococcus marinus]
 ref|NP_895619.1| ATP-dependent Clp protease adaptor protein ClpS [Prochlorococcus 
marinus str. MIT 9313]
 emb|CAE21967.1| conserved hypothetical protein [Prochlorococcus marinus str. 
MIT 9313]
Length=130

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -1

Query  497  TPGRQS--EFDLRKSRKTSPPYRVLLHNDNFNKREYVVQVLMKVIPGMTLDIAVNIMQEA  324
            TPG  +  E    + RK SP Y+VLLHND  N  EYVV  L +V+P ++   A+ +M EA
Sbjct  35   TPGGAAVLEKQTERIRKQSPHYKVLLHNDPVNSMEYVVVTLQQVVPQLSEQDAMAVMLEA  94

Query  323  HHNGLSVVIICAQVDAEEHCTQLRGNGLLSSIE  225
            H+ G+ +VI+C    AE +C  L+  GL S++E
Sbjct  95   HNTGVGLVIVCDLEPAEFYCETLKAKGLTSTLE  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1166488890696