BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16790_g1_i3 len=314 path=[1581:0-147 648:148-313]

Length=314
                                                                      Score     E

gb|KCW52188.1|  hypothetical protein EUGRSUZ_J01617                   61.6    5e-09   
ref|XP_010034487.1|  PREDICTED: peroxidase 5-like                     61.6    5e-09   
gb|KCW52187.1|  hypothetical protein EUGRSUZ_J01616                   60.8    9e-09   
ref|XP_010032733.1|  PREDICTED: peroxidase 5-like                     60.8    1e-08   
gb|KCW52190.1|  hypothetical protein EUGRSUZ_J01619                   59.7    2e-08   
gb|KCW52189.1|  hypothetical protein EUGRSUZ_J01618                   59.7    2e-08   
ref|XP_010032732.1|  PREDICTED: peroxidase 5-like                     59.7    3e-08   
ref|XP_010032734.1|  PREDICTED: peroxidase 5-like                     59.7    3e-08   
gb|KCW52185.1|  hypothetical protein EUGRSUZ_J01614                   59.3    3e-08   
ref|XP_010041692.1|  PREDICTED: peroxidase 5-like                     59.3    3e-08   
ref|XP_010906352.1|  PREDICTED: peroxidase 5-like                     59.3    3e-08   
ref|XP_010032731.1|  PREDICTED: peroxidase 5-like                     59.3    4e-08   
gb|KCW44165.1|  hypothetical protein EUGRSUZ_L02416                   58.9    5e-08   
gb|KCW52186.1|  hypothetical protein EUGRSUZ_J01615                   58.5    6e-08   
ref|XP_009799014.1|  PREDICTED: peroxidase 5-like                     57.8    1e-07   
ref|XP_008793597.1|  PREDICTED: peroxidase 5-like                     57.8    1e-07   
ref|XP_010906360.1|  PREDICTED: peroxidase 5-like                     57.4    2e-07   
ref|XP_010674524.1|  PREDICTED: peroxidase 5-like                     57.0    2e-07   
ref|XP_009598825.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...  57.0    3e-07   
ref|XP_004231304.1|  PREDICTED: peroxidase 5-like                     56.6    4e-07   
ref|XP_011077203.1|  PREDICTED: peroxidase 5-like                     57.0    4e-07   
ref|XP_011077202.1|  PREDICTED: peroxidase 5-like                     56.6    5e-07   
ref|XP_006358573.1|  PREDICTED: peroxidase 5-like                     55.5    8e-07   
ref|XP_010659811.1|  PREDICTED: peroxidase 5-like                     53.5    4e-06   
emb|CBI39654.3|  unnamed protein product                              53.5    5e-06   
ref|XP_009768802.1|  PREDICTED: peroxidase 5-like                     52.8    7e-06   
ref|XP_009629163.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...  52.8    7e-06   
ref|XP_010674523.1|  PREDICTED: peroxidase 5-like                     52.8    8e-06   
ref|XP_007051236.1|  Class III peroxidase 70                          52.8    8e-06   
ref|XP_009382469.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...  52.4    1e-05   
ref|XP_006840292.1|  hypothetical protein AMTR_s00045p00063130        52.0    1e-05   
ref|XP_010938174.1|  PREDICTED: peroxidase 5-like                     51.6    2e-05   
ref|XP_002530462.1|  Cationic peroxidase 1 precursor, putative        51.6    2e-05   Ricinus communis
ref|XP_010553703.1|  PREDICTED: peroxidase 5-like                     51.2    3e-05   
ref|XP_010659743.1|  PREDICTED: peroxidase 5-like                     50.4    5e-05   
ref|XP_006444582.1|  hypothetical protein CICLE_v10021010mg           50.1    6e-05   
ref|XP_010921348.1|  PREDICTED: peroxidase 5-like                     50.1    6e-05   
ref|XP_009411603.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...  49.7    7e-05   
emb|CBI39655.3|  unnamed protein product                              50.4    7e-05   
gb|KDP37024.1|  hypothetical protein JCGZ_06080                       49.7    8e-05   
gb|EYU39444.1|  hypothetical protein MIMGU_mgv1a009735mg              49.7    9e-05   
ref|XP_008246297.1|  PREDICTED: peroxidase 5-like                     49.3    1e-04   
ref|XP_008781200.1|  PREDICTED: peroxidase 5-like                     49.3    1e-04   
ref|XP_004304932.1|  PREDICTED: peroxidase 5-like                     49.3    1e-04   
ref|XP_010921347.1|  PREDICTED: peroxidase 5-like                     48.9    1e-04   
ref|XP_010911662.1|  PREDICTED: peroxidase 5-like                     48.9    1e-04   
emb|CDP04200.1|  unnamed protein product                              48.9    1e-04   
ref|XP_002530464.1|  Peroxidase 3 precursor, putative                 48.9    2e-04   Ricinus communis
ref|XP_010921346.1|  PREDICTED: peroxidase 5-like                     48.5    2e-04   
ref|XP_007207711.1|  hypothetical protein PRUPE_ppa025326mg           48.5    2e-04   
ref|XP_006353128.1|  PREDICTED: peroxidase 5-like                     48.5    2e-04   
ref|XP_002530463.1|  Peroxidase 2 precursor, putative                 48.1    2e-04   Ricinus communis
ref|XP_008781197.1|  PREDICTED: peroxidase 5-like                     48.1    3e-04   
gb|KDP34818.1|  hypothetical protein JCGZ_11180                       48.1    3e-04   
ref|XP_008776272.1|  PREDICTED: peroxidase 5-like                     48.1    3e-04   
ref|XP_009781189.1|  PREDICTED: peroxidase 5-like                     48.1    3e-04   
gb|AAT94051.1|  unknown protein                                       45.8    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004251979.1|  PREDICTED: peroxidase 5-like                     47.8    4e-04   
ref|NP_001054573.1|  Os05g0135400                                     45.8    5e-04   Oryza sativa Japonica Group [Japonica rice]
gb|KDP37025.1|  hypothetical protein JCGZ_06081                       47.0    5e-04   
ref|XP_004495876.1|  PREDICTED: peroxidase 5-like                     47.4    5e-04   
ref|XP_004239722.1|  PREDICTED: peroxidase 5-like                     47.4    6e-04   
ref|XP_010682401.1|  PREDICTED: peroxidase 6-like                     47.4    6e-04   
gb|KDP37026.1|  hypothetical protein JCGZ_06082                       47.0    6e-04   
ref|XP_008793417.1|  PREDICTED: peroxidase 5-like                     46.6    8e-04   
ref|XP_004135971.1|  PREDICTED: peroxidase 5-like                     47.0    8e-04   
ref|XP_006346000.1|  PREDICTED: peroxidase 5-like                     46.6    9e-04   
ref|XP_009619824.1|  PREDICTED: peroxidase 5 {ECO:0000250|UniProt...  46.6    9e-04   
ref|XP_004167191.1|  PREDICTED: LOW QUALITY PROTEIN: peroxidase 5...  46.6    0.001   
emb|CAN68183.1|  hypothetical protein VITISV_028562                   46.6    0.001   Vitis vinifera
ref|XP_007145114.1|  hypothetical protein PHAVU_007G211100g           46.6    0.001   
ref|XP_007145112.1|  hypothetical protein PHAVU_007G210900g           46.6    0.001   



>gb|KCW52188.1| hypothetical protein EUGRSUZ_J01617, partial [Eucalyptus grandis]
Length=319

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = +3

Query  96   NGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngg  275
            NG +S P  T   + +  NRLDN+YY NL K RGVLTSDQTL +SP TA IVR NAN+GG
Sbjct  218  NGGTSDP--TVPLDFVTANRLDNKYYTNLKKHRGVLTSDQTLFNSPSTAHIVRRNANHGG  275

Query  276  gwakkfaaaMVKM  314
             WA KFAAAMVKM
Sbjct  276  AWASKFAAAMVKM  288



>ref|XP_010034487.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=327

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 54/73 (74%), Gaps = 2/73 (3%)
 Frame = +3

Query  96   NGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngg  275
            NG +S P  T   + +  NRLDN+YY NL K RGVLTSDQTL +SP TA IVR NAN+GG
Sbjct  236  NGGTSDP--TVPLDFVTANRLDNKYYTNLKKHRGVLTSDQTLFNSPSTAHIVRRNANHGG  293

Query  276  gwakkfaaaMVKM  314
             WA KFAAAMVKM
Sbjct  294  AWASKFAAAMVKM  306



>gb|KCW52187.1| hypothetical protein EUGRSUZ_J01616, partial [Eucalyptus grandis]
Length=313

 Score = 60.8 bits (146),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +3

Query  96   NGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngg  275
            NG +S P  T   +L+  NRLDN+YY NL   RG+LTSDQTL++SP TA IVR+NANNGG
Sbjct  224  NGGASDP--TVPLDLVTPNRLDNKYYTNLKNRRGLLTSDQTLSNSPSTANIVRSNANNGG  281

Query  276  gwakkfaaaMVKM  314
             WA KFAAAMVKM
Sbjct  282  AWANKFAAAMVKM  294



>ref|XP_010032733.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=326

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 56/73 (77%), Gaps = 2/73 (3%)
 Frame = +3

Query  96   NGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngg  275
            NG +S P  T   +L+  NRLDN+YY NL   RG+LTSDQTL++SP TA IVR+NANNGG
Sbjct  235  NGGASDP--TVPLDLVTPNRLDNKYYTNLKNRRGLLTSDQTLSNSPSTANIVRSNANNGG  292

Query  276  gwakkfaaaMVKM  314
             WA KFAAAMVKM
Sbjct  293  AWANKFAAAMVKM  305



>gb|KCW52190.1| hypothetical protein EUGRSUZ_J01619, partial [Eucalyptus grandis]
Length=313

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +3

Query  96   NGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngg  275
            NG +S P  T   +L+  NRLDN+YY NL   RG+LTSDQTL +SP TA IVR+NANNGG
Sbjct  224  NGGASDP--TVPLDLVTPNRLDNKYYTNLKNHRGLLTSDQTLFNSPSTANIVRSNANNGG  281

Query  276  gwakkfaaaMVKM  314
             WA KFAAAMVKM
Sbjct  282  AWANKFAAAMVKM  294



>gb|KCW52189.1| hypothetical protein EUGRSUZ_J01618, partial [Eucalyptus grandis]
Length=313

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +3

Query  96   NGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngg  275
            NG +S P  T   +L+  NRLDN+YY NL   RG+LTSDQTL +SP TA IVR+NANNGG
Sbjct  224  NGGASDP--TVPLDLVTPNRLDNKYYTNLKNHRGLLTSDQTLFNSPSTANIVRSNANNGG  281

Query  276  gwakkfaaaMVKM  314
             WA KFAAAMVKM
Sbjct  282  AWANKFAAAMVKM  294



>ref|XP_010032732.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=326

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +3

Query  96   NGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngg  275
            NG +S P  T   +L+  NRLDN+YY NL   RG+LTSDQTL +SP TA IVR+NANNGG
Sbjct  235  NGGASDP--TVPLDLVTPNRLDNKYYTNLKNHRGLLTSDQTLFNSPSTANIVRSNANNGG  292

Query  276  gwakkfaaaMVKM  314
             WA KFAAAMVKM
Sbjct  293  AWANKFAAAMVKM  305



>ref|XP_010032734.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=326

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +3

Query  96   NGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngg  275
            NG +S P  T   +L+  NRLDN+YY NL   RG+LTSDQTL +SP TA IVR+NANNGG
Sbjct  235  NGGASDP--TVPLDLVTPNRLDNKYYTNLKNHRGLLTSDQTLFNSPSTANIVRSNANNGG  292

Query  276  gwakkfaaaMVKM  314
             WA KFAAAMVKM
Sbjct  293  AWANKFAAAMVKM  305



>gb|KCW52185.1| hypothetical protein EUGRSUZ_J01614, partial [Eucalyptus grandis]
Length=307

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +3

Query  96   NGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngg  275
            NG +S P +    +    NRLDN+YY NL   RGVLTSDQTL DSP TA IVR +AN+GG
Sbjct  218  NGGASDPTVP--LDFATPNRLDNKYYTNLKDHRGVLTSDQTLFDSPSTAYIVRKHANHGG  275

Query  276  gwakkfaaaMVKM  314
             WA KFAAAMVKM
Sbjct  276  AWANKFAAAMVKM  288



>ref|XP_010041692.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=323

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 48/73 (66%), Positives = 55/73 (75%), Gaps = 2/73 (3%)
 Frame = +3

Query  96   NGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngg  275
            NG +S P  T   +L+  NRLDN+YY NL   RG+LTSDQTL +SP TA IVR+NANNGG
Sbjct  232  NGGASDP--TVPLDLVTPNRLDNKYYTNLKNRRGLLTSDQTLFNSPSTANIVRSNANNGG  289

Query  276  gwakkfaaaMVKM  314
             WA KFAAAMVKM
Sbjct  290  AWANKFAAAMVKM  302



>ref|XP_010906352.1| PREDICTED: peroxidase 5-like, partial [Elaeis guineensis]
Length=322

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  132  FNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaaMVK  311
             +++  NRLDNQYY NL KGRG+LTSDQTL  S LT+R+V  NA     WA  FAAAMVK
Sbjct  239  LDVVTPNRLDNQYYKNLQKGRGLLTSDQTLQASALTSRLVDTNAKRPQAWAANFAAAMVK  298

Query  312  M  314
            M
Sbjct  299  M  299



>ref|XP_010032731.1| PREDICTED: peroxidase 5-like [Eucalyptus grandis]
Length=327

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 52/73 (71%), Gaps = 2/73 (3%)
 Frame = +3

Query  96   NGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngg  275
            NG +S P  T   +    NRLDN+YY NL   RGVLTSDQTL DSP TA IVR +AN+GG
Sbjct  236  NGGASDP--TVPLDFATPNRLDNKYYTNLKDHRGVLTSDQTLFDSPSTAYIVRKHANHGG  293

Query  276  gwakkfaaaMVKM  314
             WA KFAAAMVKM
Sbjct  294  AWANKFAAAMVKM  306



>gb|KCW44165.1| hypothetical protein EUGRSUZ_L02416, partial [Eucalyptus grandis]
Length=302

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 58/81 (72%), Gaps = 3/81 (4%)
 Frame = +3

Query  75   QYISSWPN-GYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            Q  S  PN G +S P +    +L+  NRLDN+YY NL   RG+LTSDQTL +SP TA IV
Sbjct  203  QLKSKCPNNGGASDPTVP--LDLVTPNRLDNKYYTNLKNRRGLLTSDQTLFNSPSTANIV  260

Query  252  RnnanngggwakkfaaaMVKM  314
            R+NANNGG WA KFAAAMVKM
Sbjct  261  RSNANNGGAWANKFAAAMVKM  281



>gb|KCW52186.1| hypothetical protein EUGRSUZ_J01615 [Eucalyptus grandis]
Length=300

 Score = 58.5 bits (140),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = +3

Query  96   NGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngg  275
            NG +S P +    + +  N LDN+YY NL K RGVLTSDQTL +SP TA IVR NAN+GG
Sbjct  208  NGGTSDPTVP--LDFVTANGLDNKYYTNLKKHRGVLTSDQTLFNSPSTAHIVRRNANHGG  265

Query  276  gwakkfaaaMVKM  314
             WA KFAAAMVKM
Sbjct  266  AWANKFAAAMVKM  278



>ref|XP_009799014.1| PREDICTED: peroxidase 5-like [Nicotiana sylvestris]
Length=334

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 39/61 (64%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +3

Query  132  FNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaaMVK  311
             +++  NRLDN+YYVNL   RG+LTSDQTL +SPLTA +VR+NA +G  WA+K+AAAMVK
Sbjct  253  LDVVTPNRLDNKYYVNLKNHRGLLTSDQTLWNSPLTAGMVRSNAIHGVNWARKYAAAMVK  312

Query  312  M  314
            M
Sbjct  313  M  313



>ref|XP_008793597.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=338

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +3

Query  132  FNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaaMVK  311
             +++   RLDNQYY NL KGRG+LTSDQTL  S LTAR+V  NA     WA  FAAAMVK
Sbjct  255  LDVVTPKRLDNQYYKNLRKGRGLLTSDQTLQTSALTARLVAANAERPRAWAANFAAAMVK  314

Query  312  M  314
            M
Sbjct  315  M  315



>ref|XP_010906360.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=311

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  132  FNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaaMVK  311
             +++  NRLDNQYY NL KGRG+LTSDQTL  S LT+R+V  NA     WA  FAAAMVK
Sbjct  228  LDVVTPNRLDNQYYKNLRKGRGLLTSDQTLQTSALTSRLVDANAKRPRAWAANFAAAMVK  287

Query  312  M  314
            M
Sbjct  288  M  288



>ref|XP_010674524.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=335

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +3

Query  141  LMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVR  254
            L  +RLDN+YY NL+KGRG+L SDQ L DSPLT+++V+
Sbjct  256  LTPSRLDNKYYRNLVKGRGLLASDQALMDSPLTSKMVK  293



>ref|XP_009598825.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Nicotiana 
tomentosiformis]
Length=334

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = +3

Query  132  FNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaaMVK  311
             +++  NRLDN+YYVNL   RG+LTSDQTL  SPLTA +VR+NA +G  WA+K+AAAMVK
Sbjct  253  LDVVTPNRLDNKYYVNLKNHRGLLTSDQTLWKSPLTAGMVRSNAIHGVNWARKYAAAMVK  312

Query  312  M  314
            M
Sbjct  313  M  313



>ref|XP_004231304.1| PREDICTED: peroxidase 5-like [Solanum lycopersicum]
Length=321

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 38/55 (69%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaaMVKM  314
            NRLDN+YY+NL   RGVLTSDQTL +SP TAR+ R+NA +G  WA KFA AMVKM
Sbjct  246  NRLDNKYYLNLKNKRGVLTSDQTLWNSPSTARMARSNAIHGANWAHKFADAMVKM  300



>ref|XP_011077203.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
Length=463

 Score = 57.0 bits (136),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +3

Query  93   PNGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            P   +S P++    ++L  N+LDN+YYVNL   +G+LTSDQTL DSPLT+++V
Sbjct  371  PGSSNSDPVVNN--DVLTPNQLDNKYYVNLKNHKGLLTSDQTLFDSPLTSKLV  421



>ref|XP_011077202.1| PREDICTED: peroxidase 5-like [Sesamum indicum]
Length=429

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = +3

Query  93   PNGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            P   +S P++    ++L  N+LDN+YYVNL   +G+LTSDQTL DSPLT+++V
Sbjct  337  PGSSNSDPVVNN--DVLTPNQLDNKYYVNLKNHKGLLTSDQTLFDSPLTSKLV  387



>ref|XP_006358573.1| PREDICTED: peroxidase 5-like [Solanum tuberosum]
Length=324

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaaMVKM  314
            NRLDN+YY+NL   RG+LTSDQTL +SP TAR+ R+NA +G  WA KFA AMVKM
Sbjct  249  NRLDNKYYLNLRNNRGLLTSDQTLWNSPSTARMARSNAIHGANWAHKFADAMVKM  303



>ref|XP_010659811.1| PREDICTED: peroxidase 5-like [Vitis vinifera]
Length=322

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVR  254
            NRLDN+YY +L   RG+LTSDQTL DSP TAR+V+
Sbjct  247  NRLDNKYYKDLKNHRGLLTSDQTLFDSPSTARMVK  281



>emb|CBI39654.3| unnamed protein product [Vitis vinifera]
Length=378

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVR  254
            NRLDN+YY +L   RG+LTSDQTL DSP TAR+V+
Sbjct  242  NRLDNKYYKDLKNHRGLLTSDQTLFDSPSTARMVK  276



>ref|XP_009768802.1| PREDICTED: peroxidase 5-like [Nicotiana sylvestris]
Length=343

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            NRLDN+YY+NL   +G+LTSDQTL +SPLT+++V
Sbjct  268  NRLDNKYYLNLKNHKGLLTSDQTLFESPLTSKLV  301



>ref|XP_009629163.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Nicotiana 
tomentosiformis]
Length=346

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            NRLDN+YY+NL   +G+LTSDQTL +SPLT+++V
Sbjct  271  NRLDNKYYLNLKNHKGLLTSDQTLFESPLTSKLV  304



>ref|XP_010674523.1| PREDICTED: peroxidase 5-like [Beta vulgaris subsp. vulgaris]
Length=336

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  135  NLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVR  254
            + +  NRLDN+YY NL   RG+LTSDQTL  SP TA +VR
Sbjct  256  DFVTPNRLDNKYYQNLQNKRGLLTSDQTLVTSPETANMVR  295



>ref|XP_007051236.1| Class III peroxidase 70 [Theobroma cacao]
 gb|EOX95393.1| Class III peroxidase 70 [Theobroma cacao]
Length=338

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +3

Query  123  TKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            T   +++  NRLDN YY  L + RG+LTSDQTL DS LT+R+V
Sbjct  254  TVALDMVTPNRLDNNYYSELRRRRGLLTSDQTLMDSSLTSRMV  296



>ref|XP_009382469.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=334

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 48/70 (69%), Gaps = 5/70 (7%)
 Frame = +3

Query  105  SSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwa  284
            +++PL     + +   RLDNQYY NL K RG+L SDQTL  S LTAR+VR +A  G  WA
Sbjct  246  TTVPL-----DAVTPRRLDNQYYKNLAKRRGLLFSDQTLQASRLTARLVRLDAKLGSVWA  300

Query  285  kkfaaaMVKM  314
             KFAAAMV+M
Sbjct  301  AKFAAAMVRM  310



>ref|XP_006840292.1| hypothetical protein AMTR_s00045p00063130 [Amborella trichopoda]
 gb|ERN01967.1| hypothetical protein AMTR_s00045p00063130 [Amborella trichopoda]
Length=334

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 32/49 (65%), Gaps = 0/49 (0%)
 Frame = +3

Query  108  SIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVR  254
            + P +T   + L  N LDN+YY+NL   RG+L SDQ L  SP TAR+VR
Sbjct  243  ATPDVTVAMDPLSPNVLDNKYYINLRMNRGLLASDQALMTSPATARMVR  291



>ref|XP_010938174.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=329

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +3

Query  123  TKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaa  302
            T   + +  +RLDN YY NL+K RGVLTSDQTL +S  TA++V   A +   WA KFAAA
Sbjct  244  TVVLDAVTPDRLDNMYYWNLLKHRGVLTSDQTLEESSETAKLVWYYAEDQSTWAAKFAAA  303

Query  303  MVKM  314
            MVKM
Sbjct  304  MVKM  307



>ref|XP_002530462.1| Cationic peroxidase 1 precursor, putative [Ricinus communis]
 gb|EEF31932.1| Cationic peroxidase 1 precursor, putative [Ricinus communis]
Length=331

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 34/52 (65%), Gaps = 6/52 (12%)
 Frame = +3

Query  96   NGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            NG  ++PL          NR+DN+YY+ L + RG+LTSDQTL +SP T R+V
Sbjct  244  NGDPTVPLDPT------PNRMDNKYYIELTRNRGLLTSDQTLMNSPSTQRMV  289



>ref|XP_010553703.1| PREDICTED: peroxidase 5-like [Tarenaya hassleriana]
Length=329

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaaMVKM  314
            NRLDN+YY+NLM    VLTSDQ+L +S  TAR+VR NA NG  WA++FA AMVKM
Sbjct  251  NRLDNEYYLNLMNRNVVLTSDQSLMNSSETARMVRFNAENGRVWARRFARAMVKM  305



>ref|XP_010659743.1| PREDICTED: peroxidase 5-like [Vitis vinifera]
Length=314

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVR  254
            NRLDN+YY +L   +G+LTSDQTL DSP T R+V+
Sbjct  239  NRLDNKYYKDLKSRKGLLTSDQTLFDSPSTVRMVK  273



>ref|XP_006444582.1| hypothetical protein CICLE_v10021010mg [Citrus clementina]
 ref|XP_006492388.1| PREDICTED: peroxidase 5-like [Citrus sinensis]
 gb|ESR57822.1| hypothetical protein CICLE_v10021010mg [Citrus clementina]
 gb|KDO86854.1| hypothetical protein CISIN_1g019585mg [Citrus sinensis]
Length=338

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 2/51 (4%)
 Frame = +3

Query  99   GYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            G +  P +T+ F  +  NRLDN+YY  L   RG+LTSDQTL DS LT+++V
Sbjct  248  GCTRDPTVTQEF--VTPNRLDNKYYRELRNHRGLLTSDQTLMDSRLTSKMV  296



>ref|XP_010921348.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=321

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 42/64 (66%), Gaps = 0/64 (0%)
 Frame = +3

Query  123  TKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaa  302
            T   + +   RLDN YY NL+K RGVLTSDQTL DS  T + V  NA +   WA KFA+A
Sbjct  236  TVLLDAVTPTRLDNMYYRNLLKHRGVLTSDQTLQDSSETTKHVWYNAKHQSAWAAKFASA  295

Query  303  MVKM  314
            MVKM
Sbjct  296  MVKM  299



>ref|XP_009411603.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Musa 
acuminata subsp. malaccensis]
Length=332

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  153  RLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaaMVKM  314
            RLDNQYY NL+  RGVL SDQTL  SPLTA  V  NA NG  WA KFAAAMVKM
Sbjct  257  RLDNQYYKNLLTHRGVLFSDQTLQASPLTAGTVSCNAENGPAWAAKFAAAMVKM  310



>emb|CBI39655.3| unnamed protein product [Vitis vinifera]
Length=856

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVR  254
            NRLDN+YY +L   +G+LTSDQTL DSP T R+V+
Sbjct  485  NRLDNKYYKDLKSRKGLLTSDQTLFDSPSTVRMVK  519



>gb|KDP37024.1| hypothetical protein JCGZ_06080 [Jatropha curcas]
Length=318

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            NR+DN+YY+ L K RG+LTSDQTL +SP T ++V
Sbjct  243  NRMDNRYYMELKKNRGLLTSDQTLLNSPSTQKMV  276



>gb|EYU39444.1| hypothetical protein MIMGU_mgv1a009735mg [Erythranthe guttata]
Length=333

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +3

Query  156  LDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            LDN+YYVNL   +G+LTSDQTL DSPLT  +V
Sbjct  260  LDNKYYVNLKNHKGLLTSDQTLFDSPLTKNLV  291



>ref|XP_008246297.1| PREDICTED: peroxidase 5-like [Prunus mume]
Length=327

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 48/73 (66%), Gaps = 5/73 (7%)
 Frame = +3

Query  96   NGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngg  275
            N   ++PL     ++L  NRLDN+YY +L    G+LTSDQTL  S  TA IVRNNA  G 
Sbjct  239  NDRVTVPL-----DILTPNRLDNKYYTDLKNHHGLLTSDQTLLTSHSTAGIVRNNARFGT  293

Query  276  gwakkfaaaMVKM  314
             WA KFAAAMVKM
Sbjct  294  AWANKFAAAMVKM  306



>ref|XP_008781200.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=328

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 37/61 (61%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  132  FNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaaMVK  311
             +++  NRLDN YY NL   +G+LTSDQ+L D P T  IVRNNAN G  WA KFAAAMV+
Sbjct  247  LDIVSPNRLDNWYYKNLRSSKGLLTSDQSLMDDPSTKTIVRNNANRGAEWAAKFAAAMVR  306

Query  312  M  314
            M
Sbjct  307  M  307



>ref|XP_004304932.1| PREDICTED: peroxidase 5-like [Fragaria vesca subsp. vesca]
Length=324

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 37/55 (67%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaaMVKM  314
            NRLDN+YY NLM  RG+  SDQTL  S  TA +VRNNA  G  WAKKFA+AMVKM
Sbjct  249  NRLDNKYYTNLMNHRGLFASDQTLLSSRSTAGMVRNNARLGPAWAKKFASAMVKM  303



>ref|XP_010921347.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=321

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  123  TKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaa  302
            T   + +   RLDN YY NL+K RGVLTSDQTL +S  TA+ V  NA +   WA KFA+A
Sbjct  236  TVLLDAVTPTRLDNIYYRNLLKHRGVLTSDQTLQESSETAKHVWYNAKHQSAWAAKFASA  295

Query  303  MVKM  314
            MVKM
Sbjct  296  MVKM  299



>ref|XP_010911662.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=321

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +3

Query  93   PNGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanng  272
            P+  S     T   + +   RLDN YY NL+K RGVLTSDQTL +S  T + V  NA + 
Sbjct  226  PSTASPTDPTTVLLDAVTPTRLDNMYYRNLLKHRGVLTSDQTLQESSETTKHVWYNAKHQ  285

Query  273  ggwakkfaaaMVKM  314
              WA KFA+AMVKM
Sbjct  286  SAWAAKFASAMVKM  299



>emb|CDP04200.1| unnamed protein product [Coffea canephora]
Length=334

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  153  RLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            RLDN+YYVNL   RG+LTSDQTL  SP TA+ V
Sbjct  260  RLDNKYYVNLKYHRGLLTSDQTLLSSPSTAKQV  292



>ref|XP_002530464.1| Peroxidase 3 precursor, putative [Ricinus communis]
 gb|EEF31934.1| Peroxidase 3 precursor, putative [Ricinus communis]
Length=329

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            NRLDN+YYV L   RG+L SDQTL  SP T ++V
Sbjct  254  NRLDNKYYVQLSNDRGLLNSDQTLMKSPFTQKMV  287



>ref|XP_010921346.1| PREDICTED: peroxidase 5-like [Elaeis guineensis]
Length=328

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%), Gaps = 5/50 (10%)
 Frame = +3

Query  105  SSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVR  254
            +++PL     +++  NRLDN+YY NL   +G+LTSDQ+L   P T  IVR
Sbjct  243  ATVPL-----DIVTPNRLDNRYYKNLRNNKGLLTSDQSLMSDPSTKTIVR  287



>ref|XP_007207711.1| hypothetical protein PRUPE_ppa025326mg [Prunus persica]
 gb|EMJ08910.1| hypothetical protein PRUPE_ppa025326mg [Prunus persica]
Length=320

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 41/73 (56%), Positives = 48/73 (66%), Gaps = 5/73 (7%)
 Frame = +3

Query  96   NGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngg  275
            N   ++PL     ++L  NRLDN+YY +L    G+LTSDQTL  S  TA IVRNNA  G 
Sbjct  232  NDRVTVPL-----DVLTPNRLDNKYYTDLKNHHGLLTSDQTLLTSRSTAGIVRNNARFGA  286

Query  276  gwakkfaaaMVKM  314
             WA KFAAAMVKM
Sbjct  287  AWANKFAAAMVKM  299



>ref|XP_006353128.1| PREDICTED: peroxidase 5-like [Solanum tuberosum]
Length=353

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  156  LDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            LDN+YY+NL   +G+LTSDQTL +SPLT+++V
Sbjct  280  LDNKYYLNLRNHKGLLTSDQTLYESPLTSKLV  311



>ref|XP_002530463.1| Peroxidase 2 precursor, putative [Ricinus communis]
 gb|EEF31933.1| Peroxidase 2 precursor, putative [Ricinus communis]
Length=258

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 6/52 (12%)
 Frame = +3

Query  96   NGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            NG  ++PL          NR+DN+YYV L + RG+L SDQTL +SP T R+V
Sbjct  171  NGDPTVPLDPT------PNRMDNKYYVELTRNRGLLISDQTLMNSPSTQRMV  216



>ref|XP_008781197.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=334

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  156  LDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaaMVKM  314
            LDN YY NL+K RGVLTSDQTL DS  T ++V  NA +   WA KFA+AMVKM
Sbjct  260  LDNLYYRNLLKHRGVLTSDQTLQDSSETTKLVWYNAKHQSAWAAKFASAMVKM  312



>gb|KDP34818.1| hypothetical protein JCGZ_11180 [Jatropha curcas]
Length=322

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            N++DN+YY+ L K RG+LTSDQTL +SP T  IV
Sbjct  247  NQMDNRYYMELKKNRGLLTSDQTLMNSPSTQNIV  280



>ref|XP_008776272.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=339

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +3

Query  114  PLLTKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            P  T   ++   N LD +YY NL+KG+G+LTSDQTLA S  T R+V
Sbjct  251  PAPTVPLDIKAPNHLDVKYYKNLLKGKGLLTSDQTLASSRSTLRLV  296



>ref|XP_009781189.1| PREDICTED: peroxidase 5-like [Nicotiana sylvestris]
 ref|XP_009781190.1| PREDICTED: peroxidase 5-like [Nicotiana sylvestris]
 ref|XP_009794831.1| PREDICTED: peroxidase 5-like [Nicotiana sylvestris]
Length=334

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  132  FNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
             ++L  NRLDN+YY++L   +G+L SDQTL  +P TA++V
Sbjct  253  LDVLTPNRLDNRYYMDLKSKKGLLVSDQTLMSNPKTAKMV  292



>gb|AAT94051.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEC78473.1| hypothetical protein OsI_18358 [Oryza sativa Indica Group]
 gb|EEE62239.1| hypothetical protein OsJ_17026 [Oryza sativa Japonica Group]
Length=150

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  156  LDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaaMVKM  314
             DNQYY N++K R VL SDQ L DSP TA +V+ ++     +  KFAAAMVKM
Sbjct  74   FDNQYYKNVLKHRVVLNSDQALLDSPWTAGVVKLHSAVEKVFQVKFAAAMVKM  126



>ref|XP_004251979.1| PREDICTED: peroxidase 5-like [Solanum lycopersicum]
Length=354

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/32 (63%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  156  LDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            LDN+YY+NL   +G+LTSDQTL  SPLT+++V
Sbjct  281  LDNKYYLNLRNHKGLLTSDQTLYQSPLTSKLV  312



>ref|NP_001054573.1| Os05g0135400 [Oryza sativa Japonica Group]
 dbj|BAF16487.1| Os05g0135400 [Oryza sativa Japonica Group]
Length=164

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +3

Query  156  LDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaaMVKM  314
             DNQYY N++K R VL SDQ L DSP TA +V+ ++     +  KFAAAMVKM
Sbjct  88   FDNQYYKNVLKHRVVLNSDQALLDSPWTAGVVKLHSAVEKVFQVKFAAAMVKM  140



>gb|KDP37025.1| hypothetical protein JCGZ_06081 [Jatropha curcas]
Length=268

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            NR+DN+YY+ L K RG+LTSDQTL +SP T  +V
Sbjct  192  NRMDNRYYMELKKNRGLLTSDQTLMNSPSTQNMV  225



>ref|XP_004495876.1| PREDICTED: peroxidase 5-like [Cicer arietinum]
Length=334

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +3

Query  123  TKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLT  239
            T  F+    NRLDN YY+ L K RG+LTSDQTL  S LT
Sbjct  248  TVVFDASTPNRLDNNYYLRLQKHRGLLTSDQTLVSSGLT  286



>ref|XP_004239722.1| PREDICTED: peroxidase 5-like [Solanum lycopersicum]
Length=334

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  132  FNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            F+++  N+LDN+YY++L   +G+L +DQTL   P TA++V
Sbjct  253  FDVITPNKLDNKYYMDLKSNKGLLVTDQTLMSDPKTAKMV  292



>ref|XP_010682401.1| PREDICTED: peroxidase 6-like [Beta vulgaris subsp. vulgaris]
Length=356

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 25/79 (32%), Positives = 42/79 (53%), Gaps = 4/79 (5%)
 Frame = +3

Query  15   WSKGQDIFSILQRQFREPVGQYISSWPNGYSSIPLLTKFFNLLMKNRLDNQYYVNLMKGR  194
            +SK Q +   L  ++ E + +  ++    Y+  P +  F +++   + DN YY NL +G 
Sbjct  235  YSKTQPVDPRLNPKYAEGLKKLCAN----YTKDPTMAAFNDVMTPGKFDNMYYKNLQRGL  290

Query  195  GVLTSDQTLADSPLTARIV  251
            G+L +DQ L D P T  IV
Sbjct  291  GLLATDQGLIDDPRTKPIV  309



>gb|KDP37026.1| hypothetical protein JCGZ_06082 [Jatropha curcas]
Length=325

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            N++DN+YY+ L K RG+LTSDQTL +SP T  +V
Sbjct  250  NQMDNRYYMELKKNRGLLTSDQTLMNSPSTQNMV  283



>ref|XP_008793417.1| PREDICTED: peroxidase 5-like [Phoenix dactylifera]
Length=267

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = +3

Query  123  TKFFNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            T   + +   RLDN YY NL+K RGVLTSDQTL  S  TA++V
Sbjct  182  TVVLDAVTPARLDNLYYWNLLKHRGVLTSDQTLQASSETAKLV  224



>ref|XP_004135971.1| PREDICTED: peroxidase 5-like [Cucumis sativus]
Length=338

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaaMVKM  314
            NRLDNQYY+ L K +G+L+SDQ L  SP T+++    A  G  WA  F  +MVKM
Sbjct  263  NRLDNQYYIGLTKHQGLLSSDQILLSSPSTSKLALVYAKYGSIWASNFKKSMVKM  317



>ref|XP_006346000.1| PREDICTED: peroxidase 5-like [Solanum tuberosum]
Length=360

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  132  FNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
            F+++  N+LDN+YY++L   +G+L +DQTL   P TA++V
Sbjct  279  FDVITPNKLDNKYYMDLKSKKGLLVTDQTLMSDPKTAKMV  318



>ref|XP_009619824.1| PREDICTED: peroxidase 5 {ECO:0000250|UniProtKB:P22195}-like [Nicotiana 
tomentosiformis]
Length=334

 Score = 46.6 bits (109),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 19/40 (48%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  132  FNLLMKNRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIV  251
             ++L  N+LDN+YY++L   +G+L SDQTL  +P TA++V
Sbjct  253  LDVLTPNKLDNRYYMDLKSKKGLLVSDQTLMSNPKTAKMV  292



>ref|XP_004167191.1| PREDICTED: LOW QUALITY PROTEIN: peroxidase 5-like [Cucumis sativus]
Length=338

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVRnnanngggwakkfaaaMVKM  314
            NRLDNQYY+ L K +G+L+SDQ L  SP T+++    A  G  WA  F  +MVKM
Sbjct  263  NRLDNQYYIGLTKHQGLLSSDQILLSSPSTSKLALVYAKYGSIWASNFKKSMVKM  317



>emb|CAN68183.1| hypothetical protein VITISV_028562 [Vitis vinifera]
Length=322

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLTARIVR  254
            N+LDN+YY +L   RG+L SDQTL  SP TAR+V+
Sbjct  247  NKLDNKYYKDLKNHRGLLASDQTLFYSPSTARMVK  281



>ref|XP_007145114.1| hypothetical protein PHAVU_007G211100g [Phaseolus vulgaris]
 gb|ESW17108.1| hypothetical protein PHAVU_007G211100g [Phaseolus vulgaris]
Length=324

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLT  239
            NRLDN+YY  L K RG+LTSDQTL  SP T
Sbjct  249  NRLDNKYYTELKKHRGLLTSDQTLLGSPST  278



>ref|XP_007145112.1| hypothetical protein PHAVU_007G210900g [Phaseolus vulgaris]
 gb|ESW17106.1| hypothetical protein PHAVU_007G210900g [Phaseolus vulgaris]
Length=325

 Score = 46.6 bits (109),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = +3

Query  150  NRLDNQYYVNLMKGRGVLTSDQTLADSPLT  239
            NRLDN+YY  L K RG+LTSDQTL  SP T
Sbjct  249  NRLDNKYYTELKKHRGLLTSDQTLLGSPST  278



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512023305854