BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16836_g2_i1 len=162 path=[140:0-161]

Length=162
                                                                      Score     E

ref|XP_010451325.1|  PREDICTED: alpha carbonic anhydrase 4-like       53.9    5e-07   
ref|XP_006292541.1|  hypothetical protein CARUB_v10018775mg           52.4    2e-06   
ref|XP_010439535.1|  PREDICTED: alpha carbonic anhydrase 4            52.0    2e-06   
ref|XP_002869914.1|  carbonic anhydrase family protein                51.6    2e-06   
gb|EYU20767.1|  hypothetical protein MIMGU_mgv1a019017mg              51.6    3e-06   
ref|NP_193832.1|  alpha carbonic anhydrase 6                          51.6    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003553396.1|  PREDICTED: bifunctional monodehydroascorbate...  51.6    3e-06   
gb|KHN14952.1|  Bifunctional monodehydroascorbate reductase and c...  51.6    4e-06   
ref|XP_007028632.1|  Carbonic anhydrase, putative                     51.6    4e-06   
ref|XP_010434249.1|  PREDICTED: alpha carbonic anhydrase 4-like       51.2    4e-06   
emb|CAB45894.1|  carbonic anhydrase-like protein                      49.3    6e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193831.1|  alpha carbonic anhydrase 4                          50.1    1e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KHN10573.1|  Bifunctional monodehydroascorbate reductase and c...  48.5    1e-05   
emb|CDY70224.1|  BnaCnng67290D                                        48.1    1e-05   
emb|CDX98682.1|  BnaA03g44670D                                        48.1    1e-05   
ref|XP_011018803.1|  PREDICTED: alpha carbonic anhydrase 7-like       49.7    1e-05   
emb|CDX76404.1|  BnaA08g09960D                                        49.7    2e-05   
ref|XP_009137160.1|  PREDICTED: alpha carbonic anhydrase 4-like       49.7    2e-05   
emb|CDX94018.1|  BnaC07g36520D                                        49.7    2e-05   
ref|XP_002869915.1|  carbonic anhydrase family protein                49.3    2e-05   
ref|XP_010530484.1|  PREDICTED: alpha carbonic anhydrase 7-like       48.1    3e-05   
emb|CDY27409.1|  BnaC03g64490D                                        48.9    3e-05   
gb|KHN10833.1|  Bifunctional monodehydroascorbate reductase and c...  48.1    4e-05   
emb|CDX76409.1|  BnaA08g09910D                                        47.4    1e-04   
emb|CDY56563.1|  BnaCnng30610D                                        47.4    1e-04   
ref|XP_006391784.1|  hypothetical protein EUTSA_v10023909mg           46.6    2e-04   
ref|XP_009134167.1|  PREDICTED: alpha carbonic anhydrase 4-like       46.2    2e-04   
emb|CDX79018.1|  BnaA01g10850D                                        46.2    2e-04   
ref|XP_006381381.1|  hypothetical protein POPTR_0006s12380g           46.2    3e-04   
ref|XP_007028635.1|  Alpha carbonic anhydrase 4, putative             46.2    3e-04   
ref|XP_008351630.1|  PREDICTED: bifunctional monodehydroascorbate...  46.2    3e-04   
gb|EYU18692.1|  hypothetical protein MIMGU_mgv1a011638mg              45.8    4e-04   
ref|XP_006413835.1|  hypothetical protein EUTSA_v10027157mg           45.8    4e-04   
ref|XP_010521744.1|  PREDICTED: alpha carbonic anhydrase 7-like       45.8    4e-04   
ref|XP_007016793.1|  Alpha carbonic anhydrase 7                       45.8    4e-04   
ref|XP_010272832.1|  PREDICTED: alpha carbonic anhydrase 7-like       45.4    5e-04   
ref|XP_002532668.1|  carbonic anhydrase, putative                     45.4    5e-04   Ricinus communis
gb|KCW47834.1|  hypothetical protein EUGRSUZ_K01571                   45.4    5e-04   
gb|KCW47832.1|  hypothetical protein EUGRSUZ_K01571                   45.4    5e-04   
gb|ACU14280.1|  unknown                                               43.9    5e-04   Glycine max [soybeans]
ref|XP_010036307.1|  PREDICTED: alpha carbonic anhydrase 4-like       45.4    6e-04   
emb|CDP14170.1|  unnamed protein product                              45.1    7e-04   
ref|XP_004493459.1|  PREDICTED: bifunctional monodehydroascorbate...  45.1    7e-04   
ref|XP_004493458.1|  PREDICTED: bifunctional monodehydroascorbate...  45.1    7e-04   
ref|XP_002519458.1|  carbonic anhydrase, putative                     45.1    8e-04   Ricinus communis
gb|KFK28694.1|  hypothetical protein AALP_AA7G034200                  45.1    8e-04   
gb|EYU18693.1|  hypothetical protein MIMGU_mgv1a011955mg              44.7    9e-04   



>ref|XP_010451325.1| PREDICTED: alpha carbonic anhydrase 4-like [Camelina sativa]
Length=267

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A + +L+K+GEP+ FL + LN  IK VG    DLGV++PR+I ++ +K+Y
Sbjct  155  AVIGVLYKLGEPNEFLTKLLNG-IKAVGNKEVDLGVIDPREIRFQTRKFY  203



>ref|XP_006292541.1| hypothetical protein CARUB_v10018775mg [Capsella rubella]
 gb|EOA25439.1| hypothetical protein CARUB_v10018775mg [Capsella rubella]
Length=268

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A + +L+K+G+P+ FL + LN  IK VG    DLGV++PR+I ++ +K+Y
Sbjct  156  AVIGVLYKLGKPNEFLAKLLNG-IKSVGTKEIDLGVIDPREIRFQTRKFY  204



>ref|XP_010439535.1| PREDICTED: alpha carbonic anhydrase 4 [Camelina sativa]
Length=267

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A + +L+K+G+P+ FL + LN  IK VG    DLGV++PR+I ++ +K+Y
Sbjct  155  AVIGVLYKLGKPNEFLTKLLNG-IKAVGNKEVDLGVIDPREIRFQTRKFY  203



>ref|XP_002869914.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46173.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=234

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A V +L+K+GEPD FL + LN  IK VG+   +LG+++PR I +E   +Y
Sbjct  156  AVVGVLYKLGEPDEFLTKLLN-GIKGVGKKEMNLGIVDPRDIRFETNNFY  204



>gb|EYU20767.1| hypothetical protein MIMGU_mgv1a019017mg, partial [Erythranthe 
guttata]
Length=240

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 32/50 (64%), Gaps = 0/50 (0%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A V +L+ +G PD+FL +FL      VG  G DLG+++PR I +  +KY+
Sbjct  125  AVVGILYTLGRPDTFLEKFLEHITSLVGEEGIDLGIVSPRDIKFGSRKYF  174



>ref|NP_193832.1| alpha carbonic anhydrase 6 [Arabidopsis thaliana]
 sp|Q9SUB4.1|ATCA6_ARATH RecName: Full=Alpha carbonic anhydrase 6; Short=AtaCA6; Short=AtalphaCA6; 
AltName: Full=Alpha carbonate dehydratase 6; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB45895.1| carbonic anhydrase-like protein [Arabidopsis thaliana]
 emb|CAB79100.1| carbonic anhydrase-like protein [Arabidopsis thaliana]
 gb|AEE84386.1| alpha carbonic anhydrase 6 [Arabidopsis thaliana]
Length=260

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +3

Query  18   VSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            V +L+K+GEPD FL + LN  IK VG+   DLG+++PR I +E   +Y
Sbjct  158  VGVLYKLGEPDEFLTKILNG-IKGVGKKEIDLGIVDPRDIRFETNNFY  204



>ref|XP_003553396.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Glycine max]
Length=275

 Score = 51.6 bits (122),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            EFA + +L+KIG PD F  + LN  IK       D+GV+NPR+I ++ + YY
Sbjct  156  EFAVIGILYKIGSPDPFFSKLLN-DIKSSVDKDIDVGVINPREIKFKSRPYY  206



>gb|KHN14952.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=275

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 33/52 (63%), Gaps = 1/52 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            EFA + +L+KIG PD F  + LN  IK       D+GV+NPR+I ++ + YY
Sbjct  156  EFAVIGILYKIGSPDPFFSKLLN-DIKSSVDKDIDVGVINPREIKFKSRPYY  206



>ref|XP_007028632.1| Carbonic anhydrase, putative [Theobroma cacao]
 gb|EOY09134.1| Carbonic anhydrase, putative [Theobroma cacao]
Length=273

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = +3

Query  3    DEFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            ++ A VS++F+ G+PD FL   L SSIK VG    +LG +NP  IG+ G++Y+
Sbjct  155  NQIAVVSMVFQFGQPDPFLSALL-SSIKTVGGGEKELGNVNPGDIGFVGRQYF  206



>ref|XP_010434249.1| PREDICTED: alpha carbonic anhydrase 4-like [Camelina sativa]
Length=267

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A + +L+K+G+P+ FL + LN  IK VG+   DLGV++PR+I ++ +K++
Sbjct  155  AVIGVLYKLGKPNEFLTKLLNG-IKAVGQKEVDLGVIDPREIRFQTRKFF  203



>emb|CAB45894.1| carbonic anhydrase-like protein [Arabidopsis thaliana]
 emb|CAB79099.1| carbonic anhydrase-like protein [Arabidopsis thaliana]
Length=150

 Score = 49.3 bits (116),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A + +L+K+GEP+ FL + LN  IK VG    +LG+++PR+I ++ +K+Y
Sbjct  44   AVIGVLYKLGEPNEFLTKLLNG-IKAVGNKEINLGMIDPREIRFQTRKFY  92



>ref|NP_193831.1| alpha carbonic anhydrase 4 [Arabidopsis thaliana]
 sp|F4JIK2.1|ATCA4_ARATH RecName: Full=Alpha carbonic anhydrase 4; Short=AtaCA4; Short=AtalphaCA4; 
AltName: Full=Alpha carbonate dehydratase 4; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE84385.1| alpha carbonic anhydrase 4 [Arabidopsis thaliana]
Length=267

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A + +L+K+GEP+ FL + LN  IK VG    +LG+++PR+I ++ +K+Y
Sbjct  155  AVIGVLYKLGEPNEFLTKLLNG-IKAVGNKEINLGMIDPREIRFQTRKFY  203



>gb|KHN10573.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3 [Glycine soja]
Length=159

 Score = 48.5 bits (114),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (62%), Gaps = 1/52 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            EFA + +L+KIG PD F  + L   IK       D+GV+NPR+I ++ + YY
Sbjct  78   EFAVIGILYKIGSPDPFFSKLL-KDIKSSVDKDIDVGVINPREIKFKSRPYY  128



>emb|CDY70224.1| BnaCnng67290D [Brassica napus]
Length=141

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
              A + +L+K+G+P+ FL + L+  +K VG+   DLG+++PR I ++ KK+Y
Sbjct  27   RIAVIGVLYKLGKPNEFLTRLLDG-LKTVGKEEKDLGIVDPRTIRFQTKKFY  77



>emb|CDX98682.1| BnaA03g44670D [Brassica napus]
Length=141

 Score = 48.1 bits (113),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 36/52 (69%), Gaps = 1/52 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
              A + +L+K+G+P+ FL + L+  +K VG+   DLG+++PR I ++ KK+Y
Sbjct  27   RIAVIGVLYKLGKPNEFLTRLLDG-LKTVGKEEKDLGIVDPRTIRFQTKKFY  77



>ref|XP_011018803.1| PREDICTED: alpha carbonic anhydrase 7-like [Populus euphratica]
Length=277

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGA-DLGVLNPRKIGYEGKKYY  161
            + A V  L+KIG+PD+FL + LN  +    +    ++G+++PR+I + GKKYY
Sbjct  156  KIAVVGYLYKIGKPDAFLSKLLNDIVSMTDQKSERNIGIVDPREIKFGGKKYY  208



>emb|CDX76404.1| BnaA08g09960D [Brassica napus]
Length=268

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A + +L+K+G+P+ FL + L+  IK VG+   DLG++ PR I ++ KK+Y
Sbjct  156  AVIGVLYKLGKPNEFLTRLLDG-IKTVGKEERDLGIVEPRTIRFQTKKFY  204



>ref|XP_009137160.1| PREDICTED: alpha carbonic anhydrase 4-like [Brassica rapa]
Length=268

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A + +L+K+G+P+ FL + L+  +K VG+   DLG+++PR I ++ KK+Y
Sbjct  156  AVIGVLYKLGKPNEFLTRLLDG-LKTVGKEEKDLGIVDPRTIRFQTKKFY  204



>emb|CDX94018.1| BnaC07g36520D [Brassica napus]
Length=268

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A + +L+K+G+P+ FL + L+  +K VG+   DLG+++PR I ++ KK+Y
Sbjct  156  AVIGVLYKLGKPNEFLTRLLDG-LKTVGKEEKDLGIVDPRTIRFQTKKFY  204



>ref|XP_002869915.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46174.1| carbonic anhydrase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=267

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 36/50 (72%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A + +L+++GEP+ FL + LN  IK VG    +LG+++PR+I ++ +K+Y
Sbjct  155  AVIGVLYRLGEPNEFLTKLLNG-IKAVGNKEINLGMIDPREIRFQTRKFY  203



>ref|XP_010530484.1| PREDICTED: alpha carbonic anhydrase 7-like [Tarenaya hassleriana]
Length=206

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 38/54 (70%), Gaps = 3/54 (6%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGAD--LGVLNPRKIGYEGKKYY  161
            + A + +L+KIG PDSFL + L  +++ VG N  +  +G+++PR+I  +GKKY+
Sbjct  92   KIAVLGILYKIGSPDSFLSK-LTKNVETVGDNKQEKKIGIMDPREIKIKGKKYF  144



>emb|CDY27409.1| BnaC03g64490D [Brassica napus]
Length=268

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/48 (42%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = +3

Query  18   VSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            + +L+K+G+P+ FL + L+  IK VG+   DLG+++PR I ++ KK+Y
Sbjct  158  IGVLYKLGKPNEFLTRLLDG-IKTVGKEERDLGIVDPRTIRFQTKKFY  204



>gb|KHN10833.1| Bifunctional monodehydroascorbate reductase and carbonic anhydrase 
nectarin-3, partial [Glycine soja]
Length=237

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 1/52 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            E A + + +KIG PD FL + LN+ IK +     DLGV+NP  I +  +KYY
Sbjct  123  ETAVIGIWYKIGSPDPFLSKLLNN-IKSIRDKDIDLGVINPGDIYFRSRKYY  173



>emb|CDX76409.1| BnaA08g09910D [Brassica napus]
Length=263

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 35/50 (70%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A + +L+K+ +P+ FL + L+  IK VG+   DLG+++PR I ++ KK+Y
Sbjct  151  AVIGVLYKLDKPNEFLTRLLDG-IKTVGKEERDLGIVDPRTIRFQTKKFY  199



>emb|CDY56563.1| BnaCnng30610D [Brassica napus]
Length=263

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A +++L+K+G P+ FL   L + IK VG+    LG+++PR IG+   K+Y
Sbjct  151  AVIAVLYKLGRPNEFLTT-LQNEIKTVGKEEKKLGIVDPRTIGFHTDKFY  199



>ref|XP_006391784.1| hypothetical protein EUTSA_v10023909mg [Eutrema salsugineum]
 gb|ESQ29070.1| hypothetical protein EUTSA_v10023909mg [Eutrema salsugineum]
Length=273

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A + +L+++GEP+ FL + LN  IK V +   +LG+++PR I  E +K+Y
Sbjct  161  AVIGVLYRLGEPNEFLTKLLNG-IKTVEKEEKNLGIVDPRTIRVENEKFY  209



>ref|XP_009134167.1| PREDICTED: alpha carbonic anhydrase 4-like [Brassica rapa]
Length=261

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A +++L+K+G P+ FL   L + IK VG+   ++G+++PR IG+   K+Y
Sbjct  149  AVIAVLYKLGRPNEFLTT-LENEIKTVGKEEKEIGIVDPRIIGFHTDKFY  197



>emb|CDX79018.1| BnaA01g10850D [Brassica napus]
Length=261

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A +++L+K+G P+ FL   L + IK VG+   ++G+++PR IG+   K+Y
Sbjct  149  AVIAVLYKLGRPNEFLTT-LENEIKTVGKEEKEIGIVDPRIIGFHTDKFY  197



>ref|XP_006381381.1| hypothetical protein POPTR_0006s12380g [Populus trichocarpa]
 gb|ERP59178.1| hypothetical protein POPTR_0006s12380g [Populus trichocarpa]
Length=277

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/56 (38%), Positives = 37/56 (66%), Gaps = 7/56 (13%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSI----KQVGRNGADLGVLNPRKIGYEGKKYY  161
            + A +  L+K G+PD+FL + LN  +    +++ RN   +G+++PR+I + GKKYY
Sbjct  156  KIAVIGYLYKTGKPDAFLSKLLNDIVSMTDQKMERN---IGIVDPREIKFGGKKYY  208



>ref|XP_007028635.1| Alpha carbonic anhydrase 4, putative [Theobroma cacao]
 gb|EOY09137.1| Alpha carbonic anhydrase 4, putative [Theobroma cacao]
Length=279

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 32/52 (62%), Gaps = 1/52 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            E A V+++FK G PD FL +  +  IK +G    +LG++NP  I +  +KYY
Sbjct  160  EIAVVAIVFKYGRPDRFLARLFHH-IKTMGNEEKNLGMVNPGDIKFGSRKYY  210



>ref|XP_008351630.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like [Malus domestica]
Length=280

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 32/52 (62%), Gaps = 1/52 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            + A + +++K G PD FL +  +  IK VG+   D+G++NP  I +  +KYY
Sbjct  161  KIAVIGIVYKYGRPDPFLSKLFHH-IKSVGKEEVDIGIINPGDIKFGSRKYY  211



>gb|EYU18692.1| hypothetical protein MIMGU_mgv1a011638mg [Erythranthe guttata]
Length=275

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/52 (35%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            + A V +L+++G PDSFL + L   ++   R G ++G+L P ++ + G++YY
Sbjct  159  DIAVVGILYELGPPDSFLARIL-PYLQAATREGTNIGILEPPEVAFGGREYY  209



>ref|XP_006413835.1| hypothetical protein EUTSA_v10027157mg [Eutrema salsugineum]
 gb|ESQ55288.1| hypothetical protein EUTSA_v10027157mg [Eutrema salsugineum]
Length=268

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A + +L+++G+P+ FL + LN  IK V +    LG+++PR I ++ KK+Y
Sbjct  155  AVIGVLYRLGKPNEFLTRLLNG-IKTVEKEEKSLGIVDPRSIRFQTKKFY  203



>ref|XP_010521744.1| PREDICTED: alpha carbonic anhydrase 7-like [Tarenaya hassleriana]
Length=274

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/54 (39%), Positives = 37/54 (69%), Gaps = 4/54 (7%)
 Frame = +3

Query  9    FAAVSLLFKIGEPDSFLGQFLNSSIKQVG---RNGADLGVLNPRKIGYEGKKYY  161
            FA V++L+KIG PD+FL Q L + +++V        ++G+++P+KI +  +KYY
Sbjct  157  FAVVTILYKIGRPDTFL-QSLENGLEEVSDKHEAEKNIGIIDPKKIKFGSRKYY  209



>ref|XP_007016793.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
 gb|EOY34412.1| Alpha carbonic anhydrase 7 [Theobroma cacao]
Length=275

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 33/55 (60%), Gaps = 2/55 (4%)
 Frame = +3

Query  3    DEFAAVSLLFKIGEPDSFLGQFLN--SSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            D+ A + +++KIG PDSFL   L+  +SI  +    +  GV++PR I    +KYY
Sbjct  153  DKVAVIGIMYKIGRPDSFLSSLLDHLASITDITEGESVAGVIDPRHIKIGSRKYY  207



>ref|XP_010272832.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
 ref|XP_010272833.1| PREDICTED: alpha carbonic anhydrase 7-like [Nelumbo nucifera]
Length=270

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 30/52 (58%), Gaps = 2/52 (4%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGA--DLGVLNPRKIGYEGKKYY  161
            A V +L+K G PD FL    N   K   + GA  +LG++NP++I   G +YY
Sbjct  154  AVVGILYKFGRPDRFLSMMENYVFKTADKEGAEEELGIVNPKRIKLGGTEYY  205



>ref|XP_002532668.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF29715.1| carbonic anhydrase, putative [Ricinus communis]
Length=228

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 19/52 (37%), Positives = 34/52 (65%), Gaps = 1/52 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            + A V+++++ G PDSFL +  +  IK VG+   ++G++NP  I +  +KYY
Sbjct  155  KIAVVAIVYEYGRPDSFLSRLFHH-IKSVGKEERNIGIINPGDIKFGSRKYY  205



>gb|KCW47834.1| hypothetical protein EUGRSUZ_K01571 [Eucalyptus grandis]
Length=278

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 31/52 (60%), Gaps = 1/52 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            E A + +++K G PD FL + L   I  VG+   DLGV+NP  I +  +KY+
Sbjct  180  EIAVIGIVYKYGRPDPFLTKLL-EHITVVGKEDTDLGVINPGIIKFGSRKYF  230



>gb|KCW47832.1| hypothetical protein EUGRSUZ_K01571 [Eucalyptus grandis]
Length=289

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 31/52 (60%), Gaps = 1/52 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            E A + +++K G PD FL + L   I  VG+   DLGV+NP  I +  +KY+
Sbjct  170  EIAVIGIVYKYGRPDPFLTKLL-EHITVVGKEDTDLGVINPGIIKFGSRKYF  220



>gb|ACU14280.1| unknown [Glycine max]
Length=151

 Score = 43.9 bits (102),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 30/52 (58%), Gaps = 1/52 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            E A + + +KIG  D  L + LN  IK +     D+GV+NP  I +E K+YY
Sbjct  81   EIAVIGIWYKIGHSDPLLSKLLND-IKSIKDKKIDVGVINPGDIMFETKEYY  131



>ref|XP_010036307.1| PREDICTED: alpha carbonic anhydrase 4-like [Eucalyptus grandis]
 gb|KCW47833.1| hypothetical protein EUGRSUZ_K01571 [Eucalyptus grandis]
Length=299

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 31/52 (60%), Gaps = 1/52 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            E A + +++K G PD FL + L   I  VG+   DLGV+NP  I +  +KY+
Sbjct  180  EIAVIGIVYKYGRPDPFLTKLL-EHITVVGKEDTDLGVINPGIIKFGSRKYF  230



>emb|CDP14170.1| unnamed protein product [Coffea canephora]
Length=273

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 31/50 (62%), Gaps = 0/50 (0%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A V +L+KIG PDSFL + L+   +    +  DLGV++P  I +  +KYY
Sbjct  160  AVVGILYKIGRPDSFLAKLLHHIKRADEGDAIDLGVVSPGDIKFGSRKYY  209



>ref|XP_004493459.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X2 [Cicer arietinum]
Length=275

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 31/52 (60%), Gaps = 1/52 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            E A + + +KIG+PD FL + L+  IK +     D+G +NP  I +  KKYY
Sbjct  156  ETAVIGVWYKIGKPDPFLSKLLDQ-IKLIDDKEIDVGTINPADIKFANKKYY  206



>ref|XP_004493458.1| PREDICTED: bifunctional monodehydroascorbate reductase and carbonic 
anhydrase nectarin-3-like isoform X1 [Cicer arietinum]
Length=276

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 31/52 (60%), Gaps = 1/52 (2%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            E A + + +KIG+PD FL + L+  IK +     D+G +NP  I +  KKYY
Sbjct  157  ETAVIGVWYKIGKPDPFLSKLLDQ-IKLIDDKEIDVGTINPADIKFANKKYY  207



>ref|XP_002519458.1| carbonic anhydrase, putative [Ricinus communis]
 gb|EEF42872.1| carbonic anhydrase, putative [Ricinus communis]
Length=274

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 34/54 (63%), Gaps = 1/54 (2%)
 Frame = +3

Query  3    DEFAAVSLLFKIGEPDSFLGQFLNSSIKQVG-RNGADLGVLNPRKIGYEGKKYY  161
            ++ A   +L+KIG+PD+FL + L + I     +   ++G++NP +I   GK+YY
Sbjct  158  NKIAVTGILYKIGQPDAFLSKLLGNVISMTDHKQDRNMGMINPNEIKMGGKRYY  211



>gb|KFK28694.1| hypothetical protein AALP_AA7G034200 [Arabis alpina]
Length=269

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/53 (36%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = +3

Query  6    EFAAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRK-IGYEGKKYY  161
            + A + +LFK+G+P+ FL + LN  IK +G+   ++G++NP   I ++ +K+Y
Sbjct  154  KLAVIGVLFKLGQPNKFLTKLLN-GIKAIGKEEINIGIVNPHDIIRFQTRKFY  205



>gb|EYU18693.1| hypothetical protein MIMGU_mgv1a011955mg [Erythranthe guttata]
Length=265

 Score = 44.7 bits (104),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 32/50 (64%), Gaps = 1/50 (2%)
 Frame = +3

Query  12   AAVSLLFKIGEPDSFLGQFLNSSIKQVGRNGADLGVLNPRKIGYEGKKYY  161
            A + +L+K+G PD F+ +F    ++     G D+G+++P+ I Y G++YY
Sbjct  158  AVIGILYKLGWPDYFIARFF-PYLRTADSEGTDVGIIDPKHIRYGGREYY  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517806786618