BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1685_g1_i1 len=227 path=[1:0-226]

Length=227
                                                                      Score     E

ref|XP_009625530.1|  PREDICTED: putative germin-like protein 2-1        129   5e-35   
emb|CDP10693.1|  unnamed protein product                                129   6e-35   
ref|XP_004230405.1|  PREDICTED: germin-like protein subfamily 1 m...    128   9e-35   
ref|XP_009612542.1|  PREDICTED: putative germin-like protein 2-1        128   9e-35   
ref|XP_009620404.1|  PREDICTED: germin-like protein subfamily 1 m...    128   1e-34   
ref|XP_009786127.1|  PREDICTED: putative germin-like protein 2-1        128   2e-34   
ref|XP_004230403.1|  PREDICTED: putative germin-like protein 2-1        127   2e-34   
ref|XP_009620876.1|  PREDICTED: putative germin-like protein 2-1        127   3e-34   
ref|XP_006349264.1|  PREDICTED: germin-like protein subfamily 1 m...    127   3e-34   
ref|XP_006349268.1|  PREDICTED: germin-like protein subfamily 1 m...    127   3e-34   
ref|XP_006349261.1|  PREDICTED: putative germin-like protein 2-1-...    127   3e-34   
ref|XP_009795503.1|  PREDICTED: germin-like protein subfamily 1 m...    127   3e-34   
ref|XP_009784933.1|  PREDICTED: germin-like protein subfamily 1 m...    127   3e-34   
ref|XP_009612543.1|  PREDICTED: germin-like protein subfamily 1 m...    127   4e-34   
emb|CDP10694.1|  unnamed protein product                                126   5e-34   
ref|XP_009795501.1|  PREDICTED: putative germin-like protein 2-1        126   5e-34   
ref|XP_009786129.1|  PREDICTED: putative germin-like protein 2-1        126   6e-34   
emb|CDP10701.1|  unnamed protein product                                126   1e-33   
emb|CDP10695.1|  unnamed protein product                                125   1e-33   
ref|XP_006346966.1|  PREDICTED: putative germin-like protein 2-1-...    125   1e-33   
gb|AFW90592.1|  germin-like protein subfamily 1 member 20 precursor     125   1e-33   
ref|XP_006349267.1|  PREDICTED: germin-like protein subfamily 1 m...    125   1e-33   
gb|EYU20542.1|  hypothetical protein MIMGU_mgv1a020630mg                125   2e-33   
ref|XP_004230404.1|  PREDICTED: putative germin-like protein 2-1        125   2e-33   
gb|EYU20545.1|  hypothetical protein MIMGU_mgv1a020779mg                125   2e-33   
gb|EYU20549.1|  hypothetical protein MIMGU_mgv1a020596mg                125   2e-33   
ref|XP_006358459.1|  PREDICTED: germin-like protein subfamily 1 m...    125   2e-33   
gb|EYU20539.1|  hypothetical protein MIMGU_mgv1a013072mg                125   3e-33   
ref|XP_009627660.1|  PREDICTED: germin-like protein subfamily 1 m...    125   3e-33   
ref|XP_009612541.1|  PREDICTED: germin-like protein subfamily 1 m...    124   3e-33   
ref|XP_006358464.1|  PREDICTED: germin-like protein subfamily 1 m...    124   3e-33   
gb|EYU20547.1|  hypothetical protein MIMGU_mgv1a023357mg                124   3e-33   
gb|EYU20536.1|  hypothetical protein MIMGU_mgv1a025658mg                124   4e-33   
gb|EYU20548.1|  hypothetical protein MIMGU_mgv1a013109mg                124   7e-33   
gb|EYU28622.1|  hypothetical protein MIMGU_mgv1a018753mg                123   8e-33   
ref|XP_011099652.1|  PREDICTED: putative germin-like protein 2-1        123   8e-33   
gb|EYU38444.1|  hypothetical protein MIMGU_mgv1a013102mg                123   9e-33   
ref|XP_009620917.1|  PREDICTED: germin-like protein subfamily 1 m...    123   1e-32   
ref|XP_006358462.1|  PREDICTED: germin-like protein subfamily 1 m...    123   1e-32   
gb|EYU40211.1|  hypothetical protein MIMGU_mgv1a013108mg                123   1e-32   
gb|EYU20541.1|  hypothetical protein MIMGU_mgv1a018988mg                123   1e-32   
gb|EYU20535.1|  hypothetical protein MIMGU_mgv1a013054mg                122   2e-32   
ref|XP_006358460.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    122   2e-32   
ref|XP_006358463.1|  PREDICTED: germin-like protein subfamily 1 m...    122   3e-32   
ref|XP_006358461.1|  PREDICTED: germin-like protein subfamily 1 m...    122   3e-32   
gb|EYU40208.1|  hypothetical protein MIMGU_mgv1a020439mg                122   4e-32   
ref|XP_011099651.1|  PREDICTED: germin-like protein subfamily 1 m...    121   6e-32   
gb|EYU40210.1|  hypothetical protein MIMGU_mgv1a022317mg                120   8e-32   
gb|EYU40209.1|  hypothetical protein MIMGU_mgv1a013129mg                119   4e-31   
gb|EYU20540.1|  hypothetical protein MIMGU_mgv1a013117mg                119   4e-31   
gb|EYU20546.1|  hypothetical protein MIMGU_mgv1a013111mg                119   5e-31   
ref|XP_006349265.1|  PREDICTED: germin-like protein subfamily 1 m...    119   5e-31   
emb|CDP16787.1|  unnamed protein product                                117   2e-30   
emb|CDP16791.1|  unnamed protein product                                117   2e-30   
ref|XP_010251871.1|  PREDICTED: putative germin-like protein 2-1        117   3e-30   
ref|XP_006349263.1|  PREDICTED: germin-like protein subfamily 1 m...    117   3e-30   
emb|CDP22064.1|  unnamed protein product                                115   9e-30   
emb|CDP16790.1|  unnamed protein product                                115   1e-29   
emb|CDP16788.1|  unnamed protein product                                115   1e-29   
gb|AAM76225.1|  putative germin E protein precursor                     114   2e-29   Gossypium herbaceum [Arabian cotton]
ref|XP_010251869.1|  PREDICTED: putative germin-like protein 2-1 ...    114   2e-29   
gb|AAM76227.1|  putative germin E protein precursor                     113   2e-29   Gossypium hirsutum [American cotton]
ref|XP_010251870.1|  PREDICTED: putative germin-like protein 2-1 ...    114   2e-29   
gb|AAM76226.1|  putative germin E protein precursor                     113   2e-29   Gossypium raimondii
emb|CDP16789.1|  unnamed protein product                                117   3e-29   
emb|CDP21353.1|  unnamed protein product                                117   3e-29   
ref|XP_010251867.1|  PREDICTED: putative germin-like protein 2-1        114   4e-29   
ref|XP_010251872.1|  PREDICTED: putative germin-like protein 2-1        113   6e-29   
ref|XP_007030280.1|  RmlC-like cupins superfamily protein isoform 1     112   1e-28   
ref|XP_007030284.1|  RmlC-like cupins superfamily protein               112   1e-28   
ref|XP_007030281.1|  RmlC-like cupins superfamily protein isoform 2     112   1e-28   
emb|CDP16786.1|  unnamed protein product                                117   2e-28   
ref|XP_007030272.1|  RmlC-like cupins superfamily protein               111   3e-28   
gb|AAM76229.1|  putative germin E protein precursor                     110   3e-28   Gossypioides kirkii
ref|XP_007030289.1|  RmlC-like cupins superfamily protein               111   4e-28   
ref|XP_007030176.1|  Germin-like protein subfamily 1 member 18          112   5e-28   
ref|XP_010241946.1|  PREDICTED: putative germin-like protein 2-1        110   5e-28   
ref|XP_002530594.1|  Rhicadhesin receptor precursor, putative           109   7e-28   Ricinus communis
ref|XP_010257844.1|  PREDICTED: putative germin-like protein 2-1        110   7e-28   
ref|XP_008780761.1|  PREDICTED: germin-like protein 8-5                 108   9e-28   
ref|XP_007030267.1|  Germin-like protein subfamily 1 member 18          112   9e-28   
ref|XP_002531991.1|  Rhicadhesin receptor precursor, putative           109   1e-27   Ricinus communis
ref|XP_002276644.1|  PREDICTED: putative germin-like protein 2-1        110   1e-27   Vitis vinifera
ref|XP_002265608.1|  PREDICTED: putative germin-like protein 2-1        110   1e-27   Vitis vinifera
ref|XP_002276315.2|  PREDICTED: putative germin-like protein 2-1        110   1e-27   Vitis vinifera
ref|XP_003633724.1|  PREDICTED: putative germin-like protein 2-1        110   1e-27   
emb|CBI33612.3|  unnamed protein product                                110   1e-27   
emb|CBI33611.3|  unnamed protein product                                111   1e-27   
ref|XP_010907049.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    109   1e-27   
emb|CAN70189.1|  hypothetical protein VITISV_016562                     109   2e-27   Vitis vinifera
ref|XP_002531992.1|  Rhicadhesin receptor precursor, putative           109   2e-27   Ricinus communis
ref|XP_003633723.2|  PREDICTED: putative germin-like protein 2-1        109   2e-27   
ref|XP_010911724.1|  PREDICTED: putative germin-like protein 2-1        109   2e-27   
ref|XP_009113441.1|  PREDICTED: germin-like protein subfamily 1 m...    109   2e-27   
emb|CBI33610.3|  unnamed protein product                                111   2e-27   
ref|XP_002530595.1|  Oxalate oxidase 2 precursor, putative              108   2e-27   Ricinus communis
ref|XP_002265857.1|  PREDICTED: putative germin-like protein 2-1        109   2e-27   Vitis vinifera
ref|XP_004301229.1|  PREDICTED: germin-like protein subfamily 1 m...    108   2e-27   
emb|CAN66771.1|  hypothetical protein VITISV_022559                     108   2e-27   Vitis vinifera
ref|XP_007030270.1|  Germin-like protein subfamily 1 member 18          110   3e-27   
ref|XP_007030278.1|  Germin-like protein subfamily 1 member 18          112   3e-27   
ref|XP_007030273.1|  RmlC-like cupins superfamily protein               109   3e-27   
ref|XP_007030274.1|  Germin-like protein subfamily 1 member 18          113   3e-27   
ref|XP_008237524.1|  PREDICTED: germin-like protein subfamily 1 m...    108   3e-27   
emb|CAN74828.1|  hypothetical protein VITISV_002139                     108   3e-27   Vitis vinifera
ref|XP_008237522.1|  PREDICTED: germin-like protein subfamily 1 m...    108   3e-27   
ref|XP_008375054.1|  PREDICTED: germin-like protein subfamily 1 m...    108   3e-27   
ref|XP_006856738.1|  hypothetical protein AMTR_s03266p00004160          107   4e-27   
ref|XP_008237526.1|  PREDICTED: germin-like protein subfamily 1 m...    108   4e-27   
ref|XP_007200157.1|  hypothetical protein PRUPE_ppa016753mg             108   4e-27   
ref|XP_010911182.1|  PREDICTED: putative germin-like protein 2-1        108   4e-27   
emb|CAN71631.1|  hypothetical protein VITISV_015711                     108   4e-27   Vitis vinifera
ref|XP_010251866.1|  PREDICTED: putative germin-like protein 2-1        108   4e-27   
emb|CDX95190.1|  BnaC09g16800D                                          107   4e-27   
ref|XP_007201862.1|  hypothetical protein PRUPE_ppa020162mg             108   4e-27   
ref|XP_007200183.1|  hypothetical protein PRUPE_ppa016284mg             108   5e-27   
ref|XP_011034308.1|  PREDICTED: germin-like protein subfamily 1 m...    108   5e-27   
ref|XP_010659820.1|  PREDICTED: germin-like protein 3 isoform X1        107   5e-27   
ref|XP_011034305.1|  PREDICTED: germin-like protein subfamily 1 m...    108   5e-27   
emb|CDP10698.1|  unnamed protein product                                108   6e-27   
ref|XP_007200176.1|  hypothetical protein PRUPE_ppa016529mg             108   6e-27   
emb|CBI36816.3|  unnamed protein product                                108   6e-27   
ref|XP_008351931.1|  PREDICTED: germin-like protein subfamily 1 m...    108   6e-27   
ref|XP_008393483.1|  PREDICTED: germin-like protein subfamily 1 m...    108   6e-27   
ref|XP_004952511.1|  PREDICTED: putative germin-like protein 2-2-...    108   6e-27   
ref|XP_008363404.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    108   6e-27   
ref|XP_002525480.1|  Rhicadhesin receptor precursor, putative           107   6e-27   Ricinus communis
ref|XP_007199217.1|  hypothetical protein PRUPE_ppa021882mg             108   6e-27   
ref|XP_002452098.1|  hypothetical protein SORBIDRAFT_04g019650          108   6e-27   Sorghum bicolor [broomcorn]
gb|KDO38410.1|  hypothetical protein CISIN_1g048538mg                   107   7e-27   
emb|CBI36815.3|  unnamed protein product                                108   7e-27   
ref|XP_002276756.2|  PREDICTED: putative germin-like protein 2-1        108   7e-27   Vitis vinifera
ref|XP_002277055.1|  PREDICTED: putative germin-like protein 2-1        108   7e-27   Vitis vinifera
emb|CBI39473.3|  unnamed protein product                                107   7e-27   
ref|XP_008237521.1|  PREDICTED: germin-like protein subfamily 1 m...    108   8e-27   
ref|XP_009349816.1|  PREDICTED: germin-like protein subfamily 1 m...    107   8e-27   
ref|XP_006857270.1|  hypothetical protein AMTR_s00067p00014150          107   8e-27   
ref|XP_008393146.1|  PREDICTED: germin-like protein subfamily 1 m...    107   8e-27   
ref|XP_002281186.2|  PREDICTED: uncharacterized protein LOC100244552    110   9e-27   Vitis vinifera
ref|XP_002522034.1|  Rhicadhesin receptor precursor, putative           107   9e-27   Ricinus communis
emb|CBI36791.3|  unnamed protein product                                107   9e-27   
gb|AAL15887.1|AF417299_1  putative germin                               106   9e-27   Castanea sativa
ref|XP_008780704.1|  PREDICTED: germin-like protein 8-5                 105   1e-26   
ref|XP_007030265.1|  Germin-like protein 2                              107   1e-26   
ref|XP_008360941.1|  PREDICTED: germin-like protein subfamily 1 m...    107   1e-26   
ref|NP_001267943.1|  germin-like protein 4 precursor                    107   1e-26   
ref|XP_002265447.3|  PREDICTED: uncharacterized protein LOC100242782    110   1e-26   Vitis vinifera
ref|XP_006477881.1|  PREDICTED: germin-like protein subfamily 1 m...    107   1e-26   
gb|KDP23768.1|  hypothetical protein JCGZ_23601                         107   1e-26   
emb|CBI36814.3|  unnamed protein product                                107   1e-26   
ref|XP_010941821.1|  PREDICTED: putative germin-like protein 2-1        107   1e-26   
ref|XP_006442438.1|  hypothetical protein CICLE_v10024000mg             107   1e-26   
ref|XP_007201690.1|  hypothetical protein PRUPE_ppa016952mg             106   1e-26   
ref|XP_008367619.1|  PREDICTED: germin-like protein subfamily 1 m...    107   1e-26   
ref|XP_006841333.1|  hypothetical protein AMTR_s01299p00010680          105   1e-26   
ref|XP_002265297.3|  PREDICTED: uncharacterized protein LOC100247931    110   1e-26   Vitis vinifera
ref|XP_002284284.2|  PREDICTED: germin-like protein subfamily 1 m...    107   1e-26   Vitis vinifera
ref|XP_006442436.1|  hypothetical protein CICLE_v10024280mg             107   1e-26   
ref|XP_006477875.1|  PREDICTED: germin-like protein subfamily 1 m...    107   1e-26   
emb|CAN61141.1|  hypothetical protein VITISV_024669                     106   1e-26   Vitis vinifera
ref|XP_003633711.2|  PREDICTED: putative germin-like protein 2-1        107   1e-26   
emb|CBI36811.3|  unnamed protein product                                107   2e-26   
ref|XP_006477877.1|  PREDICTED: germin-like protein subfamily 1 m...    107   2e-26   
ref|XP_006845051.1|  hypothetical protein AMTR_s00794p00001640          107   2e-26   
ref|XP_006477879.1|  PREDICTED: germin-like protein subfamily 1 m...    107   2e-26   
ref|XP_010659856.1|  PREDICTED: germin-like protein subfamily 1 m...    107   2e-26   
ref|XP_009355938.1|  PREDICTED: germin-like protein subfamily 1 m...    107   2e-26   
ref|XP_004952512.1|  PREDICTED: putative germin-like protein 2-2-...    106   2e-26   
ref|XP_006442442.1|  hypothetical protein CICLE_v10022152mg             106   2e-26   
ref|XP_007030276.1|  RmlC-like cupins superfamily protein               107   2e-26   
emb|CAN72994.1|  hypothetical protein VITISV_000563                     106   2e-26   Vitis vinifera
ref|XP_010662282.1|  PREDICTED: putative germin-like protein 2-1        106   2e-26   
ref|XP_002319671.1|  hypothetical protein POPTR_0013s04840g             106   2e-26   Populus trichocarpa [western balsam poplar]
emb|CBI36810.3|  unnamed protein product                                108   2e-26   
gb|KDO42113.1|  hypothetical protein CISIN_1g027369mg                   106   2e-26   
ref|XP_006477883.1|  PREDICTED: germin-like protein subfamily 1 m...    106   2e-26   
emb|CAN73848.1|  hypothetical protein VITISV_021639                     104   2e-26   Vitis vinifera
ref|XP_002319672.1|  hypothetical protein POPTR_0013s04850g             106   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_008780786.1|  PREDICTED: germin-like protein 8-5                 104   2e-26   
ref|XP_010662281.1|  PREDICTED: putative germin-like protein 2-1        105   3e-26   
ref|XP_006443312.1|  hypothetical protein CICLE_v10022118mg             106   3e-26   
gb|KFK33230.1|  hypothetical protein AALP_AA6G347300                    106   3e-26   
emb|CAN80134.1|  hypothetical protein VITISV_012033                     106   3e-26   Vitis vinifera
emb|CAN74481.1|  hypothetical protein VITISV_042845                     105   3e-26   Vitis vinifera
ref|NP_001046876.1|  Os02g0491800                                       106   3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952510.1|  PREDICTED: putative germin-like protein 2-2-...    106   3e-26   
ref|XP_011038440.1|  PREDICTED: germin-like protein subfamily 1 m...    106   3e-26   
ref|XP_008237525.1|  PREDICTED: germin-like protein subfamily 1 m...    106   3e-26   
ref|XP_002270404.2|  PREDICTED: putative germin-like protein 2-1        106   3e-26   Vitis vinifera
ref|XP_010549631.1|  PREDICTED: germin-like protein subfamily 1 m...    104   3e-26   
ref|XP_002284624.1|  PREDICTED: germin-like protein subfamily 1 m...    106   3e-26   Vitis vinifera
ref|XP_007030283.1|  RmlC-like cupins superfamily protein               104   3e-26   
emb|CBI36790.3|  unnamed protein product                                105   4e-26   
ref|XP_006840196.1|  hypothetical protein AMTR_s00089p00119480          106   4e-26   
ref|NP_001267940.1|  germin-like protein 1                              105   4e-26   
ref|XP_006442440.1|  hypothetical protein CICLE_v10023726mg             105   4e-26   
ref|XP_003618167.1|  Germin-like protein                                105   4e-26   
ref|XP_002319184.1|  hypothetical protein POPTR_0013s06030g             105   4e-26   Populus trichocarpa [western balsam poplar]
ref|XP_003618165.1|  Germin-like protein subfamily 1 member             105   5e-26   
ref|XP_006286150.1|  hypothetical protein CARUB_v10007709mg             105   5e-26   
ref|XP_007201148.1|  hypothetical protein PRUPE_ppa016020mg             105   5e-26   
ref|XP_006442447.1|  hypothetical protein CICLE_v10024005mg             105   5e-26   
ref|XP_006442444.1|  hypothetical protein CICLE_v10023384mg             105   5e-26   
ref|XP_003618162.1|  Germin-like protein subfamily 1 member             105   5e-26   
ref|XP_006375874.1|  germin-like protein 1                              105   5e-26   
ref|XP_008243694.1|  PREDICTED: germin-like protein 9-1                 108   6e-26   
emb|CAN74480.1|  hypothetical protein VITISV_042844                     105   6e-26   Vitis vinifera
ref|XP_002284343.2|  PREDICTED: uncharacterized protein LOC100256308    108   6e-26   Vitis vinifera
sp|Q6K5P9.1|GL22_ORYSJ  RecName: Full=Putative germin-like protei...    105   6e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004489240.1|  PREDICTED: germin-like protein subfamily 1 m...    105   6e-26   
emb|CBI36812.3|  unnamed protein product                                108   6e-26   
ref|XP_009414512.1|  PREDICTED: putative germin-like protein 2-1        105   6e-26   
ref|XP_003618164.1|  Germin-like protein subfamily 1 member             105   6e-26   
ref|XP_008381868.1|  PREDICTED: germin-like protein subfamily 1 m...    104   7e-26   
ref|XP_010528695.1|  PREDICTED: germin-like protein subfamily 1 m...    104   7e-26   
emb|CAN63888.1|  hypothetical protein VITISV_027217                     103   7e-26   Vitis vinifera
ref|XP_010528696.1|  PREDICTED: germin-like protein subfamily 1 m...    105   7e-26   
ref|NP_198707.1|  putative germin-like protein subfamily 1 member 9     105   7e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007030263.1|  Germin-like protein subfamily 1 member 18          105   8e-26   
gb|ABR92335.1|  putative germin-like protein                            105   8e-26   Salvia miltiorrhiza [Chinese salvia]
gb|KDP23764.1|  hypothetical protein JCGZ_23597                         105   8e-26   
ref|XP_002452099.1|  hypothetical protein SORBIDRAFT_04g019670          105   8e-26   Sorghum bicolor [broomcorn]
ref|XP_010549630.1|  PREDICTED: germin-like protein subfamily 1 m...    103   8e-26   
ref|XP_006840206.1|  hypothetical protein AMTR_s00089p00127600          105   9e-26   
emb|CAN71140.1|  hypothetical protein VITISV_005471                     105   9e-26   Vitis vinifera
ref|XP_009357348.1|  PREDICTED: germin-like protein subfamily 1 m...    105   9e-26   
ref|NP_568562.1|  germin-like protein 6                                 102   9e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011034307.1|  PREDICTED: germin-like protein subfamily 1 m...    105   1e-25   
ref|XP_006387364.1|  hypothetical protein POPTR_1158s00200g             105   1e-25   
ref|XP_011034445.1|  PREDICTED: germin-like protein subfamily 1 m...    105   1e-25   
ref|XP_011013026.1|  PREDICTED: germin-like protein subfamily 1 m...    105   1e-25   
ref|XP_004290344.1|  PREDICTED: germin-like protein subfamily 1 m...    105   1e-25   
ref|XP_010528697.1|  PREDICTED: germin-like protein subfamily 1 m...    104   1e-25   
ref|XP_008776811.1|  PREDICTED: putative germin-like protein 2-1 ...    104   1e-25   
ref|XP_010528694.1|  PREDICTED: germin-like protein subfamily 1 m...    104   1e-25   
ref|XP_002284320.1|  PREDICTED: germin-like protein subfamily 1 m...    104   1e-25   Vitis vinifera
ref|XP_008776810.1|  PREDICTED: putative germin-like protein 2-1 ...    104   1e-25   
gb|EAZ23098.1|  hypothetical protein OsJ_06792                          103   1e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006285306.1|  hypothetical protein CARUB_v10006688mg             104   2e-25   
ref|NP_001046874.1|  Os02g0491600                                       104   2e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002452097.1|  hypothetical protein SORBIDRAFT_04g019640          104   2e-25   Sorghum bicolor [broomcorn]
ref|XP_006850557.1|  hypothetical protein AMTR_s00436p00008110          103   2e-25   
ref|XP_002868742.1|  predicted protein                                  104   2e-25   
ref|XP_006840197.1|  hypothetical protein AMTR_s00089p00120230          104   2e-25   
ref|XP_011034442.1|  PREDICTED: germin-like protein subfamily 1 m...    104   2e-25   
ref|XP_011034444.1|  PREDICTED: germin-like protein subfamily 1 m...    104   2e-25   
ref|XP_006647292.1|  PREDICTED: putative germin-like protein 2-2-...    103   2e-25   
ref|XP_008808516.1|  PREDICTED: putative germin-like protein 2-1        103   2e-25   
gb|EAY85909.1|  hypothetical protein OsI_07272                          103   2e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_006285342.1|  hypothetical protein CARUB_v10006732mg             102   2e-25   
ref|XP_011075123.1|  PREDICTED: putative germin-like protein 2-1 ...    103   2e-25   
ref|XP_011075124.1|  PREDICTED: putative germin-like protein 2-1 ...    103   2e-25   
ref|XP_004489241.1|  PREDICTED: putative germin-like protein 2-1-...    103   2e-25   
gb|AFK48994.1|  unknown                                                 103   3e-25   
ref|XP_006405675.1|  hypothetical protein EUTSA_v10027915mg             103   3e-25   
ref|XP_002452100.1|  hypothetical protein SORBIDRAFT_04g019680          103   3e-25   Sorghum bicolor [broomcorn]
emb|CAN63434.1|  hypothetical protein VITISV_033830                     103   3e-25   Vitis vinifera
ref|XP_008393482.1|  PREDICTED: germin-like protein subfamily 1 m...    103   3e-25   
ref|XP_006405676.1|  hypothetical protein EUTSA_v10027913mg             103   3e-25   
ref|XP_006405677.1|  hypothetical protein EUTSA_v10027920mg             103   3e-25   
gb|AAB51572.1|  germin-like protein                                     103   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001268198.1|  germin-like protein 3 precursor                    103   3e-25   
ref|XP_006405680.1|  hypothetical protein EUTSA_v10027917mg             103   3e-25   
sp|P92997.2|GL113_ARATH  RecName: Full=Germin-like protein subfam...    103   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008778966.1|  PREDICTED: putative germin-like protein 2-1        103   3e-25   
ref|XP_008778853.1|  PREDICTED: putative germin-like protein 2-1        103   3e-25   
ref|XP_002280481.2|  PREDICTED: uncharacterized protein LOC100252737    107   3e-25   Vitis vinifera
gb|EPS67173.1|  hypothetical protein M569_07603                         103   3e-25   
gb|KCW61433.1|  hypothetical protein EUGRSUZ_H04161                     103   3e-25   
ref|XP_011034443.1|  PREDICTED: germin-like protein subfamily 1 m...    103   3e-25   
ref|XP_006405681.1|  hypothetical protein EUTSA_v10027922mg             103   3e-25   
ref|XP_011099650.1|  PREDICTED: germin-like protein subfamily 1 m...    103   4e-25   
ref|XP_006405679.1|  hypothetical protein EUTSA_v10027925mg             103   4e-25   
ref|XP_010435804.1|  PREDICTED: germin-like protein subfamily 1 m...    103   4e-25   
ref|XP_008358299.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    102   4e-25   
ref|XP_002870812.1|  predicted protein                                  103   4e-25   
ref|XP_008381865.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    102   4e-25   
ref|XP_011038438.1|  PREDICTED: germin-like protein subfamily 1 m...    103   4e-25   
ref|NP_001046875.2|  Os02g0491700                                       103   4e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004142552.1|  PREDICTED: germin-like protein subfamily 1 m...    103   4e-25   
ref|XP_002276445.2|  PREDICTED: uncharacterized protein LOC100254460    107   4e-25   
gb|KFK24125.1|  hypothetical protein AALP_AAs58370U000100               103   4e-25   
emb|CAN70904.1|  hypothetical protein VITISV_032927                     102   4e-25   
ref|XP_011075119.1|  PREDICTED: putative germin-like protein 2-1 ...    103   4e-25   
ref|XP_008439536.1|  PREDICTED: germin-like protein 8-2                 103   4e-25   
gb|EMT02677.1|  Putative germin-like protein 2-1                        103   4e-25   
ref|XP_011075120.1|  PREDICTED: putative germin-like protein 2-1 ...    103   5e-25   
ref|XP_010688719.1|  PREDICTED: germin-like protein subfamily 1 m...    103   5e-25   
gb|KHN04147.1|  Germin-like protein 12-1                                102   5e-25   
ref|XP_011038439.1|  PREDICTED: germin-like protein subfamily 1 m...    103   5e-25   
ref|XP_004155681.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    103   5e-25   
ref|XP_004142551.1|  PREDICTED: germin-like protein subfamily 1 m...    103   5e-25   
ref|XP_011075121.1|  PREDICTED: putative germin-like protein 2-1 ...    102   5e-25   
ref|XP_006479020.1|  PREDICTED: germin-like protein subfamily 1 m...    103   5e-25   
ref|XP_010435818.1|  PREDICTED: germin-like protein subfamily 1 m...    103   5e-25   
ref|XP_010441025.1|  PREDICTED: germin-like protein subfamily 1 m...    103   6e-25   
ref|XP_004291649.1|  PREDICTED: germin-like protein subfamily 1 m...    103   6e-25   
ref|XP_006443311.1|  hypothetical protein CICLE_v10022142mg             102   6e-25   
emb|CDP10106.1|  unnamed protein product                                102   6e-25   
gb|EYU40207.1|  hypothetical protein MIMGU_mgv1a012993mg                103   6e-25   
ref|XP_002870811.1|  manganese ion binding protein                      102   6e-25   
ref|XP_010441036.1|  PREDICTED: germin-like protein subfamily 1 m...    102   6e-25   
ref|XP_010450848.1|  PREDICTED: germin-like protein subfamily 1 m...    102   6e-25   
ref|XP_006371137.1|  hypothetical protein POPTR_0019s04480g           99.4    7e-25   
ref|XP_006284934.1|  hypothetical protein CARUB_v10006233mg             102   7e-25   
ref|XP_004293672.1|  PREDICTED: putative germin-like protein 2-1-...    102   7e-25   
gb|KFK33208.1|  hypothetical protein AALP_AA6G344800                    102   7e-25   
ref|NP_198734.1|  germin-like protein subfamily 1 member 19             102   7e-25   
ref|XP_006375871.1|  hypothetical protein POPTR_0013s04880g             102   7e-25   
ref|XP_002870810.1|  predicted protein                                  102   7e-25   
ref|XP_004293675.1|  PREDICTED: putative germin-like protein 2-1-...    102   7e-25   
ref|XP_006375870.1|  germin-like protein 1                              102   7e-25   
ref|NP_198710.2|  germin-like protein subfamily 1 member 11             102   7e-25   
ref|NP_198731.1|  germin-like protein subfamily 1 member 17             102   8e-25   
ref|XP_007140862.1|  hypothetical protein PHAVU_008G147800g             102   8e-25   
ref|XP_004293674.1|  PREDICTED: putative germin-like protein 2-1-...    102   8e-25   
ref|XP_002868745.1|  hypothetical protein ARALYDRAFT_494078             100   8e-25   
ref|XP_002319674.2|  hypothetical protein POPTR_0013s04920g             102   8e-25   
emb|CAN72946.1|  hypothetical protein VITISV_034968                     107   8e-25   
ref|XP_006282503.1|  hypothetical protein CARUB_v10006909mg             102   8e-25   
gb|EMT10792.1|  Putative germin-like protein 2-1                        102   8e-25   
emb|CDY69099.1|  BnaA07g37570D                                          102   9e-25   
ref|XP_010434310.1|  PREDICTED: germin-like protein subfamily 1 m...    102   9e-25   
gb|KFK33231.1|  hypothetical protein AALP_AA6G347400                    102   9e-25   
gb|EAY85910.1|  hypothetical protein OsI_07273                          102   9e-25   
ref|XP_008237387.1|  PREDICTED: germin-like protein subfamily 1 m...    102   9e-25   
ref|XP_008443754.1|  PREDICTED: germin-like protein subfamily 1 m...    102   9e-25   
ref|XP_002280455.1|  PREDICTED: germin-like protein subfamily 1 m...    101   9e-25   
ref|NP_198728.1|  germin-like protein subfamily 1 member 15             102   9e-25   
ref|XP_006840195.1|  hypothetical protein AMTR_s00089p00119070          102   9e-25   
gb|KCW76698.1|  hypothetical protein EUGRSUZ_D01058                     101   9e-25   
ref|NP_198727.1|  germin-like protein subfamily 1 member 14             102   1e-24   
gb|KHN10835.1|  Germin-like protein 12-1                                101   1e-24   
ref|XP_010445633.1|  PREDICTED: germin-like protein subfamily 1 m...    102   1e-24   
ref|XP_002868741.1|  predicted protein                                  102   1e-24   
emb|CAB65370.1|  germin-like protein                                    101   1e-24   
ref|XP_002868743.1|  predicted protein                                  102   1e-24   
gb|KHN14793.1|  Germin-like protein subfamily 1 member 16               101   1e-24   
ref|XP_006298965.1|  hypothetical protein CARUB_v10015090mg             102   1e-24   
emb|CAN74366.1|  hypothetical protein VITISV_015882                     101   1e-24   
emb|CDY11695.1|  BnaC06g13030D                                          102   1e-24   
ref|XP_007210592.1|  hypothetical protein PRUPE_ppa016616mg             102   1e-24   
ref|XP_008775104.1|  PREDICTED: putative germin-like protein 2-1        102   1e-24   
ref|XP_010450837.1|  PREDICTED: germin-like protein subfamily 1 m...    102   1e-24   
ref|XP_010464157.1|  PREDICTED: germin-like protein subfamily 1 m...    102   1e-24   
ref|XP_002284616.2|  PREDICTED: germin-like protein subfamily 1 m...    102   1e-24   
gb|KDO42111.1|  hypothetical protein CISIN_1g027345mg                   102   1e-24   
ref|XP_008808107.1|  PREDICTED: putative germin-like protein 2-1 ...    101   1e-24   
ref|XP_009124949.1|  PREDICTED: germin-like protein subfamily 1 m...    102   1e-24   
ref|XP_006371122.1|  Germin-like protein subfamily 1 member 6 pre...    102   1e-24   
gb|KCW44232.1|  hypothetical protein EUGRSUZ_L02342                     102   1e-24   
gb|EMT32553.1|  Putative germin-like protein 2-2                        102   1e-24   
ref|XP_010024915.1|  PREDICTED: putative germin-like protein 2-1        102   1e-24   
ref|XP_008808106.1|  PREDICTED: putative germin-like protein 2-1 ...    102   1e-24   
ref|XP_010659615.1|  PREDICTED: germin-like protein subfamily 1 m...    102   1e-24   
ref|XP_006405663.1|  hypothetical protein EUTSA_v10027916mg             102   1e-24   
ref|XP_006443310.1|  hypothetical protein CICLE_v10022111mg             102   1e-24   
gb|KCW61443.1|  hypothetical protein EUGRSUZ_H04174                     102   1e-24   
gb|KCW61437.1|  hypothetical protein EUGRSUZ_H04167                     102   1e-24   
ref|XP_002868739.1|  predicted protein                                  102   1e-24   
gb|KDP23769.1|  hypothetical protein JCGZ_23602                         102   2e-24   
ref|XP_003604730.1|  Germin-like protein subfamily 1 member             102   2e-24   
emb|CDP10146.1|  unnamed protein product                                101   2e-24   
ref|XP_008240380.1|  PREDICTED: germin-like protein subfamily 1 m...    102   2e-24   
ref|XP_007201563.1|  hypothetical protein PRUPE_ppa018105mg             102   2e-24   
gb|KDP23774.1|  hypothetical protein JCGZ_23607                         103   2e-24   
gb|KCW61445.1|  hypothetical protein EUGRSUZ_H04176                     102   2e-24   
ref|XP_010052624.1|  PREDICTED: germin-like protein subfamily 1 m...    101   2e-24   
emb|CDY37880.1|  BnaC04g31260D                                          101   2e-24   
gb|EMS53398.1|  Putative germin-like protein 2-1                        101   2e-24   
gb|EMT14063.1|  Putative germin-like protein 2-1                        101   2e-24   
gb|KDP23765.1|  hypothetical protein JCGZ_23598                         103   2e-24   
ref|XP_010066342.1|  PREDICTED: germin-like protein subfamily 1 m...    101   2e-24   
gb|AFK39387.1|  unknown                                                 101   2e-24   
ref|XP_011075126.1|  PREDICTED: putative germin-like protein 2-1 ...    101   2e-24   
ref|XP_010041604.1|  PREDICTED: germin-like protein subfamily 1 m...    101   2e-24   
ref|XP_006285960.1|  hypothetical protein CARUB_v10007479mg             100   2e-24   
ref|XP_002276926.2|  PREDICTED: uncharacterized protein LOC100251187    103   2e-24   
ref|XP_003604729.1|  Germin-like protein subfamily 1 member             101   2e-24   
ref|XP_006408007.1|  hypothetical protein EUTSA_v10021469mg             101   2e-24   
ref|XP_003593910.1|  Germin-like protein subfamily 1 member             101   2e-24   
ref|NP_198709.1|  germin-like protein subfamily 1 member 10             101   2e-24   
ref|XP_009414514.1|  PREDICTED: putative germin-like protein 2-1        101   2e-24   
ref|XP_010066343.1|  PREDICTED: germin-like protein subfamily 1 m...    101   2e-24   
ref|XP_003604731.1|  Germin-like protein subfamily 1 member             101   2e-24   
ref|XP_010024919.1|  PREDICTED: germin-like protein subfamily 1 m...    101   2e-24   
gb|KCW61456.1|  hypothetical protein EUGRSUZ_H04192                     101   2e-24   
ref|XP_010048221.1|  PREDICTED: germin-like protein subfamily 1 m...    101   2e-24   
ref|XP_011075127.1|  PREDICTED: putative germin-like protein 2-1 ...    101   2e-24   
ref|XP_006405658.1|  hypothetical protein EUTSA_v10027918mg             101   2e-24   
ref|XP_010024918.1|  PREDICTED: germin-like protein subfamily 1 m...    101   2e-24   
ref|XP_007201630.1|  hypothetical protein PRUPE_ppa020060mg             101   2e-24   
gb|EMT10776.1|  Putative germin-like protein 2-1                        101   2e-24   
ref|XP_011002008.1|  PREDICTED: germin-like protein subfamily 1 m...    101   2e-24   
ref|XP_002862402.1|  hypothetical protein ARALYDRAFT_497466             100   2e-24   
gb|EMT02678.1|  Putative germin-like protein 2-1                        101   2e-24   
ref|XP_002870813.1|  predicted protein                                  101   3e-24   
ref|XP_002452096.1|  hypothetical protein SORBIDRAFT_04g019630          101   3e-24   
ref|XP_004134896.1|  PREDICTED: germin-like protein 8-2-like            101   3e-24   
gb|AFK49577.1|  unknown                                                 101   3e-24   
ref|XP_010450836.1|  PREDICTED: germin-like protein subfamily 1 m...    101   3e-24   
ref|XP_006405659.1|  hypothetical protein EUTSA_v10028158mg             101   3e-24   
ref|XP_008443751.1|  PREDICTED: germin-like protein subfamily 1 m...    101   3e-24   
gb|KDO36579.1|  hypothetical protein CISIN_1g048097mg                   101   3e-24   
ref|NP_001240963.1|  germin-like protein subfamily 1 member 7-lik...    101   3e-24   
ref|XP_003574983.1|  PREDICTED: putative germin-like protein 2-1        100   3e-24   
ref|XP_003553592.1|  PREDICTED: germin-like protein subfamily 1 m...    100   3e-24   
ref|NP_187246.1|  germin-like protein subfamily 1 member 7              101   3e-24   
ref|XP_007143989.1|  hypothetical protein PHAVU_007G119700g             100   3e-24   
ref|XP_009415610.1|  PREDICTED: putative germin-like protein 2-1        100   4e-24   
ref|XP_007143990.1|  hypothetical protein PHAVU_007G119700g             100   4e-24   
gb|ACG69478.1|  germin-like protein 2                                   100   4e-24   
ref|XP_009388248.1|  PREDICTED: putative germin-like protein 2-1 ...    100   4e-24   
ref|XP_009388249.1|  PREDICTED: putative germin-like protein 2-1 ...    100   4e-24   
emb|CBI36786.3|  unnamed protein product                                100   4e-24   
emb|CDP10107.1|  unnamed protein product                                100   4e-24   
ref|NP_001238673.1|  uncharacterized protein LOC100527866 precursor     100   4e-24   
ref|XP_009414513.1|  PREDICTED: putative germin-like protein 2-1        100   4e-24   
ref|XP_010435820.1|  PREDICTED: germin-like protein subfamily 1 m...    100   4e-24   
ref|XP_002452101.1|  hypothetical protein SORBIDRAFT_04g019700          100   4e-24   
ref|XP_007214200.1|  hypothetical protein PRUPE_ppa022275mg             100   4e-24   
ref|XP_010050174.1|  PREDICTED: germin-like protein subfamily 1 m...    100   4e-24   
ref|XP_008225614.1|  PREDICTED: putative germin-like protein 2-3        100   4e-24   
emb|CDP22258.1|  unnamed protein product                              98.2    4e-24   
gb|EMS53399.1|  Putative germin-like protein 2-1                        100   4e-24   
ref|NP_001268128.1|  germin-like protein 5                              100   4e-24   
emb|CDY66959.1|  BnaCnng52940D                                          100   4e-24   
ref|XP_002868798.1|  predicted protein                                  100   4e-24   
ref|XP_009604370.1|  PREDICTED: putative germin-like protein 2-3        100   5e-24   
ref|XP_009125150.1|  PREDICTED: germin-like protein subfamily 1 m...    100   5e-24   
ref|XP_011075128.1|  PREDICTED: putative germin-like protein 2-1        100   5e-24   
emb|CDP12575.1|  unnamed protein product                                102   5e-24   
ref|XP_010024914.1|  PREDICTED: putative germin-like protein 2-1        100   5e-24   
ref|XP_002884546.1|  hypothetical protein ARALYDRAFT_477892             100   5e-24   
emb|CAB65371.1|  germin-like protein                                    100   5e-24   
sp|Q9FMA6.1|GL112_ARATH  RecName: Full=Putative germin-like prote...    100   5e-24   
ref|NP_198712.1|  RmlC-like cupins superfamily protein                  100   5e-24   
gb|ACG69479.1|  germin-like protein 3                                   100   6e-24   
ref|XP_010027145.1|  PREDICTED: germin-like protein subfamily 1 m...    100   6e-24   
gb|EMT11294.1|  Putative germin-like protein 2-1                        100   6e-24   
ref|XP_002325797.2|  hypothetical protein POPTR_0019s04340g             100   6e-24   
ref|XP_006414433.1|  hypothetical protein EUTSA_v10026190mg             100   6e-24   
ref|XP_009341765.1|  PREDICTED: germin-like protein subfamily 1 m...    100   6e-24   
ref|XP_010024911.1|  PREDICTED: germin-like protein subfamily 1 m...    100   7e-24   
gb|EYU20537.1|  hypothetical protein MIMGU_mgv1a013077mg                100   7e-24   
ref|XP_003535383.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    100   7e-24   
ref|XP_008371812.1|  PREDICTED: germin-like protein subfamily 1 m...    100   7e-24   
gb|KCW76697.1|  hypothetical protein EUGRSUZ_D01057                     100   7e-24   
ref|XP_010441023.1|  PREDICTED: putative germin-like protein subf...    100   7e-24   
ref|XP_010024912.1|  PREDICTED: germin-like protein subfamily 1 m...    100   7e-24   
ref|XP_011002009.1|  PREDICTED: germin-like protein subfamily 1 m...    100   7e-24   
ref|XP_007140901.1|  hypothetical protein PHAVU_008G1508000g          98.6    8e-24   
gb|EYU20538.1|  hypothetical protein MIMGU_mgv1a012929mg                100   8e-24   
ref|XP_006845853.1|  hypothetical protein AMTR_s00154p00039580        99.4    8e-24   
ref|XP_010435803.1|  PREDICTED: putative germin-like protein subf...    100   8e-24   
ref|NP_001066189.1|  Os12g0154800                                       100   8e-24   
gb|EMS61024.1|  Putative germin-like protein 2-1                      99.8    9e-24   
ref|XP_008243693.1|  PREDICTED: germin-like protein subfamily 1 m...  99.4    9e-24   
ref|NP_001237300.1|  uncharacterized protein LOC100527781 precursor   99.8    9e-24   
ref|XP_010688720.1|  PREDICTED: germin-like protein subfamily 1 m...    100   9e-24   
ref|XP_009140172.1|  PREDICTED: germin-like protein subfamily 1 m...  99.8    9e-24   
ref|XP_009140173.1|  PREDICTED: germin-like protein subfamily 1 m...  99.8    9e-24   
ref|XP_006371120.1|  hypothetical protein POPTR_0019s04280g           99.8    1e-23   
gb|KHN04965.1|  Germin-like protein subfamily 1 member 7                100   1e-23   
ref|XP_003536153.1|  PREDICTED: germin-like protein subfamily 1 m...    100   1e-23   
ref|XP_007140907.1|  hypothetical protein PHAVU_008G151200g           99.8    1e-23   
ref|XP_010050157.1|  PREDICTED: germin-like protein subfamily 1 m...  99.8    1e-23   
ref|XP_009139822.1|  PREDICTED: germin-like protein subfamily 1 m...  99.8    1e-23   
emb|CDX99677.1|  BnaC04g34340D                                          100   1e-23   
ref|XP_011012323.1|  PREDICTED: germin-like protein subfamily 1 m...    101   1e-23   
ref|NP_001236994.1|  uncharacterized protein LOC100527249 precursor   99.8    1e-23   
ref|XP_002517295.1|  Nectarin-1 precursor, putative                   97.8    1e-23   
ref|XP_010450850.1|  PREDICTED: putative germin-like protein subf...  99.4    1e-23   
ref|XP_010672088.1|  PREDICTED: germin-like protein subfamily 1 m...  99.8    1e-23   
ref|XP_009761605.1|  PREDICTED: putative germin-like protein 2-3      98.6    1e-23   
ref|XP_010042132.1|  PREDICTED: germin-like protein subfamily 1 m...  99.4    1e-23   
emb|CBI39477.3|  unnamed protein product                              99.4    1e-23   
ref|XP_010024921.1|  PREDICTED: germin-like protein subfamily 1 m...  99.4    1e-23   
ref|XP_011075129.1|  PREDICTED: putative germin-like protein 2-1 ...  99.4    1e-23   
gb|KHN14792.1|  Germin-like protein subfamily 1 member 7              99.4    1e-23   
ref|XP_010050166.1|  PREDICTED: germin-like protein subfamily 1 m...  99.4    1e-23   
emb|CBI36783.3|  unnamed protein product                                100   1e-23   
ref|XP_004293676.1|  PREDICTED: putative germin-like protein 2-1-...  99.0    1e-23   
ref|XP_011075130.1|  PREDICTED: putative germin-like protein 2-1 ...  99.0    2e-23   
ref|XP_004972687.1|  PREDICTED: germin-like protein 12-2-like         99.4    2e-23   
ref|XP_010235436.1|  PREDICTED: putative germin-like protein 2-2 ...  99.0    2e-23   
ref|XP_003574976.1|  PREDICTED: putative germin-like protein 2-2 ...  99.0    2e-23   
ref|XP_010027143.1|  PREDICTED: uncharacterized protein LOC104417591    101   2e-23   
emb|CAN80133.1|  hypothetical protein VITISV_012032                   99.0    2e-23   
ref|XP_010024925.1|  PREDICTED: germin-like protein subfamily 1 m...  98.6    2e-23   
gb|KHN28992.1|  Germin-like protein 12-1                              98.2    2e-23   
ref|XP_007213147.1|  hypothetical protein PRUPE_ppa024806mg           98.2    2e-23   
ref|XP_003590904.1|  Germin-like protein subfamily 1 member           99.0    2e-23   
emb|CDP14600.1|  unnamed protein product                              99.0    2e-23   
ref|XP_008439540.1|  PREDICTED: putative germin-like protein 2-1      99.0    2e-23   
ref|XP_008777419.1|  PREDICTED: uncharacterized protein LOC103697358    101   2e-23   
ref|XP_009758467.1|  PREDICTED: putative germin-like protein 2-3      99.0    2e-23   
gb|EYU38443.1|  hypothetical protein MIMGU_mgv1a013090mg              99.0    2e-23   
gb|KFK23658.1|  germin-like protein                                   99.0    2e-23   
gb|KDP32127.1|  hypothetical protein JCGZ_12588                       99.0    2e-23   



>ref|XP_009625530.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score =   129 bits (324),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVL +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNIGKT
Sbjct  112  THPRATEVLVVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNIGKT  171

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNPGV
Sbjct  172  TAVAFAGLSSQNPGV  186



>emb|CDP10693.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   129 bits (323),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVLF+LEGTL VGFV SNPP  MKN LFTKTL  GDVFVFPEGLIHFQFN+GKT
Sbjct  106  THPRATEVLFVLEGTLNVGFVTSNPPNNMKNQLFTKTLNPGDVFVFPEGLIHFQFNVGKT  165

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAG  SQNPGV
Sbjct  166  NAVAFAGFGSQNPGV  180



>ref|XP_004230405.1| PREDICTED: germin-like protein subfamily 1 member 14 [Solanum 
lycopersicum]
Length=228

 Score =   128 bits (322),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVL L EGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRATEVLTLFEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPVGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  172  NAVAFAGLSSQNPGV  186



>ref|XP_009612542.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score =   128 bits (322),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVL +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNIGKT
Sbjct  112  THPRATEVLVVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNIGKT  171

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNPGV
Sbjct  172  TAVAFAGLSSQNPGV  186



>ref|XP_009620404.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   128 bits (321),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNIGKT
Sbjct  112  THPRATEILVVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNIGKT  171

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNPGV
Sbjct  172  TAVAFAGLSSQNPGV  186



>ref|XP_009786127.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=229

 Score =   128 bits (321),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVL +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRATEVLAVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNPGV
Sbjct  172  KAVAFAGLSSQNPGV  186



>ref|XP_004230403.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score =   127 bits (320),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVL L EGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRATEVLTLFEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPVGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
            +AVAFAGLSSQNPGV
Sbjct  172  DAVAFAGLSSQNPGV  186



>ref|XP_009620876.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=211

 Score =   127 bits (318),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  95   THPRGTEILAVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPIGLIHFQFNVGKT  154

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  155  NAVAFAGLSSQNPGV  169



>ref|XP_006349264.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   127 bits (319),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TEVL L EGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRGTEVLALFEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPVGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  172  NAVAFAGLSSQNPGV  186



>ref|XP_006349268.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   127 bits (319),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TEVL L EGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRGTEVLALFEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPVGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  172  NAVAFAGLSSQNPGV  186



>ref|XP_006349261.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
 ref|XP_006349262.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score =   127 bits (319),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TEVL L EGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRGTEVLALFEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPVGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  172  NAVAFAGLSSQNPGV  186



>ref|XP_009795503.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009795504.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X2 [Nicotiana sylvestris]
Length=228

 Score =   127 bits (319),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRGTEILAVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPIGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  172  NAVAFAGLSSQNPGV  186



>ref|XP_009784933.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
sylvestris]
Length=228

 Score =   127 bits (319),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRGTEILAVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPIGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  172  NAVAFAGLSSQNPGV  186



>ref|XP_009612543.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score =   127 bits (318),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRGTEILAVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPIGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  172  NAVAFAGLSSQNPGV  186



>emb|CDP10694.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   126 bits (317),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVLF+LEG L VGFV SNPP  MKN LFTKTL  GDVFVFPEGLIHFQFN+GKT
Sbjct  111  THPRATEVLFVLEGVLNVGFVTSNPPNNMKNQLFTKTLNPGDVFVFPEGLIHFQFNVGKT  170

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAG  SQNPGV
Sbjct  171  NAVAFAGFGSQNPGV  185



>ref|XP_009795501.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score =   126 bits (317),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVL +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNIGK 
Sbjct  112  THPRATEVLAVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNIGKN  171

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNPGV
Sbjct  172  KAVAFAGLSSQNPGV  186



>ref|XP_009786129.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score =   126 bits (317),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRA EVL +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRAAEVLVVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNPGV
Sbjct  172  KAVAFAGLSSQNPGV  186



>emb|CDP10701.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   126 bits (316),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVLF+LEGTL+VGFV SNPP  MKN LFTKTL  GDVFVFPEGLIHFQFN GKT
Sbjct  111  THPRATEVLFVLEGTLHVGFVTSNPPNNMKNQLFTKTLNPGDVFVFPEGLIHFQFNFGKT  170

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAG  SQNPGV
Sbjct  171  KAVAFAGFGSQNPGV  185



>emb|CDP10695.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   125 bits (315),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVLF+LEGTL+VGFV SNPP  MKN LFTKTL  GDVFVFPEGLIHFQFN GKT
Sbjct  111  THPRATEVLFVLEGTLHVGFVTSNPPNNMKNQLFTKTLNPGDVFVFPEGLIHFQFNFGKT  170

Query  45   NAVAFAGLSSQNPGV  1
            NAVAF+   SQNPGV
Sbjct  171  NAVAFSAFGSQNPGV  185



>ref|XP_006346966.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score =   125 bits (315),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TEVL +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRGTEVLTVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNPGV
Sbjct  172  KAVAFAGLSSQNPGV  186



>gb|AFW90592.1| germin-like protein subfamily 1 member 20 precursor [Solanum 
tuberosum]
Length=228

 Score =   125 bits (314),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TEVL +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRGTEVLTVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNPGV
Sbjct  172  KAVAFAGLSSQNPGV  186



>ref|XP_006349267.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   125 bits (314),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TEVL +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRGTEVLTVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNPGV
Sbjct  172  KAVAFAGLSSQNPGV  186



>gb|EYU20542.1| hypothetical protein MIMGU_mgv1a020630mg [Erythranthe guttata]
Length=231

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L ++EGTLYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFN+GK
Sbjct  114  THPRATEILVVMEGTLYVGFVTSNPANPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGK  173

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFAGLSSQNPGV
Sbjct  174  TNAVAFAGLSSQNPGV  189



>ref|XP_004230404.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TEVL +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRGTEVLTVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNPGV
Sbjct  172  KAVAFAGLSSQNPGV  186



>gb|EYU20545.1| hypothetical protein MIMGU_mgv1a020779mg [Erythranthe guttata]
Length=231

 Score =   125 bits (314),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNP-PPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L ++EGTLYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFN+GK
Sbjct  114  THPRATEILVVMEGTLYVGFVTSNPADPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGK  173

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFAGLSSQNPGV
Sbjct  174  TNAVAFAGLSSQNPGV  189



>gb|EYU20549.1| hypothetical protein MIMGU_mgv1a020596mg [Erythranthe guttata]
Length=231

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNP-PPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L ++EGTLYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFN+GK
Sbjct  114  THPRATEILVVMEGTLYVGFVTSNPADPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGK  173

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFAGLSSQNPGV
Sbjct  174  TNAVAFAGLSSQNPGV  189



>ref|XP_006358459.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TEVL +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRGTEVLAVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNPGV
Sbjct  172  KAVAFAGLSSQNPGV  186



>gb|EYU20539.1| hypothetical protein MIMGU_mgv1a013072mg [Erythranthe guttata]
Length=231

 Score =   125 bits (313),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNP-PPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L ++EGTLYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFN+GK
Sbjct  114  THPRATEILVVIEGTLYVGFVTSNPADPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGK  173

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFAGLSSQNPGV
Sbjct  174  TNAVAFAGLSSQNPGV  189



>ref|XP_009627660.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score =   125 bits (313),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRGTEILAVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPIGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNPGV
Sbjct  172  KAVAFAGLSSQNPGV  186



>ref|XP_009612541.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   124 bits (312),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRGTEILAVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPIGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNPGV
Sbjct  172  KAVAFAGLSSQNPGV  186



>ref|XP_006358464.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   124 bits (312),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TEVL +L+G LYVGFVLSNP P MKN LFTK L +GDVFVFPEGLIHFQ N+GKT
Sbjct  114  THPRGTEVLVVLKGRLYVGFVLSNPGPNMKNKLFTKILNSGDVFVFPEGLIHFQLNVGKT  173

Query  45   NAVAFAGLSSQNPGV  1
            NA+AFAGLSSQN GV
Sbjct  174  NAIAFAGLSSQNAGV  188



>gb|EYU20547.1| hypothetical protein MIMGU_mgv1a023357mg [Erythranthe guttata]
Length=231

 Score =   124 bits (312),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPP-GMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+LF++EGTLYVGFV SNP    +KN LFTK L  GDVFVFPEGLIHFQFN+GK
Sbjct  114  THPRATEILFVMEGTLYVGFVTSNPADLALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGK  173

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFAGLSSQNPGV
Sbjct  174  TNAVAFAGLSSQNPGV  189



>gb|EYU20536.1| hypothetical protein MIMGU_mgv1a025658mg [Erythranthe guttata]
Length=231

 Score =   124 bits (312),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/76 (83%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L +LEGTLYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFN GK
Sbjct  114  THPRATEILVVLEGTLYVGFVTSNPANPALKNKLFTKYLYPGDVFVFPEGLIHFQFNAGK  173

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFAGLSSQNPGV
Sbjct  174  TNAVAFAGLSSQNPGV  189



>gb|EYU20548.1| hypothetical protein MIMGU_mgv1a013109mg [Erythranthe guttata]
Length=230

 Score =   124 bits (310),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNP-PPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L +LEGTLYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFN+GK
Sbjct  113  THPRATEILVVLEGTLYVGFVTSNPADPTLKNKLFTKYLYPGDVFVFPEGLIHFQFNVGK  172

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFA LSSQNPGV
Sbjct  173  TNAVAFAALSSQNPGV  188



>gb|EYU28622.1| hypothetical protein MIMGU_mgv1a018753mg [Erythranthe guttata]
Length=230

 Score =   123 bits (309),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L +LEGTLYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFN+GK
Sbjct  113  THPRATEILVVLEGTLYVGFVTSNPANPAIKNKLFTKYLYPGDVFVFPEGLIHFQFNVGK  172

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFA LSSQNPGV
Sbjct  173  TNAVAFAALSSQNPGV  188



>ref|XP_011099652.1| PREDICTED: putative germin-like protein 2-1 [Sesamum indicum]
Length=228

 Score =   123 bits (309),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L L+EG+LYVGFV SNP  P  KN LFTKTL  GDVFVFPEGLIHFQFN+G 
Sbjct  111  THPRATEILVLVEGSLYVGFVTSNPANPNQKNKLFTKTLYPGDVFVFPEGLIHFQFNVGN  170

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFAGLSSQNPGV
Sbjct  171  TNAVAFAGLSSQNPGV  186



>gb|EYU38444.1| hypothetical protein MIMGU_mgv1a013102mg [Erythranthe guttata]
Length=230

 Score =   123 bits (309),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L +LEGTLYVGFV SNP  P +KN LF K L  GDVFVFPEGLIHFQFN+GK
Sbjct  113  THPRATEILVVLEGTLYVGFVTSNPANPAIKNKLFAKYLYPGDVFVFPEGLIHFQFNVGK  172

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFAGLSSQNPGV
Sbjct  173  TNAVAFAGLSSQNPGV  188



>ref|XP_009620917.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   123 bits (308),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L +LEGTLYVGFVLSNP P +KN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRGTEILAVLEGTLYVGFVLSNPGPNIKNKLFTKILNPGDVFVFPIGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNPGV
Sbjct  172  KAVAFAGLSSQNPGV  186



>ref|XP_006358462.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   123 bits (308),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TEVL +L+G LYVGFVLSNP P MKN LFTK L  GDVFVFPEGLIHFQ N+GKT
Sbjct  114  THPRGTEVLVVLKGRLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPEGLIHFQLNVGKT  173

Query  45   NAVAFAGLSSQNPGV  1
            NA+AFAGLSSQN GV
Sbjct  174  NAIAFAGLSSQNAGV  188



>gb|EYU40211.1| hypothetical protein MIMGU_mgv1a013108mg [Erythranthe guttata]
Length=230

 Score =   123 bits (308),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/76 (82%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNP-PPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L LL+GTLYVGFV SNP  P +KN LFTK L  GDVFVFP+GLIHFQFN+GK
Sbjct  113  THPRATEILILLKGTLYVGFVTSNPADPALKNKLFTKYLHPGDVFVFPQGLIHFQFNVGK  172

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFAGLSSQNPGV
Sbjct  173  TNAVAFAGLSSQNPGV  188



>gb|EYU20541.1| hypothetical protein MIMGU_mgv1a018988mg [Erythranthe guttata]
Length=230

 Score =   123 bits (308),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L ++EGTLYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFN+GK
Sbjct  113  THPRATEILVVMEGTLYVGFVTSNPANPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGK  172

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFA LSSQNPGV
Sbjct  173  TNAVAFAALSSQNPGV  188



>gb|EYU20535.1| hypothetical protein MIMGU_mgv1a013054mg [Erythranthe guttata]
Length=231

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 66/76 (87%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L ++EGTLYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFN+GK
Sbjct  114  THPRATEILVVIEGTLYVGFVTSNPANPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGK  173

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFAGLSSQNP V
Sbjct  174  TNAVAFAGLSSQNPSV  189



>ref|XP_006358460.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 18-like [Solanum tuberosum]
Length=233

 Score =   122 bits (307),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TEVL +L+G LYVGFVLSNP P MKN LFTK L  GDVFVFPEGLIHFQ N+GKT
Sbjct  114  THPRGTEVLVVLKGRLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPEGLIHFQLNVGKT  173

Query  45   NAVAFAGLSSQNPGV  1
            NA+AFAGLSSQN GV
Sbjct  174  NAIAFAGLSSQNAGV  188



>ref|XP_006358463.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score =   122 bits (305),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TEVL +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRGTEVLVVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNP V
Sbjct  172  KAVAFAGLSSQNPVV  186



>ref|XP_006358461.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   122 bits (305),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TEVL +L+G LYVGFVLSNP P MKN LFTK L  GDVFVFPEGL+HFQ N+GKT
Sbjct  114  THPRGTEVLVVLKGRLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPEGLVHFQLNVGKT  173

Query  45   NAVAFAGLSSQNPGV  1
            NA+AFAGLSSQN GV
Sbjct  174  NAIAFAGLSSQNAGV  188



>gb|EYU40208.1| hypothetical protein MIMGU_mgv1a020439mg [Erythranthe guttata]
Length=230

 Score =   122 bits (305),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L +LEGTLYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFN+GK
Sbjct  113  THPRATEILVVLEGTLYVGFVTSNPANPAIKNKLFTKYLYPGDVFVFPEGLIHFQFNVGK  172

Query  48   TNAVAFAGLSSQNPGV  1
            T AVAFA LSSQNPGV
Sbjct  173  TKAVAFAALSSQNPGV  188



>ref|XP_011099651.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=229

 Score =   121 bits (303),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRA+E+L ++EGTLYVGFV SNP  P MKN LFTK L  GDVFVFP+GLIHFQFN+GK
Sbjct  112  THPRASEILLVVEGTLYVGFVTSNPANPTMKNKLFTKYLYPGDVFVFPQGLIHFQFNVGK  171

Query  48   TNAVAFAGLSSQNPGV  1
            TNA+AFAGLSSQNPGV
Sbjct  172  TNALAFAGLSSQNPGV  187



>gb|EYU40210.1| hypothetical protein MIMGU_mgv1a022317mg [Erythranthe guttata]
Length=230

 Score =   120 bits (302),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L + EGTLYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFN+GK
Sbjct  113  THPRATEILVVSEGTLYVGFVTSNPANPAIKNKLFTKYLYPGDVFVFPEGLIHFQFNVGK  172

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFA LSSQNPGV
Sbjct  173  TNAVAFAALSSQNPGV  188



>gb|EYU40209.1| hypothetical protein MIMGU_mgv1a013129mg [Erythranthe guttata]
Length=230

 Score =   119 bits (298),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L LL+GTLYVGFV SNP  P +KN LF   L  GDVFVFP+GLIHFQFN+GK
Sbjct  113  THPRATEILILLKGTLYVGFVTSNPADPALKNKLFATYLHPGDVFVFPQGLIHFQFNVGK  172

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFAGLSSQNPGV
Sbjct  173  TNAVAFAGLSSQNPGV  188



>gb|EYU20540.1| hypothetical protein MIMGU_mgv1a013117mg [Erythranthe guttata]
Length=230

 Score =   119 bits (298),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNP-PPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L LL+GTLYVGFV SNP  P +KN LF   L  GDVFVFP+GLIHFQFN+GK
Sbjct  113  THPRATEILILLKGTLYVGFVTSNPADPALKNKLFATYLHPGDVFVFPQGLIHFQFNVGK  172

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFAGLSSQNPGV
Sbjct  173  TNAVAFAGLSSQNPGV  188



>gb|EYU20546.1| hypothetical protein MIMGU_mgv1a013111mg [Erythranthe guttata]
Length=230

 Score =   119 bits (297),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 65/76 (86%), Gaps = 1/76 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGK  49
            THPRATE+L LL+GTLYVGFV SNP  P +KN LF   L  GDVFVFP+GLIHFQFN+GK
Sbjct  113  THPRATEILILLKGTLYVGFVTSNPADPALKNKLFATYLHPGDVFVFPQGLIHFQFNVGK  172

Query  48   TNAVAFAGLSSQNPGV  1
            TNAVAFAGLSSQNPGV
Sbjct  173  TNAVAFAGLSSQNPGV  188



>ref|XP_006349265.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   119 bits (297),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/75 (81%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE L +LEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN GKT
Sbjct  112  THPRGTEFLVVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNPGKT  171

Query  45   NAVAFAGLSSQNPGV  1
              VAFAGLSSQNPGV
Sbjct  172  KTVAFAGLSSQNPGV  186



>emb|CDP16787.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SNP   MKN LFTK L  GDVFVFPEGLIHFQFN G +
Sbjct  111  THPRATEILVVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFNKGHS  170

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  171  NAVAFAGLSSQNPGV  185



>emb|CDP16791.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   117 bits (293),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVLF+LEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN GKT
Sbjct  111  THPRATEVLFVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGKT  170

Query  45   NAVAFAGLSSQNPGV  1
            +AVAFAG  SQNPGV
Sbjct  171  DAVAFAGFGSQNPGV  185



>ref|XP_010251871.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 63/74 (85%), Gaps = 4/74 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVL +LEGTLYVGFV SNP    +N LFTK L  GDVFVFPEGLIHFQFN+G T
Sbjct  110  THPRATEVLVVLEGTLYVGFVTSNP----ENRLFTKVLNKGDVFVFPEGLIHFQFNVGHT  165

Query  45   NAVAFAGLSSQNPG  4
            NAVAFAGLSSQNPG
Sbjct  166  NAVAFAGLSSQNPG  179



>ref|XP_006349263.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   117 bits (292),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TEVL +LEGTLYVGFVLSNP   MKN LFTK L  GDVFVFP GLIHFQFN+GKT
Sbjct  112  THPRGTEVLTVLEGTLYVGFVLSNPGANMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAG +SQN GV
Sbjct  172  KAVAFAGFNSQNQGV  186



>emb|CDP22064.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   115 bits (289),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SNP   MKN LFTK L  GDVFVFPEGLIHFQFN G +
Sbjct  111  THPRATEILVVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFNKGHS  170

Query  45   NAVAFAGLSSQNPGV  1
            +AVAFAGLSSQNPGV
Sbjct  171  SAVAFAGLSSQNPGV  185



>emb|CDP16790.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   115 bits (288),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SNP   MKN LFTK L  GDVFVFPEGLIHFQFN G +
Sbjct  113  THPRATEILVVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFNQGHS  172

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFA LSSQNPGV
Sbjct  173  NAVAFAALSSQNPGV  187



>emb|CDP16788.1| unnamed protein product [Coffea canephora]
Length=229

 Score =   115 bits (288),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
            HPRATEVLF+LEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G +N
Sbjct  112  HPRATEVLFVLEGTLVVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGHSN  171

Query  42   AVAFAGLSSQNPGV  1
            AVAFAGL SQNPGV
Sbjct  172  AVAFAGLGSQNPGV  185



>gb|AAM76225.1| putative germin E protein precursor [Gossypium herbaceum]
Length=187

 Score =   114 bits (284),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L + +GTLYVGFV SNP     N LFTK L  GDVFVFP GLIHFQFNIGKT
Sbjct  87   THPRATEILVVTKGTLYVGFVTSNP----DNRLFTKVLKTGDVFVFPVGLIHFQFNIGKT  142

Query  45   NAVAFAGLSSQNPGV  1
            NA+AFAGLSSQNPGV
Sbjct  143  NAIAFAGLSSQNPGV  157



>ref|XP_010251869.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Nelumbo 
nucifera]
Length=222

 Score =   114 bits (286),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 61/74 (82%), Gaps = 4/74 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVL +LEG LYVGFV SNP     N LFTK L  GDVFVFPEGLIHFQFN+G T
Sbjct  110  THPRATEVLVVLEGRLYVGFVTSNP----DNRLFTKVLNKGDVFVFPEGLIHFQFNVGHT  165

Query  45   NAVAFAGLSSQNPG  4
            NAVAFAGLSSQNPG
Sbjct  166  NAVAFAGLSSQNPG  179



>gb|AAM76227.1| putative germin E protein precursor [Gossypium hirsutum]
Length=187

 Score =   113 bits (283),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L + +GTLYVGFV SNP     N LFTK L  GDVFVFP GLIHFQFNIGKT
Sbjct  87   THPRATEILVVTKGTLYVGFVTSNP----DNRLFTKVLKTGDVFVFPVGLIHFQFNIGKT  142

Query  45   NAVAFAGLSSQNPGV  1
            NA+AFAGLSSQNPGV
Sbjct  143  NAIAFAGLSSQNPGV  157



>ref|XP_010251870.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Nelumbo 
nucifera]
Length=222

 Score =   114 bits (285),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 61/74 (82%), Gaps = 4/74 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVL +LEG LYVGFV SNP     N LFTK L  GDVFVFPEGLIHFQFN+G T
Sbjct  110  THPRATEVLVVLEGRLYVGFVTSNP----DNRLFTKVLNKGDVFVFPEGLIHFQFNVGHT  165

Query  45   NAVAFAGLSSQNPG  4
            NAVAFAGLSSQNPG
Sbjct  166  NAVAFAGLSSQNPG  179



>gb|AAM76226.1| putative germin E protein precursor [Gossypium raimondii]
 gb|AAM76228.1| putative germin E protein precursor [Gossypium hirsutum]
Length=187

 Score =   113 bits (283),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L + +GTLYVGFV SNP     N LFTK L  GDVFVFP GLIHFQFNIGKT
Sbjct  87   THPRATEILVVTKGTLYVGFVTSNP----DNRLFTKVLKTGDVFVFPVGLIHFQFNIGKT  142

Query  45   NAVAFAGLSSQNPGV  1
            NA+AFAGLSSQNPGV
Sbjct  143  NAIAFAGLSSQNPGV  157



>emb|CDP16789.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SNP   MKN LFTK L  GDVFVFPEGLIHFQFN G+T
Sbjct  369  THPRATEILVVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFNQGQT  428

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFA LSSQNPGV
Sbjct  429  NAVAFAALSSQNPGV  443


 Score =   114 bits (285),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G +
Sbjct  111  THPRATEILVVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGHS  170

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGL SQNPGV
Sbjct  171  NAVAFAGLGSQNPGV  185



>emb|CDP21353.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   117 bits (293),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SNP   MKN LFTK L  GDVFVFPEGLIHFQFN G +
Sbjct  340  THPRATEILVVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFNKGHS  399

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  400  NAVAFAGLSSQNPGV  414


 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
            HPRATEVLF+LEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G +N
Sbjct  112  HPRATEVLFVLEGTLVVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGHSN  171

Query  42   AVAFAGLSSQNPGV  1
            AVAFAGL SQNPGV
Sbjct  172  AVAFAGLGSQNPGV  185



>ref|XP_010251867.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   114 bits (284),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 61/74 (82%), Gaps = 4/74 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVL +LEG LYVGFV SNP     N LFTK L  GDVFVFPEGLIHFQFN+G T
Sbjct  110  THPRATEVLVVLEGRLYVGFVTSNP----DNRLFTKVLNKGDVFVFPEGLIHFQFNVGHT  165

Query  45   NAVAFAGLSSQNPG  4
            NAVAFAGLSSQNPG
Sbjct  166  NAVAFAGLSSQNPG  179



>ref|XP_010251872.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   113 bits (283),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 62/74 (84%), Gaps = 4/74 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVL +LEGTLYVGFV SNP    +N L TKTL  GDVFVFP GLIHFQFN+G T
Sbjct  110  THPRATEVLVVLEGTLYVGFVTSNP----ENRLITKTLNKGDVFVFPVGLIHFQFNVGHT  165

Query  45   NAVAFAGLSSQNPG  4
            NAVAFAGLSSQNPG
Sbjct  166  NAVAFAGLSSQNPG  179



>ref|XP_007030280.1| RmlC-like cupins superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY10782.1| RmlC-like cupins superfamily protein isoform 1 [Theobroma cacao]
Length=226

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRA+E+L +LEGTLYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ NIGKT
Sbjct  114  THPRASEILVVLEGTLYVGFVTSNP----ENRLITKVLYPGDVFVFPVGLIHFQLNIGKT  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  170  NAVAFAGLSSQNPGV  184



>ref|XP_007030284.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10786.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=226

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRA+E+L +LEGTLYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ NIGKT
Sbjct  114  THPRASEILVVLEGTLYVGFVTSNP----ENRLITKVLYPGDVFVFPVGLIHFQLNIGKT  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  170  NAVAFAGLSSQNPGV  184



>ref|XP_007030281.1| RmlC-like cupins superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY10783.1| RmlC-like cupins superfamily protein isoform 2 [Theobroma cacao]
Length=226

 Score =   112 bits (281),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRA+E+L +LEGTLYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ NIGKT
Sbjct  114  THPRASEILVVLEGTLYVGFVTSNP----ENRLITKVLYPGDVFVFPVGLIHFQLNIGKT  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  170  NAVAFAGLSSQNPGV  184



>emb|CDP16786.1| unnamed protein product [Coffea canephora]
Length=690

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVLF+LEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G+T
Sbjct  111  THPRATEVLFVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGET  170

Query  45   NAVAFAGLSSQNPGV  1
            +AVAFAGL SQNPGV
Sbjct  171  DAVAFAGLGSQNPGV  185


 Score =   115 bits (287),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
            HPRATEVLF+LEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G +N
Sbjct  343  HPRATEVLFVLEGTLVVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGHSN  402

Query  42   AVAFAGLSSQNPGV  1
            AVAFAGL SQNPGV
Sbjct  403  AVAFAGLGSQNPGV  416


 Score =   115 bits (287),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
            HPRATEVLF+LEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G +N
Sbjct  573  HPRATEVLFVLEGTLVVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGHSN  632

Query  42   AVAFAGLSSQNPGV  1
            AVAFAGL SQNPGV
Sbjct  633  AVAFAGLGSQNPGV  646



>ref|XP_007030272.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10774.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=225

 Score =   111 bits (278),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L TK L  GDVFVFP GLIHFQFN+GKT
Sbjct  113  THPRATEILVVLEGTLYVGFVTSNP----DNRLITKILYPGDVFVFPIGLIHFQFNVGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFA LSSQNPGV
Sbjct  169  NAVAFAALSSQNPGV  183



>gb|AAM76229.1| putative germin E protein precursor [Gossypioides kirkii]
Length=187

 Score =   110 bits (276),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L + +GTLYVGF+ SNP     N LFTK L  GDVFVFP GLI FQFNIGKT
Sbjct  87   THPRATEILVVTKGTLYVGFITSNP----DNRLFTKVLKTGDVFVFPVGLIQFQFNIGKT  142

Query  45   NAVAFAGLSSQNPGV  1
            NA+AFAGLSSQNPGV
Sbjct  143  NAIAFAGLSSQNPGV  157



>ref|XP_007030289.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10791.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=221

 Score =   111 bits (277),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L + +GTLYVGFV SNP     N  FTK L  GDVFVFP GLIHFQFNIGKT
Sbjct  114  THPRATEILAVKKGTLYVGFVTSNP----DNKFFTKILKTGDVFVFPVGLIHFQFNIGKT  169

Query  45   NAVAFAGLSSQNPGV  1
            NA+AFAGLSSQNPGV
Sbjct  170  NAIAFAGLSSQNPGV  184



>ref|XP_007030176.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10678.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=295

 Score =   112 bits (280),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRA+E+L ++EGTLYVGFV SNP     N L TK L  GDVFVFP GLIHFQFNIGKT
Sbjct  154  THPRASEILVVMEGTLYVGFVTSNP----NNHLITKVLYPGDVFVFPVGLIHFQFNIGKT  209

Query  45   NAVAFAGLSSQNPGV  1
            NA+AFAGLSSQNPGV
Sbjct  210  NAIAFAGLSSQNPGV  224



>ref|XP_010241946.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=223

 Score =   110 bits (276),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 60/74 (81%), Gaps = 4/74 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVL +LEG LYVGFV SNP     N LFTK L  GDVFVFP+GL HFQFN+G T
Sbjct  111  THPRATEVLVVLEGRLYVGFVTSNP----DNRLFTKVLNKGDVFVFPQGLTHFQFNVGHT  166

Query  45   NAVAFAGLSSQNPG  4
            NAVAFAGLSSQNPG
Sbjct  167  NAVAFAGLSSQNPG  180



>ref|XP_002530594.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF31774.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=190

 Score =   109 bits (273),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 60/74 (81%), Gaps = 5/74 (7%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L TKTL  GDVFVFP G+IHFQFN G T
Sbjct  79   THPRATEILVVLEGTLYVGFVTSNP-----NRLITKTLKPGDVFVFPIGMIHFQFNTGNT  133

Query  45   NAVAFAGLSSQNPG  4
            NAVAFAGLSSQNPG
Sbjct  134  NAVAFAGLSSQNPG  147



>ref|XP_010257844.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=224

 Score =   110 bits (275),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGF  SNP     N L TKTL  GDVFVFP GLIHFQFN G+T
Sbjct  112  THPRATEILVVLEGTLYVGFATSNP----DNRLITKTLNKGDVFVFPVGLIHFQFNTGET  167

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGLSSQNPGV
Sbjct  168  NAVALAGLSSQNPGV  182



>ref|XP_008780761.1| PREDICTED: germin-like protein 8-5, partial [Phoenix dactylifera]
Length=148

 Score =   108 bits (270),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 60/74 (81%), Gaps = 3/74 (4%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
            HPR TE+L +LEGTL+VGFV SN P    N LFTK L  GDVFVFP+GLIHFQFN GKTN
Sbjct  35   HPRGTEILTVLEGTLHVGFVTSNNP---NNQLFTKVLNKGDVFVFPQGLIHFQFNYGKTN  91

Query  42   AVAFAGLSSQNPGV  1
            AVA AGLSSQNPGV
Sbjct  92   AVAIAGLSSQNPGV  105



>ref|XP_007030267.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10769.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=298

 Score =   112 bits (279),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EGTLYVGFV SNP     N L TK L  GDVFVFP GLIHFQFNIG T
Sbjct  114  THPRATEILVVVEGTLYVGFVTSNP----DNRLITKVLYPGDVFVFPVGLIHFQFNIGNT  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVAF+GLSSQNPG+
Sbjct  170  NAVAFSGLSSQNPGI  184



>ref|XP_002531991.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF30390.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=194

 Score =   109 bits (272),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 60/74 (81%), Gaps = 5/74 (7%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L TKTL  GDVFVFP G+IHFQFN G T
Sbjct  83   THPRATEILVVLEGTLYVGFVTSNP-----NRLITKTLKPGDVFVFPIGMIHFQFNTGST  137

Query  45   NAVAFAGLSSQNPG  4
            NAVAFAGLSSQNPG
Sbjct  138  NAVAFAGLSSQNPG  151



>ref|XP_002276644.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFP+GLIHFQ N+GKT
Sbjct  114  THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPQGLIHFQLNVGKT  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  170  NAVAIASLSSQNPGV  184



>ref|XP_002265608.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFPEGLIHFQ N+GKT
Sbjct  114  THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKT  169

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  170  KAVAIAALSSQNPGV  184



>ref|XP_002276315.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFP+GLIHFQ N+GKT
Sbjct  114  THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPQGLIHFQLNVGKT  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  170  NAVAIASLSSQNPGV  184



>ref|XP_003633724.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFPEGLIHFQ N+GKT
Sbjct  114  THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKT  169

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  170  KAVAIAALSSQNPGV  184



>emb|CBI33612.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   110 bits (274),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFPEGLIHFQ N+GKT
Sbjct  114  THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKT  169

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  170  KAVAIAALSSQNPGV  184



>emb|CBI33611.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFPEGLIHFQ N+GKT
Sbjct  172  THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKT  227

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  228  KAVAIAALSSQNPGV  242



>ref|XP_010907049.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein 8-2 [Elaeis 
guineensis]
Length=224

 Score =   109 bits (273),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L +LEGTLYVGFV SNP     N LFTK L  GDVFVFP+GLIHFQFN GKT
Sbjct  111  THPRGTEILVVLEGTLYVGFVTSNP----NNQLFTKVLHEGDVFVFPQGLIHFQFNNGKT  166

Query  45   NAVAFAGLSSQNPGV  1
            +AVAFAGLSSQN GV
Sbjct  167  SAVAFAGLSSQNLGV  181



>emb|CAN70189.1| hypothetical protein VITISV_016562 [Vitis vinifera]
Length=214

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFPEGLIHFQ N+GKT
Sbjct  107  THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKT  162

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  163  KAVAIAALSSQNPGV  177



>ref|XP_002531992.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF30391.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=223

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 60/74 (81%), Gaps = 5/74 (7%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L TKTL  GDVFVFP G+IHFQFN G T
Sbjct  112  THPRATEILVVLEGTLYVGFVTSNP-----NRLITKTLKPGDVFVFPIGMIHFQFNTGNT  166

Query  45   NAVAFAGLSSQNPG  4
            NAVAFAGLSSQNPG
Sbjct  167  NAVAFAGLSSQNPG  180



>ref|XP_003633723.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=226

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L  K L  GDVFVFPEGLIHFQ N+GKT
Sbjct  119  THPRATEILTVLEGTLYVGFVTSNP----DNRLICKVLYKGDVFVFPEGLIHFQLNVGKT  174

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  175  KAVAIAALSSQNPGV  189



>ref|XP_010911724.1| PREDICTED: putative germin-like protein 2-1 [Elaeis guineensis]
Length=221

 Score =   109 bits (273),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L +LEGTLYVGFV SNP     N LF+K L  GDVFVFP+GLIHFQFN GKT
Sbjct  108  THPRGTEILVVLEGTLYVGFVTSNP----NNQLFSKVLHEGDVFVFPQGLIHFQFNNGKT  163

Query  45   NAVAFAGLSSQNPGV  1
            +AVA AGLSSQNPGV
Sbjct  164  SAVALAGLSSQNPGV  178



>ref|XP_009113441.1| PREDICTED: germin-like protein subfamily 1 member 11 [Brassica 
rapa]
Length=222

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 62/75 (83%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L L EGTL+VGFV SN   G  N LFTKTL  GDVFVFPEGLIHFQFN+G++
Sbjct  114  THPRATEILVLQEGTLFVGFVSSN---GDGNRLFTKTLKQGDVFVFPEGLIHFQFNVGRS  170

Query  45   NAVAFAGLSSQNPGV  1
             AVAFA LSSQNPGV
Sbjct  171  PAVAFAALSSQNPGV  185



>emb|CBI33610.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFPEGLIHFQ N+GKT
Sbjct  208  THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKT  263

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  264  KAVAIAALSSQNPGV  278



>ref|XP_002530595.1| Oxalate oxidase 2 precursor, putative [Ricinus communis]
 gb|EEF31775.1| Oxalate oxidase 2 precursor, putative [Ricinus communis]
Length=209

 Score =   108 bits (271),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 60/74 (81%), Gaps = 5/74 (7%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
            HPRATE+L ++EGTLYVGFV SNP     N L TKTL  GDVFVFP GLIHFQFNIG  N
Sbjct  99   HPRATEILVVVEGTLYVGFVTSNP-----NRLITKTLKPGDVFVFPVGLIHFQFNIGHNN  153

Query  42   AVAFAGLSSQNPGV  1
            AVAFAGLSSQNPGV
Sbjct  154  AVAFAGLSSQNPGV  167



>ref|XP_002265857.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   109 bits (272),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFPEGLIHFQ N+GKT
Sbjct  114  THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKT  169

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  170  KAVAIAALSSQNPGV  184



>ref|XP_004301229.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Fragaria 
vesca subsp. vesca]
Length=209

 Score =   108 bits (271),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRA+E L ++EGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQFNIGK 
Sbjct  95   THPRASEFLVVMEGTLYVGFVTSNSDNG--NKLFTKVLYPGDVFVFPVGLIHFQFNIGKV  152

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGLSSQNPGV
Sbjct  153  NAVAIAGLSSQNPGV  167



>emb|CAN66771.1| hypothetical protein VITISV_022559 [Vitis vinifera]
Length=205

 Score =   108 bits (271),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFPEGLIHFQ N+GKT
Sbjct  98   THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKT  153

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  154  KAVAIAALSSQNPGV  168



>ref|XP_007030270.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10772.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=329

 Score =   110 bits (276),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EGTLYVGFV SNP     N L TK L  GDVFVFP GLIHFQFN G T
Sbjct  190  THPRATEILVVVEGTLYVGFVTSNP----DNRLITKVLYPGDVFVFPVGLIHFQFNKGNT  245

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  246  NAVAFAGLSSQNPGV  260



>ref|XP_007030278.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10780.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=476

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 62/75 (83%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRA+E+L +LEGTLYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ NIGKT
Sbjct  114  THPRASEILVVLEGTLYVGFVTSNP----ENRLITKVLYPGDVFVFPVGLIHFQLNIGKT  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  170  NAVAFAGLSSQNPGV  184


 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L TK L  GDVFVFP GLIHFQ NIGKT
Sbjct  364  THPRATEILVVLEGTLYVGFVTSNP----DNRLITKVLYPGDVFVFPVGLIHFQLNIGKT  419

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFA   SQNPGV
Sbjct  420  NAVAFAAFGSQNPGV  434



>ref|XP_007030273.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10775.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=224

 Score =   109 bits (272),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L ++EGTLYVGFV SNP    +N LFTK L  GDVFVFP GLIHFQFNIGKT
Sbjct  114  THPRGTEILVVVEGTLYVGFVTSNP----ENRLFTKVLYPGDVFVFPIGLIHFQFNIGKT  169

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQN GV
Sbjct  170  EAVAFAGLSSQNAGV  184



>ref|XP_007030274.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10776.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=675

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 62/75 (83%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ NIGKT
Sbjct  563  THPRATEILVVLEGTLYVGFVTSNP----ENRLITKVLYPGDVFVFPVGLIHFQLNIGKT  618

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  619  NAVAFAGLSSQNPGV  633


 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L ++EGTLYVGFV SNP    +N LFTK L  GDVFVFP GLIHFQFNIGKT
Sbjct  341  THPRGTEILVVVEGTLYVGFVTSNP----ENRLFTKVLNPGDVFVFPIGLIHFQFNIGKT  396

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQN GV
Sbjct  397  AAVAFAGLSSQNAGV  411


 Score = 87.4 bits (215),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 54/74 (73%), Gaps = 4/74 (5%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
             P+  ++L ++EGTLYVG V SNP    +N   TK L  GD F+FP GLIHFQFN+GKTN
Sbjct  51   DPKHGKILVIMEGTLYVGLVTSNP----ENHPITKVLNPGDGFLFPVGLIHFQFNVGKTN  106

Query  42   AVAFAGLSSQNPGV  1
            AVAFA LSSQNP V
Sbjct  107  AVAFAALSSQNPDV  120



>ref|XP_008237524.1| PREDICTED: germin-like protein subfamily 1 member 11 isoform 
X2 [Prunus mume]
Length=228

 Score =   108 bits (271),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+G  
Sbjct  115  THPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHV  171

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  172  NAVAFAGLSSQNPGV  186



>emb|CAN74828.1| hypothetical protein VITISV_002139 [Vitis vinifera]
Length=186

 Score =   108 bits (269),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SN     +N L +K L  GDVFVFP GLIHFQFN+GKT
Sbjct  74   THPRATEILVVLEGTLLVGFVTSNN----ENRLISKVLYKGDVFVFPIGLIHFQFNVGKT  129

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  130  NAVAFAGLSSQNPGV  144



>ref|XP_008237522.1| PREDICTED: germin-like protein subfamily 1 member 11 isoform 
X1 [Prunus mume]
Length=229

 Score =   108 bits (271),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+G  
Sbjct  116  THPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHV  172

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  173  NAVAFAGLSSQNPGV  187



>ref|XP_008375054.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=226

 Score =   108 bits (271),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEG+LYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+GKT
Sbjct  113  THPRATEILIVLEGSLYVGFVTSN---GDGNRLFTKVLYKGDVFVFPVGLIHFQLNVGKT  169

Query  45   NAVAFAGLSSQNPGV  1
            NA+A AGLSSQNPGV
Sbjct  170  NALAIAGLSSQNPGV  184



>ref|XP_006856738.1| hypothetical protein AMTR_s03266p00004160, partial [Amborella 
trichopoda]
 gb|ERN18205.1| hypothetical protein AMTR_s03266p00004160, partial [Amborella 
trichopoda]
Length=182

 Score =   107 bits (268),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEG+LYVGFV SNP     N L TKTL  GDVFVFPEGLIHFQ N+G  
Sbjct  70   THPRATEILTILEGSLYVGFVTSNP----DNRLITKTLQKGDVFVFPEGLIHFQQNVGYK  125

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  126  NAVAIAALSSQNPGV  140



>ref|XP_008237526.1| PREDICTED: germin-like protein subfamily 1 member 11 [Prunus 
mume]
Length=228

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+G  
Sbjct  115  THPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHV  171

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  172  NAVAFAGLSSQNPGV  186



>ref|XP_007200157.1| hypothetical protein PRUPE_ppa016753mg [Prunus persica]
 gb|EMJ01356.1| hypothetical protein PRUPE_ppa016753mg [Prunus persica]
Length=226

 Score =   108 bits (271),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+G  
Sbjct  113  THPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHV  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  170  NAVAFAGLSSQNPGV  184



>ref|XP_010911182.1| PREDICTED: putative germin-like protein 2-1 [Elaeis guineensis]
Length=221

 Score =   108 bits (270),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 59/74 (80%), Gaps = 4/74 (5%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
            HPR TE+L +LEGTLYVGFV SNP     N LFTK L   DVFVFP+GL+HFQFN GKTN
Sbjct  109  HPRGTEILIVLEGTLYVGFVTSNP----NNQLFTKILNNSDVFVFPQGLVHFQFNYGKTN  164

Query  42   AVAFAGLSSQNPGV  1
            AVA AGLSSQNPGV
Sbjct  165  AVAIAGLSSQNPGV  178



>emb|CAN71631.1| hypothetical protein VITISV_015711 [Vitis vinifera]
Length=204

 Score =   108 bits (269),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFPEGLIHFQ N+GKT
Sbjct  97   THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKT  152

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  153  KAVAIAALSSQNPGV  167



>ref|XP_010251866.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   108 bits (270),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/73 (75%), Positives = 60/73 (82%), Gaps = 4/73 (5%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
            HPRAT+VL +LEGTLYV FV SN    + N LFTK L  GDVFVFP+GLIHFQFN+G TN
Sbjct  111  HPRATKVLVVLEGTLYVSFVTSN----LDNRLFTKVLNKGDVFVFPKGLIHFQFNVGHTN  166

Query  42   AVAFAGLSSQNPG  4
            AVAFAGLSSQNPG
Sbjct  167  AVAFAGLSSQNPG  179



>emb|CDX95190.1| BnaC09g16800D [Brassica napus]
Length=197

 Score =   107 bits (268),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 61/75 (81%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L L EGTL VGFV SN   G  N LFTKTL  GDVFVFPEGLIHFQFN+G++
Sbjct  89   THPRATEILVLQEGTLLVGFVSSN---GDGNRLFTKTLKQGDVFVFPEGLIHFQFNVGRS  145

Query  45   NAVAFAGLSSQNPGV  1
             AVAFA LSSQNPGV
Sbjct  146  PAVAFAALSSQNPGV  160



>ref|XP_007201862.1| hypothetical protein PRUPE_ppa020162mg [Prunus persica]
 gb|EMJ03061.1| hypothetical protein PRUPE_ppa020162mg [Prunus persica]
Length=226

 Score =   108 bits (270),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+G  
Sbjct  113  THPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHV  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  170  NAVAFAGLSSQNPGV  184



>ref|XP_007200183.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
 gb|EMJ01382.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
Length=226

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+G  
Sbjct  113  THPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKVLNEGDVFVFPIGLIHFQLNVGHV  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  170  NAVAFAGLSSQNPGV  184



>ref|XP_011034308.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=228

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EGTLYVGFV SN P G  N L TK L  GDVFVFP GL+HFQ N+GKT
Sbjct  112  THPRATEILVVVEGTLYVGFVTSNLPNG-DNRLITKVLNPGDVFVFPVGLVHFQLNVGKT  170

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFA LSSQNPGV
Sbjct  171  NAVAFASLSSQNPGV  185



>ref|XP_010659820.1| PREDICTED: germin-like protein 3 isoform X1 [Vitis vinifera]
Length=190

 Score =   107 bits (267),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SN     +N L +K L  GDVFVFP GLIHFQFN+GKT
Sbjct  78   THPRATEILVVLEGTLLVGFVTSN----NENRLISKVLYKGDVFVFPIGLIHFQFNVGKT  133

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  134  NAVAFAGLSSQNPGV  148



>ref|XP_011034305.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=228

 Score =   108 bits (270),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EGTLYVGFV SN P G  N L TK L  GDVFVFP GL+HFQ N+GKT
Sbjct  112  THPRATEILVVVEGTLYVGFVTSNLPNG-DNRLITKVLNPGDVFVFPVGLVHFQLNVGKT  170

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFA LSSQNPGV
Sbjct  171  NAVAFASLSSQNPGV  185



>emb|CDP10698.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   108 bits (269),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEV+F +EGTL   FV SNPP  MKN LFTK L  GDVFVFP+GL+HF  N+GKT
Sbjct  111  THPRATEVIFAVEGTLAASFVTSNPPNNMKNRLFTKVLNPGDVFVFPQGLVHFIQNLGKT  170

Query  45   NAVAFAGLSSQNPGV  1
             A+AF+G SSQNPGV
Sbjct  171  KALAFSGFSSQNPGV  185



>ref|XP_007200176.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
 gb|EMJ01375.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
Length=226

 Score =   108 bits (269),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+G  
Sbjct  113  THPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHV  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  170  NAVAFAGLSSQNPGV  184



>emb|CBI36816.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   108 bits (269),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFNIGKT
Sbjct  113  THPRATEILTVLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPIGLIHFQFNIGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  169  NAVAIAALSSQNPGV  183



>ref|XP_008351931.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   108 bits (269),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EG+LYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+GKT
Sbjct  115  THPRATEILIVVEGSLYVGFVTSN---GDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
            NA+A AGLSSQNPGV
Sbjct  172  NALAIAGLSSQNPGV  186



>ref|XP_008393483.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   108 bits (269),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EG+LYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+GKT
Sbjct  115  THPRATEILIVVEGSLYVGFVTSN---GDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
            NA+A AGLSSQNPGV
Sbjct  172  NALAIAGLSSQNPGV  186



>ref|XP_004952511.1| PREDICTED: putative germin-like protein 2-2-like [Setaria italica]
Length=217

 Score =   108 bits (269),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEG+LYVGFV SNP     N LFTK L  GDVFVFPEGLIHFQFN G  
Sbjct  110  THPRATEILTVLEGSLYVGFVTSNP----DNKLFTKILNKGDVFVFPEGLIHFQFNYGTN  165

Query  45   NAVAFAGLSSQNPGV  1
            +AVA A LSSQNPGV
Sbjct  166  SAVALAALSSQNPGV  180



>ref|XP_008363404.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 11 [Malus domestica]
Length=225

 Score =   108 bits (269),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+LFL EGTLYVGFV SNP     N LFTK L  GDVFVFP GLIHFQ N+G T
Sbjct  113  THPRGTEILFLQEGTLYVGFVTSNP----DNRLFTKVLNKGDVFVFPVGLIHFQLNVGHT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA +GLSSQNPGV
Sbjct  169  NAVAISGLSSQNPGV  183



>ref|XP_002525480.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF36970.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=175

 Score =   107 bits (266),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 5/75 (7%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EGTLYVGFV SNP     N   +K L  GDVFVFP GLIHFQFN+ KT
Sbjct  65   THPRATEILVVIEGTLYVGFVTSNP-----NRFISKVLYPGDVFVFPIGLIHFQFNLAKT  119

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  120  NAVAFAGLSSQNPGV  134



>ref|XP_007199217.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
 gb|EMJ00416.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
Length=226

 Score =   108 bits (269),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+G  
Sbjct  113  THPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHV  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  170  NAVAFAGLSSQNPGV  184



>ref|XP_002452098.1| hypothetical protein SORBIDRAFT_04g019650 [Sorghum bicolor]
 gb|EES05074.1| hypothetical protein SORBIDRAFT_04g019650 [Sorghum bicolor]
Length=217

 Score =   108 bits (269),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L +LEG+LYVGFV SNP     N LFTK L  GDVFVFPEGLIHFQFN G+ 
Sbjct  110  THPRGTEILTMLEGSLYVGFVTSNP----DNKLFTKVLNKGDVFVFPEGLIHFQFNYGRK  165

Query  45   NAVAFAGLSSQNPGV  1
            +AVA A LSSQNPGV
Sbjct  166  SAVALAALSSQNPGV  180



>gb|KDO38410.1| hypothetical protein CISIN_1g048538mg, partial [Citrus sinensis]
Length=181

 Score =   107 bits (266),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRAT++L +LEGTLYVGFV SN    + N L  K L  GDVFVFP GLIHFQFNIGKT
Sbjct  73   THPRATDILAVLEGTLYVGFVTSNE---LNNTLIAKVLKKGDVFVFPIGLIHFQFNIGKT  129

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  130  NAVAIAALSSQNPGV  144



>emb|CBI36815.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   108 bits (269),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFNIG T
Sbjct  113  THPRATEILTVLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPMGLIHFQFNIGHT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGLSSQNPGV
Sbjct  169  NAVAIAGLSSQNPGV  183



>ref|XP_002276756.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   108 bits (269),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            +HPRATE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFP+GLIHFQ N+GKT
Sbjct  114  SHPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLHKGDVFVFPQGLIHFQLNVGKT  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  170  NAVAIASLSSQNPGV  184



>ref|XP_002277055.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
 emb|CBI38542.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   108 bits (269),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFP+GLIHFQ N+G T
Sbjct  114  THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPQGLIHFQLNVGTT  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  170  NAVAIASLSSQNPGV  184



>emb|CBI39473.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   107 bits (268),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFNIGKT
Sbjct  113  THPRATEILTVLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPIGLIHFQFNIGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  169  NAVAIAALSSQNPGV  183



>ref|XP_008237521.1| PREDICTED: germin-like protein subfamily 1 member 16 [Prunus 
mume]
Length=234

 Score =   108 bits (269),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+G  
Sbjct  121  THPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGYV  177

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  178  NAVAFAGLSSQNPGV  192



>ref|XP_009349816.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=228

 Score =   107 bits (268),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EG+LYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+GKT
Sbjct  115  THPRATEILIVVEGSLYVGFVTSN---GDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
            NA+A AGLSSQNPGV
Sbjct  172  NALAIAGLSSQNPGV  186



>ref|XP_006857270.1| hypothetical protein AMTR_s00067p00014150 [Amborella trichopoda]
 gb|ERN18737.1| hypothetical protein AMTR_s00067p00014150 [Amborella trichopoda]
Length=218

 Score =   107 bits (268),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEG+LYVGFV SNP     N L TKTL  GDVFVFPEGLIHFQ N+G  
Sbjct  106  THPRATEILTVLEGSLYVGFVTSNP----DNRLITKTLQKGDVFVFPEGLIHFQQNVGYK  161

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  162  NAVAIAALSSQNPGV  176



>ref|XP_008393146.1| PREDICTED: germin-like protein subfamily 1 member 11 [Malus domestica]
Length=225

 Score =   107 bits (268),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+LFL EGTLYVGFV SNP     N LFTK L  GDVFVFP GLIHFQ N+G T
Sbjct  113  THPRGTEILFLQEGTLYVGFVTSNP----NNRLFTKVLNKGDVFVFPVGLIHFQLNVGHT  168

Query  45   NAVAFAGLSSQNPGV  1
            +AVA AGLSSQNPGV
Sbjct  169  SAVAIAGLSSQNPGV  183



>ref|XP_002281186.2| PREDICTED: uncharacterized protein LOC100244552 [Vitis vinifera]
Length=478

 Score =   110 bits (275),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFPEGLIHFQ N+GKT
Sbjct  371  THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKT  426

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  427  KAVAIAALSSQNPGV  441


 Score = 97.4 bits (241),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 56/75 (75%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            T+PRATE+L +LEGTLYVGFV SNP     N L +K L  GDVF+F EGLIHFQ N+ KT
Sbjct  98   TYPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFIFLEGLIHFQLNVRKT  153

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQN GV
Sbjct  154  KAVAIAALSSQNLGV  168



>ref|XP_002522034.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF40438.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=198

 Score =   107 bits (266),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 5/75 (7%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EGTLYVGFV SNP     N   +K L  GDVFVFP GLIHFQFN+ KT
Sbjct  88   THPRATEILVVIEGTLYVGFVTSNP-----NRFISKVLYPGDVFVFPIGLIHFQFNLAKT  142

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  143  NAVAFAGLSSQNPGV  157



>emb|CBI36791.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   107 bits (268),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SN     +N L +K L  GDVFVFP GLIHFQFN+GKT
Sbjct  113  THPRATEILVVLEGTLLVGFVTSN----NENRLISKVLYKGDVFVFPIGLIHFQFNVGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  169  NAVAFAGLSSQNPGV  183



>gb|AAL15887.1|AF417299_1 putative germin [Castanea sativa]
Length=164

 Score =   106 bits (264),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L ++EGTL+VGFV SNP    +N LFTKTL  GDVFVFP GLIHFQ N+GKT
Sbjct  55   THPRGTEILVVVEGTLFVGFVTSNP----ENRLFTKTLNKGDVFVFPIGLIHFQLNVGKT  110

Query  45   NAVAFAGLSSQNPGV  1
            NA+A +GLSSQN GV
Sbjct  111  NAIAISGLSSQNAGV  125



>ref|XP_008780704.1| PREDICTED: germin-like protein 8-5, partial [Phoenix dactylifera]
Length=152

 Score =   105 bits (263),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 59/74 (80%), Gaps = 3/74 (4%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
            HPR TE+L +LEGTL+VGFV SN    + N LFTK L  GDVFVFP+GLIHFQFN GKTN
Sbjct  39   HPRGTEILTVLEGTLHVGFVTSN---NLNNQLFTKVLNKGDVFVFPQGLIHFQFNYGKTN  95

Query  42   AVAFAGLSSQNPGV  1
            AVA A LSSQNPGV
Sbjct  96   AVAIAALSSQNPGV  109



>ref|XP_007030265.1| Germin-like protein 2 [Theobroma cacao]
 gb|EOY10767.1| Germin-like protein 2 [Theobroma cacao]
Length=221

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFP GLIHFQ N+GKT
Sbjct  114  THPRGTEILVVLEGTLYVGFVTSNP----NNRLISKILSPGDVFVFPIGLIHFQQNVGKT  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  170  NAVAFAGLSSQNPGV  184



>ref|XP_008360941.1| PREDICTED: germin-like protein subfamily 1 member 17 [Malus domestica]
Length=228

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EG+LYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+GKT
Sbjct  115  THPRATEILIVVEGSLYVGFVTSN---GDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
            NA+A AGLSSQNPGV
Sbjct  172  NALAIAGLSSQNPGV  186



>ref|NP_001267943.1| germin-like protein 4 precursor [Vitis vinifera]
 gb|ABL60873.1| germin-like protein 4 [Vitis vinifera]
Length=220

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFN+GKT
Sbjct  113  THPRATEILTVLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPIGLIHFQFNVGKT  168

Query  45   NAVAFAGLSSQNPGV  1
             AVA AGLSSQNPGV
Sbjct  169  KAVAIAGLSSQNPGV  183



>ref|XP_002265447.3| PREDICTED: uncharacterized protein LOC100242782 [Vitis vinifera]
Length=450

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFPEGLIHFQ N+GKT
Sbjct  343  THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKT  398

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  399  KAVAIAALSSQNPGV  413


 Score =   102 bits (254),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 55/75 (73%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L  LEGTLYVGFV SNP     N L +K L  GDVFVFPE LIHFQ N+ KT
Sbjct  77   THPRDTEILTFLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEDLIHFQLNVEKT  132

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  133  KAVAIAALSSQNPGV  147



>ref|XP_006477881.1| PREDICTED: germin-like protein subfamily 1 member 17-like isoform 
X2 [Citrus sinensis]
Length=219

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN    + N L  K L  GDVFVFP GLIHFQFNIGKT
Sbjct  111  THPRATEILTVLEGTLYVGFVTSN---QLNNTLIAKVLKKGDVFVFPIGLIHFQFNIGKT  167

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  168  NAVAIAALSSQNPGV  182



>gb|KDP23768.1| hypothetical protein JCGZ_23601 [Jatropha curcas]
Length=229

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 5/75 (7%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EGTLYVGFV SNP     N L +K L  GDVFVFP GLIHFQ NI KT
Sbjct  120  THPRATEILVVVEGTLYVGFVTSNP-----NRLISKVLYPGDVFVFPIGLIHFQMNIAKT  174

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  175  NAVAFAGLSSQNPGV  189



>emb|CBI36814.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRA+E+L +LEGTLYVGFV SNP    +N L +K L  GDVFVFP GLIHFQFN+G T
Sbjct  113  THPRASEILTVLEGTLYVGFVTSNP----ENRLISKVLNKGDVFVFPIGLIHFQFNVGHT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGL+SQNPGV
Sbjct  169  NAVAIAGLNSQNPGV  183



>ref|XP_010941821.1| PREDICTED: putative germin-like protein 2-1 [Elaeis guineensis]
Length=199

 Score =   107 bits (266),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRA+E L ++EG+LY GFV SNP     N LF K L  GDVFVFPEGLIHFQ N+GKT
Sbjct  91   THPRASEFLTVIEGSLYAGFVTSNP----DNKLFAKILHKGDVFVFPEGLIHFQLNVGKT  146

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGLSSQNPGV
Sbjct  147  NAVAIAGLSSQNPGV  161



>ref|XP_006442438.1| hypothetical protein CICLE_v10024000mg [Citrus clementina]
 gb|ESR55678.1| hypothetical protein CICLE_v10024000mg [Citrus clementina]
Length=220

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN    + N L  K L  GDVFVFP GLIHFQFNIGKT
Sbjct  112  THPRATEILTVLEGTLYVGFVTSNQ---LNNTLIAKVLKKGDVFVFPIGLIHFQFNIGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  169  NAVAIAALSSQNPGV  183



>ref|XP_007201690.1| hypothetical protein PRUPE_ppa016952mg, partial [Prunus persica]
 gb|EMJ02889.1| hypothetical protein PRUPE_ppa016952mg, partial [Prunus persica]
Length=183

 Score =   106 bits (265),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRA+E+L +LEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+G  
Sbjct  70   THPRASEILAVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHV  126

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  127  NAVAFAGLSSQNPGV  141



>ref|XP_008367619.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L + EG+LYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+GKT
Sbjct  115  THPRATEILIVXEGSLYVGFVTSN---GDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
            NA+A AGLSSQNPGV
Sbjct  172  NALAIAGLSSQNPGV  186



>ref|XP_006841333.1| hypothetical protein AMTR_s01299p00010680, partial [Amborella 
trichopoda]
 gb|ERN03008.1| hypothetical protein AMTR_s01299p00010680, partial [Amborella 
trichopoda]
Length=139

 Score =   105 bits (261),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 58/74 (78%), Gaps = 4/74 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEG+LYVGFV SNP     N L TKTL  GDVFVFPEGLIHFQ N+G  
Sbjct  70   THPRATEILTVLEGSLYVGFVTSNP----DNRLITKTLQKGDVFVFPEGLIHFQQNVGYN  125

Query  45   NAVAFAGLSSQNPG  4
            NAVA A LSSQNPG
Sbjct  126  NAVAIAALSSQNPG  139



>ref|XP_002265297.3| PREDICTED: uncharacterized protein LOC100247931 [Vitis vinifera]
Length=490

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFPEGLIHFQ N+GKT
Sbjct  114  THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKT  169

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  170  KAVAIAALSSQNPGV  184


 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L  K L  GDVF+FPEGLIHFQ N+GKT
Sbjct  383  THPRATEILTVLEGTLYVGFVTSNP----DNRLICKVLYKGDVFIFPEGLIHFQLNVGKT  438

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  439  KAVAIAALSSQNPGV  453



>ref|XP_002284284.2| PREDICTED: germin-like protein subfamily 1 member 17 [Vitis vinifera]
Length=245

 Score =   107 bits (268),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFNIGKT
Sbjct  138  THPRATEILTVLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPIGLIHFQFNIGKT  193

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  194  NAVAIAALSSQNPGV  208



>ref|XP_006442436.1| hypothetical protein CICLE_v10024280mg [Citrus clementina]
 gb|ESR55676.1| hypothetical protein CICLE_v10024280mg [Citrus clementina]
Length=220

 Score =   107 bits (266),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN    + N L  K L  GDVFVFP GLIHFQFNIGKT
Sbjct  112  THPRATEILTVLEGTLYVGFVTSN---QLNNTLIAKVLKKGDVFVFPIGLIHFQFNIGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  169  NAVAIAALSSQNPGV  183



>ref|XP_006477875.1| PREDICTED: germin-like protein subfamily 1 member 15-like [Citrus 
sinensis]
 ref|XP_006477880.1| PREDICTED: germin-like protein subfamily 1 member 17-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477882.1| PREDICTED: germin-like protein subfamily 1 member 15-like [Citrus 
sinensis]
Length=220

 Score =   107 bits (266),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN    + N L  K L  GDVFVFP GLIHFQFNIGKT
Sbjct  112  THPRATEILTVLEGTLYVGFVTSN---QLNNTLIAKVLKKGDVFVFPIGLIHFQFNIGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  169  NAVAIAALSSQNPGV  183



>emb|CAN61141.1| hypothetical protein VITISV_024669 [Vitis vinifera]
Length=181

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFN+GKT
Sbjct  74   THPRATEILTVLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPIGLIHFQFNVGKT  129

Query  45   NAVAFAGLSSQNPGV  1
             AVA AGLSSQNPGV
Sbjct  130  KAVAIAGLSSQNPGV  144



>ref|XP_003633711.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   107 bits (266),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 57/75 (76%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L  K L  GDVFVFPEGLIHF  N+GKT
Sbjct  114  THPRATEILTVLEGTLYVGFVTSNP----DNRLIAKVLYKGDVFVFPEGLIHFHLNVGKT  169

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  170  KAVAIAALSSQNPGV  184



>emb|CBI36811.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFN+GKT
Sbjct  113  THPRATEILTVLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPIGLIHFQFNVGKT  168

Query  45   NAVAFAGLSSQNPGV  1
             AVA AGLSSQNPGV
Sbjct  169  KAVAIAGLSSQNPGV  183



>ref|XP_006477877.1| PREDICTED: germin-like protein subfamily 1 member 15-like [Citrus 
sinensis]
Length=220

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN    + N L  K L  GDVFVFP GLIHFQFNIGKT
Sbjct  112  THPRATEILTVLEGTLYVGFVTSN---QLNNTLIAKVLKKGDVFVFPIGLIHFQFNIGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  169  NAVAIAALSSQNPGV  183



>ref|XP_006845051.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
 gb|ERN06726.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
Length=220

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEG+LYVGFV SNP     N L TKT+  GDVFVFPEGLIHFQ N+G  
Sbjct  108  THPRATEILTVLEGSLYVGFVTSNP----DNRLITKTIQKGDVFVFPEGLIHFQQNVGSK  163

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  164  NAVAIAALSSQNPGV  178



>ref|XP_006477879.1| PREDICTED: germin-like protein subfamily 1 member 15-like [Citrus 
sinensis]
Length=220

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN    + N L  K L  GDVFVFP GLIHFQFNIGKT
Sbjct  112  THPRATEILTVLEGTLYVGFVTSN---QLNNTLVAKVLKKGDVFVFPIGLIHFQFNIGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  169  NAVAIAALSSQNPGV  183



>ref|XP_010659856.1| PREDICTED: germin-like protein subfamily 1 member 7 [Vitis vinifera]
Length=222

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SNP    +N LF+K L  GDVFVFP GLIHFQFNIG T
Sbjct  115  THPRATEILTVLEGTLLVGFVTSNP----QNRLFSKVLNKGDVFVFPIGLIHFQFNIGHT  170

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGL+SQNPGV
Sbjct  171  NAVAIAGLNSQNPGV  185



>ref|XP_009355938.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=226

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEG+LYVGFV SN      N LFTK L  GDVFVFP GLIHFQ N+GKT
Sbjct  113  THPRATEILIVLEGSLYVGFVTSN---ADGNRLFTKVLYKGDVFVFPVGLIHFQLNVGKT  169

Query  45   NAVAFAGLSSQNPGV  1
            NA+A AGLSSQNPGV
Sbjct  170  NALAIAGLSSQNPGV  184



>ref|XP_004952512.1| PREDICTED: putative germin-like protein 2-2-like [Setaria italica]
Length=215

 Score =   106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEG+L+VGFV SNP     N L TK L  GDVFVFP+GLIHFQFN G  
Sbjct  108  THPRATEILTVLEGSLFVGFVTSNP----NNALITKALNKGDVFVFPKGLIHFQFNNGTN  163

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGLSSQNPGV
Sbjct  164  NAVALAGLSSQNPGV  178



>ref|XP_006442442.1| hypothetical protein CICLE_v10022152mg [Citrus clementina]
 gb|ESR55682.1| hypothetical protein CICLE_v10022152mg [Citrus clementina]
Length=220

 Score =   106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN    + N L  K L  GDVFVFP GLIHFQFNIGKT
Sbjct  112  THPRATEILTVLEGTLYVGFVTSN---QLNNTLVAKVLKKGDVFVFPIGLIHFQFNIGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  169  NAVAIAALSSQNPGV  183



>ref|XP_007030276.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 ref|XP_007030282.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10778.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10784.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=225

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L TK L  GDVFVFP GLIHFQ NIGKT
Sbjct  113  THPRATEILVVLEGTLYVGFVTSNP----DNRLITKVLYPGDVFVFPVGLIHFQLNIGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFA   SQNPGV
Sbjct  169  NAVAFAAFGSQNPGV  183



>emb|CAN72994.1| hypothetical protein VITISV_000563 [Vitis vinifera]
Length=205

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 57/75 (76%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L  K L  GDVFVFPEGLIHF  N+GKT
Sbjct  98   THPRATEILTVLEGTLYVGFVTSNP----DNRLIAKVLYKGDVFVFPEGLIHFHLNVGKT  153

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  154  KAVAIAALSSQNPGV  168



>ref|XP_010662282.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=192

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GD+FVFP+GLIHFQ N+G T
Sbjct  78   THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDLFVFPQGLIHFQLNVGTT  133

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  134  NAVAIASLSSQNPGV  148



>ref|XP_002319671.1| hypothetical protein POPTR_0013s04840g [Populus trichocarpa]
 gb|EEE95594.1| hypothetical protein POPTR_0013s04840g [Populus trichocarpa]
Length=221

 Score =   106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE++ ++EGTLYVGFV SN   G  N L TK L  GDVFVFP GLIHFQFN+GKT
Sbjct  111  THPRATEIIVVVEGTLYVGFVTSNLANG-DNRLITKALKPGDVFVFPIGLIHFQFNVGKT  169

Query  45   NAVAFAGLSSQNPGV  1
             A+AFAGLSSQNPGV
Sbjct  170  KALAFAGLSSQNPGV  184



>emb|CBI36810.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP    +N L +K L  GDVFVFP GLIHFQFN+G T
Sbjct  113  THPRATEILTVLEGTLYVGFVTSNP----ENRLISKVLNKGDVFVFPIGLIHFQFNVGHT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGL+SQNPGV
Sbjct  169  NAVAIAGLNSQNPGV  183



>gb|KDO42113.1| hypothetical protein CISIN_1g027369mg [Citrus sinensis]
Length=224

 Score =   106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN    + N L  K L  GDVFVFP G+IHFQFNIGKT
Sbjct  112  THPRATEILVVLEGTLYVGFVTSNQ---LNNTLIAKVLNKGDVFVFPIGMIHFQFNIGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAG  SQNPGV
Sbjct  169  NAVAFAGFGSQNPGV  183



>ref|XP_006477883.1| PREDICTED: germin-like protein subfamily 1 member 15-like [Citrus 
sinensis]
 ref|XP_006477885.1| PREDICTED: germin-like protein subfamily 1 member 15-like [Citrus 
sinensis]
Length=220

 Score =   106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN    + N L  K L  GDVFVFP GLIHFQFNIGKT
Sbjct  112  THPRATEILTVLEGTLYVGFVTSN---QLNNTLVAKVLKKGDVFVFPIGLIHFQFNIGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  169  NAVAIAALSSQNPGV  183



>emb|CAN73848.1| hypothetical protein VITISV_021639 [Vitis vinifera]
Length=141

 Score =   104 bits (260),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SNP    +N LF+K L  GDVFVFP GLIHFQFNIG T
Sbjct  34   THPRATEILTVLEGTLLVGFVTSNP----QNRLFSKVLNKGDVFVFPIGLIHFQFNIGHT  89

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A L+SQNPGV
Sbjct  90   NAVAIAALNSQNPGV  104



>ref|XP_002319672.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
 gb|EEE95595.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
Length=221

 Score =   106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE++ ++EGTLYVGFV SN   G  N L TK L  GDVFVFP GLIHFQFN+GKT
Sbjct  111  THPRATEIIVVVEGTLYVGFVTSNLANG-DNRLITKALKPGDVFVFPIGLIHFQFNVGKT  169

Query  45   NAVAFAGLSSQNPGV  1
             A+AFAGLSSQNPGV
Sbjct  170  KALAFAGLSSQNPGV  184



>ref|XP_008780786.1| PREDICTED: germin-like protein 8-5, partial [Phoenix dactylifera]
Length=148

 Score =   104 bits (260),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 58/74 (78%), Gaps = 3/74 (4%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
            HPR TE+L +LEGTL+ GFV SN P    N LFTK L  GDVFVFP+GLIHFQFN GKTN
Sbjct  35   HPRGTEILTVLEGTLHAGFVTSNNP---NNQLFTKVLNKGDVFVFPQGLIHFQFNYGKTN  91

Query  42   AVAFAGLSSQNPGV  1
            AVA A LSSQNPGV
Sbjct  92   AVAIAALSSQNPGV  105



>ref|XP_010662281.1| PREDICTED: putative germin-like protein 2-1, partial [Vitis vinifera]
Length=187

 Score =   105 bits (263),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L +K L  GD+FVFP+GLIHFQ N+G T
Sbjct  73   THPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLHKGDIFVFPQGLIHFQLNVGTT  128

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  129  NAVAIASLSSQNPGV  143



>ref|XP_006443312.1| hypothetical protein CICLE_v10022118mg [Citrus clementina]
 ref|XP_006479023.1| PREDICTED: germin-like protein subfamily 1 member 15-like [Citrus 
sinensis]
 gb|ESR56552.1| hypothetical protein CICLE_v10022118mg [Citrus clementina]
Length=224

 Score =   106 bits (265),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 59/74 (80%), Gaps = 3/74 (4%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
            HPRATE+L +LEGTLYVGFV SN    + N L  K L  GDVFVFP G+IHFQFNIGKTN
Sbjct  113  HPRATEILVVLEGTLYVGFVTSNQ---LNNTLIAKVLNKGDVFVFPIGMIHFQFNIGKTN  169

Query  42   AVAFAGLSSQNPGV  1
            AVAFAGL SQNPGV
Sbjct  170  AVAFAGLGSQNPGV  183



>gb|KFK33230.1| hypothetical protein AALP_AA6G347300 [Arabis alpina]
Length=222

 Score =   106 bits (265),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L + +GTL+VGFV SN   G  N LFTKTL  GDVFVFPEGL+HFQFN G+T
Sbjct  114  THPRATEILVVHQGTLFVGFVTSN---GDGNRLFTKTLKQGDVFVFPEGLVHFQFNTGRT  170

Query  45   NAVAFAGLSSQNPGV  1
             AVAFA LSSQNPGV
Sbjct  171  PAVAFAALSSQNPGV  185



>emb|CAN80134.1| hypothetical protein VITISV_012033 [Vitis vinifera]
Length=224

 Score =   106 bits (265),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP    +N L +K L  GDVFVFP GLIHFQFN+G T
Sbjct  113  THPRATEILVVLEGTLYVGFVTSNP----ENRLISKVLNKGDVFVFPIGLIHFQFNVGHT  168

Query  45   NAVAFAGLSSQNPGV  1
            N VA A LSSQNPGV
Sbjct  169  NTVAIAALSSQNPGV  183



>emb|CAN74481.1| hypothetical protein VITISV_042845 [Vitis vinifera]
Length=181

 Score =   105 bits (262),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SNP    +N LF+K L  GDVFVFP GLIHFQFNIG  
Sbjct  74   THPRATEILTVLEGTLLVGFVTSNP----QNRLFSKVLNKGDVFVFPIGLIHFQFNIGHM  129

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGLSSQNPGV
Sbjct  130  NAVAIAGLSSQNPGV  144



>ref|NP_001046876.1| Os02g0491800 [Oryza sativa Japonica Group]
 sp|Q6K5P8.1|GL23_ORYSJ RecName: Full=Putative germin-like protein 2-3; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD21900.1| putative germin-like protein [Oryza sativa Japonica Group]
 dbj|BAD22077.1| putative germin-like protein [Oryza sativa Japonica Group]
 dbj|BAF08790.1| Os02g0491800 [Oryza sativa Japonica Group]
 gb|EAZ23100.1| hypothetical protein OsJ_06794 [Oryza sativa Japonica Group]
Length=223

 Score =   106 bits (265),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEG+LYVGFV SNP    +N LFTK +  GDVFVFP+GL+HFQFN G T
Sbjct  116  THPRATEILTVLEGSLYVGFVTSNP----ENKLFTKVINKGDVFVFPKGLVHFQFNYGTT  171

Query  45   NAVAFAGLSSQNPGV  1
            +AVA   LSSQNPGV
Sbjct  172  DAVAIVALSSQNPGV  186



>ref|XP_004952510.1| PREDICTED: putative germin-like protein 2-2-like [Setaria italica]
Length=217

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L +LEG+LYVGFV SNP     N LFTK +  GDVFVFP+GLIHFQFN G  
Sbjct  110  THPRGTEILTVLEGSLYVGFVTSNP----DNKLFTKVINKGDVFVFPQGLIHFQFNYGTK  165

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  166  NAVALAALSSQNPGV  180



>ref|XP_011038440.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE++ ++EGTLYVGFV SN   G  N L TK L  GDVFVFP GLIHFQFN+GKT
Sbjct  111  THPRATEIIVVVEGTLYVGFVTSNLANG-DNRLITKALKPGDVFVFPIGLIHFQFNMGKT  169

Query  45   NAVAFAGLSSQNPGV  1
             A+AFAGLSSQNPGV
Sbjct  170  KALAFAGLSSQNPGV  184



>ref|XP_008237525.1| PREDICTED: germin-like protein subfamily 1 member 18 [Prunus 
mume]
Length=234

 Score =   106 bits (265),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRA+E L +LEG+LYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQFN+G  
Sbjct  121  THPRASEFLVVLEGSLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQFNVGHV  177

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  178  NAVAFAGLSSQNPGV  192



>ref|XP_002270404.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 59/74 (80%), Gaps = 4/74 (5%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
            HPRATE+L +LEGTLYVGFV SNP    +N L +K L  GDVFVFP+GLIHFQ N+G TN
Sbjct  115  HPRATEILTVLEGTLYVGFVTSNP----ENRLISKVLYKGDVFVFPQGLIHFQLNVGTTN  170

Query  42   AVAFAGLSSQNPGV  1
            AVA A LSSQNPGV
Sbjct  171  AVAIASLSSQNPGV  184



>ref|XP_010549631.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X2 
[Tarenaya hassleriana]
Length=141

 Score =   104 bits (259),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L L+EGTL VGFV SN     KN LF+K L  GDVFVFP G+IHFQ N+G+T
Sbjct  26   THPRATEILVLVEGTLLVGFVSSNQD---KNRLFSKVLYPGDVFVFPIGMIHFQVNVGRT  82

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGL SQNPGV
Sbjct  83   NAVAFAGLGSQNPGV  97



>ref|XP_002284624.1| PREDICTED: germin-like protein subfamily 1 member 7 [Vitis vinifera]
 emb|CBI36787.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   106 bits (264),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SNP    +N LF+K L  GDVFVFP GLIHFQFNIG T
Sbjct  113  THPRATEILTVLEGTLLVGFVTSNP----QNRLFSKVLNKGDVFVFPIGLIHFQFNIGHT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGL+SQNPGV
Sbjct  169  NAVAIAGLNSQNPGV  183



>ref|XP_007030283.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10785.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=166

 Score =   104 bits (260),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L ++EGTLYVGFV SN    ++N LFTK L  GDVFVFP GLIHFQFNIGKT
Sbjct  56   THPRGTEILVVVEGTLYVGFVTSN----LENRLFTKVLNPGDVFVFPIGLIHFQFNIGKT  111

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQN  V
Sbjct  112  KAVAFAGLSSQNAVV  126



>emb|CBI36790.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   105 bits (263),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SNP    +N LF+K L  GDVFVFP GLIHFQFNIG  
Sbjct  100  THPRATEILTVLEGTLLVGFVTSNP----QNRLFSKVLNKGDVFVFPIGLIHFQFNIGHM  155

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGLSSQNPGV
Sbjct  156  NAVAIAGLSSQNPGV  170



>ref|XP_006840196.1| hypothetical protein AMTR_s00089p00119480 [Amborella trichopoda]
 gb|ERN01871.1| hypothetical protein AMTR_s00089p00119480 [Amborella trichopoda]
Length=219

 Score =   106 bits (264),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP    +N L +KTL  GDVFVFP+GLIHFQ N+G  
Sbjct  107  THPRATEILTVLEGTLYVGFVTSNP----ENRLISKTLNKGDVFVFPQGLIHFQQNVGYG  162

Query  45   NAVAFAGLSSQNPGV  1
            N+VA AGLSSQNPGV
Sbjct  163  NSVAIAGLSSQNPGV  177



>ref|NP_001267940.1| germin-like protein 1 [Vitis vinifera]
 gb|ABL60872.1| germin-like protein 1 [Vitis vinifera]
Length=207

 Score =   105 bits (263),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SNP    +N LF+K L  GDVFVFP GLIHFQFNIG  
Sbjct  100  THPRATEILTVLEGTLLVGFVTSNP----QNRLFSKVLNKGDVFVFPIGLIHFQFNIGHM  155

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGLSSQNPGV
Sbjct  156  NAVAIAGLSSQNPGV  170



>ref|XP_006442440.1| hypothetical protein CICLE_v10023726mg [Citrus clementina]
 gb|ESR55680.1| hypothetical protein CICLE_v10023726mg [Citrus clementina]
Length=220

 Score =   105 bits (263),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 58/75 (77%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN    + N L  K L  GD FVFP GLIHFQFNIGKT
Sbjct  112  THPRATEILTVLEGTLYVGFVTSN---QLNNTLIAKVLKKGDAFVFPIGLIHFQFNIGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  169  NAVAIAALSSQNPGV  183



>ref|XP_003618167.1| Germin-like protein [Medicago truncatula]
 gb|AES74385.1| germin family protein [Medicago truncatula]
Length=220

 Score =   105 bits (263),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ N+G  
Sbjct  108  THPRATEILIVLEGTLYVGFVTSNP----ENRLITKVLNKGDVFVFPIGLIHFQLNVGYG  163

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGLSSQNPGV
Sbjct  164  NAVAIAGLSSQNPGV  178



>ref|XP_002319184.1| hypothetical protein POPTR_0013s06030g [Populus trichocarpa]
 ref|XP_002319673.2| germin-like protein 1 [Populus trichocarpa]
 ref|XP_006375916.1| hypothetical protein POPTR_0013s06010g [Populus trichocarpa]
 ref|XP_002319185.2| hypothetical protein POPTR_0013s06020g [Populus trichocarpa]
 gb|EEE95107.1| hypothetical protein POPTR_0013s06030g [Populus trichocarpa]
 gb|EEE95596.2| germin-like protein 1 [Populus trichocarpa]
 gb|ERP53713.1| hypothetical protein POPTR_0013s06010g [Populus trichocarpa]
 gb|EEE95108.2| hypothetical protein POPTR_0013s06020g [Populus trichocarpa]
Length=228

 Score =   105 bits (263),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EGTLYVGFV SN   G  N L TK L  GDVFVFP GLIHFQ N+GKT
Sbjct  112  THPRATEILVVVEGTLYVGFVTSNLANG-DNRLITKVLNPGDVFVFPVGLIHFQLNVGKT  170

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFA LSSQNPGV
Sbjct  171  NAVAFASLSSQNPGV  185



>ref|XP_003618165.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES74383.1| germin family protein [Medicago truncatula]
 gb|AFK46512.1| unknown [Medicago truncatula]
Length=220

 Score =   105 bits (263),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ N+G  
Sbjct  108  THPRATEILIVLEGTLYVGFVTSNP----ENRLITKVLNKGDVFVFPIGLIHFQLNVGYG  163

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGLSSQNPGV
Sbjct  164  NAVAIAGLSSQNPGV  178



>ref|XP_006286150.1| hypothetical protein CARUB_v10007709mg [Capsella rubella]
 gb|EOA19048.1| hypothetical protein CARUB_v10007709mg [Capsella rubella]
Length=226

 Score =   105 bits (263),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L L+EGTLYVGFV SN     KN LF KTL  GDVFVFP G+IHFQ NIGKT
Sbjct  114  THPRATEILVLIEGTLYVGFVSSNQD---KNRLFAKTLHPGDVFVFPIGMIHFQVNIGKT  170

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQN GV
Sbjct  171  PAVAFAGLSSQNAGV  185



>ref|XP_007201148.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
 gb|EMJ02347.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
Length=226

 Score =   105 bits (263),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRA+E L +LEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+G  
Sbjct  113  THPRASEFLVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHV  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  170  NAVAFAGLSSQNPGV  184



>ref|XP_006442447.1| hypothetical protein CICLE_v10024005mg [Citrus clementina]
 gb|ESR55687.1| hypothetical protein CICLE_v10024005mg [Citrus clementina]
Length=220

 Score =   105 bits (263),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 58/75 (77%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN    + N L  K L  GD FVFP GLIHFQFNIGKT
Sbjct  112  THPRATEILTVLEGTLYVGFVTSN---QLNNTLIAKVLKKGDAFVFPIGLIHFQFNIGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  169  NAVAIAALSSQNPGV  183



>ref|XP_006442444.1| hypothetical protein CICLE_v10023384mg [Citrus clementina]
 gb|ESR55684.1| hypothetical protein CICLE_v10023384mg [Citrus clementina]
Length=220

 Score =   105 bits (262),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 58/75 (77%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN    + N L  K L  GD FVFP GLIHFQFNIGKT
Sbjct  112  THPRATEILTVLEGTLYVGFVTSN---QLNNTLIAKVLKKGDAFVFPIGLIHFQFNIGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  169  NAVAIAALSSQNPGV  183



>ref|XP_003618162.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES74380.1| germin family protein [Medicago truncatula]
 gb|AFK39197.1| unknown [Medicago truncatula]
Length=220

 Score =   105 bits (262),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ N+G  
Sbjct  108  THPRATEILIVLEGTLYVGFVTSNP----ENRLITKVLNKGDVFVFPIGLIHFQLNVGYG  163

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGLSSQNPGV
Sbjct  164  NAVAIAGLSSQNPGV  178



>ref|XP_006375874.1| germin-like protein 1, partial [Populus trichocarpa]
 gb|ERP53671.1| germin-like protein 1, partial [Populus trichocarpa]
Length=199

 Score =   105 bits (261),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP     N L TK L AGDVFVFP GLIHFQFN+GKT
Sbjct  87   THPRATEILTVLEGTLYVGFVTSNP----DNRLITKVLNAGDVFVFPVGLIHFQFNVGKT  142

Query  45   NAVAFAGLSSQNPGV  1
             A A   LSSQNPGV
Sbjct  143  KASAIGALSSQNPGV  157



>ref|XP_008243694.1| PREDICTED: germin-like protein 9-1 [Prunus mume]
Length=456

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+G  
Sbjct  113  THPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKELNKGDVFVFPIGLIHFQLNVGHV  169

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  170  NAVAFAGLSSQNPGV  184


 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ N+G  
Sbjct  343  THPRATEILVVLEGTLYVGFVTSN---GDGNRLFTKELNKGDVFVFPIGLIHFQLNVGHV  399

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  400  NAVAFAGLSSQNPGV  414



>emb|CAN74480.1| hypothetical protein VITISV_042844 [Vitis vinifera]
Length=192

 Score =   105 bits (261),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SN     +N L +K L  GDVFVFP GLIHFQFN+GKT
Sbjct  80   THPRATEILVVLEGTLLVGFVTSN----NENRLISKVLYKGDVFVFPIGLIHFQFNVGKT  135

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNPGV
Sbjct  136  KAVAFAGLSSQNPGV  150



>ref|XP_002284343.2| PREDICTED: uncharacterized protein LOC100256308 [Vitis vinifera]
Length=477

 Score =   108 bits (270),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFNIG T
Sbjct  113  THPRATEILTVLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPMGLIHFQFNIGHT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGLSSQNPGV
Sbjct  169  NAVAIAGLSSQNPGV  183


 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFNIGKT
Sbjct  370  THPRATEILTVLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPIGLIHFQFNIGKT  425

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  426  NAVAIAALSSQNPGV  440



>sp|Q6K5P9.1|GL22_ORYSJ RecName: Full=Putative germin-like protein 2-2; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD21899.1| putative germin-like protein [Oryza sativa Japonica Group]
 dbj|BAD22076.1| putative germin-like protein [Oryza sativa Japonica Group]
 gb|EAZ23099.1| hypothetical protein OsJ_06793 [Oryza sativa Japonica Group]
Length=223

 Score =   105 bits (262),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+  +LEG+LYVGFV+SNP    +N LFTK L  GDVFVFP+GL+HFQFN G  
Sbjct  116  THPRATEIPTVLEGSLYVGFVISNP----ENKLFTKVLNKGDVFVFPQGLVHFQFNNGTN  171

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  172  NAVALAALSSQNPGV  186



>ref|XP_004489240.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Cicer 
arietinum]
Length=220

 Score =   105 bits (262),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ N+G  
Sbjct  108  THPRATEILIVLEGTLYVGFVTSNP----QNRLITKVLNKGDVFVFPIGLIHFQLNVGYE  163

Query  45   NAVAFAGLSSQNPGV  1
            NA+A AGLSSQNPGV
Sbjct  164  NAIAVAGLSSQNPGV  178



>emb|CBI36812.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFNIGKT
Sbjct  113  THPRATEILTVLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPIGLIHFQFNIGKT  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA A LSSQNPGV
Sbjct  169  NAVAIAALSSQNPGV  183


 Score =   105 bits (262),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SN     +N   +K L  GDVFVFP GLIHFQFN+GKT
Sbjct  340  THPRATEILTVLEGTLYVGFVTSN----TENRFISKVLNKGDVFVFPIGLIHFQFNVGKT  395

Query  45   NAVAFAGLSSQNPGV  1
             AVA AGLSSQNPGV
Sbjct  396  KAVAIAGLSSQNPGV  410



>ref|XP_009414512.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=217

 Score =   105 bits (262),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 4/74 (5%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
            HPRATE+L +LEG+LYVGFV SNP     N LFTK L  GDVFVFP+GLIHFQFN G  N
Sbjct  111  HPRATEILTVLEGSLYVGFVTSNP----DNKLFTKMLTKGDVFVFPQGLIHFQFNHGTKN  166

Query  42   AVAFAGLSSQNPGV  1
            AVA A LSSQNPG+
Sbjct  167  AVALAALSSQNPGL  180



>ref|XP_003618164.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES74382.1| germin family protein [Medicago truncatula]
Length=220

 Score =   105 bits (262),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ N+G  
Sbjct  108  THPRATEILIVLEGTLYVGFVTSNP----ENRLITKVLNKGDVFVFPIGLIHFQLNVGYG  163

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGLSSQNPGV
Sbjct  164  NAVAIAGLSSQNPGV  178



>ref|XP_008381868.1| PREDICTED: germin-like protein subfamily 1 member 11 [Malus domestica]
Length=185

 Score =   104 bits (260),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 57/75 (76%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+LFL EGTLYVGFV SNP     N LFTK L  GDVFVFP GLIHFQ N+G  
Sbjct  73   THPRGTEILFLQEGTLYVGFVTSNP----DNRLFTKVLNKGDVFVFPVGLIHFQLNVGHX  128

Query  45   NAVAFAGLSSQNPGV  1
             AVA AGLSSQNPGV
Sbjct  129  XAVAIAGLSSQNPGV  143



>ref|XP_010528695.1| PREDICTED: germin-like protein subfamily 1 member 8 isoform X2 
[Tarenaya hassleriana]
Length=196

 Score =   104 bits (260),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVL + EGTLYVGFV SN      N LFTKTL  GDVFVFPEGLIHFQFN  ++
Sbjct  88   THPRATEVLVVQEGTLYVGFVSSN---ADGNRLFTKTLNTGDVFVFPEGLIHFQFNPTRS  144

Query  45   NAVAFAGLSSQNPGV  1
             AVAFA LSSQNPGV
Sbjct  145  KAVAFAALSSQNPGV  159



>emb|CAN63888.1| hypothetical protein VITISV_027217 [Vitis vinifera]
Length=143

 Score =   103 bits (257),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 57/75 (76%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTLYVGFV SNP P   +    ++   GDVF FPEGLIHFQ N+GKT
Sbjct  35   THPRATEILTVLEGTLYVGFVTSNPEPTASS---XRSFYKGDVFXFPEGLIHFQLNVGKT  91

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  92   KAVAIAALSSQNPGV  106



>ref|XP_010528696.1| PREDICTED: germin-like protein subfamily 1 member 8 [Tarenaya 
hassleriana]
Length=220

 Score =   105 bits (261),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVL + EGTLYVGFV S+ P G  N LFTKTL  GDVFVFPEGLIHFQFN   +
Sbjct  111  THPRATEVLVVQEGTLYVGFVSSSIPDG--NRLFTKTLNTGDVFVFPEGLIHFQFNPTHS  168

Query  45   NAVAFAGLSSQNPGV  1
             AVAFA LSSQNPGV
Sbjct  169  KAVAFAALSSQNPGV  183



>ref|NP_198707.1| putative germin-like protein subfamily 1 member 9 [Arabidopsis 
thaliana]
 sp|Q9FMB0.1|GL19_ARATH RecName: Full=Putative germin-like protein subfamily 1 member 
9; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB08648.1| oxalate oxidase (germin protein)-like protein [Arabidopsis thaliana]
 gb|AED94374.1| putative germin-like protein subfamily 1 member 9 [Arabidopsis 
thaliana]
Length=222

 Score =   105 bits (262),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 62/75 (83%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRA+EVL++  GTL+VGFV SNP    +N LF+KTL  GDVFVFP+GLIHFQ N+GK 
Sbjct  112  THPRASEVLYVAVGTLFVGFVTSNP----ENRLFSKTLYEGDVFVFPQGLIHFQVNVGKY  167

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQNPGV
Sbjct  168  PAVAFAGLSSQNPGV  182



>ref|XP_007030263.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10765.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=252

 Score =   105 bits (263),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 59/74 (80%), Gaps = 4/74 (5%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
            HPR TE+L +LEGTLYVGFV SNP     N L +K L  GDVFVFP GLIHFQ N+GKTN
Sbjct  141  HPRGTEILVVLEGTLYVGFVTSNP----DNRLISKVLYPGDVFVFPIGLIHFQQNVGKTN  196

Query  42   AVAFAGLSSQNPGV  1
            AVAFAGLSSQNPGV
Sbjct  197  AVAFAGLSSQNPGV  210



>gb|ABR92335.1| putative germin-like protein [Salvia miltiorrhiza]
Length=235

 Score =   105 bits (262),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            HPR +E+  +LEGTLY G + SNP  P  KNPLF K L AGD+FVFP GLIHFQ+NIGKT
Sbjct  117  HPRGSEIFLVLEGTLYAGLINSNPANPNDKNPLFAKVLNAGDIFVFPRGLIHFQYNIGKT  176

Query  45   NAVAFAGLSSQNPGV  1
             AVA A  +SQNPGV
Sbjct  177  KAVAIAAFNSQNPGV  191



>gb|KDP23764.1| hypothetical protein JCGZ_23597 [Jatropha curcas]
Length=229

 Score =   105 bits (262),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 59/75 (79%), Gaps = 5/75 (7%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EGTLYVGF  SNP     N L +K L  GDVFVFP GLIHFQ NI KT
Sbjct  120  THPRATEILVVVEGTLYVGFFTSNP-----NRLISKVLYPGDVFVFPIGLIHFQMNIAKT  174

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGLSSQNPGV
Sbjct  175  NAVAFAGLSSQNPGV  189



>ref|XP_002452099.1| hypothetical protein SORBIDRAFT_04g019670 [Sorghum bicolor]
 gb|EES05075.1| hypothetical protein SORBIDRAFT_04g019670 [Sorghum bicolor]
Length=217

 Score =   105 bits (261),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 57/75 (76%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEG+LYVGFV SNP     N LF K +  GDVFVFPEGLIHFQFN G  
Sbjct  110  THPRATEILTVLEGSLYVGFVTSNP----DNKLFAKVINKGDVFVFPEGLIHFQFNYGAN  165

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  166  CAVALAALSSQNPGV  180



>ref|XP_010549630.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X1 
[Tarenaya hassleriana]
Length=175

 Score =   103 bits (258),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 60/75 (80%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L L+EGTL VGFV SN     KN LF+K L  GDVFVFP G+IHFQ N+G+T
Sbjct  60   THPRATEILVLVEGTLLVGFVSSNQD---KNRLFSKVLYPGDVFVFPIGMIHFQVNVGRT  116

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFAGL SQNPGV
Sbjct  117  NAVAFAGLGSQNPGV  131



>ref|XP_006840206.1| hypothetical protein AMTR_s00089p00127600 [Amborella trichopoda]
 gb|ERN01881.1| hypothetical protein AMTR_s00089p00127600 [Amborella trichopoda]
Length=219

 Score =   105 bits (261),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L +LEGTLYVGFV SNP    +N L +KTL  GDVFVFPEGLIHFQ N+G  
Sbjct  107  THPRGTEILTVLEGTLYVGFVTSNP----ENRLISKTLKKGDVFVFPEGLIHFQQNVGYG  162

Query  45   NAVAFAGLSSQNPGV  1
            N VA AGLSSQNPGV
Sbjct  163  NTVAIAGLSSQNPGV  177



>emb|CAN71140.1| hypothetical protein VITISV_005471 [Vitis vinifera]
Length=220

 Score =   105 bits (261),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEGTL VGFV SNP    +N LF+K L  GDVFVFP GLIHFQFNIG  
Sbjct  113  THPRATEILTVLEGTLLVGFVTSNP----QNRLFSKVLNKGDVFVFPIGLIHFQFNIGHF  168

Query  45   NAVAFAGLSSQNPGV  1
            NAVA AGLSSQNPGV
Sbjct  169  NAVAIAGLSSQNPGV  183



>ref|XP_009357348.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=226

 Score =   105 bits (261),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEG+LYVGFV SN      N LFTK L  GDVFVFP GLIHFQ N+GKT
Sbjct  113  THPRATEILIVLEGSLYVGFVTSN---ADGNRLFTKVLYKGDVFVFPVGLIHFQLNVGKT  169

Query  45   NAVAFAGLSSQNPGV  1
            NA+A  GLSSQNPGV
Sbjct  170  NALAIGGLSSQNPGV  184



>ref|NP_568562.1| germin-like protein 6 [Arabidopsis thaliana]
 gb|AED94394.1| germin-like protein 6 [Arabidopsis thaliana]
Length=130

 Score =   102 bits (255),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 58/75 (77%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L L+EGTLYVGFV SN      N LF K L  GDVFVFP G+IHFQ NIGKT
Sbjct  20   THPRATEILVLIEGTLYVGFVSSNQD---NNRLFAKVLYPGDVFVFPIGMIHFQVNIGKT  76

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQN GV
Sbjct  77   PAVAFAGLSSQNAGV  91



>ref|XP_011034307.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=229

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EGTLYVGF+ SN   G  N L TK L  GDVFVFP GLIHFQ N+GKT
Sbjct  113  THPRATEILLVVEGTLYVGFLTSNLAKG-GNRLITKVLNPGDVFVFPVGLIHFQLNVGKT  171

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFA LSSQNPGV
Sbjct  172  NAVAFASLSSQNPGV  186



>ref|XP_006387364.1| hypothetical protein POPTR_1158s00200g [Populus trichocarpa]
 gb|ERP46278.1| hypothetical protein POPTR_1158s00200g [Populus trichocarpa]
Length=228

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EGTLYVGFV SN   G  N L TK L  GDVFVFP GLIHFQ N+G+T
Sbjct  112  THPRATEILVVVEGTLYVGFVTSNLANG-DNRLITKVLNPGDVFVFPVGLIHFQLNVGRT  170

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFA LSSQNPGV
Sbjct  171  NAVAFASLSSQNPGV  185



>ref|XP_011034445.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
 ref|XP_011038441.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 61/75 (81%), Gaps = 1/75 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE++ ++EGTLYVGFV SN   G  N L TK L  GDVFVFP GLIHFQFN+G+T
Sbjct  111  THPRATEIIVVVEGTLYVGFVTSNLANG-DNRLITKALKPGDVFVFPIGLIHFQFNMGQT  169

Query  45   NAVAFAGLSSQNPGV  1
             A+AFAGLSSQNPGV
Sbjct  170  KALAFAGLSSQNPGV  184



>ref|XP_011013026.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=228

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 60/75 (80%), Gaps = 1/75 (1%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EGTLYVGF+ SN   G  N L TK L  GDVFVFP GLIHFQ N+GKT
Sbjct  112  THPRATEILLVVEGTLYVGFLTSNLAKG-GNRLITKVLNPGDVFVFPVGLIHFQLNVGKT  170

Query  45   NAVAFAGLSSQNPGV  1
            NAVAFA LSSQNPGV
Sbjct  171  NAVAFASLSSQNPGV  185



>ref|XP_004290344.1| PREDICTED: germin-like protein subfamily 1 member 18-like [Fragaria 
vesca subsp. vesca]
Length=230

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 58/74 (78%), Gaps = 2/74 (3%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRA+E L ++EGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQFNIGK 
Sbjct  116  THPRASEFLVVMEGTLYVGFVTSNTDNG--NKLFTKVLYPGDVFVFPVGLIHFQFNIGKV  173

Query  45   NAVAFAGLSSQNPG  4
             AVA AGLSSQNPG
Sbjct  174  KAVAIAGLSSQNPG  187



>ref|XP_010528697.1| PREDICTED: germin-like protein subfamily 1 member 8 [Tarenaya 
hassleriana]
Length=219

 Score =   104 bits (260),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVL + EGTLYVGFV SN   G  N LFTKTL  GDVFVFPEGLIHFQFN   +
Sbjct  111  THPRATEVLVVQEGTLYVGFVSSN---GDGNRLFTKTLNTGDVFVFPEGLIHFQFNPTHS  167

Query  45   NAVAFAGLSSQNPGV  1
             AVAFA LSSQNPGV
Sbjct  168  KAVAFAALSSQNPGV  182



>ref|XP_008776811.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Phoenix 
dactylifera]
Length=206

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THP+ATE+L +LEGTLYVGFV SN   G  N LFTK L  GDVFVFPEGLIHFQFN G T
Sbjct  92   THPQATEILTVLEGTLYVGFVTSNTNNG--NLLFTKMLKKGDVFVFPEGLIHFQFNYGPT  149

Query  45   NAVAFAGLSSQNPGV  1
            +AVA A LSSQNPGV
Sbjct  150  HAVAVAALSSQNPGV  164



>ref|XP_010528694.1| PREDICTED: germin-like protein subfamily 1 member 8 isoform X1 
[Tarenaya hassleriana]
Length=219

 Score =   104 bits (260),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEVL + EGTLYVGFV SN      N LFTKTL  GDVFVFPEGLIHFQFN  ++
Sbjct  111  THPRATEVLVVQEGTLYVGFVSSN---ADGNRLFTKTLNTGDVFVFPEGLIHFQFNPTRS  167

Query  45   NAVAFAGLSSQNPGV  1
             AVAFA LSSQNPGV
Sbjct  168  KAVAFAALSSQNPGV  182



>ref|XP_002284320.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]
 emb|CBI36817.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   104 bits (260),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +L GTLYVGFV SNP    +N L +K L  GDVFVFP GLIHFQFN+GKT
Sbjct  113  THPRATEILTVLGGTLYVGFVTSNP----ENRLISKVLNKGDVFVFPIGLIHFQFNVGKT  168

Query  45   NAVAFAGLSSQNPGV  1
             AVA A LSSQNPGV
Sbjct  169  KAVAIAALSSQNPGV  183



>ref|XP_008776810.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Phoenix 
dactylifera]
Length=203

 Score =   104 bits (259),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 60/75 (80%), Gaps = 2/75 (3%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THP+ATE+L +LEGTLYVGFV SN   G  N LFTK L  GDVFVFPEGLIHFQFN G T
Sbjct  89   THPQATEILTVLEGTLYVGFVTSNTNNG--NLLFTKMLKKGDVFVFPEGLIHFQFNYGPT  146

Query  45   NAVAFAGLSSQNPGV  1
            +AVA A LSSQNPGV
Sbjct  147  HAVAVAALSSQNPGV  161



>gb|EAZ23098.1| hypothetical protein OsJ_06792 [Oryza sativa Japonica Group]
Length=181

 Score =   103 bits (257),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 58/74 (78%), Gaps = 4/74 (5%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
            HPRATE+L +LEG+LYVGFV SNP    +N LFTK L  GDVFVFP+GLIHFQFN G  +
Sbjct  75   HPRATEILTILEGSLYVGFVTSNP----ENKLFTKVLNKGDVFVFPQGLIHFQFNYGTKD  130

Query  42   AVAFAGLSSQNPGV  1
             +A A LSSQNPGV
Sbjct  131  VIALAALSSQNPGV  144



>ref|XP_006285306.1| hypothetical protein CARUB_v10006688mg [Capsella rubella]
 gb|EOA18204.1| hypothetical protein CARUB_v10006688mg [Capsella rubella]
Length=223

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L + EGTL VGFV SNP    +N L TKTL  GDVFVFPEGLIHFQ N+G +
Sbjct  114  THPRATEILIVAEGTLQVGFVTSNP----ENRLITKTLYVGDVFVFPEGLIHFQANVGHS  169

Query  45   NAVAFAGLSSQNPGV  1
             AVAFA LSSQNPGV
Sbjct  170  PAVAFAALSSQNPGV  184



>ref|NP_001046874.1| Os02g0491600 [Oryza sativa Japonica Group]
 sp|Q6K5Q0.1|GL21_ORYSJ RecName: Full=Putative germin-like protein 2-1; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAD21898.1| putative germin-like protein [Oryza sativa Japonica Group]
 dbj|BAD22075.1| putative germin-like protein [Oryza sativa Japonica Group]
 dbj|BAF08788.1| Os02g0491600 [Oryza sativa Japonica Group]
 gb|EAY85908.1| hypothetical protein OsI_07271 [Oryza sativa Indica Group]
Length=216

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 58/74 (78%), Gaps = 4/74 (5%)
 Frame = -3

Query  222  HPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKTN  43
            HPRATE+L +LEG+LYVGFV SNP    +N LFTK L  GDVFVFP+GLIHFQFN G  +
Sbjct  110  HPRATEILTILEGSLYVGFVTSNP----ENKLFTKVLNKGDVFVFPQGLIHFQFNYGTKD  165

Query  42   AVAFAGLSSQNPGV  1
             +A A LSSQNPGV
Sbjct  166  VIALAALSSQNPGV  179



>ref|XP_002452097.1| hypothetical protein SORBIDRAFT_04g019640 [Sorghum bicolor]
 gb|EES05073.1| hypothetical protein SORBIDRAFT_04g019640 [Sorghum bicolor]
Length=217

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 57/75 (76%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L +LEG+LYVGFV SNP     N LF K L  GDVFVFPEGLIHFQFN G  
Sbjct  110  THPRGTEILTVLEGSLYVGFVTSNP----DNKLFAKVLNKGDVFVFPEGLIHFQFNYGTK  165

Query  45   NAVAFAGLSSQNPGV  1
            +AVA A LSSQNPGV
Sbjct  166  SAVALAALSSQNPGV  180



>ref|XP_006850557.1| hypothetical protein AMTR_s00436p00008110, partial [Amborella 
trichopoda]
 gb|ERN12138.1| hypothetical protein AMTR_s00436p00008110, partial [Amborella 
trichopoda]
Length=184

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/75 (71%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L ++EGTLYVGFV SNP    +N L  KTL  GDVFVFPEGLIHFQ N+G  
Sbjct  70   THPRGTEILTVVEGTLYVGFVTSNP----ENHLICKTLKKGDVFVFPEGLIHFQQNVGYG  125

Query  45   NAVAFAGLSSQNPGV  1
            N+VA AGLSSQNPGV
Sbjct  126  NSVAIAGLSSQNPGV  140



>ref|XP_002868742.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45001.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=222

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/75 (75%), Positives = 59/75 (79%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L L+EGTLYVGFV SN      N LFTK L  GDVFVFP G+IHFQ NIGKT
Sbjct  112  THPRATEILVLVEGTLYVGFVSSNQD---NNRLFTKVLNPGDVFVFPIGMIHFQVNIGKT  168

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQN GV
Sbjct  169  PAVAFAGLSSQNAGV  183



>ref|XP_006840197.1| hypothetical protein AMTR_s00089p00120230 [Amborella trichopoda]
 gb|ERN01872.1| hypothetical protein AMTR_s00089p00120230 [Amborella trichopoda]
Length=251

 Score =   104 bits (260),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPR TE+L +LEGTLYVGFV SNP    +N L  KTL  GDVFVFPEGLIHFQ N+G  
Sbjct  107  THPRGTEILTVLEGTLYVGFVTSNP----ENHLICKTLKKGDVFVFPEGLIHFQQNVGYG  162

Query  45   NAVAFAGLSSQNPGV  1
            N+VA AGLSSQNPGV
Sbjct  163  NSVAIAGLSSQNPGV  177



>ref|XP_011034442.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEV+ +LEGTLYVGFV SNP     N L TK L  GDVFVFP GLIHFQFN+GKT
Sbjct  113  THPRATEVITVLEGTLYVGFVTSNP----DNRLITKVLKPGDVFVFPFGLIHFQFNVGKT  168

Query  45   NAVAFAGLSSQNPGV  1
             A A + LSSQNPGV
Sbjct  169  KAAAMSALSSQNPGV  183



>ref|XP_011034444.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   104 bits (259),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/75 (72%), Positives = 58/75 (77%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATEV+ +LEGTLYVGFV SNP     N L TK L  GDVFVFP GLIHFQFN+GKT
Sbjct  113  THPRATEVITVLEGTLYVGFVTSNP----DNRLITKVLKPGDVFVFPFGLIHFQFNVGKT  168

Query  45   NAVAFAGLSSQNPGV  1
             A A + LSSQNPGV
Sbjct  169  KAAAMSALSSQNPGV  183



>ref|XP_006647292.1| PREDICTED: putative germin-like protein 2-2-like [Oryza brachyantha]
Length=218

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEG+LYVGFV SNP    ++ LF K L  GDVFVFP+GLIHFQFN G +
Sbjct  111  THPRATEILTVLEGSLYVGFVTSNP----ESKLFAKVLNKGDVFVFPQGLIHFQFNHGTS  166

Query  45   NAVAFAGLSSQNPGV  1
            NAVA   LSSQNPGV
Sbjct  167  NAVALVALSSQNPGV  181



>ref|XP_008808516.1| PREDICTED: putative germin-like protein 2-1 [Phoenix dactylifera]
Length=215

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 59/75 (79%), Gaps = 5/75 (7%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L ++EG+LYVGFV SNP     N  F KTL  GDVFVFP+GLIHFQFN+G  
Sbjct  108  THPRATEILTVIEGSLYVGFVTSNP-----NKFFAKTLHKGDVFVFPQGLIHFQFNVGDI  162

Query  45   NAVAFAGLSSQNPGV  1
            NAVA +G +SQNPGV
Sbjct  163  NAVAMSGFNSQNPGV  177



>gb|EAY85909.1| hypothetical protein OsI_07272 [Oryza sativa Indica Group]
Length=223

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/75 (69%), Positives = 59/75 (79%), Gaps = 4/75 (5%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L +LEG+LYVGFV+SN     +N LFTK L  GDVFVFP+GL+HFQFN G  
Sbjct  116  THPRATEILTVLEGSLYVGFVISN----HENKLFTKVLNKGDVFVFPQGLVHFQFNNGTN  171

Query  45   NAVAFAGLSSQNPGV  1
            N VA A LSSQNPGV
Sbjct  172  NVVALAALSSQNPGV  186



>ref|XP_006285342.1| hypothetical protein CARUB_v10006732mg [Capsella rubella]
 gb|EOA18240.1| hypothetical protein CARUB_v10006732mg [Capsella rubella]
Length=170

 Score =   102 bits (255),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 58/75 (77%), Gaps = 3/75 (4%)
 Frame = -3

Query  225  THPRATEVLFLLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNIGKT  46
            THPRATE+L LLEGTLYVGFV SN      N LF K L  GDVFVFP G+IHFQ N+GKT
Sbjct  60   THPRATEILVLLEGTLYVGFVSSNQD---NNRLFAKMLYPGDVFVFPIGMIHFQVNMGKT  116

Query  45   NAVAFAGLSSQNPGV  1
             AVAFAGLSSQN GV
Sbjct  117  PAVAFAGLSSQNAGV  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 524286916336