BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16769_g1_i1 len=1162 path=[1:0-1161]

Length=1162
                                                                      Score     E

ref|XP_011074972.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     435   2e-147   
ref|XP_011095918.1|  PREDICTED: GDSL esterase/lipase At1g71691          433   1e-146   
ref|XP_009597060.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     427   8e-145   
ref|XP_009605870.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     427   1e-144   
ref|XP_009793810.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     427   2e-144   
ref|XP_009357251.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     425   3e-143   
ref|XP_008361601.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    424   4e-143   
ref|XP_004301466.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     422   5e-143   
ref|XP_009773145.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     424   6e-143   
ref|XP_004250678.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     423   6e-143   
ref|XP_007019795.1|  Zinc finger protein, putative isoform 1            423   9e-143   
ref|XP_010683198.1|  PREDICTED: GDSL esterase/lipase At1g71691          422   3e-142   
emb|CBI39225.3|  unnamed protein product                                419   7e-142   
ref|XP_004499570.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     420   9e-142   
ref|XP_010064853.1|  PREDICTED: GDSL esterase/lipase At1g71691          425   1e-141   
gb|KHN20549.1|  GDSL esterase/lipase                                    419   1e-141   
ref|XP_008339092.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    418   2e-141   
ref|XP_006582440.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     419   2e-141   
ref|XP_002278219.2|  PREDICTED: GDSL esterase/lipase At1g71691          418   8e-141   Vitis vinifera
gb|KHG24758.1|  hypothetical protein F383_07589                         417   9e-141   
gb|EYU28214.1|  hypothetical protein MIMGU_mgv1a008192mg                417   1e-140   
gb|KHN47078.1|  GDSL esterase/lipase                                    416   2e-140   
ref|NP_001242345.1|  uncharacterized protein LOC100779380 precursor     414   1e-139   
ref|XP_007148613.1|  hypothetical protein PHAVU_005G001100g             414   1e-139   
ref|XP_006339389.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     414   2e-139   
ref|XP_004241911.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     414   3e-139   
ref|XP_011031552.1|  PREDICTED: GDSL esterase/lipase At1g71691-li...    413   4e-139   
ref|XP_011031551.1|  PREDICTED: GDSL esterase/lipase At1g71691-li...    413   6e-139   
ref|XP_010265554.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     413   8e-139   
ref|XP_006356515.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     412   1e-138   
emb|CDP18864.1|  unnamed protein product                                409   3e-138   
ref|XP_003598045.1|  GDSL esterase/lipase                               410   3e-138   
ref|XP_006441600.1|  hypothetical protein CICLE_v10024521mg             408   1e-137   
ref|XP_010100104.1|  GDSL esterase/lipase                               412   1e-137   
ref|XP_002325955.1|  GDSL-motif lipase/hydrolase family protein         410   1e-137   Populus trichocarpa [western balsam poplar]
ref|XP_006376145.1|  GDSL-motif lipase/hydrolase family protein         409   3e-137   
ref|XP_009631479.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     409   5e-137   
gb|EPS67957.1|  hypothetical protein M569_06816                         407   1e-136   
ref|XP_009802347.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     409   1e-136   
ref|XP_009761478.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     408   1e-136   
ref|XP_006478220.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     407   2e-136   
ref|XP_008219080.1|  PREDICTED: GDSL esterase/lipase At1g71691          407   2e-136   
ref|XP_009333996.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     406   6e-136   
ref|XP_007223318.1|  hypothetical protein PRUPE_ppa007324mg             405   8e-136   
ref|XP_011005437.1|  PREDICTED: GDSL esterase/lipase At1g71691-li...    403   3e-135   
ref|XP_011005436.1|  PREDICTED: GDSL esterase/lipase At1g71691-li...    403   5e-135   
ref|XP_004158530.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     400   2e-134   
ref|XP_004138671.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     400   2e-134   
ref|XP_008441153.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     401   3e-134   
gb|KGN63057.1|  hypothetical protein Csa_2G396190                       400   7e-134   
ref|XP_004141644.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     395   7e-132   
ref|XP_008788334.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     395   8e-132   
ref|XP_008459639.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     394   2e-131   
ref|XP_009399303.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     395   3e-131   
ref|XP_010908040.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     392   2e-130   
ref|NP_974125.1|  GDSL esterase/lipase                                  390   5e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002526412.1|  zinc finger protein, putative                      392   5e-130   Ricinus communis
emb|CDX68306.1|  BnaA07g23460D                                          389   2e-129   
ref|XP_010312984.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     389   3e-129   
ref|XP_006390758.1|  hypothetical protein EUTSA_v10019478mg             389   3e-129   
ref|XP_009104909.1|  PREDICTED: GDSL esterase/lipase At1g71691          389   3e-129   
ref|XP_010427992.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     388   7e-129   
ref|XP_010471167.1|  PREDICTED: GDSL esterase/lipase At1g71691          388   7e-129   
ref|XP_006339345.1|  PREDICTED: formin-2-like                           397   1e-128   
emb|CDY36687.1|  BnaCnng07890D                                          387   1e-128   
ref|XP_002888840.1|  GDSL-motif lipase/hydrolase family protein         387   2e-128   
ref|XP_010415867.1|  PREDICTED: GDSL esterase/lipase At1g71691          386   3e-128   
ref|XP_006301319.1|  hypothetical protein CARUB_v10021728mg             386   4e-128   
ref|XP_010521103.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    380   1e-125   
gb|KCW69515.1|  hypothetical protein EUGRSUZ_F02957                     378   2e-125   
emb|CDX96333.1|  BnaA07g29440D                                          379   2e-125   
ref|XP_009105822.1|  PREDICTED: GDSL esterase/lipase At1g71691          379   3e-124   
ref|XP_004962048.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     373   3e-123   
ref|XP_002439816.1|  hypothetical protein SORBIDRAFT_09g020670          373   6e-123   Sorghum bicolor [broomcorn]
ref|XP_003568429.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     371   2e-122   
gb|KFK41586.1|  hypothetical protein AALP_AA2G148200                    370   9e-122   
ref|NP_001150393.1|  anther-specific proline-rich protein APG pre...    369   3e-121   Zea mays [maize]
ref|NP_001055574.1|  Os05g0419800                                       369   3e-121   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001147753.1|  anther-specific proline-rich protein APG pre...    369   3e-121   Zea mays [maize]
dbj|BAJ92238.1|  predicted protein                                      365   6e-120   
ref|XP_004973035.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     362   4e-119   
ref|XP_009804132.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     358   2e-117   
ref|XP_006441602.1|  hypothetical protein CICLE_v10023728mg             353   1e-116   
gb|EEC82803.1|  hypothetical protein OsI_27577                          356   2e-116   Oryza sativa Indica Group [Indian rice]
ref|NP_001060835.1|  Os08g0112900                                       356   2e-116   Oryza sativa Japonica Group [Japonica rice]
gb|EAY98084.1|  hypothetical protein OsI_20002                          352   2e-114   Oryza sativa Indica Group [Indian rice]
gb|KDP45642.1|  hypothetical protein JCGZ_17249                         346   5e-114   
gb|AFW74302.1|  hypothetical protein ZEAMMB73_454294                    349   6e-114   
ref|XP_008648378.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    347   2e-113   
ref|XP_002443746.1|  hypothetical protein SORBIDRAFT_07g001270          348   3e-113   Sorghum bicolor [broomcorn]
ref|NP_565021.2|  GDSL esterase/lipase                                  334   3e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003571310.2|  PREDICTED: GDSL esterase/lipase At1g71691-like     329   2e-106   
ref|XP_006659756.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     328   1e-105   
ref|XP_007200393.1|  hypothetical protein PRUPE_ppa008473mg             325   3e-105   
ref|XP_008237811.1|  PREDICTED: GDSL esterase/lipase At1g71250          327   5e-105   
ref|XP_004154173.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     322   1e-103   
ref|XP_004145208.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     322   2e-103   
ref|XP_008381690.1|  PREDICTED: GDSL esterase/lipase At1g71250          322   3e-103   
ref|XP_010930550.1|  PREDICTED: GDSL esterase/lipase At1g71250          319   3e-102   
ref|XP_010252444.1|  PREDICTED: GDSL esterase/lipase At1g71250          318   6e-102   
ref|XP_008786569.1|  PREDICTED: GDSL esterase/lipase At1g71250          318   1e-101   
ref|XP_008440329.1|  PREDICTED: GDSL esterase/lipase At1g71250          317   3e-101   
ref|XP_004290271.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     315   2e-100   
ref|XP_006836894.1|  hypothetical protein AMTR_s00099p00119900          313   4e-100   
ref|XP_009787100.1|  PREDICTED: GDSL esterase/lipase At1g71250          312   2e-99    
ref|XP_006441595.1|  hypothetical protein CICLE_v100203321mg            306   6e-99    
ref|XP_009599586.1|  PREDICTED: GDSL esterase/lipase At1g71250          310   1e-98    
ref|XP_011083216.1|  PREDICTED: GDSL esterase/lipase At5g08460-like     309   2e-98    
gb|KCW70983.1|  hypothetical protein EUGRSUZ_F04092                     308   3e-98    
ref|XP_009596154.1|  PREDICTED: GDSL esterase/lipase At1g33811 is...    308   3e-98    
ref|XP_010065073.1|  PREDICTED: GDSL esterase/lipase At1g71250          308   5e-98    
gb|AAZ23955.1|  GDSL-lipase 1                                           308   6e-98    Capsicum annuum
ref|XP_009770266.1|  PREDICTED: GDSL esterase/lipase At1g33811 is...    307   1e-97    
ref|XP_010687162.1|  PREDICTED: GDSL esterase/lipase At5g45670          307   1e-97    
ref|NP_001149080.1|  anther-specific proline-rich protein APG pre...    307   1e-97    Zea mays [maize]
gb|KDP21169.1|  hypothetical protein JCGZ_21640                         307   2e-97    
emb|CBI16986.3|  unnamed protein product                                306   2e-97    
ref|XP_002266194.2|  PREDICTED: GDSL esterase/lipase At1g71250          306   2e-97    Vitis vinifera
ref|XP_006858605.1|  hypothetical protein AMTR_s00071p00200630          306   4e-97    
ref|XP_004250819.1|  PREDICTED: GDSL esterase/lipase At1g71250          305   5e-97    
ref|XP_006441809.1|  hypothetical protein CICLE_v10023910mg             305   6e-97    
ref|XP_007025248.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    305   7e-97    
gb|KDO51376.1|  hypothetical protein CISIN_1g036887mg                   305   1e-96    
ref|XP_010025680.1|  PREDICTED: GDSL esterase/lipase At5g08460-like     305   1e-96    
ref|XP_006478360.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     305   2e-96    
ref|XP_006339350.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     303   3e-96    
ref|XP_004969944.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     303   3e-96    
ref|XP_002456353.1|  hypothetical protein SORBIDRAFT_03g034560          304   3e-96    Sorghum bicolor [broomcorn]
ref|XP_006852691.1|  hypothetical protein AMTR_s00021p00254410          305   4e-96    
gb|KHG24391.1|  hypothetical protein F383_02353                         302   6e-96    
ref|XP_006362723.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     302   1e-95    
ref|XP_011095134.1|  PREDICTED: GDSL esterase/lipase At1g71250          303   1e-95    
ref|XP_011004908.1|  PREDICTED: GDSL esterase/lipase At1g71250          302   1e-95    
ref|XP_007019796.1|  Zinc finger protein, putative isoform 2            297   2e-95    
gb|KHN20550.1|  GDSL esterase/lipase                                    302   2e-95    
emb|CDM83980.1|  unnamed protein product                                301   2e-95    
ref|XP_004166340.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     297   2e-95    
ref|XP_002522292.1|  zinc finger protein, putative                      301   3e-95    Ricinus communis
ref|XP_003526398.2|  PREDICTED: GDSL esterase/lipase At1g33811-like     301   4e-95    
ref|XP_002266118.1|  PREDICTED: GDSL esterase/lipase At5g45670          300   9e-95    Vitis vinifera
ref|XP_006371372.1|  GDSL-motif lipase/hydrolase family protein         300   1e-94    
ref|XP_004250650.1|  PREDICTED: GDSL esterase/lipase At1g33811          299   1e-94    
gb|EYU28141.1|  hypothetical protein MIMGU_mgv1a008629mg                299   2e-94    
gb|KHN09688.1|  GDSL esterase/lipase                                    298   2e-94    
gb|KEH33152.1|  GDSL-like lipase/acylhydrolase                          299   2e-94    
gb|ACJ85846.1|  unknown                                                 298   3e-94    Medicago truncatula
gb|KHN48037.1|  GDSL esterase/lipase                                    298   3e-94    
gb|AAX20033.1|  GDSL-lipase protein                                     298   4e-94    Capsicum annuum
gb|EYU43295.1|  hypothetical protein MIMGU_mgv1a008614mg                298   4e-94    
gb|ABF72016.1|  GDSL-motif lipase/hydrolase family protein              298   4e-94    Musa acuminata [banana]
ref|XP_009406156.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     298   4e-94    
ref|XP_006467574.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     298   5e-94    
ref|XP_003526907.1|  PREDICTED: GDSL esterase/lipase At5g08460          298   5e-94    
gb|KHN06446.1|  GDSL esterase/lipase                                    297   8e-94    
ref|XP_003569805.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     297   9e-94    
gb|KHG06516.1|  hypothetical protein F383_33590                         297   1e-93    
ref|XP_010057187.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     297   1e-93    
ref|XP_003522601.2|  PREDICTED: GDSL esterase/lipase At1g33811-like     297   1e-93    
gb|EYU31208.1|  hypothetical protein MIMGU_mgv1a026796mg                296   1e-93    
ref|XP_010683187.1|  PREDICTED: GDSL esterase/lipase At1g33811          297   1e-93    
ref|NP_001242353.1|  uncharacterized protein LOC100777335 precursor     297   1e-93    
ref|XP_010273431.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     297   1e-93    
ref|XP_006449582.1|  hypothetical protein CICLE_v10015686mg             296   2e-93    
gb|KHN47079.1|  GDSL esterase/lipase                                    296   2e-93    
emb|CDY62118.1|  BnaCnng39210D                                          297   2e-93    
ref|XP_010924691.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     296   2e-93    
ref|XP_007019704.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    296   2e-93    
ref|XP_011085304.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     296   2e-93    
ref|XP_006399344.1|  hypothetical protein EUTSA_v10016068mg             296   2e-93    
ref|XP_011095907.1|  PREDICTED: GDSL esterase/lipase At1g33811          296   2e-93    
ref|XP_008443704.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     296   3e-93    
gb|AFK40262.1|  unknown                                                 295   3e-93    
emb|CAN77693.1|  hypothetical protein VITISV_030206                     296   3e-93    Vitis vinifera
ref|XP_004504253.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     295   4e-93    
ref|XP_006471326.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     295   4e-93    
ref|NP_001242366.1|  uncharacterized protein LOC100800635 precursor     295   5e-93    
ref|XP_010471141.1|  PREDICTED: GDSL esterase/lipase At1g71250          295   6e-93    
ref|XP_003629880.1|  GDSL esterase/lipase                               295   6e-93    
ref|XP_007148614.1|  hypothetical protein PHAVU_005G001200g             295   8e-93    
gb|KHN11641.1|  GDSL esterase/lipase                                    295   9e-93    
ref|XP_004147394.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     295   9e-93    
ref|XP_009596155.1|  PREDICTED: GDSL esterase/lipase At1g33811 is...    294   1e-92    
ref|XP_004233002.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     294   1e-92    
gb|KDP24218.1|  hypothetical protein JCGZ_25875                         294   1e-92    
gb|ABY59947.1|  nectar protein 1                                        293   1e-92    Jacaranda mimosifolia
ref|XP_006422361.1|  hypothetical protein CICLE_v10018420mg             291   1e-92    
ref|XP_007159508.1|  hypothetical protein PHAVU_002G243500g             294   1e-92    
ref|XP_010273430.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     294   1e-92    
gb|KHG17696.1|  hypothetical protein F383_20601                         294   1e-92    
ref|XP_010415834.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     294   1e-92    
emb|CBI16914.3|  unnamed protein product                                293   1e-92    
ref|XP_002278194.1|  PREDICTED: GDSL esterase/lipase At1g33811          294   1e-92    Vitis vinifera
dbj|BAJ85694.1|  predicted protein                                      294   2e-92    
ref|XP_009122453.1|  PREDICTED: GDSL esterase/lipase At5g08460          294   2e-92    
emb|CDY35297.1|  BnaC03g59260D                                          294   2e-92    
emb|CDP15726.1|  unnamed protein product                                294   2e-92    
ref|XP_009612511.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     294   2e-92    
ref|XP_009105797.1|  PREDICTED: GDSL esterase/lipase At1g71250          293   2e-92    
ref|XP_010427953.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     293   3e-92    
ref|XP_011102152.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     293   3e-92    
ref|XP_002278481.1|  PREDICTED: GDSL esterase/lipase 7-like             293   3e-92    Vitis vinifera
ref|XP_011010176.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     293   4e-92    
ref|XP_009770267.1|  PREDICTED: GDSL esterase/lipase At1g33811 is...    293   4e-92    
ref|XP_003534425.2|  PREDICTED: GDSL esterase/lipase At1g71250          296   5e-92    
gb|ACN29259.1|  unknown                                                 293   5e-92    Zea mays [maize]
gb|KHG10246.1|  hypothetical protein F383_10927                         293   5e-92    
ref|NP_001149980.1|  anther-specific proline-rich protein APG pre...    293   5e-92    Zea mays [maize]
ref|XP_009769556.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     293   5e-92    
gb|KGN65589.1|  hypothetical protein Csa_1G467090                       294   7e-92    
ref|XP_006355559.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     292   7e-92    
ref|XP_002456282.1|  hypothetical protein SORBIDRAFT_03g033460          292   8e-92    Sorghum bicolor [broomcorn]
ref|XP_010534848.1|  PREDICTED: GDSL esterase/lipase At1g71250 is...    292   9e-92    
ref|XP_008786406.1|  PREDICTED: GDSL esterase/lipase At1g33811          292   1e-91    
ref|XP_004232990.1|  PREDICTED: GDSL esterase/lipase At5g45670          292   1e-91    
ref|XP_006655493.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     292   1e-91    
ref|XP_002871328.1|  GDSL-motif lipase/hydrolase family protein         292   1e-91    
gb|EMT18311.1|  hypothetical protein F775_52607                         291   1e-91    
ref|XP_008459640.1|  PREDICTED: GDSL esterase/lipase At1g33811          292   1e-91    
ref|XP_004497726.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     291   1e-91    
ref|XP_010549442.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     291   2e-91    
ref|XP_006355561.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     291   2e-91    
gb|KGN52691.1|  hypothetical protein Csa_5G650560                       291   2e-91    
ref|XP_002887358.1|  predicted protein                                  291   2e-91    
ref|XP_004141643.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     291   2e-91    
ref|XP_002305046.1|  GDSL-motif lipase/hydrolase family protein         291   2e-91    Populus trichocarpa [western balsam poplar]
ref|XP_010677280.1|  PREDICTED: GDSL esterase/lipase At1g71250          292   2e-91    
gb|KEH29338.1|  GDSL-like lipase/acylhydrolase                          291   2e-91    
ref|XP_002521611.1|  zinc finger protein, putative                      291   2e-91    Ricinus communis
emb|CDX90201.1|  BnaA08g17830D                                          291   2e-91    
ref|XP_002316749.2|  GDSL-motif lipase/hydrolase family protein         291   3e-91    Populus trichocarpa [western balsam poplar]
ref|XP_008792294.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     291   3e-91    
ref|XP_009109657.1|  PREDICTED: GDSL esterase/lipase At1g29660          290   3e-91    
dbj|BAB56037.1|  putative proline-rich protein                          290   3e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011035467.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     290   3e-91    
ref|XP_008439698.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     290   4e-91    
gb|KFK31816.1|  hypothetical protein AALP_AA6G162300                    290   6e-91    
ref|XP_010062377.1|  PREDICTED: GDSL esterase/lipase At1g33811          290   7e-91    
ref|NP_196463.1|  GDSL esterase/lipase                                  290   7e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004134596.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     290   7e-91    
ref|XP_010669494.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     290   8e-91    
ref|XP_006300432.1|  hypothetical protein CARUB_v10022173mg             290   8e-91    
ref|XP_007147964.1|  hypothetical protein PHAVU_006G169100g             290   8e-91    
ref|XP_009767072.1|  PREDICTED: GDSL esterase/lipase At5g08460          289   8e-91    
emb|CDO96913.1|  unnamed protein product                                290   9e-91    
ref|XP_009612510.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     290   9e-91    
gb|ABD96893.1|  hypothetical protein                                    289   1e-90    Tarenaya spinosa
ref|XP_010491482.1|  PREDICTED: GDSL esterase/lipase At5g08460          289   1e-90    
ref|XP_004485963.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     289   1e-90    
ref|XP_007226475.1|  hypothetical protein PRUPE_ppa027202mg             288   1e-90    
ref|XP_004969823.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     289   1e-90    
ref|XP_010558516.1|  PREDICTED: GDSL esterase/lipase 7                  290   2e-90    
ref|XP_010054297.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     289   2e-90    
ref|XP_007131319.1|  hypothetical protein PHAVU_011G003600g             288   2e-90    
gb|KEH15769.1|  GDSL-like lipase/acylhydrolase                          288   2e-90    
ref|XP_010452841.1|  PREDICTED: GDSL esterase/lipase At5g08460-like     289   2e-90    
ref|XP_002871339.1|  predicted protein                                  289   2e-90    
ref|XP_010100103.1|  GDSL esterase/lipase                               288   3e-90    
ref|XP_009769554.1|  PREDICTED: GDSL esterase/lipase At1g29670 is...    288   3e-90    
ref|XP_011102202.1|  PREDICTED: uncharacterized protein LOC105180227    299   3e-90    
ref|XP_008219130.1|  PREDICTED: GDSL esterase/lipase At1g33811          288   3e-90    
ref|XP_006415558.1|  hypothetical protein EUTSA_v10007994mg             288   3e-90    
ref|NP_177281.1|  GDSL esterase/lipase                                  288   3e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289976.1|  hypothetical protein CARUB_v10003606mg             288   4e-90    
gb|EPS71849.1|  hypothetical protein M569_02907                         287   5e-90    
gb|EYU28213.1|  hypothetical protein MIMGU_mgv1a008354mg                288   5e-90    
ref|XP_004506365.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     287   6e-90    
ref|XP_002518015.1|  zinc finger protein, putative                      287   7e-90    Ricinus communis
ref|XP_009102833.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     287   7e-90    
ref|XP_010112067.1|  GDSL esterase/lipase                               287   8e-90    
ref|XP_010911116.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     287   8e-90    
ref|XP_003566036.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     286   1e-89    
gb|KDP45644.1|  hypothetical protein JCGZ_17251                         286   1e-89    
emb|CDO96914.1|  unnamed protein product                                286   1e-89    
ref|XP_009392443.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     286   2e-89    
ref|XP_007048633.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    286   2e-89    
ref|XP_002267889.1|  PREDICTED: GDSL esterase/lipase At5g08460          286   2e-89    Vitis vinifera
ref|XP_010540543.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     286   2e-89    
ref|XP_010549444.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     285   3e-89    
ref|XP_006390789.1|  hypothetical protein EUTSA_v10019503mg             285   3e-89    
ref|XP_006494856.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     285   4e-89    
ref|XP_003569720.1|  PREDICTED: GDSL esterase/lipase At5g45670          285   4e-89    
ref|XP_010095110.1|  GDSL esterase/lipase                               285   4e-89    
ref|XP_002891066.1|  GDSL-motif lipase/hydrolase family protein         285   4e-89    
ref|XP_002526411.1|  zinc finger protein, putative                      285   5e-89    
ref|XP_009145171.1|  PREDICTED: GDSL esterase/lipase At1g33811          285   5e-89    
ref|XP_004499571.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     285   6e-89    
gb|EAY75691.1|  hypothetical protein OsI_03598                          285   6e-89    
ref|XP_008371536.1|  PREDICTED: GDSL esterase/lipase At5g45670          285   7e-89    
ref|XP_006356087.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     285   7e-89    
ref|XP_011074971.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     285   7e-89    
ref|XP_006305157.1|  hypothetical protein CARUB_v10009525mg             284   8e-89    
gb|EYU22692.1|  hypothetical protein MIMGU_mgv1a007347mg                286   9e-89    
emb|CDY70134.1|  BnaCnng66890D                                          280   1e-88    
emb|CDX94689.1|  BnaC07g09690D                                          284   1e-88    
ref|XP_006426401.1|  hypothetical protein CICLE_v10027519mg             284   1e-88    
ref|XP_009104921.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     284   1e-88    
ref|XP_006466217.1|  PREDICTED: GDSL esterase/lipase At5g08460-like     284   2e-88    
ref|XP_002890825.1|  GDSL-motif lipase/hydrolase family protein         283   2e-88    
ref|XP_009379054.1|  PREDICTED: GDSL esterase/lipase At1g33811          284   2e-88    
ref|XP_004234068.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     283   2e-88    
emb|CDX68319.1|  BnaA07g23590D                                          283   2e-88    
ref|XP_009102834.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     283   2e-88    
emb|CDX73285.1|  BnaC05g28210D                                          283   3e-88    
ref|XP_010542848.1|  PREDICTED: GDSL esterase/lipase At1g33811          283   3e-88    
ref|XP_008366024.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     283   3e-88    
ref|XP_006441609.1|  hypothetical protein CICLE_v10020729mg             283   3e-88    
gb|ABF72017.1|  GDSL-motif lipase/hydrolase family protein              283   3e-88    
ref|XP_006288000.1|  hypothetical protein CARUB_v10001233mg             283   3e-88    
ref|XP_006415557.1|  hypothetical protein EUTSA_v10008016mg             282   4e-88    
emb|CDX90202.1|  BnaA08g17820D                                          282   6e-88    
ref|XP_010423079.1|  PREDICTED: GDSL esterase/lipase At5g08460-like     282   6e-88    
ref|XP_002873738.1|  GDSL-motif lipase 7                                282   6e-88    
gb|KDP31296.1|  hypothetical protein JCGZ_11672                         282   7e-88    
emb|CDY49215.1|  BnaCnng17040D                                          282   8e-88    
ref|XP_009351953.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    281   9e-88    
ref|XP_008378723.1|  PREDICTED: GDSL esterase/lipase At1g33811          282   9e-88    
ref|XP_010272684.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     281   1e-87    
ref|XP_003546057.1|  PREDICTED: GDSL esterase/lipase At1g29670          281   1e-87    
gb|KFK45101.1|  hypothetical protein AALP_AA1G343700                    281   1e-87    
emb|CDY59325.1|  BnaCnng34700D                                          281   1e-87    
dbj|BAJ85725.1|  predicted protein                                      281   1e-87    
emb|CDY35296.1|  BnaC03g59270D                                          281   2e-87    
ref|XP_002441391.1|  hypothetical protein SORBIDRAFT_09g025780          281   2e-87    
gb|AAM64368.1|  lipase/hydrolase, putative                              281   2e-87    
ref|XP_010492414.1|  PREDICTED: GDSL esterase/lipase 7-like isofo...    281   2e-87    
gb|EPS68861.1|  hypothetical protein M569_05905                         281   2e-87    
ref|XP_006415056.1|  hypothetical protein EUTSA_v10007976mg             281   2e-87    
gb|AES72967.2|  GDSL-like lipase/acylhydrolase                          281   2e-87    
ref|NP_199379.1|  GDSL esterase/lipase                                  280   2e-87    
ref|XP_006646284.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     281   2e-87    
ref|XP_010461207.1|  PREDICTED: GDSL esterase/lipase At1g33811          281   2e-87    
gb|KFK44794.1|  hypothetical protein AALP_AA1G304300                    280   3e-87    
ref|NP_174260.1|  GDSL esterase/lipase                                  280   3e-87    
ref|XP_002865231.1|  GDSL-motif lipase/hydrolase family protein         280   3e-87    
ref|XP_010478804.1|  PREDICTED: GDSL esterase/lipase At1g33811-li...    280   3e-87    
ref|XP_003602716.1|  GDSL esterase/lipase                               281   4e-87    
ref|XP_009109655.1|  PREDICTED: GDSL esterase/lipase At1g29670          280   4e-87    
emb|CDO96915.1|  unnamed protein product                                280   4e-87    
gb|AAM63021.1|  GDSL-motif lipase/hydrolase-like protein                280   4e-87    
ref|XP_003598046.1|  GDSL esterase/lipase                               280   5e-87    
ref|XP_010492413.1|  PREDICTED: GDSL esterase/lipase 7-like isofo...    280   6e-87    
emb|CDM84214.1|  unnamed protein product                                279   6e-87    
ref|XP_010499477.1|  PREDICTED: GDSL esterase/lipase At1g29670          280   6e-87    
ref|XP_010661323.1|  PREDICTED: GDSL esterase/lipase At1g71250-li...    278   6e-87    
ref|XP_010521634.1|  PREDICTED: GDSL esterase/lipase At5g08460          280   9e-87    
ref|XP_010453711.1|  PREDICTED: GDSL esterase/lipase 7                  279   9e-87    
ref|XP_010499923.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     281   1e-86    
gb|KFK31532.1|  hypothetical protein AALP_AA6G124800                    279   1e-86    
ref|XP_010661322.1|  PREDICTED: GDSL esterase/lipase At1g71250-li...    278   1e-86    
ref|XP_010661321.1|  PREDICTED: GDSL esterase/lipase At1g71250-li...    278   1e-86    
ref|XP_002275448.3|  PREDICTED: GDSL esterase/lipase At1g71250-li...    278   1e-86    
ref|XP_006400092.1|  hypothetical protein EUTSA_v10015627mg             278   2e-86    
emb|CDY39440.1|  BnaAnng05710D                                          277   2e-86    
emb|CBI16594.3|  unnamed protein product                                278   2e-86    
ref|XP_010661319.1|  PREDICTED: GDSL esterase/lipase At1g71250-li...    278   2e-86    
ref|XP_004961487.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     278   2e-86    
ref|XP_008803727.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     278   2e-86    
emb|CDX72790.1|  BnaC06g32380D                                          295   3e-86    
gb|AGJ83937.1|  GLIP                                                    278   3e-86    
ref|XP_009101579.1|  PREDICTED: GDSL esterase/lipase At5g45670          277   3e-86    
ref|XP_010674288.1|  PREDICTED: GDSL esterase/lipase At5g08460          277   4e-86    
ref|XP_006280692.1|  hypothetical protein CARUB_v10026655mg             277   5e-86    
ref|NP_001056057.1|  Os05g0518300                                       277   5e-86    
gb|AAM65973.1|  lipase/hydrolase, putative                              277   5e-86    
gb|ABF70089.1|  GDSL-motif lipase/hydrolase family protein              278   6e-86    
ref|NP_564430.1|  GDSL esterase/lipase                                  277   6e-86    
ref|XP_011005438.1|  PREDICTED: GDSL esterase/lipase At1g33811          277   6e-86    
ref|XP_009407058.1|  PREDICTED: GDSL esterase/lipase At1g33811          279   8e-86    
emb|CDX96311.1|  BnaA07g29220D                                          293   9e-86    
ref|NP_174259.1|  GDSL esterase/lipase                                  276   1e-85    
ref|XP_006305078.1|  hypothetical protein CARUB_v10009448mg             276   1e-85    
ref|XP_010499475.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    276   1e-85    
ref|XP_007019797.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    276   2e-85    
emb|CDX90976.1|  BnaC02g06210D                                          275   2e-85    
ref|NP_568318.1|  GDSL esterase/lipase 7                                275   3e-85    
ref|XP_003605652.1|  GDSL esterase/lipase                               290   3e-85    
ref|XP_004293650.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     275   3e-85    
ref|XP_010930423.1|  PREDICTED: GDSL esterase/lipase At1g33811          275   3e-85    
ref|NP_567570.1|  GDSL esterase/lipase                                  275   3e-85    
emb|CDX78649.1|  BnaA03g05610D                                          275   4e-85    
ref|XP_006398248.1|  hypothetical protein EUTSA_v10000937mg             274   6e-85    
ref|XP_009114398.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     274   7e-85    
ref|XP_009385181.1|  PREDICTED: GDSL esterase/lipase At1g71691-like     274   7e-85    
emb|CDY13043.1|  BnaA09g17740D                                          274   8e-85    
emb|CAC01771.1|  putative protein                                       274   1e-84    
ref|XP_010258913.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     273   1e-84    
ref|XP_004301465.1|  PREDICTED: GDSL esterase/lipase At1g33811-like     273   2e-84    
ref|XP_010538583.1|  PREDICTED: GDSL esterase/lipase At5g45670          273   2e-84    
ref|XP_007211471.1|  hypothetical protein PRUPE_ppa007546mg             273   3e-84    
ref|XP_008225405.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     273   3e-84    
ref|XP_010478329.1|  PREDICTED: GDSL esterase/lipase At1g29660          272   3e-84    
emb|CAN83203.1|  hypothetical protein VITISV_035686                     274   4e-84    
ref|XP_010460737.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     272   4e-84    
ref|NP_001190767.1|  GDSL esterase/lipase                               274   4e-84    
ref|XP_002890824.1|  GDSL-motif lipase/hydrolase family protein         272   4e-84    
gb|KFK44793.1|  hypothetical protein AALP_AA1G304100                    272   5e-84    
ref|XP_010441685.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     271   6e-84    
ref|XP_010494685.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     271   7e-84    
ref|XP_010439787.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     271   8e-84    
ref|XP_010518837.1|  PREDICTED: GDSL esterase/lipase At5g45670-li...    272   9e-84    
ref|XP_010481545.1|  PREDICTED: GDSL esterase/lipase At5g45670          271   9e-84    
gb|AAM67249.1|  GDSL-motif lipase/hydrolase-like protein                271   1e-83    
ref|XP_010449440.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     271   1e-83    
ref|XP_002867968.1|  GDSL-motif lipase/hydrolase family protein         271   1e-83    
ref|XP_006844094.1|  hypothetical protein AMTR_s00006p00253020          270   1e-83    
ref|XP_006441598.1|  hypothetical protein CICLE_v10023256mg             267   2e-83    
ref|XP_010518836.1|  PREDICTED: GDSL esterase/lipase At5g45670-li...    272   2e-83    
emb|CDY01575.1|  BnaC07g35650D                                          270   3e-83    
ref|XP_010434476.1|  PREDICTED: GDSL esterase/lipase At4g18970          270   3e-83    
emb|CDY23109.1|  BnaC09g18630D                                          270   4e-83    
ref|XP_009416437.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     270   4e-83    
ref|XP_009131491.1|  PREDICTED: GDSL esterase/lipase 7                  271   5e-83    
emb|CAA16754.1|  putative protein                                       277   5e-83    
ref|XP_002988284.1|  hypothetical protein SELMODRAFT_127685             267   2e-82    
ref|XP_002994082.1|  hypothetical protein SELMODRAFT_45524              266   2e-82    
ref|XP_002963881.1|  hypothetical protein SELMODRAFT_80725              267   3e-82    
ref|XP_003519329.1|  PREDICTED: GDSL esterase/lipase At5g37690-li...    266   4e-82    
emb|CDX85537.1|  BnaA02g02760D                                          267   5e-82    
ref|XP_006414032.1|  hypothetical protein EUTSA_v10025529mg             267   5e-82    
ref|XP_002967217.1|  hypothetical protein SELMODRAFT_87116              266   6e-82    
ref|XP_009126065.1|  PREDICTED: GDSL esterase/lipase 7-like             268   9e-82    
ref|XP_001757546.1|  predicted protein                                  266   1e-81    
ref|XP_002989121.1|  hypothetical protein SELMODRAFT_129215             266   1e-81    
ref|XP_002968205.1|  hypothetical protein SELMODRAFT_89823              266   2e-81    
ref|XP_002960505.1|  hypothetical protein SELMODRAFT_73430              265   2e-81    
gb|EMT08946.1|  GDSL esterase/lipase                                    263   2e-81    
ref|XP_006305152.1|  hypothetical protein CARUB_v10009519mg             265   3e-81    
ref|XP_007141917.1|  hypothetical protein PHAVU_008G236800g             265   3e-81    
gb|AAF97292.1|AC010164_14  Hypothetical protein                         265   5e-81    
ref|XP_010261380.1|  PREDICTED: GDSL esterase/lipase 7                  264   6e-81    
ref|XP_002976172.1|  hypothetical protein SELMODRAFT_104120             264   6e-81    
ref|XP_007019705.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    262   8e-81    
ref|XP_009136981.1|  PREDICTED: GDSL esterase/lipase At4g18970          263   1e-80    
emb|CDX98598.1|  BnaA03g43830D                                          263   1e-80    
ref|XP_006376146.1|  GDSL-motif lipase/hydrolase family protein         263   2e-80    
gb|KFK28567.1|  hypothetical protein AALP_AA7G013200                    262   4e-80    
ref|XP_010694356.1|  PREDICTED: GDSL esterase/lipase 7-like             261   6e-80    
ref|XP_010522212.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     261   1e-79    
ref|XP_010540541.1|  PREDICTED: GDSL esterase/lipase At1g29670-li...    261   1e-79    
ref|XP_001759235.1|  predicted protein                                  260   1e-79    
gb|AES99241.2|  GDSL-like lipase/acylhydrolase                          260   2e-79    
ref|XP_008343129.1|  PREDICTED: GDSL esterase/lipase At5g37690          259   2e-79    
ref|XP_001781861.1|  predicted protein                                  261   2e-79    
gb|KHN39466.1|  GDSL esterase/lipase                                    259   3e-79    
ref|XP_007147963.1|  hypothetical protein PHAVU_006G169000g             259   4e-79    
ref|XP_009370610.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     259   5e-79    
ref|XP_002973831.1|  hypothetical protein SELMODRAFT_100257             257   3e-78    
ref|XP_009367135.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     256   4e-78    
gb|KHN47367.1|  GDSL esterase/lipase                                    256   6e-78    
ref|XP_004145849.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     256   7e-78    
gb|ABK26965.1|  unknown                                                 256   1e-77    
ref|XP_002983559.1|  hypothetical protein SELMODRAFT_118578             255   1e-77    
ref|XP_011083333.1|  PREDICTED: GDSL esterase/lipase At5g08460-like     255   1e-77    
ref|XP_004490816.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     255   2e-77    
ref|XP_009415654.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     256   3e-77    
ref|XP_002459135.1|  hypothetical protein SORBIDRAFT_03g046440          254   3e-77    
ref|XP_008457023.1|  PREDICTED: GDSL esterase/lipase At5g37690          255   3e-77    
emb|CDP18863.1|  unnamed protein product                                252   5e-77    
ref|XP_006430582.1|  hypothetical protein CICLE_v10013564mg             253   5e-77    
ref|XP_009407589.1|  PREDICTED: GDSL esterase/lipase 7                  254   5e-77    
ref|XP_007216510.1|  hypothetical protein PRUPE_ppa025674mg             253   6e-77    
ref|XP_008381376.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     253   6e-77    
ref|XP_010534856.1|  PREDICTED: GDSL esterase/lipase At1g71250 is...    253   7e-77    
ref|XP_003565364.2|  PREDICTED: GDSL esterase/lipase At1g33811-like     255   7e-77    
ref|XP_010540540.1|  PREDICTED: GDSL esterase/lipase At1g29660-like     253   1e-76    
gb|KDO50801.1|  hypothetical protein CISIN_1g041889mg                   252   2e-76    
ref|XP_006286004.1|  hypothetical protein CARUB_v10007532mg             257   2e-76    
ref|XP_006646701.1|  PREDICTED: GDSL esterase/lipase At1g71250-like     252   2e-76    
ref|XP_006482381.1|  PREDICTED: GDSL esterase/lipase At5g37690-like     252   2e-76    
emb|CBI30761.3|  unnamed protein product                                252   2e-76    
ref|XP_001772825.1|  predicted protein                                  252   3e-76    
ref|XP_003616283.1|  GDSL esterase/lipase                               252   3e-76    
ref|XP_010271296.1|  PREDICTED: GDSL esterase/lipase At5g37690          252   3e-76    
ref|XP_001753090.1|  predicted protein                                  251   4e-76    
emb|CDP01632.1|  unnamed protein product                                251   7e-76    
ref|XP_010108989.1|  GDSL esterase/lipase                               251   8e-76    
ref|XP_008228044.1|  PREDICTED: GDSL esterase/lipase At5g37690          250   1e-75    
ref|XP_010265525.1|  PREDICTED: GDSL esterase/lipase 7-like             249   1e-75    
ref|XP_008649890.1|  PREDICTED: GDSL esterase/lipase At4g18970-like     248   2e-75    
ref|XP_007139614.1|  hypothetical protein PHAVU_008G044500g             249   3e-75    
gb|ABK95330.1|  unknown                                                 249   4e-75    
emb|CDY72200.1|  BnaAnng40320D                                          246   8e-75    
ref|XP_006388931.1|  hypothetical protein POPTR_0073s00220g             247   2e-74    
gb|KCW74228.1|  hypothetical protein EUGRSUZ_E028672                    244   2e-74    
ref|XP_010671752.1|  PREDICTED: GDSL esterase/lipase At4g16230-like     247   2e-74    
ref|XP_002518038.1|  zinc finger protein, putative                      246   2e-74    
ref|XP_006389045.1|  hypothetical protein POPTR_0053s00200g             246   3e-74    
ref|XP_011001569.1|  PREDICTED: GDSL esterase/lipase At5g37690          246   3e-74    
ref|XP_009589693.1|  PREDICTED: GDSL esterase/lipase At5g37690          246   4e-74    
ref|XP_009789284.1|  PREDICTED: GDSL esterase/lipase At5g37690          246   5e-74    
ref|XP_008809415.1|  PREDICTED: GDSL esterase/lipase At5g37690          246   7e-74    
ref|XP_001764592.1|  predicted protein                                  246   7e-74    
ref|XP_007156849.1|  hypothetical protein PHAVU_002G022600g             246   9e-74    
emb|CDP04257.1|  unnamed protein product                                245   1e-73    
ref|XP_006575487.1|  PREDICTED: GDSL esterase/lipase At5g37690-li...    244   1e-73    
ref|XP_011046352.1|  PREDICTED: GDSL esterase/lipase At1g29670-like     244   1e-73    
ref|XP_009757859.1|  PREDICTED: GDSL esterase/lipase At5g45670-like     244   2e-73    
ref|XP_006436361.1|  hypothetical protein CICLE_v10031897mg             244   2e-73    
ref|NP_179496.1|  SGNH hydrolase-type esterase family protein           244   3e-73    
ref|XP_002266915.1|  PREDICTED: GDSL esterase/lipase At1g29670          244   3e-73    



>ref|XP_011074972.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Sesamum indicum]
Length=374

 Score =   435 bits (1118),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 209/324 (65%), Positives = 260/324 (80%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAYS
Sbjct  51   FGDSLIDNGNNNNLPSFAKANYLPYGIDFNGGPTGRFSNGYTMVDTIAELLGLPLIPAYS  110

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQMR+GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ +L A  V 
Sbjct  111  --EASGDQMRYGVNYASAAAGILDITGRNFVSRIPFNQQIKNFENTLDQITDSLGAPDVA  168

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + + KCIFFVG+GSNDYL NYLMP   T   Y  QQYADLL+QQYS  L RLY+LGARKF
Sbjct  169  QALAKCIFFVGMGSNDYLNNYLMPNYDTKYQYNAQQYADLLVQQYSQQLTRLYNLGARKF  228

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G +GCIP+++A+S NG C +EVNQ+V PFN N K M+ N +  LP A+F Y+D +
Sbjct  229  VIAGLGLMGCIPSILAQSSNGICSEEVNQLVLPFNTNTKAMINNLSANLPGARFSYIDIR  288

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
            NMFR+++AN+ +YGFSV++RGCCG+G+  G+ITC+PF+TPCP R +Y+FWDA+HPT AVN
Sbjct  289  NMFRDLLANAGSYGFSVLNRGCCGIGRNRGQITCLPFQTPCPERNQYIFWDAFHPTEAVN  348

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            VL G+ AF+G ++LVYPINI+QLA
Sbjct  349  VLFGQKAFNGNTELVYPINIEQLA  372



>ref|XP_011095918.1| PREDICTED: GDSL esterase/lipase At1g71691 [Sesamum indicum]
Length=372

 Score =   433 bits (1113),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 206/325 (63%), Positives = 261/325 (80%), Gaps = 2/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAYS
Sbjct  49   FGDSLIDNGNNNNLPSFAKANYFPYGIDFKGGPTGRFSNGYTMVDTIAELLGLPLIPAYS  108

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQMR+GVNYASAA+GILD+TG+ FV R+P   QI NF  TLDQ++ NL A  V 
Sbjct  109  --EASGDQMRYGVNYASAASGILDITGRNFVSRIPFGQQIRNFENTLDQITDNLGAPDVA  166

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + + KCIFFVG+GSNDYL NYLMP  +T   Y  QQY+DLL+QQYS  L RLY+LGARKF
Sbjct  167  QALAKCIFFVGMGSNDYLNNYLMPNYNTRNQYNAQQYSDLLVQQYSQQLTRLYNLGARKF  226

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G +GCIP+++A+S NG C +EVNQ+V PFN   K M+ N +  LP A+F Y+D +
Sbjct  227  VIAGLGLMGCIPSILAQSNNGVCSEEVNQLVLPFNTKTKAMINNLSANLPGARFSYIDIR  286

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
            +MF++++AN+++YGF+VV+RGCCG+G+  G+ITC+PF+TPCPNR +Y+FWDA+HPT AVN
Sbjct  287  HMFQDLLANARSYGFTVVNRGCCGIGRNRGQITCLPFQTPCPNRNQYIFWDAFHPTEAVN  346

Query  903  VLVGKMAFSGGSDLVYPINIQQLAR  977
            VL G+ AF G  D+VYP+NI+QLAR
Sbjct  347  VLFGRRAFYGNRDVVYPMNIEQLAR  371



>ref|XP_009597060.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nicotiana tomentosiformis]
Length=363

 Score =   427 bits (1099),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 204/324 (63%), Positives = 260/324 (80%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I Q LGLPL P Y+
Sbjct  40   FGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDVIAQLLGLPLIPPYT  99

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQMRFG+NYASAAAGILD+TG+ FV R+P   QITNF  T++Q+ +NL    V 
Sbjct  100  --EASGDQMRFGINYASAAAGILDITGRNFVGRIPFNQQITNFESTVNQIRSNLGVSDVG  157

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            E + K IFFVG+GSNDYL NYLMP  +T   Y  Q++A LL+QQY+  L RLY+LGARKF
Sbjct  158  EALAKSIFFVGMGSNDYLNNYLMPNYNTKNQYNAQEFASLLVQQYNQQLMRLYNLGARKF  217

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+ G+G +GCIP+++A+S+NG C DEV+Q+V PF+ N++ M+ NFNT LP +KFVY+D +
Sbjct  218  VIGGVGLMGCIPSILAQSQNGACSDEVDQLVLPFHNNVRSMLNNFNTNLPGSKFVYIDIR  277

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
            NMF++++ N + YGFS ++ GCCGVG+  G+ITC+PF+TPC NRE+++FWDA+HPT AVN
Sbjct  278  NMFQDLLTNYRQYGFSEINNGCCGVGRNRGQITCLPFQTPCQNREQFIFWDAFHPTEAVN  337

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +L G+ AFSGGSD+VYPINIQQLA
Sbjct  338  ILFGRKAFSGGSDVVYPINIQQLA  361



>ref|XP_009605870.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nicotiana tomentosiformis]
Length=377

 Score =   427 bits (1099),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 205/326 (63%), Positives = 259/326 (79%), Gaps = 2/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAY+
Sbjct  50   FGDSLIDNGNNNNLPSFAKANYFPYGIDFDGGPTGRFSNGYTMVDEIAELLGLPLIPAYT  109

Query  183  --TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV  356
              + D S D+MRFGVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A  
Sbjct  110  EASADASGDKMRFGVNYASAAAGILDITGRNFVGRIPFNQQIKNFENTLDQITDNLGAPD  169

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGAR  536
            V + + KC+FFVG+GSNDYL NYLMP   T   Y  QQYA+LL+QQYS  L RLY+LGAR
Sbjct  170  VAQALAKCMFFVGMGSNDYLNNYLMPNYDTKNRYNPQQYANLLVQQYSQQLSRLYNLGAR  229

Query  537  KFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLD  716
            KFV+ G+G +GCIP+++A+     C +EVNQ+V PF+ N+K M++N N  LP +KF+Y+D
Sbjct  230  KFVIGGLGLMGCIPSILAQGNGNVCSEEVNQLVLPFSNNVKSMLSNLNANLPGSKFIYID  289

Query  717  TQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSA  896
             +NMF++++ N + YGFSV+DRGCCG+G+  G+ITC+P +TPCPNR++Y+FWDA+HPT A
Sbjct  290  IKNMFQDLLTNYRRYGFSVIDRGCCGIGRNRGQITCLPLQTPCPNRDQYIFWDAFHPTEA  349

Query  897  VNVLVGKMAFSGGSDLVYPINIQQLA  974
            VN+L G+ AFSGG D+VYPINIQQLA
Sbjct  350  VNILFGRRAFSGGPDVVYPINIQQLA  375



>ref|XP_009793810.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nicotiana sylvestris]
Length=364

 Score =   427 bits (1097),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 203/324 (63%), Positives = 260/324 (80%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I Q LGLPL P Y+
Sbjct  41   FGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDVIAQLLGLPLIPPYT  100

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQMRFG+NYASAAAGILD+TG+ FV R+P   QITNF  T++Q+ +NL    V 
Sbjct  101  --EASGDQMRFGINYASAAAGILDITGRNFVGRIPFNQQITNFESTVNQIRSNLGVSDVG  158

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            E + K IFFVG+GSNDYL NYLMP  +T   Y  QQ+A LL+QQY+  L RLY+LGARKF
Sbjct  159  EALAKSIFFVGMGSNDYLNNYLMPNYNTKNQYNAQQFASLLVQQYNQQLMRLYNLGARKF  218

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+ G+G +GCIP+++A+S+NG+C +EVNQ+V PF+ N++ M+ NFNT LP +KFVY+D +
Sbjct  219  VIGGVGLMGCIPSILAQSQNGECSEEVNQLVLPFHNNVRSMLNNFNTNLPGSKFVYIDIR  278

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
            NMF++++ N + YGFS ++ GCCGVG+  G+ITC+PF+TPC NRE+++FWDA+HPT AVN
Sbjct  279  NMFQDLLTNYRQYGFSEINNGCCGVGRNRGQITCLPFQTPCQNREQFIFWDAFHPTEAVN  338

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +L G+ AF+GG D+VYPINIQQLA
Sbjct  339  ILFGRKAFNGGPDVVYPINIQQLA  362



>ref|XP_009357251.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Pyrus x bretschneideri]
 ref|XP_009362505.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Pyrus x bretschneideri]
Length=389

 Score =   425 bits (1092),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 201/324 (62%), Positives = 254/324 (78%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNN++ + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PA+S
Sbjct  60   FGDSLIDNGNNNDIPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPAHS  119

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQMR GVNYASAAAGILD TG+ FV R+P   QI NF  TLDQ++ NL A    
Sbjct  120  --EASGDQMRHGVNYASAAAGILDDTGRNFVGRIPFSEQIRNFQNTLDQITGNLGADDAA  177

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              I KCIFFVG+GSNDYL NYLMP   T   Y  QQYADLL Q+Y+  L RLY+LGARKF
Sbjct  178  RSIAKCIFFVGMGSNDYLNNYLMPNYPTRNQYNAQQYADLLAQEYTQQLTRLYNLGARKF  237

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G +GCIP+++A++ +G C DEVN++V PFN N+K M+ N N  LP +KF+Y+D  
Sbjct  238  VIAGLGRMGCIPSILAQNPSGTCSDEVNRLVLPFNTNVKTMINNLNANLPSSKFIYIDIA  297

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF +++ NS++YGFSV +RGCCG+G+  G++TC+PF+TPCPNR++Y+FWDA+HPTSAVN
Sbjct  298  RMFEDMLLNSRSYGFSVANRGCCGIGRNRGQVTCLPFQTPCPNRDQYIFWDAFHPTSAVN  357

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +++G+ AFSG    VYP+NIQQLA
Sbjct  358  IIIGRKAFSGDRTEVYPMNIQQLA  381



>ref|XP_008361601.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At1g71691-like 
[Malus domestica]
Length=391

 Score =   424 bits (1091),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 202/324 (62%), Positives = 255/324 (79%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNN+L + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PA+S
Sbjct  62   FGDSLIDNGNNNDLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPAHS  121

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQMR GVNYASAAAGILD TG+ FV R+P   QI NF  TLDQ++ NL A    
Sbjct  122  --EASGDQMRHGVNYASAAAGILDDTGRNFVGRIPFSEQIRNFQNTLDQITDNLGADDAA  179

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              I KCI+FVG+GSNDYL NYLMP   T   Y  QQYADLL Q+Y+  L RLY+LGARKF
Sbjct  180  RSIAKCIYFVGMGSNDYLNNYLMPNYPTRNQYNAQQYADLLAQEYTQQLTRLYNLGARKF  239

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+GE GCIP+++A++ +G C DEVN++V PFN N+K M+ N NT LP +KF+Y+D  
Sbjct  240  VIAGLGEXGCIPSILAQNPSGTCSDEVNRLVLPFNTNVKTMINNLNTNLPGSKFIYVDIA  299

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF +++ NS++YGFSV +RGCCG+G+  G++TC+PF+TPCPNR++Y+FWDA+HPTSAVN
Sbjct  300  RMFEDMLLNSRSYGFSVANRGCCGIGRNRGQVTCLPFQTPCPNRDQYIFWDAFHPTSAVN  359

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +++G+ AFSG    VYP+N+QQLA
Sbjct  360  IIIGRKAFSGDRTEVYPMNVQQLA  383



>ref|XP_004301466.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Fragaria vesca 
subsp. vesca]
Length=336

 Score =   422 bits (1085),  Expect = 5e-143, Method: Compositional matrix adjust.
 Identities = 202/324 (62%), Positives = 256/324 (79%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANYPPYGIDF+ GPTGRFSNGYT+VD I + LGLPL PA+S
Sbjct  8    FGDSLIDNGNNNNLPSFAKANYPPYGIDFSGGPTGRFSNGYTMVDEIAELLGLPLIPAFS  67

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + + DQ+  GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A  V 
Sbjct  68   --EATGDQVLHGVNYASAAAGILDITGRNFVGRIPFGQQIKNFQTTLDQITENLGADDVA  125

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              I KCIFFVG+GSNDYL NYLMP   T   Y  QQ+ADLL QQY+ +L RLY+LGARKF
Sbjct  126  RAIGKCIFFVGMGSNDYLNNYLMPNYDTKNQYNAQQFADLLAQQYTHHLTRLYNLGARKF  185

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G +GCIP+++A+S NG C ++VN +V PFNAN+K M+ N NT LP +KF+Y+D  
Sbjct  186  VIAGVGRMGCIPSILAQSPNGSCSEDVNLLVLPFNANVKAMINNLNTNLPGSKFIYIDIA  245

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF +I+ N++ YG SV +RGCCG+G+  G+ITC+P +TPCPNR++YVFWDA+HPT+AVN
Sbjct  246  QMFEDIVTNARVYGLSVANRGCCGIGRNRGQITCLPMQTPCPNRDQYVFWDAFHPTAAVN  305

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +++G+ AFSG    VYP+NIQQL+
Sbjct  306  IIIGRKAFSGDFSQVYPMNIQQLS  329



>ref|XP_009773145.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nicotiana sylvestris]
Length=379

 Score =   424 bits (1089),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 204/326 (63%), Positives = 258/326 (79%), Gaps = 2/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAY+
Sbjct  52   FGDSLIDNGNNNNLPSFAKANYFPYGIDFDGGPTGRFSNGYTMVDEIAELLGLPLIPAYT  111

Query  183  --TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV  356
              + D S D+MR+GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A  
Sbjct  112  EASADTSGDKMRYGVNYASAAAGILDITGRNFVGRIPFNQQIKNFENTLDQITDNLGAPD  171

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGAR  536
            V + +  C+FFVG+GSNDYL NYLMP   T   Y  QQYA LL+QQYS  L RLY+LGAR
Sbjct  172  VAQALAICMFFVGMGSNDYLNNYLMPNYDTKNRYNPQQYASLLVQQYSQQLTRLYNLGAR  231

Query  537  KFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLD  716
            KFV+ G+G +GCIP+++A+     C +EVNQ+V PF+ N+K M++N N  LP +KF+Y+D
Sbjct  232  KFVIGGVGLMGCIPSILAQGNGNVCSEEVNQLVLPFSNNVKSMLSNLNANLPGSKFIYVD  291

Query  717  TQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSA  896
             +NMF++++AN + YGFSV+DRGCCG+G+  G+ITC+P +TPCPNR++Y+FWDA+HPT A
Sbjct  292  IKNMFQDLLANYRRYGFSVIDRGCCGIGRNRGQITCLPLQTPCPNRDQYIFWDAFHPTEA  351

Query  897  VNVLVGKMAFSGGSDLVYPINIQQLA  974
            VN+L G+ AFSGG D+VYPINIQQLA
Sbjct  352  VNILFGRRAFSGGPDVVYPINIQQLA  377



>ref|XP_004250678.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Solanum lycopersicum]
Length=360

 Score =   423 bits (1087),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 197/324 (61%), Positives = 255/324 (79%), Gaps = 0/324 (0%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I +QLGLPL PA+S
Sbjct  35   FGDSLIDNGNNNNLPSFAKANYYPYGIDFDGGPTGRFSNGYTMVDEIAEQLGLPLIPAHS  94

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                S +QMRFGVNYASAA+GILD TG+ FVER+P   QI NF  TLD+++ NL A  V 
Sbjct  95   EASSSGEQMRFGVNYASAASGILDDTGRNFVERIPFNQQIKNFEDTLDEITDNLGAPDVA  154

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + + KCIFFVG+GSNDYL NYLMP   T   Y  QQYA+LL+Q Y+  L RLY+LG RKF
Sbjct  155  QALAKCIFFVGMGSNDYLNNYLMPNYDTKNHYNPQQYANLLVQHYTEQLTRLYNLGGRKF  214

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+ G+G +GCIP+++A+S +  C +EVN+++ PF  N+K M+TN N  LP +KF+Y+D +
Sbjct  215  VIGGVGLMGCIPSILAKSNSNVCSEEVNELILPFTNNVKSMLTNLNVNLPGSKFIYIDIK  274

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
            NMF++++ N + YGFSV++RGCCG+G+  G+ITC+P +TPCPNR +Y+FWDA+HPT AVN
Sbjct  275  NMFQDLLTNYRQYGFSVINRGCCGIGRNRGQITCLPMQTPCPNRNQYIFWDAFHPTEAVN  334

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +L  + AF+GG+D+VYPINI +LA
Sbjct  335  ILFARKAFNGGTDVVYPINIHELA  358



>ref|XP_007019795.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
 gb|EOY17020.1| Zinc finger protein, putative isoform 1 [Theobroma cacao]
Length=375

 Score =   423 bits (1087),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 204/330 (62%), Positives = 258/330 (78%), Gaps = 2/330 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNN+L + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAYS
Sbjct  47   FGDSLIDNGNNNDLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPAYS  106

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQ+  GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A    
Sbjct  107  --EASGDQVLHGVNYASAAAGILDITGRNFVSRIPFDQQIRNFQSTLDQITDNLGAVDAA  164

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + I +CIFFVG+GSNDYL NYLMP   T   Y  QQ+ADLL+QQY+  L+ LY+LGARKF
Sbjct  165  DAIARCIFFVGMGSNDYLNNYLMPNYPTRNQYNAQQFADLLVQQYTRQLRTLYNLGARKF  224

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            VLAG+G +GCIP+++A+S  G C +EVNQ+V PFNAN+K M+ N N  LP A+F+Y+D  
Sbjct  225  VLAGLGRMGCIPSILAQSTVGSCSEEVNQLVLPFNANVKTMMNNLNANLPGARFIYIDVA  284

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
            ++F +I+ANS TYGFSVV+RGCCG+G+  G+ITC+PF+TPCPNR++YVFWDA+HPT  VN
Sbjct  285  HLFEDIVANSGTYGFSVVNRGCCGIGRNRGQITCLPFQTPCPNRDQYVFWDAFHPTEKVN  344

Query  903  VLVGKMAFSGGSDLVYPINIQQLARTETWP  992
            +++ + AF+G + +VYPINI+QLA     P
Sbjct  345  IIMARKAFNGDTSIVYPINIKQLASINIEP  374



>ref|XP_010683198.1| PREDICTED: GDSL esterase/lipase At1g71691 [Beta vulgaris subsp. 
vulgaris]
Length=377

 Score =   422 bits (1084),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 202/324 (62%), Positives = 253/324 (78%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSN YTIVDAI   LGLPL PAYS
Sbjct  49   FGDSLIDNGNNNNLPSFAKANYFPYGIDFNAGPTGRFSNAYTIVDAIADSLGLPLIPAYS  108

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              +   +QM  G+NYASAAAGILD+TG+ FV R+P   Q+ NF  TLD ++ANL A  V 
Sbjct  109  --EARGEQMLHGINYASAAAGILDVTGRNFVGRIPFNQQVRNFESTLDAITANLGADDVG  166

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              I +C+FFVG+GSNDYL NYLMP   T   Y  QQ+A+LL+QQY+  L RLY+LG RKF
Sbjct  167  RSIAQCLFFVGMGSNDYLNNYLMPNYPTRNQYNAQQFANLLVQQYTTQLTRLYNLGGRKF  226

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
             +AG+G++GCIP+++A+S  G C D VN +V PFNAN+K+M+ N N+ LP +KF+Y++  
Sbjct  227  AIAGLGKMGCIPSILAQSPTGNCSDAVNNLVQPFNANVKKMINNLNSKLPASKFIYINID  286

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
            NMFR+I+A+   YGF V+DRGCCG+G+  G+ITC+PF+TPC NREEYVFWDA+HP+S VN
Sbjct  287  NMFRDILASPADYGFRVIDRGCCGIGRNQGQITCLPFQTPCMNREEYVFWDAFHPSSHVN  346

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            VL+GK AF+GG D+ YP+NIQQLA
Sbjct  347  VLLGKKAFNGGLDVAYPMNIQQLA  370



>emb|CBI39225.3| unnamed protein product [Vitis vinifera]
Length=336

 Score =   419 bits (1077),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 201/330 (61%), Positives = 259/330 (78%), Gaps = 2/330 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I +QLGLPL PAYS
Sbjct  4    FGDSLIDNGNNNNLPSFAKANYFPYGIDFEGGPTGRFSNGYTMVDEIAEQLGLPLTPAYS  63

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S +++  GVN+ASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A  V 
Sbjct  64   --EASGEEVLHGVNFASAAAGILDITGRNFVGRIPFNQQIRNFENTLDQITDNLGADNVA  121

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            E I KCIFFVG+GSNDYL NYLMP  +T   Y  QQ+A+LLIQQY+  L  LY+LGAR+F
Sbjct  122  EAIAKCIFFVGMGSNDYLNNYLMPNYATRNQYNGQQFANLLIQQYNRQLNTLYNLGARRF  181

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            VLAG+G +GCIP+++A+S   +C D+VN ++ PFNAN++ MV   N+ LP AKF+Y+D  
Sbjct  182  VLAGLGIMGCIPSILAQSPTSRCSDDVNHLILPFNANVRAMVNRLNSNLPGAKFIYIDVY  241

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF++I++NS+ YGFSV++RGCCG+G+  G+ITC+PF+TPC NRE+YVFWDA+HPT AVN
Sbjct  242  RMFQDILSNSRNYGFSVINRGCCGIGRNSGQITCLPFQTPCSNREQYVFWDAFHPTEAVN  301

Query  903  VLVGKMAFSGGSDLVYPINIQQLARTETWP  992
            +++G+ AF+G    VYP+NI+QLA  +  P
Sbjct  302  IIMGRKAFNGDKSAVYPMNIEQLANLDLEP  331



>ref|XP_004499570.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Cicer arietinum]
Length=360

 Score =   420 bits (1079),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 202/325 (62%), Positives = 259/325 (80%), Gaps = 2/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ +LAKANY PYGIDF  GPTGRFSNGYTIVD I + LGLPL PAY+
Sbjct  37   FGDSLIDNGNNNNMASLAKANYFPYGIDFNGGPTGRFSNGYTIVDEIAELLGLPLIPAYN  96

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                + +Q+  GVNYASAAAGILD TG+ FV R+P   Q+ NF  TL+Q+S NL A  + 
Sbjct  97   --GAARNQVFHGVNYASAAAGILDATGRNFVGRIPFDQQLRNFENTLNQISGNLGADNMA  154

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + +CIFFVG+GSNDYL NYLMP  +T   Y  QQYADLL+Q Y+  L RLY+LGARKF
Sbjct  155  TQLSRCIFFVGMGSNDYLNNYLMPNYNTRNQYNGQQYADLLVQTYNHQLTRLYNLGARKF  214

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G +GCIP+++A+S +G+C  EVN +V PFN N+K M++N NT LP ++F +LDT 
Sbjct  215  VIAGLGLMGCIPSILAQSMSGKCSQEVNLLVQPFNENVKTMLSNLNTNLPGSRFTFLDTS  274

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF+ I+ N++TYGF+VV+RGCCG+G+  G+ITC+PF+TPCPNR +YVFWDA+HPT AVN
Sbjct  275  RMFQEILLNARTYGFTVVNRGCCGLGRNRGQITCLPFQTPCPNRNQYVFWDAFHPTEAVN  334

Query  903  VLVGKMAFSGGSDLVYPINIQQLAR  977
            VL+G++AFSG ++ +YPINIQQLA+
Sbjct  335  VLMGRIAFSGSTNFIYPINIQQLAQ  359



>ref|XP_010064853.1| PREDICTED: GDSL esterase/lipase At1g71691 [Eucalyptus grandis]
Length=502

 Score =   425 bits (1092),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 202/324 (62%), Positives = 258/324 (80%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF +GPTGRF NGYT+VD I + +GLPL PAYS
Sbjct  179  FGDSLIDNGNNNNLPSFAKANYFPYGIDFNRGPTGRFCNGYTMVDEIAELVGLPLIPAYS  238

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S  Q+  GVNYASAAAGILD+TG+ FV R+P   QITNF  TLDQ++ NL A  V 
Sbjct  239  --EASGQQLLHGVNYASAAAGILDITGRNFVGRIPFDQQITNFQSTLDQITDNLGADDVA  296

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + +C+FFVG+GSNDYL NYLMP   T   Y  QQ+ADLL+QQY+  L  LY+LGARKF
Sbjct  297  RALARCLFFVGMGSNDYLNNYLMPNYDTKNQYNGQQFADLLVQQYTRQLTTLYNLGARKF  356

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            ++AGIGE+GCIP+++A++E G C +EVN++V PFNAN+K M+ N N  LP AKF+Y+D  
Sbjct  357  IIAGIGEMGCIPSILAQNEAGICSEEVNRLVQPFNANVKTMINNLNVNLPGAKFIYIDIA  416

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF++I+ N+++YGFSVVDRGCCG+G+  G+ITC+PF+TPC NR++YVFWDA+HPT AVN
Sbjct  417  RMFQDIVTNARSYGFSVVDRGCCGIGRNSGQITCLPFQTPCANRKQYVFWDAFHPTEAVN  476

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            V++G+ AF+G   +VYPINI+QLA
Sbjct  477  VIMGRKAFNGDPSIVYPINIEQLA  500



>gb|KHN20549.1| GDSL esterase/lipase [Glycine soja]
Length=342

 Score =   419 bits (1076),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 200/325 (62%), Positives = 256/325 (79%), Gaps = 2/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAY+
Sbjct  19   FGDSLIDNGNNNNLPSFAKANYYPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPAYT  78

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S +Q+  GVNYASAAAGILD TG+ FV R+P   Q+ NF  TL+Q++ NL A  + 
Sbjct  79   --EASGNQVLHGVNYASAAAGILDATGRNFVGRIPFDQQLRNFENTLNQITGNLGADYMA  136

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + +CIFFVG+GSNDYL NYLMP   T   Y  QQYADLL+Q YS  L RLY+LGARKF
Sbjct  137  TALARCIFFVGMGSNDYLNNYLMPNYPTRNQYNGQQYADLLVQTYSQQLTRLYNLGARKF  196

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+GE+GCIP+++A+S  G C +EVN +V PFN N+K M+ NFN  LP A+F++ D+ 
Sbjct  197  VIAGLGEMGCIPSILAQSTTGTCSEEVNLLVQPFNENVKTMLGNFNNNLPGARFIFADSS  256

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF++I+ N+++YGF+VV+RGCCG+G+  G+ITC+PF+TPCPNR +YVFWDA+HPT AVN
Sbjct  257  RMFQDILLNARSYGFAVVNRGCCGIGRNRGQITCLPFQTPCPNRRQYVFWDAFHPTEAVN  316

Query  903  VLVGKMAFSGGSDLVYPINIQQLAR  977
            +L+G+MAF+G  + VYPINI+QLA 
Sbjct  317  ILMGRMAFNGNPNFVYPINIRQLAE  341



>ref|XP_008339092.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At1g71691, 
partial [Malus domestica]
Length=337

 Score =   418 bits (1075),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 200/324 (62%), Positives = 252/324 (78%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNN+L + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PA+S
Sbjct  8    FGDSLIDNGNNNDLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPAHS  67

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQMR GVNYASAAAGILD TG  FV R+P   QI NF  TLDQ++ NL A    
Sbjct  68   --EASGDQMRHGVNYASAAAGILDDTGGNFVGRIPFSEQIRNFQNTLDQITDNLGADDAA  125

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              I KCI+FVG+GSNDYL NYLMP   T   Y  QQYADLL Q+Y+  L RLY+LGARKF
Sbjct  126  RSIAKCIYFVGMGSNDYLNNYLMPNYXTRNQYNAQQYADLLAQEYTQQLTRLYNLGARKF  185

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G +GCIP+++A++ +G C DEVN++V PFN N+K M+ N NT LP +KF+Y+D  
Sbjct  186  VIAGLGRMGCIPSILAQNPSGTCSDEVNRLVLPFNTNVKTMINNLNTNLPGSKFIYVDIA  245

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF +++ NS++YGFS  +RGCCG+G+  G++TC+PF+TPCPNR++Y+FWDA+HPTSAVN
Sbjct  246  RMFEDMLLNSRSYGFSXANRGCCGIGRNRGQVTCLPFQTPCPNRDQYIFWDAFHPTSAVN  305

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +++G+ AFSG    VYP+N QQLA
Sbjct  306  IIIGRKAFSGDRTEVYPMNXQQLA  329



>ref|XP_006582440.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Glycine max]
Length=360

 Score =   419 bits (1076),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 200/325 (62%), Positives = 256/325 (79%), Gaps = 2/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAY+
Sbjct  37   FGDSLIDNGNNNNLPSFAKANYYPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPAYT  96

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S +Q+  GVNYASAAAGILD TG+ FV R+P   Q+ NF  TL+Q++ NL A  + 
Sbjct  97   --EASGNQVLHGVNYASAAAGILDATGRNFVGRIPFDQQLRNFENTLNQITGNLGADYMA  154

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + +CIFFVG+GSNDYL NYLMP   T   Y  QQYADLL+Q YS  L RLY+LGARKF
Sbjct  155  TALARCIFFVGMGSNDYLNNYLMPNYPTRNQYNGQQYADLLVQTYSQQLTRLYNLGARKF  214

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+GE+GCIP+++A+S  G C +EVN +V PFN N+K M+ NFN  LP A+F++ D+ 
Sbjct  215  VIAGLGEMGCIPSILAQSTTGTCSEEVNLLVQPFNENVKTMLGNFNNNLPGARFIFADSS  274

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF++I+ N+++YGF+VV+RGCCG+G+  G+ITC+PF+TPCPNR +YVFWDA+HPT AVN
Sbjct  275  RMFQDILLNARSYGFAVVNRGCCGIGRNRGQITCLPFQTPCPNRRQYVFWDAFHPTEAVN  334

Query  903  VLVGKMAFSGGSDLVYPINIQQLAR  977
            +L+G+MAF+G  + VYPINI+QLA 
Sbjct  335  ILMGRMAFNGNPNFVYPINIRQLAE  359



>ref|XP_002278219.2| PREDICTED: GDSL esterase/lipase At1g71691 [Vitis vinifera]
Length=374

 Score =   418 bits (1074),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 201/330 (61%), Positives = 259/330 (78%), Gaps = 2/330 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I +QLGLPL PAYS
Sbjct  42   FGDSLIDNGNNNNLPSFAKANYFPYGIDFEGGPTGRFSNGYTMVDEIAEQLGLPLTPAYS  101

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S +++  GVN+ASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A  V 
Sbjct  102  --EASGEEVLHGVNFASAAAGILDITGRNFVGRIPFNQQIRNFENTLDQITDNLGADNVA  159

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            E I KCIFFVG+GSNDYL NYLMP  +T   Y  QQ+A+LLIQQY+  L  LY+LGAR+F
Sbjct  160  EAIAKCIFFVGMGSNDYLNNYLMPNYATRNQYNGQQFANLLIQQYNRQLNTLYNLGARRF  219

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            VLAG+G +GCIP+++A+S   +C D+VN ++ PFNAN++ MV   N+ LP AKF+Y+D  
Sbjct  220  VLAGLGIMGCIPSILAQSPTSRCSDDVNHLILPFNANVRAMVNRLNSNLPGAKFIYIDVY  279

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF++I++NS+ YGFSV++RGCCG+G+  G+ITC+PF+TPC NRE+YVFWDA+HPT AVN
Sbjct  280  RMFQDILSNSRNYGFSVINRGCCGIGRNSGQITCLPFQTPCSNREQYVFWDAFHPTEAVN  339

Query  903  VLVGKMAFSGGSDLVYPINIQQLARTETWP  992
            +++G+ AF+G    VYP+NI+QLA  +  P
Sbjct  340  IIMGRKAFNGDKSAVYPMNIEQLANLDLEP  369



>gb|KHG24758.1| hypothetical protein F383_07589 [Gossypium arboreum]
Length=373

 Score =   417 bits (1073),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 204/324 (63%), Positives = 256/324 (79%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNN+L + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAYS
Sbjct  50   FGDSLIDNGNNNDLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPAYS  109

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQ+  GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQL+ NL A    
Sbjct  110  --EASGDQVLHGVNYASAAAGILDITGRNFVGRIPFDQQIQNFQTTLDQLADNLGAIEAA  167

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            E + KCIFFVG+GSNDYL NYLMP   T   Y  QQYADLL+Q+Y+  L+ LY+LGARKF
Sbjct  168  EALGKCIFFVGMGSNDYLNNYLMPNFPTRNQYDGQQYADLLVQKYNQQLRTLYNLGARKF  227

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            VLAG+G +GCIP+++A+S  G C +EVNQ+V PFNAN+K M+ + N  LP A+F+Y+D  
Sbjct  228  VLAGLGRMGCIPSILAQSTAGSCSEEVNQLVLPFNANVKTMMNSLNANLPGARFIYVDIA  287

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
            ++F +I+AN++TYGFSVV+RGCCG+G+  G+ITC+PF+TPC NR+EYVFWDA+HPT  VN
Sbjct  288  HLFEDIVANARTYGFSVVNRGCCGIGRNRGQITCLPFQTPCENRDEYVFWDAFHPTEKVN  347

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +++ + AF+G   +VYPINIQQLA
Sbjct  348  IIMARKAFNGDPSIVYPINIQQLA  371



>gb|EYU28214.1| hypothetical protein MIMGU_mgv1a008192mg [Erythranthe guttata]
Length=381

 Score =   417 bits (1073),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 203/328 (62%), Positives = 254/328 (77%), Gaps = 4/328 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL +LAKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAYS
Sbjct  52   FGDSLIDNGNNNNLASLAKANYFPYGIDFNGGPTGRFSNGYTMVDTIAESLGLPLIPAYS  111

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV--  356
                S DQMR+GVNYASAAAGILD+TG+ FV R+P   QI NF  +LDQ++ ++      
Sbjct  112  EASSSPDQMRYGVNYASAAAGILDITGRNFVSRIPFNQQIKNFENSLDQITNSIVGAPPP  171

Query  357  --VKEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
              V + + KCIFFVG+GSNDYL NYLMP   T   Y  QQYADLL +QYS  L RLY+LG
Sbjct  172  ADVAQALSKCIFFVGMGSNDYLNNYLMPNYDTKNHYNPQQYADLLAEQYSQQLTRLYNLG  231

Query  531  ARKFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVY  710
            ARKFV+AG+G +GCIP+++A++ NG C +EVNQ+V PFN N   ++ N  T LP AKF Y
Sbjct  232  ARKFVIAGLGLMGCIPSILAQNSNGICSEEVNQLVLPFNTNTMSIMNNLTTNLPGAKFSY  291

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
            +D +N+F+++IAN+ +YGF V++RGCCG+G+  G+ITC+PF+TPCP R +Y+FWDA+HPT
Sbjct  292  IDIRNLFQDLIANAGSYGFGVLNRGCCGIGRNRGQITCLPFQTPCPERNQYIFWDAFHPT  351

Query  891  SAVNVLVGKMAFSGGSDLVYPINIQQLA  974
             AVNVL G+ AF+G +  VYPINIQQLA
Sbjct  352  EAVNVLFGQRAFNGSTHFVYPINIQQLA  379



>gb|KHN47078.1| GDSL esterase/lipase [Glycine soja]
Length=358

 Score =   416 bits (1070),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 199/325 (61%), Positives = 256/325 (79%), Gaps = 2/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAY+
Sbjct  35   FGDSLIDNGNNNNLPSFAKANYYPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPAYT  94

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S +Q+  GVNYASAAAGILD TG+ FV R+P   Q++NF  TL+Q++ NL A  + 
Sbjct  95   --EASGNQVLHGVNYASAAAGILDATGRNFVGRIPFDQQLSNFENTLNQITGNLGADYMG  152

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + +CIFFVG+GSNDYL NYLMP   T   Y  QQYADLL+Q YS  L RLY+LGARKF
Sbjct  153  TALARCIFFVGMGSNDYLNNYLMPNYPTRNQYNGQQYADLLVQTYSQQLTRLYNLGARKF  212

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G++GCIP+++A+S  G C  EVN +V PFN N+K M+ NFN  LP A+F++ D+ 
Sbjct  213  VIAGLGQMGCIPSILAQSMTGTCSKEVNLLVKPFNENVKTMLGNFNNNLPGARFIFADSS  272

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF++I+ N+++YGF+VV+RGCCG+G+  G+ITC+PF+TPCPNR +YVFWDA+HPT AVN
Sbjct  273  RMFQDILLNARSYGFTVVNRGCCGIGRNRGQITCLPFQTPCPNRRQYVFWDAFHPTEAVN  332

Query  903  VLVGKMAFSGGSDLVYPINIQQLAR  977
            +L+G+MAF+G  + VYPINI+QLA 
Sbjct  333  ILMGRMAFNGNPNFVYPINIRQLAE  357



>ref|NP_001242345.1| uncharacterized protein LOC100779380 precursor [Glycine max]
 gb|ACU17689.1| unknown [Glycine max]
Length=358

 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 199/325 (61%), Positives = 255/325 (78%), Gaps = 2/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAY+
Sbjct  35   FGDSLIDNGNNNNLPSFAKANYYPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPAYT  94

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S +Q+  GVNYASAAAGILD TG+ FV R+P   Q++NF  TL+Q++ NL A  + 
Sbjct  95   --EASGNQVLHGVNYASAAAGILDATGRNFVGRIPFDQQLSNFENTLNQITGNLGADYMG  152

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
                +CIFFVG+GSNDYL NYLMP   T   Y  QQYADLL+Q YS  L RLY+LGARKF
Sbjct  153  TAPARCIFFVGMGSNDYLNNYLMPNYPTRNQYNGQQYADLLVQTYSQQLTRLYNLGARKF  212

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G++GCIP+++A+S  G C  EVN +V PFN N+K M+ NFN  LP A+F++ D+ 
Sbjct  213  VIAGLGQMGCIPSILAQSMTGTCSKEVNLLVKPFNENVKTMLGNFNNNLPGARFIFADSS  272

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF++I+ N+++YGF+VV+RGCCG+G+  G+ITC+PF+TPCPNR +YVFWDA+HPT AVN
Sbjct  273  RMFQDILLNARSYGFTVVNRGCCGIGRNRGQITCLPFQTPCPNRRQYVFWDAFHPTEAVN  332

Query  903  VLVGKMAFSGGSDLVYPINIQQLAR  977
            +L+G+MAF+G  + VYPINI+QLA 
Sbjct  333  ILMGRMAFNGNPNFVYPINIRQLAE  357



>ref|XP_007148613.1| hypothetical protein PHAVU_005G001100g [Phaseolus vulgaris]
 gb|ESW20607.1| hypothetical protein PHAVU_005G001100g [Phaseolus vulgaris]
Length=359

 Score =   414 bits (1065),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 198/325 (61%), Positives = 255/325 (78%), Gaps = 2/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ +LAKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAYS
Sbjct  36   FGDSLIDNGNNNNIPSLAKANYYPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPAYS  95

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S +Q+  GVNYASAAAGILD TG+ FV R+P   QI NF  TL+Q++ N+    + 
Sbjct  96   --EASGNQVLHGVNYASAAAGILDATGRNFVGRIPFDQQINNFQNTLNQITGNIGPDNMA  153

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + +CIFFVG+GSNDYL NYLMP   T   Y  QQYADLL+Q YS  L RLY+LGARKF
Sbjct  154  TELARCIFFVGMGSNDYLNNYLMPNYPTRNQYNGQQYADLLVQTYSHQLTRLYNLGARKF  213

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G++GCIP+++A+S  G C +EVN +V PFN N+K ++ NFN  LP A+F++ D+ 
Sbjct  214  VIAGLGKMGCIPSILAQSTTGSCSEEVNMLVQPFNENLKTILGNFNANLPGARFIFADSS  273

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF++I+ N+++YGFSVV+RGCCG+G+  G+ITC+PF+TPCPNR +YVFWDA+HPT AVN
Sbjct  274  RMFQDILLNARSYGFSVVNRGCCGIGRNRGQITCLPFQTPCPNRNQYVFWDAFHPTEAVN  333

Query  903  VLVGKMAFSGGSDLVYPINIQQLAR  977
            +L+G+MAF G  + VYPIN++QLA 
Sbjct  334  ILMGRMAFDGNLNFVYPINVRQLAE  358



>ref|XP_006339389.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Solanum tuberosum]
Length=359

 Score =   414 bits (1063),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 199/325 (61%), Positives = 255/325 (78%), Gaps = 2/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I +QLGLPL PA+S
Sbjct  34   FGDSLIDNGNNNNLPSFAKANYYPYGIDFDGGPTGRFSNGYTMVDEIAEQLGLPLIPAHS  93

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                S +QMRFGVNYASAAAGILD TG+ FV R+P   QI NF  TLD+++ NL A  V 
Sbjct  94   EAS-SGEQMRFGVNYASAAAGILDDTGRNFVGRIPFNQQIKNFEDTLDEITDNLGAPDVA  152

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + + KCIFFVG+GSNDYL NYLMP   T   Y  QQYA+LL+QQY+  L RLY+LG RKF
Sbjct  153  QALAKCIFFVGMGSNDYLNNYLMPNYDTKNHYNPQQYANLLVQQYTQQLTRLYNLGGRKF  212

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQM-VTNFNTALPDAKFVYLDT  719
            V+ G+G +GCIP+++A+S +  C +EVN+++ PF  N+K M +TN N  LP +KF+Y+D 
Sbjct  213  VIGGVGLMGCIPSILAKSNSNVCSEEVNELILPFTNNVKSMLLTNLNVNLPGSKFIYIDI  272

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
            +NMF++++ N + YGFSV++RGCCG+G+  G+ITC+P +TPCPNR++Y+FWDA+HPT AV
Sbjct  273  KNMFQDLLTNYRQYGFSVINRGCCGIGRNRGQITCLPMQTPCPNRDQYIFWDAFHPTEAV  332

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N+L  + AF+GG D+VYPINI QLA
Sbjct  333  NILFARKAFNGGPDVVYPINIHQLA  357



>ref|XP_004241911.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Solanum lycopersicum]
Length=365

 Score =   414 bits (1063),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 208/324 (64%), Positives = 255/324 (79%), Gaps = 5/324 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL +LAKANY PYGIDF  GPTGRFSNG T+VD I + LGLPL PAYS
Sbjct  45   FGDSLIDNGNNNNLASLAKANYFPYGIDFNGGPTGRFSNGLTMVDVIAELLGLPLTPAYS  104

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                S DQMRFGVNYASAAAGILD TG+ FV R+P   QITNF  TL+QL  N     V+
Sbjct  105  --QVSGDQMRFGVNYASAAAGILDNTGRNFVGRIPFNQQITNFESTLNQLRNNGD---VE  159

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            E + K IFFVG+GSNDYL NYLMP  +T   Y  Q+YA LL QQY+  L RLY+LGARKF
Sbjct  160  EALAKSIFFVGMGSNDYLNNYLMPNYNTKNQYNPQEYATLLTQQYNQQLIRLYNLGARKF  219

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+ G+G +GCIP+++A+S+NG C +EVNQ+V PF+ N++ M+T+ NT  P  KF Y+D +
Sbjct  220  VIGGVGLMGCIPSILAQSQNGACSEEVNQLVLPFHNNVRSMLTSLNTNFPGFKFSYIDIR  279

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
            NMF++++ANS+ YGFS V+ GCCGVG+  G+ITC+PF+TPC NRE+Y+FWDA+HPT AVN
Sbjct  280  NMFQDLLANSRHYGFSEVNLGCCGVGRNRGQITCLPFQTPCSNREQYIFWDAFHPTEAVN  339

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            VL G+ AFSGG D+VYP+NIQQLA
Sbjct  340  VLFGRKAFSGGPDVVYPMNIQQLA  363



>ref|XP_011031552.1| PREDICTED: GDSL esterase/lipase At1g71691-like isoform X2 [Populus 
euphratica]
Length=360

 Score =   413 bits (1062),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 206/328 (63%), Positives = 254/328 (77%), Gaps = 3/328 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I +QLGLPL PAYS
Sbjct  31   FGDSLIDNGNNNNLPSFAKANYLPYGIDFNGGPTGRFSNGYTMVDEIAEQLGLPLIPAYS  90

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQ+  GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A  V 
Sbjct  91   --EASGDQVLNGVNYASAAAGILDITGRNFVGRIPFDQQIRNFHNTLDQITNNLGADDVA  148

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + + IFFVG+GSNDYL NYLMP   T   Y  +QYADLL Q+YS  L  LY+LGARKF
Sbjct  149  RQVGRSIFFVGMGSNDYLNNYLMPNYPTRNQYNGRQYADLLTQEYSRQLTTLYNLGARKF  208

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNT-ALPDAKFVYLDT  719
            V+AG+G +GCIP+++A+S  G C D VNQ+V PFN N+K M++NFN   LP AKF+++D 
Sbjct  209  VIAGLGVMGCIPSILAQSPAGICSDSVNQLVQPFNENVKAMLSNFNANQLPGAKFIFIDV  268

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
              MFR I+ NS  YGFSV++RGCCG+G+  G+ITC+PF+TPCPNRE+YVFWDA+HPT AV
Sbjct  269  ARMFREILTNSPAYGFSVINRGCCGIGRNRGQITCLPFQTPCPNREQYVFWDAFHPTEAV  328

Query  900  NVLVGKMAFSGGSDLVYPINIQQLARTE  983
            NVL+G+ AF+G   +VYP+NI+QLA  +
Sbjct  329  NVLMGRKAFNGDLSMVYPMNIEQLANLD  356



>ref|XP_011031551.1| PREDICTED: GDSL esterase/lipase At1g71691-like isoform X1 [Populus 
euphratica]
Length=373

 Score =   413 bits (1062),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 206/328 (63%), Positives = 254/328 (77%), Gaps = 3/328 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I +QLGLPL PAYS
Sbjct  44   FGDSLIDNGNNNNLPSFAKANYLPYGIDFNGGPTGRFSNGYTMVDEIAEQLGLPLIPAYS  103

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQ+  GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A  V 
Sbjct  104  --EASGDQVLNGVNYASAAAGILDITGRNFVGRIPFDQQIRNFHNTLDQITNNLGADDVA  161

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + + IFFVG+GSNDYL NYLMP   T   Y  +QYADLL Q+YS  L  LY+LGARKF
Sbjct  162  RQVGRSIFFVGMGSNDYLNNYLMPNYPTRNQYNGRQYADLLTQEYSRQLTTLYNLGARKF  221

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNT-ALPDAKFVYLDT  719
            V+AG+G +GCIP+++A+S  G C D VNQ+V PFN N+K M++NFN   LP AKF+++D 
Sbjct  222  VIAGLGVMGCIPSILAQSPAGICSDSVNQLVQPFNENVKAMLSNFNANQLPGAKFIFIDV  281

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
              MFR I+ NS  YGFSV++RGCCG+G+  G+ITC+PF+TPCPNRE+YVFWDA+HPT AV
Sbjct  282  ARMFREILTNSPAYGFSVINRGCCGIGRNRGQITCLPFQTPCPNREQYVFWDAFHPTEAV  341

Query  900  NVLVGKMAFSGGSDLVYPINIQQLARTE  983
            NVL+G+ AF+G   +VYP+NI+QLA  +
Sbjct  342  NVLMGRKAFNGDLSMVYPMNIEQLANLD  369



>ref|XP_010265554.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nelumbo nucifera]
Length=382

 Score =   413 bits (1061),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 202/327 (62%), Positives = 250/327 (76%), Gaps = 2/327 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  G TGRFSNGYT+VD I + LGLPL PAYS
Sbjct  54   FGDSLIDNGNNNNLPSFAKANYYPYGIDFQGGATGRFSNGYTMVDEIAELLGLPLIPAYS  113

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S ++M  GVNYASAAAGILD+TG+ FV R+P   QI N+  TLDQ++ NL A    
Sbjct  114  --EASGEEMLHGVNYASAAAGILDITGRNFVGRIPFNQQIRNYENTLDQITDNLGADDAA  171

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              I +CIFFVG+GSNDYL NYLMP   T   Y+ QQ+ADLL+QQY+  L RLY+LGARKF
Sbjct  172  RSIARCIFFVGMGSNDYLNNYLMPNYPTQNQYSSQQFADLLVQQYTTQLTRLYNLGARKF  231

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G +GCIP ++A+ +NG+C D VNQ+V PFN+N+K M+ N N  LP AKF+Y+D  
Sbjct  232  VVAGLGLMGCIPNILAQDQNGRCSDTVNQLVLPFNSNVKTMINNLNADLPGAKFIYIDVY  291

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF +I+     YGFSV+DRGCCGVG+  G+ITC+PFETPC NR +YVFWDA+HPT  VN
Sbjct  292  RMFYDILTRPTNYGFSVIDRGCCGVGRNSGQITCLPFETPCSNRNQYVFWDAFHPTERVN  351

Query  903  VLVGKMAFSGGSDLVYPINIQQLARTE  983
            V++G+ +FSG S  VYP+NIQQLA  +
Sbjct  352  VIMGRESFSGNSKYVYPMNIQQLANLD  378



>ref|XP_006356515.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Solanum tuberosum]
Length=368

 Score =   412 bits (1059),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 204/324 (63%), Positives = 255/324 (79%), Gaps = 3/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL +LAKANY PYGIDF  GPTGRFSNG T+VD   + LGLPL P YS
Sbjct  46   FGDSLIDNGNNNNLASLAKANYLPYGIDFNGGPTGRFSNGLTMVDVFAELLGLPLTPPYS  105

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                S DQMRFG+NYASAAAGILD TG+ FV R+P   QITNF  TL+QL  N  A  V+
Sbjct  106  --QASGDQMRFGINYASAAAGILDNTGRNFVGRIPFNQQITNFESTLNQLR-NTGAGDVE  162

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            E + K IFFVG+GSNDYL NYLMP  +T   Y  Q+YA LL QQY+  L RLY+LGARKF
Sbjct  163  EALAKSIFFVGMGSNDYLNNYLMPNYNTKNQYNPQEYATLLTQQYNQQLIRLYNLGARKF  222

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+ G+G +GCIP+++A+S+NG C +EVNQ+V PF+ N++ M+T+ N+ LP  +F Y+D +
Sbjct  223  VIGGVGLMGCIPSILAQSQNGACSEEVNQLVLPFHNNVRSMLTSLNSNLPGFRFSYIDIR  282

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
            NMF++++ANS+ YGFS V+ GCCGVG+  G+ITC+PF+TPC NRE+Y+FWDA+HPT AVN
Sbjct  283  NMFQDLLANSRQYGFSEVNLGCCGVGRNRGQITCLPFQTPCSNREQYIFWDAFHPTEAVN  342

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +L G+ AFSGG D+VYP+NIQQLA
Sbjct  343  ILFGRKAFSGGPDVVYPMNIQQLA  366



>emb|CDP18864.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   409 bits (1052),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 198/325 (61%), Positives = 252/325 (78%), Gaps = 2/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL P +S
Sbjct  4    FGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPPFS  63

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQ+R+GVNYASAAAGILD TG+ FV R+P   QI NF  TLDQ++ +L A  V 
Sbjct  64   --EASGDQVRYGVNYASAAAGILDETGRNFVGRIPFNQQIRNFENTLDQITNSLGAPDVA  121

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + + +CIFFVG+GSNDYL NYLMP  +T   Y  QQ+ADLL  QY+  L RLY+LGARKF
Sbjct  122  QALSRCIFFVGMGSNDYLNNYLMPNYNTKNQYNAQQFADLLTSQYAQQLTRLYNLGARKF  181

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AGIG +GCIP+++A+S  G C + VNQ+V PF+ N K M+   +T LP ++F Y+D +
Sbjct  182  VIAGIGLMGCIPSILAQSGAGLCSEPVNQLVVPFSTNSKAMINKLSTNLPGSRFAYIDVR  241

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
            NMF++++ N  +YGF +V+RGCCG+G+  G+ITC+PF+ PCP R+ Y+FWDA+HPT+AVN
Sbjct  242  NMFQDLLTNHDSYGFDIVNRGCCGIGRNRGQITCLPFQVPCPERDRYIFWDAFHPTAAVN  301

Query  903  VLVGKMAFSGGSDLVYPINIQQLAR  977
            +L GK AFSGG  LVYPINI+QLAR
Sbjct  302  ILFGKSAFSGGPQLVYPINIEQLAR  326



>ref|XP_003598045.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES68296.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=357

 Score =   410 bits (1055),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 196/325 (60%), Positives = 255/325 (78%), Gaps = 2/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ +LAKANY PYGIDF  GPTGRFSNGYTIVD I + LGLPL PAY+
Sbjct  34   FGDSLIDNGNNNNMASLAKANYFPYGIDFNGGPTGRFSNGYTIVDEIAELLGLPLIPAYN  93

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                + DQM  GVNYASAAAGILD TG+ FV R+P   Q+ NF  TL+QL+ NL A  + 
Sbjct  94   --GATGDQMLHGVNYASAAAGILDDTGRNFVGRIPFDEQLRNFENTLNQLTGNLGADNMA  151

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + +CIFFVG+GSNDYL NYLMP  +T   Y  QQYADLL+Q Y+  L RLY+LGARKF
Sbjct  152  TQLSRCIFFVGMGSNDYLNNYLMPNYNTKNQYNGQQYADLLVQTYNHQLTRLYNLGARKF  211

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G LGC P+++++S +G C ++VN +V PFN N+K M++N N  LP ++F+++D+ 
Sbjct  212  VIAGLGLLGCTPSILSQSMSGSCSEQVNMLVQPFNENVKVMLSNLNNNLPGSRFIFIDSS  271

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF+ I+ N+++YGF+ V+RGCCG+G+  G+ITC+PF+TPCPNR  YVFWDA+HPT AVN
Sbjct  272  RMFQEILFNARSYGFTDVNRGCCGLGRNRGQITCLPFQTPCPNRNRYVFWDAFHPTEAVN  331

Query  903  VLVGKMAFSGGSDLVYPINIQQLAR  977
            +L+G+MAF+G ++ VYPINI QLA+
Sbjct  332  ILMGRMAFNGNTNFVYPINIHQLAQ  356



>ref|XP_006441600.1| hypothetical protein CICLE_v10024521mg [Citrus clementina]
 gb|ESR54840.1| hypothetical protein CICLE_v10024521mg [Citrus clementina]
Length=331

 Score =   408 bits (1049),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 198/324 (61%), Positives = 250/324 (77%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFS+GYT+VD I + LGLPL PAYS
Sbjct  8    FGDSLIDNGNNNNLPSFAKANYYPYGIDFNGGPTGRFSSGYTMVDEIAELLGLPLIPAYS  67

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S  Q+  GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A  V 
Sbjct  68   --EASGAQVLHGVNYASAAAGILDITGRNFVGRIPFDQQIRNFQNTLDQVTDNLGASDVS  125

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              I +CIFFVG+GSNDYL NYLMP  +T   Y  QQYADLL+ +YS  L  LY+LGARKF
Sbjct  126  NAIARCIFFVGMGSNDYLNNYLMPNYNTKNQYNAQQYADLLVSEYSRQLTTLYNLGARKF  185

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            VLAG+G +GCIP ++A+++  +C +EVNQ+V PFNAN+K ++ N N  LP A+F ++D  
Sbjct  186  VLAGLGRIGCIPRILAQNQMDRCSEEVNQLVMPFNANVKTVINNLNANLPGARFTFIDIA  245

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF +++ N ++YGFSV+DRGCCG+G+  G+ITC+PF+TPC NRE+YVFWDA+HPT AVN
Sbjct  246  RMFEDLLTNYRSYGFSVIDRGCCGIGRNGGQITCLPFQTPCANREQYVFWDAFHPTEAVN  305

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            ++ G+ AF G   +VYP+NIQQLA
Sbjct  306  IMFGRKAFYGDQSVVYPMNIQQLA  329



>ref|XP_010100104.1| GDSL esterase/lipase [Morus notabilis]
 gb|EXB81487.1| GDSL esterase/lipase [Morus notabilis]
Length=449

 Score =   412 bits (1060),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 201/328 (61%), Positives = 249/328 (76%), Gaps = 2/328 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYTIVD I   LGLPL P YS
Sbjct  121  FGDSLIDNGNNNNLASFAKANYFPYGIDFNGGPTGRFSNGYTIVDEIADLLGLPLIPPYS  180

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              D S DQ   GVNYASAAAGILD TG+ FV R+P   QI NF  TLDQ++ NL A  V 
Sbjct  181  --DASGDQALHGVNYASAAAGILDNTGRNFVGRIPFNQQIKNFENTLDQITGNLEADDVA  238

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + +CIFFVG+GSNDYL NYLMP   T   Y  QQYA+LL+QQY+  L RLY+LGARKF
Sbjct  239  RDLARCIFFVGMGSNDYLNNYLMPNYPTRNQYNPQQYANLLVQQYTQQLTRLYNLGARKF  298

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
             +AG+G +GCIP+++A+S  G C  EVNQ+V PFNAN+K M+ N N  LP +KF+++D  
Sbjct  299  AIAGLGLMGCIPSILAQSSTGSCSQEVNQLVMPFNANVKTMLNNLNANLPGSKFIFVDIA  358

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF++I+ NS++YGF V++RGCCG+G+  G+ITC+PF+TPC NR+EYVFWDA+HPT+AVN
Sbjct  359  RMFQDILTNSRSYGFGVINRGCCGIGRNRGQITCLPFQTPCQNRQEYVFWDAFHPTAAVN  418

Query  903  VLVGKMAFSGGSDLVYPINIQQLARTET  986
            +++G+ A  G   + YPINI+QLA  E 
Sbjct  419  IIMGREAVRGNLRVAYPINIEQLANLEV  446


 Score = 70.5 bits (171),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGL  161
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYTIVD I    G+
Sbjct  46   FGDSLIDNGNNNNLASFAKANYFPYGIDFNGGPTGRFSNGYTIVDEIALAAGV  98



>ref|XP_002325955.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEF00337.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=373

 Score =   410 bits (1053),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 205/328 (63%), Positives = 253/328 (77%), Gaps = 3/328 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I +QLGLPL PAYS
Sbjct  44   FGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAEQLGLPLIPAYS  103

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQ+  GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A  V 
Sbjct  104  --EASGDQVLNGVNYASAAAGILDITGRNFVGRIPFDQQIRNFQNTLDQITNNLGADDVA  161

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + + IFFVG+GSNDYL NYLMP   T   Y  +QYADLL Q+YS  L  LY+LGARKF
Sbjct  162  RQVGRSIFFVGMGSNDYLNNYLMPNYPTRNQYNGRQYADLLTQEYSRQLTSLYNLGARKF  221

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNT-ALPDAKFVYLDT  719
            V+AG+G +GCIP+++A+S  G C D VNQ+V PFN N+K M++NFN   LP AK +++D 
Sbjct  222  VIAGLGVMGCIPSILAQSPAGICSDSVNQLVQPFNENVKAMLSNFNANQLPGAKSIFIDV  281

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
              MFR I+ NS  YGFSV++RGCCG+G+  G+ITC+PF+TPCPNRE+YVFWDA+HPT AV
Sbjct  282  ARMFREILTNSPAYGFSVINRGCCGIGRNRGQITCLPFQTPCPNREQYVFWDAFHPTEAV  341

Query  900  NVLVGKMAFSGGSDLVYPINIQQLARTE  983
            NVL+G+ AF+G   +VYP+NI+QLA  +
Sbjct  342  NVLMGRKAFNGDLSMVYPMNIEQLANLD  369



>ref|XP_006376145.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|ERP53942.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=373

 Score =   409 bits (1050),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 202/328 (62%), Positives = 253/328 (77%), Gaps = 3/328 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I +QLGLPL PAYS
Sbjct  44   FGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAEQLGLPLIPAYS  103

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQ+  G+NYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++  L A  V 
Sbjct  104  --EASGDQVLNGINYASAAAGILDVTGRNFVGRIPFDEQIRNFQNTLDQITDTLGADDVA  161

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + + +FFVG+GSNDYL NYLMP   T   Y  +Q+ADLL Q+YS  L +LY+LGARKF
Sbjct  162  RQVGRSLFFVGMGSNDYLNNYLMPNYPTRNRYNGRQFADLLTQEYSRQLTKLYNLGARKF  221

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNT-ALPDAKFVYLDT  719
            V+AG+G +GCIP+++A+S  G C D VN++V PFN N+K M+ NFN   LP AKF+++D 
Sbjct  222  VIAGLGVMGCIPSILAQSPAGNCSDSVNKLVQPFNENVKAMLKNFNANQLPGAKFIFIDV  281

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
             +MFR I+ NS  YGFSV++RGCCG+G+  G+ITC+PF+TPCPNRE+YVFWDA+HPT AV
Sbjct  282  AHMFREILTNSPAYGFSVINRGCCGIGRNRGQITCLPFQTPCPNREQYVFWDAFHPTEAV  341

Query  900  NVLVGKMAFSGGSDLVYPINIQQLARTE  983
            NVL+G+ AF+G    VYP+NI+QLA  E
Sbjct  342  NVLMGRKAFNGDLSKVYPMNIEQLANLE  369



>ref|XP_009631479.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nicotiana tomentosiformis]
Length=409

 Score =   409 bits (1052),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 208/325 (64%), Positives = 255/325 (78%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLIDSGNNN L + AKANY PYGIDF  GPTGRFSNGYTI+D IG  LGLPL P YS
Sbjct  83   FGDSLIDSGNNNRLFSFAKANYFPYGIDFG-GPTGRFSNGYTILDQIGDLLGLPLLPPYS  141

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                ++D+MRFGVNYASAAAGILD+TG  FVER+P   QI NF  TL  L  N+SA +V+
Sbjct  142  EIF-NVDKMRFGVNYASAAAGILDITGFHFVERIPFSYQIKNFESTLVSLVKNMSAPIVE  200

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            E IPKCIFFVG+GSNDYL NY+MP   T   YT Q++A+LL+ QY   L +LYDLGARKF
Sbjct  201  EAIPKCIFFVGMGSNDYLNNYIMPAYFTQDEYTPQKFAELLVHQYKEQLIKLYDLGARKF  260

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFN-TALPDAKFVYLDT  719
            ++AGIG++GCIP ++A S NG+C + VNQ+V PFNA +K M+   N + LP A F++LD 
Sbjct  261  IIAGIGQMGCIPFLLAESSNGECSEMVNQMVRPFNAKLKTMIMKLNKSELPGAHFIFLDM  320

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
            +NMF++I  N K+YGFSV +RGCCG GK  GE+TC+P +TPCPNR++Y+FWDAYHPTSAV
Sbjct  321  ENMFKDIFINYKSYGFSVKNRGCCGSGKNKGEVTCLPMQTPCPNRDDYLFWDAYHPTSAV  380

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N+L+G MAF GGS+  +P+NIQQLA
Sbjct  381  NLLLGDMAFYGGSNFTFPMNIQQLA  405



>gb|EPS67957.1| hypothetical protein M569_06816 [Genlisea aurea]
Length=369

 Score =   407 bits (1046),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 198/325 (61%), Positives = 246/325 (76%), Gaps = 1/325 (0%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL +LAKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAYS
Sbjct  43   FGDSLIDNGNNNNLASLAKANYFPYGIDFRGGPTGRFSNGYTMVDTIAELLGLPLIPAYS  102

Query  183  -TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVV  359
               + S  QMR+GVN+ASAAAGILD TG  FV R+P   QI NF  +LDQL+       +
Sbjct  103  QAAESSTAQMRYGVNFASAAAGILDNTGNNFVGRIPFNQQIKNFENSLDQLATLTGNADL  162

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
             +G+ K IFFVG+GSNDYL NYLMP   T   Y  QQYADLL+ QY+  L RLY+LGAR+
Sbjct  163  SQGLSKSIFFVGMGSNDYLNNYLMPNYDTKNQYNPQQYADLLVHQYTQQLTRLYNLGARR  222

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            F +AG+G +GCIP+++A+S    C D+VNQ+V+PFN N+K MV N    LP  KF Y+D 
Sbjct  223  FAIAGLGRMGCIPSILAQSGANTCSDQVNQLVEPFNNNVKMMVENLGAKLPGVKFSYIDI  282

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
             NMF++++AN+  YGF+V++RGCCG+G+  G++TC+PF+TPC +R  YVFWDA+HPT AV
Sbjct  283  NNMFQDLVANAPAYGFTVLNRGCCGLGRNRGQVTCLPFQTPCADRNRYVFWDAFHPTEAV  342

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            NVL G+ AFSG +D  YPINIQQLA
Sbjct  343  NVLFGQKAFSGETDFAYPINIQQLA  367



>ref|XP_009802347.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nicotiana sylvestris]
Length=409

 Score =   409 bits (1050),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 207/325 (64%), Positives = 253/325 (78%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLIDSGNNN L + AKANY PYGIDF  GPTGRFSN YTI+D IG  LGLPL P YS
Sbjct  85   FGDSLIDSGNNNRLFSFAKANYLPYGIDFG-GPTGRFSNAYTILDQIGDLLGLPLLPPYS  143

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                ++D+MRFGVNYASAAAGILD+TG  FVER+P   QI NF  TL  L  N+SA +V+
Sbjct  144  KIF-NVDKMRFGVNYASAAAGILDITGFHFVERIPFSYQIKNFENTLVSLIKNMSAPIVE  202

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            E IPKCIFFVG+GSNDYL NY+MP   T   YT Q++A+LL+ QY   L +LYDLGARKF
Sbjct  203  EAIPKCIFFVGMGSNDYLNNYIMPAYFTQDEYTPQKFAELLVHQYKEQLIKLYDLGARKF  262

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFN-TALPDAKFVYLDT  719
            ++AGIG++GCIP ++A S NG+C + VNQ+V PFNA +K M+   N + LP A F++LD 
Sbjct  263  IIAGIGQMGCIPFLLAESSNGECSEIVNQMVHPFNAKLKTMIMKLNKSELPGAHFIFLDM  322

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
            +NMF++I  N K+YGFSV DRGCCG GK  GE+TC+P +TPCPNR++Y+FWDAYHPTSAV
Sbjct  323  ENMFKDIFTNYKSYGFSVTDRGCCGSGKNKGEVTCLPMQTPCPNRDDYLFWDAYHPTSAV  382

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N+L+G MAF GG +  +P+NIQQLA
Sbjct  383  NLLLGDMAFYGGPNFTFPMNIQQLA  407



>ref|XP_009761478.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nicotiana sylvestris]
Length=406

 Score =   408 bits (1049),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 207/325 (64%), Positives = 251/325 (77%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLIDSGNNN L + AKANY PYGIDF  GPTGRFSN YTI+D IG  LGLPL P YS
Sbjct  82   FGDSLIDSGNNNRLFSFAKANYLPYGIDFG-GPTGRFSNAYTILDQIGDLLGLPLLPPYS  140

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                ++D+MRFGVNYASAAAGILD+TG  FVER+P   QI NF  TL  L  N+SA +V+
Sbjct  141  EIF-NVDKMRFGVNYASAAAGILDITGFHFVERIPFSYQIKNFENTLVSLIKNMSAPIVE  199

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            E IPKCIFFVG+GSNDYL NY+MP   T   YT Q+YA+LL+ QY   L +LYDLGARKF
Sbjct  200  EAIPKCIFFVGMGSNDYLNNYIMPAYFTQDEYTPQKYAELLVHQYKEQLIKLYDLGARKF  259

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFN-TALPDAKFVYLDT  719
            ++AGIG++GCIP ++A S NG+C + VNQ+V PFNA +K M    N + LP   F++LD 
Sbjct  260  IIAGIGQMGCIPFLLAESSNGECSEMVNQMVHPFNAKLKTMTMKLNKSELPGGHFIFLDM  319

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
            +NMF++I  N K+YGFSV DRGCCG GK  GE+TC+P +TPCPNR++Y+FWDAYHPTSAV
Sbjct  320  ENMFKDIFTNYKSYGFSVTDRGCCGSGKNKGEVTCLPMQTPCPNRDDYLFWDAYHPTSAV  379

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N+L+G MAF GG +  +P+NIQQLA
Sbjct  380  NLLLGDMAFYGGPNFTFPMNIQQLA  404



>ref|XP_006478220.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Citrus sinensis]
Length=377

 Score =   407 bits (1046),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 199/324 (61%), Positives = 248/324 (77%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAYS
Sbjct  54   FGDSLIDNGNNNNLPSFAKANYYPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPAYS  113

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S  Q+  GVNYASAAAGILD+TG+ FV  +P   QI NF  TLDQ++ NL A  V 
Sbjct  114  --EASGAQVLHGVNYASAAAGILDITGRNFVGCIPFDQQIRNFQNTLDQVTDNLGASDVS  171

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              I +CIFFVG+GSNDYL NYLMP  +T   Y  QQYADLL+ +YS  L  LY+LGARKF
Sbjct  172  NAIARCIFFVGMGSNDYLNNYLMPNYNTKNQYNAQQYADLLVSEYSRQLTTLYNLGARKF  231

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            VLAG+G +GCIP ++A+ +  +C +EVNQ+V PFNAN+K M+ N N  LP A+F ++D  
Sbjct  232  VLAGLGRMGCIPRILAQYQMDRCSEEVNQLVMPFNANVKTMINNLNANLPGARFTFIDIA  291

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF +++ N ++YGFSV+DRGCCG+G+  G+ITC+PF+TPC NRE+YVFWDA+HPT AVN
Sbjct  292  RMFEDLLTNYRSYGFSVIDRGCCGIGRNGGQITCLPFQTPCANREQYVFWDAFHPTEAVN  351

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            ++ G+ AF G   +VYP+NIQQLA
Sbjct  352  IMFGRKAFYGDQSVVYPMNIQQLA  375



>ref|XP_008219080.1| PREDICTED: GDSL esterase/lipase At1g71691 [Prunus mume]
Length=389

 Score =   407 bits (1047),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 194/324 (60%), Positives = 253/324 (78%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL P +S
Sbjct  60   FGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPPFS  119

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQ+  GVNYASAAAGILD+TG+ FV R+P   QI+NF  TLDQ++ NL A  V 
Sbjct  120  --EASGDQVLHGVNYASAAAGILDITGRNFVGRIPFGEQISNFQSTLDQITDNLGADDVA  177

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              I  CIFFVG+GSNDYL NYLMP   T   Y   Q+ADLL QQY+  L RLY+LGARKF
Sbjct  178  RAIADCIFFVGMGSNDYLNNYLMPNYPTRTQYNAPQFADLLTQQYTQQLTRLYNLGARKF  237

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G +GCIP+++A+S +G+C +EVN++V PFNAN+K M+   NT LP AKF+Y+D  
Sbjct  238  VVAGLGRMGCIPSILAQSPSGRCNEEVNRLVLPFNANVKTMINKLNTNLPGAKFIYIDIA  297

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             +F +I+ N+++YGF+V +RGCCG+G+  G+ITC+P +TPCPNR++Y+FWDA+HPT+A N
Sbjct  298  RIFEDIVNNARSYGFTVANRGCCGIGRNRGQITCLPLQTPCPNRDQYIFWDAFHPTAAAN  357

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +++G+ AF+G    VYP+NIQ+LA
Sbjct  358  IIIGRKAFNGDLSQVYPVNIQKLA  381



>ref|XP_009333996.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Pyrus x bretschneideri]
Length=391

 Score =   406 bits (1043),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 198/324 (61%), Positives = 248/324 (77%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNN+L + AKANY PYGIDF  GPTGRFSNGYT+VD I   LGLPL PA+S
Sbjct  62   FGDSLIDNGNNNDLPSFAKANYFPYGIDFNCGPTGRFSNGYTMVDEIADLLGLPLIPAHS  121

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQM  GVNYASAAAGI D TG+ FV R+P   QI NF  TLDQ++ NL A    
Sbjct  122  --EASGDQMLHGVNYASAAAGIFDATGRNFVGRIPFGQQIRNFQNTLDQITDNLGADDAA  179

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              I KCIFFVG+GSNDYL NYLMP   T   Y  QQYADLL Q+Y+  L RLY+LGARKF
Sbjct  180  RSIAKCIFFVGMGSNDYLNNYLMPNYPTMNHYNAQQYADLLAQEYTRQLTRLYNLGARKF  239

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G LGCIP+++AR+ +G C DEVN +V PFNAN+K M+ N NT LP +KF+Y+D  
Sbjct  240  VIAGLGRLGCIPSILARNPSGTCSDEVNCLVLPFNANVKTMINNQNTNLPGSKFIYIDIA  299

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF +++ + +TYGF V +RGCCG+G+  G++TC+P +TPC NR++Y+FWDA+HPT+AVN
Sbjct  300  RMFEDMLLDPRTYGFIVANRGCCGLGRNRGQVTCLPLQTPCRNRDQYIFWDAFHPTAAVN  359

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +++G+ AF+G    VYP+NIQQLA
Sbjct  360  IIIGRKAFTGDRTEVYPMNIQQLA  383



>ref|XP_007223318.1| hypothetical protein PRUPE_ppa007324mg [Prunus persica]
 gb|EMJ24517.1| hypothetical protein PRUPE_ppa007324mg [Prunus persica]
Length=373

 Score =   405 bits (1041),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 194/324 (60%), Positives = 252/324 (78%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL P +S
Sbjct  44   FGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPPFS  103

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQ+  GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A  V 
Sbjct  104  --EASGDQVLHGVNYASAAAGILDITGRNFVGRIPFGEQIRNFQSTLDQITDNLGADDVA  161

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              I  CIFFVG+GSNDYL NYLMP   T   Y   Q+ADLL QQY+  L RLY+LGARKF
Sbjct  162  GAIADCIFFVGMGSNDYLNNYLMPNYPTRTQYNAPQFADLLTQQYTQQLTRLYNLGARKF  221

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G +GCIP+++A+S +G+C +EVN++V PFNAN+K M+   NT LP AKF+Y+D  
Sbjct  222  VVAGLGRMGCIPSILAQSPSGRCNEEVNRLVLPFNANVKTMINKLNTNLPGAKFIYIDIA  281

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             +F +I+ N+++YGF+V +RGCCG+G+  G+ITC+P +TPCPNR++Y+FWDA+HPT+A N
Sbjct  282  RIFEDIVNNARSYGFTVANRGCCGIGRNRGQITCLPLQTPCPNRDQYIFWDAFHPTAAAN  341

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +++G+ AF+G    VYP+NIQ+LA
Sbjct  342  IIIGRKAFNGDLSQVYPMNIQKLA  365



>ref|XP_011005437.1| PREDICTED: GDSL esterase/lipase At1g71691-like isoform X2 [Populus 
euphratica]
Length=360

 Score =   403 bits (1035),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 200/328 (61%), Positives = 250/328 (76%), Gaps = 3/328 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I +QLGLPL PAYS
Sbjct  31   FGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAEQLGLPLIPAYS  90

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQ+   +NYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++  L A  V 
Sbjct  91   --EASGDQVLNAINYASAAAGILDVTGRNFVGRIPFDEQIRNFQNTLDQITDTLGADDVA  148

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + + +FFVG+GSNDYL NYLMP   T   Y  +Q+ADLL Q+YS  L +LY+LGARKF
Sbjct  149  RQVLRSLFFVGMGSNDYLNNYLMPNYPTRNRYNGRQFADLLTQEYSRQLTKLYNLGARKF  208

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNT-ALPDAKFVYLDT  719
            V+AG+G +GCIP+++A+S  G C D VN++V PFN N+K M+ NFN   L  AKF+++D 
Sbjct  209  VIAGLGVMGCIPSILAQSPAGNCSDSVNKLVQPFNENVKAMLKNFNANQLSGAKFIFIDV  268

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
              MFR I+ NS  YGFSV++RGCCG+G+  G+ITC+PF+TPCPNRE+YVFWDA+HPT AV
Sbjct  269  AQMFREILTNSPAYGFSVINRGCCGIGRNRGQITCLPFQTPCPNREQYVFWDAFHPTEAV  328

Query  900  NVLVGKMAFSGGSDLVYPINIQQLARTE  983
            NVL+G+ AF+G    VYP+NI+QLA  E
Sbjct  329  NVLMGRKAFNGDLSKVYPMNIEQLANLE  356



>ref|XP_011005436.1| PREDICTED: GDSL esterase/lipase At1g71691-like isoform X1 [Populus 
euphratica]
Length=373

 Score =   403 bits (1035),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 200/328 (61%), Positives = 250/328 (76%), Gaps = 3/328 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I +QLGLPL PAYS
Sbjct  44   FGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAEQLGLPLIPAYS  103

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQ+   +NYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++  L A  V 
Sbjct  104  --EASGDQVLNAINYASAAAGILDVTGRNFVGRIPFDEQIRNFQNTLDQITDTLGADDVA  161

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + + +FFVG+GSNDYL NYLMP   T   Y  +Q+ADLL Q+YS  L +LY+LGARKF
Sbjct  162  RQVLRSLFFVGMGSNDYLNNYLMPNYPTRNRYNGRQFADLLTQEYSRQLTKLYNLGARKF  221

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNT-ALPDAKFVYLDT  719
            V+AG+G +GCIP+++A+S  G C D VN++V PFN N+K M+ NFN   L  AKF+++D 
Sbjct  222  VIAGLGVMGCIPSILAQSPAGNCSDSVNKLVQPFNENVKAMLKNFNANQLSGAKFIFIDV  281

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
              MFR I+ NS  YGFSV++RGCCG+G+  G+ITC+PF+TPCPNRE+YVFWDA+HPT AV
Sbjct  282  AQMFREILTNSPAYGFSVINRGCCGIGRNRGQITCLPFQTPCPNREQYVFWDAFHPTEAV  341

Query  900  NVLVGKMAFSGGSDLVYPINIQQLARTE  983
            NVL+G+ AF+G    VYP+NI+QLA  E
Sbjct  342  NVLMGRKAFNGDLSKVYPMNIEQLANLE  369



>ref|XP_004158530.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Cucumis sativus]
Length=331

 Score =   400 bits (1028),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 194/324 (60%), Positives = 246/324 (76%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PA+S
Sbjct  8    FGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLVPAFS  67

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                S  Q   GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ+S NL A  V 
Sbjct  68   --QVSGPQSLHGVNYASAAAGILDVTGRNFVSRIPFNQQIRNFENTLDQISNNLGAANVG  125

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + I +CIFFVG+GSNDYL NYLMP   T   Y  QQYADLL+ QY   L RLY+LG R+F
Sbjct  126  QSIGRCIFFVGMGSNDYLNNYLMPNYPTRNQYNAQQYADLLVSQYMQQLTRLYNLGGRRF  185

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G +GCIP+++A+S +G C +EVNQ+V PFN N+K M+   N  LP A+F Y+D +
Sbjct  186  VIAGLGLMGCIPSILAQSPSGSCSEEVNQLVRPFNVNVKSMINQLNNNLPGARFSYIDIE  245

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF++++ NS+ YG SV++RGCCG+G+  G+ITC+PF+TPC NR++Y+FWDA+HPT AVN
Sbjct  246  RMFQDLLVNSRFYGLSVLNRGCCGIGRNRGQITCLPFQTPCTNRDQYIFWDAFHPTEAVN  305

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +L+ + AF+G   ++ P NIQQLA
Sbjct  306  ILMARKAFNGDQSVISPFNIQQLA  329



>ref|XP_004138671.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Cucumis sativus]
Length=331

 Score =   400 bits (1027),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 194/324 (60%), Positives = 246/324 (76%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PA+S
Sbjct  8    FGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLVPAFS  67

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                S  Q   GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ+S NL A  V 
Sbjct  68   --QVSGPQSLHGVNYASAAAGILDVTGRNFVSRIPFNQQIRNFENTLDQISNNLGAVNVG  125

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + I +CIFFVG+GSNDYL NYLMP   T   Y  QQYADLL+ QY   L RLY+LG R+F
Sbjct  126  QSIGRCIFFVGMGSNDYLNNYLMPNYPTRNQYNAQQYADLLVSQYMQQLTRLYNLGGRRF  185

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G +GCIP+++A+S +G C +EVNQ+V PFN N+K M+   N  LP A+F Y+D +
Sbjct  186  VIAGLGLMGCIPSILAQSPSGSCSEEVNQLVRPFNVNVKSMINQLNNNLPGARFSYIDIE  245

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF++++ NS+ YG SV++RGCCG+G+  G+ITC+PF+TPC NR++Y+FWDA+HPT AVN
Sbjct  246  RMFQDLLVNSRFYGLSVLNRGCCGIGRNRGQITCLPFQTPCTNRDQYIFWDAFHPTEAVN  305

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +L+ + AF+G   ++ P NIQQLA
Sbjct  306  ILMARKAFNGDQSVISPFNIQQLA  329



>ref|XP_008441153.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Cucumis melo]
Length=378

 Score =   401 bits (1031),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 194/324 (60%), Positives = 247/324 (76%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PA+S
Sbjct  55   FGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLVPAFS  114

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                S  Q   GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ+S NL A  V 
Sbjct  115  --QVSGPQSLHGVNYASAAAGILDVTGRNFVSRIPFNQQIRNFENTLDQISNNLGAASVG  172

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + I +C+FFVG+GSNDYL NYLMP   T   Y  QQYADLL+ QY+  L RLY+LG R+F
Sbjct  173  QSIGRCMFFVGMGSNDYLNNYLMPNYPTRNQYNAQQYADLLVSQYAQQLTRLYNLGGRRF  232

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G +GCIP+++A+S +G C +EVNQ+V PFN N+K M+   N  LP A+F Y+D +
Sbjct  233  VIAGLGLMGCIPSILAQSPSGSCSEEVNQLVRPFNVNVKSMINQLNNNLPGARFSYIDIE  292

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF++++ NS+ YG SV++RGCCG+G+  G+ITC+PF+TPC NR++Y+FWDA+HPT AVN
Sbjct  293  RMFQDLLVNSRFYGLSVLNRGCCGIGRNRGQITCLPFQTPCTNRDQYIFWDAFHPTEAVN  352

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            VL+ + AF+G   ++ P NIQQLA
Sbjct  353  VLMARKAFNGDQSVISPFNIQQLA  376



>gb|KGN63057.1| hypothetical protein Csa_2G396190 [Cucumis sativus]
Length=379

 Score =   400 bits (1028),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 194/324 (60%), Positives = 246/324 (76%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PA+S
Sbjct  56   FGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLVPAFS  115

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                S  Q   GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ+S NL A  V 
Sbjct  116  --QVSGPQSLHGVNYASAAAGILDVTGRNFVSRIPFNQQIRNFENTLDQISNNLGAVNVG  173

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + I +CIFFVG+GSNDYL NYLMP   T   Y  QQYADLL+ QY   L RLY+LG R+F
Sbjct  174  QSIGRCIFFVGMGSNDYLNNYLMPNYPTRNQYNAQQYADLLVSQYMQQLTRLYNLGGRRF  233

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G +GCIP+++A+S +G C +EVNQ+V PFN N+K M+   N  LP A+F Y+D +
Sbjct  234  VIAGLGLMGCIPSILAQSPSGSCSEEVNQLVRPFNVNVKSMINQLNNNLPGARFSYIDIE  293

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF++++ NS+ YG SV++RGCCG+G+  G+ITC+PF+TPC NR++Y+FWDA+HPT AVN
Sbjct  294  RMFQDLLVNSRFYGLSVLNRGCCGIGRNRGQITCLPFQTPCTNRDQYIFWDAFHPTEAVN  353

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +L+ + AF+G   ++ P NIQQLA
Sbjct  354  ILMARKAFNGDQSVISPFNIQQLA  377



>ref|XP_004141644.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Cucumis sativus]
 gb|KGN52692.1| hypothetical protein Csa_5G650570 [Cucumis sativus]
Length=366

 Score =   395 bits (1014),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 193/324 (60%), Positives = 243/324 (75%), Gaps = 3/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL T AKANY PYGIDF QGPTGRFSNGYTIVD I + LGLPL P  +
Sbjct  42   FGDSLIDNGNNNNLPTFAKANYFPYGIDFPQGPTGRFSNGYTIVDEIAELLGLPLIPPST  101

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
            +P  +   MR G+NYASAA+GILD+TG+ F+ R+P   QI NF  TLDQ++ NL A  V 
Sbjct  102  SP--ATGAMR-GLNYASAASGILDITGRNFIGRIPFNQQIRNFENTLDQITGNLGAATVA  158

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + +CIFFVG+GSNDYL NYLMP   T   Y   Q+A+LLIQQY+  L RLY+LG RKF
Sbjct  159  PLVARCIFFVGMGSNDYLNNYLMPNYPTRSQYNSPQFANLLIQQYTQQLTRLYNLGGRKF  218

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            ++ GIG +GCIP ++ARS +G+C +EVNQ+   FNAN++ M++N N  LP ++F YLD  
Sbjct  219  IIPGIGTMGCIPNILARSSDGRCSEEVNQLSRDFNANLRTMISNLNANLPGSRFTYLDIS  278

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             M ++I+AN   YGF VVDRGCCG+G+  G+ITC+PF+ PC NREEYVFWDA+HPT  VN
Sbjct  279  RMNQDILANPAAYGFRVVDRGCCGIGRNRGQITCLPFQMPCLNREEYVFWDAFHPTQRVN  338

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +++ + AF+G   + YP NIQQLA
Sbjct  339  IIMARRAFNGDLSVAYPFNIQQLA  362



>ref|XP_008788334.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Phoenix dactylifera]
Length=375

 Score =   395 bits (1014),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 189/327 (58%), Positives = 248/327 (76%), Gaps = 2/327 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ + AKANY PYGIDF  GPTGRFSNGYTIVD I   LGLPL P YS
Sbjct  47   FGDSLIDNGNNNNIPSFAKANYYPYGIDFAGGPTGRFSNGYTIVDEIAVLLGLPLIPPYS  106

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                S + +  GVNYASAAAGILD+TG+ FV R+P   QI NF  TLD+++ NL A  V 
Sbjct  107  --QASGEDLLHGVNYASAAAGILDITGRNFVGRIPFNQQIRNFESTLDRITGNLGADHVA  164

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + I +CIFFVG+GSNDYL NYLMP  +T  +Y  +Q+A+LL++QYS  L  LY++GAR+F
Sbjct  165  KAIARCIFFVGMGSNDYLNNYLMPNYNTRNVYNAEQFAELLVRQYSRQLASLYNVGARRF  224

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G + CIP+++A++ +  C  EV+ ++ PFN  +K MV N N  LP AKF+Y+D  
Sbjct  225  VIAGVGSMACIPSILAQNPSSHCSPEVDNLLIPFNNKVKSMVDNLNANLPGAKFIYIDNF  284

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             M R+I+ +  +YGFSV+DRGCCG+G+  G+ITC+PF+TPC +R +YVFWDA+HPT+AVN
Sbjct  285  GMIRDILIHPTSYGFSVIDRGCCGIGRNSGQITCLPFQTPCSDRNKYVFWDAFHPTAAVN  344

Query  903  VLVGKMAFSGGSDLVYPINIQQLARTE  983
            V++ K AFSGG+D+ Y +NI+QLA  E
Sbjct  345  VILAKKAFSGGTDVAYRMNIEQLAGLE  371



>ref|XP_008459639.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Cucumis melo]
Length=378

 Score =   394 bits (1011),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 192/324 (59%), Positives = 244/324 (75%), Gaps = 3/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL T A+ANY PYGIDF QGPTGRFSNGYTIVD I + LGLPL P  +
Sbjct  54   FGDSLIDNGNNNNLPTFARANYFPYGIDFPQGPTGRFSNGYTIVDEIAELLGLPLIPPST  113

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
            +P  +   MR G+NYASAA+GILD+TG+ F+ R+P   QI NF  TLDQ++ NL A +V 
Sbjct  114  SP--ATGAMR-GLNYASAASGILDITGRNFIGRIPFNQQIRNFENTLDQITGNLGAAMVA  170

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + +CIFFVG+GSNDYL NYLMP   T   Y  +Q+A+LLIQQY+  L RLY+LG RKF
Sbjct  171  PVVARCIFFVGMGSNDYLNNYLMPNYPTRSQYNSRQFANLLIQQYTQQLTRLYNLGGRKF  230

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            ++ GIG +GCIP ++ARS +G+C +EVNQ+   FNAN++ M+ N N  LP ++F YLD  
Sbjct  231  IIPGIGTMGCIPNILARSSDGRCSEEVNQLSRDFNANVRTMIANLNANLPGSRFTYLDIA  290

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             M ++I+AN   YGF VVDRGCCG+G+  G+ITC+PF+ PC NREEYVFWDA+HPT  VN
Sbjct  291  RMNQDILANPAAYGFRVVDRGCCGIGRNRGQITCLPFQMPCLNREEYVFWDAFHPTQRVN  350

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +++ + AF+G   + YP NIQQLA
Sbjct  351  IIMARRAFNGDFSVAYPFNIQQLA  374



>ref|XP_009399303.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   395 bits (1014),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/330 (57%), Positives = 245/330 (74%), Gaps = 2/330 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL D+GNNN L + AKANY PYGIDF  GPTGRFSNGYTIVD I + LGLPL P YS
Sbjct  85   FGDSLTDNGNNNGLASFAKANYYPYGIDFAGGPTGRFSNGYTIVDEIAELLGLPLIPPYS  144

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                S +    GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A  V 
Sbjct  145  --QASGEAALHGVNYASAAAGILDITGRNFVGRIPFNQQIKNFESTLDQIAGNLGADAVA  202

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
                 CIFFVG+GSNDYL NYLMP  +T   YT +Q+ADLL+Q Y+  L  LY+LGARKF
Sbjct  203  NATAHCIFFVGMGSNDYLNNYLMPNYNTRSQYTGEQFADLLVQDYTHQLTSLYNLGARKF  262

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+ G+G +GCIP+++A++    C  EV+++V PFN N+K M+   N  LP +KF+Y+DT 
Sbjct  263  VITGVGSMGCIPSILAQNLLSHCSLEVDKLVMPFNNNVKAMINALNVNLPHSKFIYVDTY  322

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
            +MF +I++N  TYGFSV++RGCCG+G+  G+ITC+PF+TPC NR++YVFWDA+HPT+AVN
Sbjct  323  HMFMDILSNPGTYGFSVINRGCCGIGRNSGQITCLPFQTPCANRDQYVFWDAFHPTAAVN  382

Query  903  VLVGKMAFSGGSDLVYPINIQQLARTETWP  992
            +++ + A+ G ++ V+P+NIQQLA     P
Sbjct  383  IILARKAYDGNTNAVFPMNIQQLANLNLEP  412



>ref|XP_010908040.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Elaeis guineensis]
Length=383

 Score =   392 bits (1006),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 187/327 (57%), Positives = 246/327 (75%), Gaps = 2/327 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ + AKANY PYGIDF  GPTGRFSNGYTIVD I   LGLPL P YS
Sbjct  55   FGDSLIDNGNNNNIPSFAKANYYPYGIDFAGGPTGRFSNGYTIVDEIADLLGLPLIPPYS  114

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                S + +  GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A  V 
Sbjct  115  --QASGEGLLHGVNYASAAAGILDITGRNFVGRIPFNQQIRNFESTLDQITRNLGADHVA  172

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              I  CIFFVG+GSNDYL NYLMP  +T  +Y   Q+ADLL++QY+  L RLY++GAR+F
Sbjct  173  NAIAHCIFFVGMGSNDYLNNYLMPNYNTRNVYNADQFADLLVRQYTRQLTRLYNIGARRF  232

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G + CIP+++A++ +  C  EV+ +V PFN N+K MV N N  L  AKF Y+D  
Sbjct  233  VIAGVGSMACIPSILAQNPSSHCSPEVDNLVIPFNNNVKLMVDNLNVNLRGAKFTYIDNF  292

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             + ++I++N  +YGFSVVDRGCCG+G+  G+ITC+PF+TPC +R++YVFWDA+HPT+AVN
Sbjct  293  RLIKDILSNPTSYGFSVVDRGCCGIGRNSGQITCLPFQTPCSDRDQYVFWDAFHPTAAVN  352

Query  903  VLVGKMAFSGGSDLVYPINIQQLARTE  983
            +++ + AF G +D+ +P+NI+QLA  +
Sbjct  353  IILAREAFRGNTDVAHPMNIKQLASLD  379



>ref|NP_974125.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9SF78.1|GDL29_ARATH RecName: Full=GDSL esterase/lipase At1g71691; AltName: Full=Extracellular 
lipase At1g71691; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAF43219.1|AC012654_3 Strong similarity to the putative GDSL-motif containing lipase/hydrolase 
F26A9.7 from A. thaliana on BAC gb|AC016163 [Arabidopsis 
thaliana]
 gb|AAG51812.1|AC016163_1 putative GDSL-motif lipase/hydrolase; 24593-26678 [Arabidopsis 
thaliana]
 gb|AEE35214.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=384

 Score =   390 bits (1003),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 190/325 (58%), Positives = 244/325 (75%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ + AKANY PYGIDF  GPTGRF NG T+VD I Q LGLPL PAYS
Sbjct  59   FGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYS  118

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-V  359
              + + DQ+  GVNYASAAAGIL  TG  FV R+P   QI NF  TLDQ+++     V +
Sbjct  119  --EATGDQVLRGVNYASAAAGILPDTGGNFVGRIPFDQQIHNFETTLDQVASKSGGAVAI  176

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
             + + + +FF+G+GSNDYL NYLMP   T   Y  QQ+ DLL+Q Y+  L RLY+LG RK
Sbjct  177  ADSVTRSLFFIGMGSNDYLNNYLMPNFPTRNQYNSQQFGDLLVQHYTDQLTRLYNLGGRK  236

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            FV+AG+G +GCIP+++A+  +G+C +EVNQ+V PFN N+K M++N N  LPDAKF+YLD 
Sbjct  237  FVVAGLGRMGCIPSILAQGNDGKCSEEVNQLVLPFNTNVKTMISNLNQNLPDAKFIYLDI  296

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
             +MF +I+AN   YG + +D+GCCG+GK  G+ITC+PFETPCPNR++YVFWDA+HPT  V
Sbjct  297  AHMFEDIVANQAAYGLTTMDKGCCGIGKNRGQITCLPFETPCPNRDQYVFWDAFHPTEKV  356

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N+++ K AF+G   + YPINIQQLA
Sbjct  357  NLIMAKKAFAGDRTVAYPINIQQLA  381



>ref|XP_002526412.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF35988.1| zinc finger protein, putative [Ricinus communis]
Length=422

 Score =   392 bits (1007),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 202/372 (54%), Positives = 254/372 (68%), Gaps = 47/372 (13%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAYS
Sbjct  49   FGDSLIDNGNNNNLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDQIAEMLGLPLIPAYS  108

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S D +  GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A  V 
Sbjct  109  --EASGDDVLHGVNYASAAAGILDITGRNFVGRIPFNQQIRNFQNTLDQITDNLGAVDVA  166

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              I K +FFVG+GSNDYL NYLMP   T   Y   QYA+LL+QQY+  L  LY+LGARKF
Sbjct  167  RAIGKSMFFVGMGSNDYLNNYLMPNYPTKNQYNGPQYANLLVQQYTQQLNTLYNLGARKF  226

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            +LAG+G +GCIP+++A+S  G C +EVNQ+V PFN N+K M+ NFN  LP AKF++LD  
Sbjct  227  ILAGLGVMGCIPSILAQSPAGLCSEEVNQLVMPFNENVKTMMNNFNNNLPGAKFIFLDVA  286

Query  723  NMFRNIIANSKTY---------------------------------------------GF  767
             MFR+I+ N+  Y                                             GF
Sbjct  287  RMFRDILTNAPAYGAICIPVEHRLTLDSLALPGRWSGWVSGVVKKLVINHWLHYEIYAGF  346

Query  768  SVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVNVLVGKMAFSGGSDLV  947
            SV++RGCCG+G+  G++TC+PF+TPCPNRE+Y+FWDA+HPT AVN+L+GK AF+G + +V
Sbjct  347  SVINRGCCGIGRNRGQVTCLPFQTPCPNREQYIFWDAFHPTEAVNILMGKRAFNGDTSIV  406

Query  948  YPINIQQLARTE  983
            YP+NI+QLA  +
Sbjct  407  YPMNIEQLANLD  418



>emb|CDX68306.1| BnaA07g23460D [Brassica napus]
Length=384

 Score =   389 bits (999),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/325 (58%), Positives = 245/325 (75%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ + AKANY PYGIDF  GPTGRF NG T+VD I Q LGLPL PAYS
Sbjct  59   FGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYS  118

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-V  359
              + + DQ+  GVNYASAAAGIL  TG  FV R+P   QI NF  TL+Q+++     V +
Sbjct  119  --EATGDQVLRGVNYASAAAGILPDTGGNFVGRIPFDQQIHNFETTLNQVASKSGGAVTI  176

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
             + + + +FF+G+GSNDYL NYLMP   T   Y  QQ+ DLL+QQY+  L RLY+LG RK
Sbjct  177  ADSVARSLFFIGMGSNDYLNNYLMPNFPTRNQYNAQQFGDLLVQQYTNQLTRLYNLGGRK  236

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            F+++G+G +GCIP+++A+  +G+C +EVNQ+V PFN N+K M+TN N  LPDAKF+YLDT
Sbjct  237  FIVSGLGRMGCIPSILAQGSDGKCSEEVNQLVLPFNTNVKTMITNLNQNLPDAKFIYLDT  296

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
             NM ++I  N   YGF+ +D+GCCG+G+  G+ITC+PFETPCPNRE+Y+FWDA+HPT  V
Sbjct  297  ANMVQDITTNPAVYGFTTLDKGCCGIGRNRGQITCLPFETPCPNREQYLFWDAFHPTEKV  356

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N+++ K AF+G   + +PINIQ+LA
Sbjct  357  NLIMAKKAFAGDRTVAFPINIQELA  381



>ref|XP_010312984.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Solanum lycopersicum]
Length=407

 Score =   389 bits (1000),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 197/325 (61%), Positives = 248/325 (76%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLIDSGNNN L + AKANY PYGID   GPTGRFSNGYTI+D IG  LGLPL P+YS
Sbjct  83   FGDSLIDSGNNNQLFSFAKANYLPYGID-VGGPTGRFSNGYTILDQIGVLLGLPLLPSYS  141

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + ++D MR+GVNYASAAAGILD+TG  FVER+P   QI NF  TL  L  NLSA VVK
Sbjct  142  -EEFNVDTMRYGVNYASAAAGILDVTGFHFVERIPFSYQIKNFENTLVNLIKNLSAPVVK  200

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSS-TNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
            E IP+CIFFVG+G+NDYL NY+MP    +   Y+ Q++A+LL+ QY   L +LYDLGARK
Sbjct  201  EAIPQCIFFVGMGNNDYLNNYIMPAVYFSQDQYSPQKFAELLVHQYKAQLLKLYDLGARK  260

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            F+++GIG++GCIP+M+A +  G C + VN++V PFN+ ++ M+   N  L  A  ++LD 
Sbjct  261  FIISGIGQMGCIPSMLAETSGGGCSETVNEMVHPFNSKLRTMIIKLNKDLAGAHLIFLDM  320

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
            + MF++I  N K YGFSV+DRGCCG+GK  GE+TC+PFE PC NR+EY+FWDAYHPTSAV
Sbjct  321  EYMFKDIFKNHKAYGFSVIDRGCCGLGKNQGEVTCLPFEIPCANRDEYLFWDAYHPTSAV  380

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N+L+G+MAF   ++  YPINIQ LA
Sbjct  381  NLLLGRMAFYNDANYSYPINIQHLA  405



>ref|XP_006390758.1| hypothetical protein EUTSA_v10019478mg [Eutrema salsugineum]
 gb|ESQ28044.1| hypothetical protein EUTSA_v10019478mg [Eutrema salsugineum]
Length=398

 Score =   389 bits (999),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 245/325 (75%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ + AKANY PYGIDF  GPTGRF NG T+VD I Q LGLPL PAYS
Sbjct  73   FGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYS  132

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-V  359
              +   DQM  GVNYASAAAGIL  TG  FV R+P   QI NF  TL+Q+++     V +
Sbjct  133  --EAIGDQMLRGVNYASAAAGILPDTGGNFVGRIPFDQQIHNFETTLNQVASKSGGAVAI  190

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
             + + + +FF+G+GSNDYL NYLMP   T   +  QQ+ DLL+Q Y+  L RLY+LG RK
Sbjct  191  ADSVARSLFFIGMGSNDYLNNYLMPNFPTRNQFNAQQFGDLLVQNYANQLTRLYNLGGRK  250

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            FV+AG+G +GCIP+++A+  +G+C DEVNQ+V PFN N+K M++N N  LPDAKF+YLD 
Sbjct  251  FVVAGVGRMGCIPSILAQGTDGKCSDEVNQLVLPFNTNVKTMISNLNQNLPDAKFIYLDI  310

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
             +MF +IIAN  +YGF+ +D+GCCG+G+  G+ITC+PFETPCPNR++Y+FWDA+HPT  V
Sbjct  311  AHMFEDIIANKASYGFTTLDKGCCGIGRNRGQITCLPFETPCPNRDQYLFWDAFHPTEKV  370

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N+++ K AF+G   + +PINIQQLA
Sbjct  371  NLIMAKKAFAGDPTVAFPINIQQLA  395



>ref|XP_009104909.1| PREDICTED: GDSL esterase/lipase At1g71691 [Brassica rapa]
Length=384

 Score =   389 bits (998),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 187/325 (58%), Positives = 245/325 (75%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ + AKANY PYGIDF  GPTGRF NG T+VD I Q LGLPL PAYS
Sbjct  59   FGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYS  118

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-V  359
              + + DQ+  GVNYASAAAGIL  TG  FV R+P   QI NF  TL+Q+++     V +
Sbjct  119  --EATGDQVLRGVNYASAAAGILPDTGGNFVGRIPFDQQIHNFETTLNQVASKSGGAVTI  176

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
             + + + +FF+G+GSNDYL NYLMP   T   Y  QQ+ DLL+QQY+  L RLY+LG RK
Sbjct  177  ADSVARSLFFIGMGSNDYLNNYLMPNFPTRNQYNAQQFGDLLVQQYTNQLTRLYNLGGRK  236

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            F+++G+G +GCIP+++A+  +G+C +EVNQ+V PFN N+K M+TN N  LPDAKF+YLDT
Sbjct  237  FIVSGLGRMGCIPSILAQGTDGKCSEEVNQLVLPFNTNVKTMITNLNQNLPDAKFIYLDT  296

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
             NM ++I  N   YGF+ +D+GCCG+G+  G+ITC+PFETPCPNRE+Y+FWDA+HPT  V
Sbjct  297  ANMVQDITTNPAVYGFTTLDKGCCGIGRNRGQITCLPFETPCPNREQYLFWDAFHPTEKV  356

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N+++ K AF+G   + +PINIQ+LA
Sbjct  357  NLIMAKKAFAGDRTVAFPINIQELA  381



>ref|XP_010427992.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Camelina sativa]
Length=384

 Score =   388 bits (996),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 242/325 (74%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ + AKANY PYGIDF  GPTGRF NG T+VD I Q LGLPL PAYS
Sbjct  59   FGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYS  118

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-V  359
              + + DQ+  GVNYASAAAGIL  TG  FV R+P   QI NF  TLDQ++      V V
Sbjct  119  --EATGDQVLRGVNYASAAAGILPDTGGNFVGRIPFDQQIHNFETTLDQIAGKSGGAVAV  176

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
             + + + +FF+G+GSNDYL NYLMP   T   +  QQ+ DLL+QQY+  L RLY+LG RK
Sbjct  177  ADSVARSLFFIGMGSNDYLNNYLMPNFPTRSQFNSQQFGDLLVQQYTNQLTRLYNLGGRK  236

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            FV+AG+G +GCIP+++A+  +G+C +EVNQ+V PFN N+K M++N N  LPDAKF+YLD 
Sbjct  237  FVVAGLGRMGCIPSILAQGTDGKCSEEVNQLVLPFNTNVKTMISNLNQNLPDAKFIYLDI  296

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
              M  +I+AN   YGF+ +D+GCCG+GK  G+ITC+PFETPC NR++YVFWDA+HPT  V
Sbjct  297  AQMLEDIVANQAAYGFTTMDKGCCGIGKNRGQITCLPFETPCANRDQYVFWDAFHPTEKV  356

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N+++ K AF+G   + YPINIQ+LA
Sbjct  357  NLIMAKKAFAGDRTVAYPINIQELA  381



>ref|XP_010471167.1| PREDICTED: GDSL esterase/lipase At1g71691 [Camelina sativa]
Length=384

 Score =   388 bits (996),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 242/325 (74%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ + AKANY PYGIDF  GPTGRF NG T+VD I Q LGLPL PAYS
Sbjct  59   FGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYS  118

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-V  359
              + + DQ+  GVNYASAAAGIL  TG  FV R+P   QI NF  TLDQ++      V V
Sbjct  119  --EATGDQVLRGVNYASAAAGILPDTGGNFVGRIPFDQQIHNFETTLDQIAGKSGGAVAV  176

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
             + + + +FF+G+GSNDYL NYLMP   T   +  QQ+ DLL+QQY+  L RLY+LG RK
Sbjct  177  ADSVARSLFFIGMGSNDYLNNYLMPNFPTRSQFNSQQFGDLLVQQYTNQLTRLYNLGGRK  236

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            FV+AG+G +GCIP+++A+  +G+C +EVNQ+V PFN N+K M++N N  LPDAKF+YLD 
Sbjct  237  FVVAGLGRMGCIPSILAQGNDGKCSEEVNQLVLPFNTNVKTMISNLNQNLPDAKFIYLDI  296

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
              M  +I+AN   YGF+ +D+GCCG+GK  G+ITC+PFETPC NR++YVFWDA+HPT  V
Sbjct  297  AQMLEDIVANQAAYGFTTMDKGCCGIGKNRGQITCLPFETPCANRDQYVFWDAFHPTEKV  356

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N+++ K AF+G   + YPINIQ+LA
Sbjct  357  NLIMAKKAFAGDRTVAYPINIQELA  381



>ref|XP_006339345.1| PREDICTED: formin-2-like [Solanum tuberosum]
Length=692

 Score =   397 bits (1021),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 199/324 (61%), Positives = 248/324 (77%), Gaps = 2/324 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLIDSGNNN L + AKANY PYGID   GPTGRFSNGYTI+D IG  LGLPL P+YS
Sbjct  369  FGDSLIDSGNNNQLFSFAKANYLPYGIDV-GGPTGRFSNGYTILDQIGVLLGLPLLPSYS  427

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + ++D M FGVNYASAAAGILD+TG  FVER+P   QI NF  TL  L  N+SA +VK
Sbjct  428  E-EFNVDTMCFGVNYASAAAGILDVTGFHFVERIPFSYQIKNFENTLVNLIKNMSAPIVK  486

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            E IPKCIFFVG+G+NDYL NY+MP   T   Y+ Q++A+LL+ QY   L +LYDLGARKF
Sbjct  487  EAIPKCIFFVGMGNNDYLNNYIMPVYFTQDQYSPQKFAELLVHQYKAQLTKLYDLGARKF  546

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            ++ GIG++GCIP+M+A +  G C + VN++V PFN+ ++ M+   N  L  A F++LD +
Sbjct  547  IITGIGQMGCIPSMLAETSGGGCSESVNEMVHPFNSKLRTMIMKLNKDLAGAHFIFLDME  606

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             MF++I  N K YGFSV+DRGCCG+GK  GE+TC+PFE PC NR+EY+FWDAYHPTSAVN
Sbjct  607  YMFKDIFKNHKAYGFSVIDRGCCGLGKNQGEVTCLPFEIPCANRDEYLFWDAYHPTSAVN  666

Query  903  VLVGKMAFSGGSDLVYPINIQQLA  974
            +L+G+MAF   ++  YPINIQQLA
Sbjct  667  LLLGRMAFYNDANYSYPINIQQLA  690



>emb|CDY36687.1| BnaCnng07890D [Brassica napus]
Length=384

 Score =   387 bits (994),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/325 (57%), Positives = 245/325 (75%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ + AKANY PYGIDF+ GPTGRF NG T+VD I Q LGLPL PAYS
Sbjct  59   FGDSLIDNGNNNNIPSFAKANYFPYGIDFSGGPTGRFCNGLTMVDGIAQLLGLPLIPAYS  118

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-V  359
              + + DQ+  GVNYASAAAGIL  TG  FV R+P   QI NF  TLDQ+++     V +
Sbjct  119  --EATGDQVLRGVNYASAAAGILPDTGGNFVGRIPFDQQIHNFETTLDQVASKSGGAVTI  176

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
             + + + +FF+G+GSNDYL NYLMP   T   Y  QQ+ DLL+QQY+  L RLY+LG RK
Sbjct  177  ADSVARSLFFIGMGSNDYLNNYLMPNFPTRNQYNAQQFGDLLVQQYTNQLTRLYNLGGRK  236

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            F+++G+G +GCIP+++A+  +G+C +EVNQ+V PFN N+K M+ N N  LPDAKF+YLDT
Sbjct  237  FIVSGLGRMGCIPSILAQGTDGKCSEEVNQLVLPFNTNVKTMINNLNQNLPDAKFIYLDT  296

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
             NM ++I  N   YGF+ +D+GCCG+G+  G+ITC+PFETPCPNR++Y+FWDA+HPT  V
Sbjct  297  ANMVQDITTNPAVYGFTTLDKGCCGIGRNRGQITCLPFETPCPNRDQYLFWDAFHPTEKV  356

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N+++ K AF+G   + +PINIQ+LA
Sbjct  357  NLIMAKRAFAGDRTVAFPINIQELA  381



>ref|XP_002888840.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65099.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=384

 Score =   387 bits (993),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 188/325 (58%), Positives = 243/325 (75%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ + AKANY PYGIDF  GPTGRF NG T+VD I Q LGLPL PAYS
Sbjct  59   FGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYS  118

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-V  359
              + + DQ+  GVNYASAAAGIL  TG  FV R+P   QI NF  TLDQ+++     V +
Sbjct  119  --EATGDQVLRGVNYASAAAGILPDTGGNFVGRIPFDQQIHNFETTLDQVASKSGGAVAI  176

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
             + + + +FF+G+GSNDYL NYLMP   T   Y  QQ+ DLL+Q Y+  L RLY+LG RK
Sbjct  177  ADSVTRSLFFIGMGSNDYLNNYLMPNFPTRNQYNSQQFGDLLVQHYTNQLTRLYNLGGRK  236

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            FV+AG+G +GCIP+++A+  +G+C +EVNQ+V PFN N+K M++N N  LP AKF+YLD 
Sbjct  237  FVVAGLGRMGCIPSILAQGNDGKCSEEVNQLVLPFNTNVKTMISNLNQNLPAAKFIYLDI  296

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
             +MF +I+AN   YG + +D+GCCG+GK  G+ITC+PFETPCPNR++YVFWDA+HPT  V
Sbjct  297  AHMFEDIVANQAAYGLTTMDKGCCGIGKNRGQITCLPFETPCPNRDQYVFWDAFHPTEKV  356

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N+++ K AF+G   + YPINIQ+LA
Sbjct  357  NLIMAKKAFAGDRTVAYPINIQELA  381



>ref|XP_010415867.1| PREDICTED: GDSL esterase/lipase At1g71691 [Camelina sativa]
Length=386

 Score =   386 bits (992),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 241/325 (74%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ + AKANY PYGIDF  GPTGRF NG T+VD I Q LGLPL PAYS
Sbjct  61   FGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYS  120

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-V  359
              + + DQ+  GVNYASAAAGIL  TG  FV R+P   QI NF  TLDQ++      V V
Sbjct  121  --EATGDQVLRGVNYASAAAGILPDTGGNFVGRIPFDQQIHNFEATLDQIAGKSGGAVAV  178

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
             + + + +FF+G+GSNDYL NYLMP   T   +  QQ+ D L+QQY+  L RLY+LG RK
Sbjct  179  ADSVARSLFFIGMGSNDYLNNYLMPNFPTRNQFNSQQFGDHLVQQYTNQLTRLYNLGGRK  238

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            FV+AG+G +GCIP+++A+  +G+C +EVNQ+V PFN N+K M+TN N  LPDAKF+YLD 
Sbjct  239  FVVAGLGRMGCIPSILAQGNDGKCSEEVNQLVVPFNTNVKTMITNLNQNLPDAKFIYLDI  298

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
              M  +I+AN   YGF+ +D+GCCG+GK  G+ITC+PFETPC NR++YVFWDA+HPT  V
Sbjct  299  AQMLEDIVANQAAYGFTTMDKGCCGIGKNRGQITCLPFETPCANRDQYVFWDAFHPTEKV  358

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N+++ K AF+G   + YPINIQ+LA
Sbjct  359  NLIMAKKAFAGDRTVAYPINIQELA  383



>ref|XP_006301319.1| hypothetical protein CARUB_v10021728mg [Capsella rubella]
 gb|EOA34217.1| hypothetical protein CARUB_v10021728mg [Capsella rubella]
Length=381

 Score =   386 bits (991),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 187/325 (58%), Positives = 243/325 (75%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ + AKANY PYGIDF  GPTGRF NG T+VD I Q LGLPL PAYS
Sbjct  56   FGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYS  115

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-V  359
              + + DQ+  GVNYASAAAGIL  TG  FV R+P   QI NF  TLDQ++      V +
Sbjct  116  --EATGDQVLRGVNYASAAAGILPDTGGNFVGRIPFDEQIHNFETTLDQVAGKSGGAVAI  173

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
             + + + +FF+G+GSNDYL NYLMP   T   +  QQ+ DLL+Q Y+  L RLY+LG RK
Sbjct  174  ADSVTRSLFFIGMGSNDYLNNYLMPNFPTRNQFNSQQFGDLLVQHYTNQLTRLYNLGGRK  233

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            FV+AG+G +GCIP+++A+  +G+C +EVNQ+V PFN N+K M++N N  LPDAKF+YLD 
Sbjct  234  FVVAGLGRMGCIPSILAQGSDGKCSEEVNQLVLPFNTNVKTMISNLNQNLPDAKFIYLDI  293

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
             +M+ +IIAN   YGF+ +D+GCCG+GK  G+ITC+PFETPC NR++Y+FWDA+HPT  V
Sbjct  294  AHMYEDIIANQAAYGFTTMDKGCCGIGKNRGQITCLPFETPCDNRDQYIFWDAFHPTEKV  353

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N+++ K AF+G   + YPINIQ+LA
Sbjct  354  NLIMAKKAFAGDRTVAYPINIQELA  378



>ref|XP_010521103.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At1g71691 
[Tarenaya hassleriana]
Length=387

 Score =   380 bits (975),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 187/336 (56%), Positives = 248/336 (74%), Gaps = 14/336 (4%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF+ GPTGRFSNGYT+VD + + LGLPL PA+S
Sbjct  50   FGDSLIDNGNNNNLPSFAKANYFPYGIDFSGGPTGRFSNGYTMVDELAELLGLPLIPAFS  109

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-V  359
              + + DQ+  GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ+++   + V V
Sbjct  110  --EATGDQVLRGVNYASAAAGILDVTGRNFVGRIPFDQQIKNFQSTLDQVTSRGGSAVEV  167

Query  360  KEGIPKCIFFVGIGSNDYLTNYLM-----------PGSSTNIIYTVQQYADLLIQQYSLN  506
             E + + +FFVG+GSNDYL NYLM           P + T      Q ++  L+QQY+  
Sbjct  168  AESVARSLFFVGMGSNDYLNNYLMFVVGXIRIIHRPHNPTTAHTRFQPFSHRLVQQYTTQ  227

Query  507  LQRLYDLGARKFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTA  686
            L  LY+LGARKFVLAG+G +GCIP+++A+  +G+C + VNQ+V PFN N+K M++N +T 
Sbjct  228  LTNLYNLGARKFVLAGLGRMGCIPSILAQGTDGRCSEAVNQLVLPFNTNVKAMISNLSTN  287

Query  687  LPDAKFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYV  866
            LP +KF Y+D  +MF +I+ N  TYGF+VVDRGCCG+G+  G+ITC+P +TPC NR++YV
Sbjct  288  LPGSKFTYVDIAHMFEDIVTNPATYGFTVVDRGCCGIGRNRGQITCLPLQTPCENRDQYV  347

Query  867  FWDAYHPTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            FWDA+HPT  VNV++ + AFSG   + +P+NIQQLA
Sbjct  348  FWDAFHPTEKVNVIMARKAFSGDQTVAFPLNIQQLA  383



>gb|KCW69515.1| hypothetical protein EUGRSUZ_F02957 [Eucalyptus grandis]
Length=350

 Score =   378 bits (970),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 187/325 (58%), Positives = 242/325 (74%), Gaps = 4/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQ-LGLPLAPAY  179
            FGDSLID+GNNNNL + AKANY PYGIDF +GPTGRF NGYT+VD IG   L  PL  +Y
Sbjct  27   FGDSLIDNGNNNNLPSFAKANYFPYGIDFNRGPTGRFCNGYTMVDEIGPSPLAFPLQCSY  86

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVV  359
                 S      GV   SA +  +D   ++ V R+P   QITNF  TLDQ++ NL A  V
Sbjct  87   FCM--SAAYRLHGVASRSALSSRID-AKRLLVGRIPFDQQITNFQSTLDQITDNLGADDV  143

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
               + +C+FFVG+GSNDYL NYLMP   T   Y  QQ+ADLL+QQY+  L  LY+LGARK
Sbjct  144  ARALARCLFFVGMGSNDYLNNYLMPNYDTKNQYNGQQFADLLVQQYTRQLTTLYNLGARK  203

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            F++AGIGE+GCIP+++A++E G C +EVN++V PFNAN+K M+ N N  LP AKF+Y+D 
Sbjct  204  FIIAGIGEMGCIPSILAQNEAGICSEEVNRLVQPFNANVKTMINNLNVNLPGAKFIYIDI  263

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
              MF++I+ N+++YGFSVVDRGCCG+G+  G+ITC+PF+TPC NR++YVFWDA+HPT AV
Sbjct  264  ARMFQDIVTNARSYGFSVVDRGCCGIGRNSGQITCLPFQTPCANRKQYVFWDAFHPTEAV  323

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            NV++G+ AF+G   +VYPINI+QLA
Sbjct  324  NVIMGRKAFNGDPSIVYPINIEQLA  348



>emb|CDX96333.1| BnaA07g29440D [Brassica napus]
Length=382

 Score =   379 bits (973),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/326 (56%), Positives = 243/326 (75%), Gaps = 3/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ + AKANY PYGIDF  GPTGRF NG T+VD I Q LGLPL PAYS
Sbjct  57   FGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYS  116

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-V  359
              + + DQ+  GVNYASAAAGIL  TG  F+ R+P   QI NF  TLDQ+++     V +
Sbjct  117  --EATGDQVLRGVNYASAAAGILPDTGGNFMGRIPFDQQIHNFQTTLDQMASKSGGPVAI  174

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
             + + + +FF+G+GSNDYL NYL+P   T   +   Q+ DLL+Q Y+ +L RLY+LG RK
Sbjct  175  ADSVARGLFFIGMGSNDYLNNYLLPNFPTRNQFNAHQFGDLLVQHYANHLTRLYNLGGRK  234

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            F++AG+G +GCIP+++A+  +G+C +EVNQ+V PFN N+K M++N N  LPDAKF+YLD 
Sbjct  235  FIVAGLGRMGCIPSILAQGTDGKCSEEVNQLVLPFNTNVKTMISNLNQNLPDAKFIYLDI  294

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
              M  +IIAN   YG + +D+GCCG+G+  G+ITC+PFETPCPNR++Y+FWDA+HPT  V
Sbjct  295  TQMLEDIIANPAVYGVTTLDKGCCGIGRNRGQITCLPFETPCPNRDQYLFWDAFHPTEKV  354

Query  900  NVLVGKMAFSGGSDLVYPINIQQLAR  977
            N+++ + AF+G   + +PINIQ+LAR
Sbjct  355  NLIMARKAFAGDRTVAFPINIQELAR  380



>ref|XP_009105822.1| PREDICTED: GDSL esterase/lipase At1g71691 [Brassica rapa]
Length=454

 Score =   379 bits (972),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 181/326 (56%), Positives = 243/326 (75%), Gaps = 3/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNN+ + AKANY PYGIDF  GPTGRF NG T+VD I Q LGLPL PAYS
Sbjct  129  FGDSLIDNGNNNNIPSFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPAYS  188

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-V  359
              + + DQ+  GVNYASAAAGIL  TG  F+ R+P   QI NF  TLDQ+++     V +
Sbjct  189  --EATGDQVLRGVNYASAAAGILPDTGGNFMGRIPFDQQIHNFQTTLDQMASKSGGPVAI  246

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
             + + + +FF+G+GSNDYL NYL+P   T   +   Q+ DLL+Q Y+ +L RLY+LG RK
Sbjct  247  ADSVARGLFFIGMGSNDYLNNYLLPNFPTRNQFNAHQFGDLLVQHYANHLTRLYNLGGRK  306

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            F++AG+G +GCIP+++A+  +G+C +EVNQ+V PFN N+K M++N N  LPDAKF+YLD 
Sbjct  307  FIVAGLGRMGCIPSILAQGTDGKCSEEVNQLVLPFNTNVKTMISNLNQNLPDAKFIYLDI  366

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
              M  +IIAN   YG + +D+GCCG+G+  G+ITC+PFETPCPNR++Y+FWDA+HPT  V
Sbjct  367  TQMLEDIIANPAVYGVTTLDKGCCGIGRNRGQITCLPFETPCPNRDQYLFWDAFHPTEKV  426

Query  900  NVLVGKMAFSGGSDLVYPINIQQLAR  977
            N+++ + AF+G   + +PINIQ+LAR
Sbjct  427  NLIMARKAFAGDRTVAFPINIQELAR  452



>ref|XP_004962048.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Setaria italica]
Length=383

 Score =   373 bits (958),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 189/325 (58%), Positives = 234/325 (72%), Gaps = 2/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL D+GNNN+L +LAKANYPPYGIDF  GPTGRFSNGYT+VD I Q LGLPL P++ 
Sbjct  56   FGDSLTDNGNNNDLQSLAKANYPPYGIDFAGGPTGRFSNGYTMVDEIAQLLGLPLLPSHP  115

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLS-AQVV  359
            +   S D    GVN+ASAAAGILD TGQ FV R+P   QI NF +TLDQLS  L  A  +
Sbjct  116  SAS-SADAALHGVNFASAAAGILDNTGQNFVGRIPFNQQIKNFEQTLDQLSRKLGGAGKL  174

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
               + + IF+VG+GSNDYL NYLMP  +T   Y   QY+ LL+QQY+  L  LY LGARK
Sbjct  175  APSLARSIFYVGMGSNDYLNNYLMPNYNTRNEYDGDQYSTLLVQQYAKQLGALYKLGARK  234

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            FV+AG+G + CIP M ARS    C  +V+ ++ PFN  +K MV + N   P+AKF+Y+D 
Sbjct  235  FVIAGVGSMACIPNMRARSPRNVCSPDVDDLIIPFNNKVKAMVNSLNANRPNAKFIYVDN  294

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
              M   ++ N  +YGFSVVDRGCCG+G+  G ITC+PF  PC NR  Y+FWDA+HPT  V
Sbjct  295  YAMISEVLRNPWSYGFSVVDRGCCGIGRNRGMITCLPFLRPCLNRNTYIFWDAFHPTERV  354

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            NVL+G+ AF+GG+D+VYP+NIQQLA
Sbjct  355  NVLLGRAAFNGGTDVVYPMNIQQLA  379



>ref|XP_002439816.1| hypothetical protein SORBIDRAFT_09g020670 [Sorghum bicolor]
 gb|EES18246.1| hypothetical protein SORBIDRAFT_09g020670 [Sorghum bicolor]
Length=386

 Score =   373 bits (957),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 190/326 (58%), Positives = 235/326 (72%), Gaps = 4/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL D+GNNN+L +LAKANYPPYGIDF  GPTGRFSNGYT+VD I Q LGLPL P++ 
Sbjct  59   FGDSLTDNGNNNDLNSLAKANYPPYGIDFAGGPTGRFSNGYTMVDEIAQLLGLPLLPSH-  117

Query  183  TPDPSI-DQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLS-AQV  356
             PD S  D    GVNYASAAAGILD TGQ FV R+P   QI NF +TLD LS +L  A  
Sbjct  118  -PDASSGDAALHGVNYASAAAGILDNTGQNFVGRIPFNQQIKNFEQTLDTLSKHLGGASK  176

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGAR  536
            +   + + IF+VG+GSNDYL NYLMP  +T   Y   QY+ LL+QQY+  L  LY+LGAR
Sbjct  177  LAPSLARSIFYVGMGSNDYLNNYLMPNYNTRNEYNGDQYSTLLVQQYAKQLGTLYNLGAR  236

Query  537  KFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLD  716
            +FV+AG+G + CIP M ARS    C  +V+ ++ PFN+ +K MV   N   P AKF+Y+D
Sbjct  237  RFVIAGVGSMACIPNMRARSPVNMCSPDVDDLIIPFNSKVKAMVNTLNANRPGAKFIYVD  296

Query  717  TQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSA  896
               M   ++ N  +YGFSV DRGCCG+G+  G ITC+PF  PC NR+ Y+FWDA+HPT  
Sbjct  297  NYAMISQVLRNPWSYGFSVTDRGCCGIGRNRGMITCLPFLRPCLNRQAYIFWDAFHPTER  356

Query  897  VNVLVGKMAFSGGSDLVYPINIQQLA  974
            VNVL+G+ AFSGG+D+VYP+NIQQLA
Sbjct  357  VNVLLGRAAFSGGNDVVYPMNIQQLA  382



>ref|XP_003568429.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Brachypodium 
distachyon]
Length=389

 Score =   371 bits (953),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 187/327 (57%), Positives = 233/327 (71%), Gaps = 4/327 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPA--  176
            FGDSL D+GNNN+L +LAKANY PYGIDF  GPTGRFSNGYT+VDAI + LGLPL P+  
Sbjct  60   FGDSLTDNGNNNDLTSLAKANYLPYGIDFAGGPTGRFSNGYTMVDAIAELLGLPLLPSNN  119

Query  177  -YSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ  353
              S+ D + D    GVNYASAAAGILD TGQ FV R+P   QI NF  TLD++   L A 
Sbjct  120  EVSSADGN-DGALHGVNYASAAAGILDNTGQNFVGRIPFNEQIKNFQGTLDKIKGRLGAS  178

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
             +   + + IF+VG+GSNDYL NYLMP  +T   Y   QY+ LL+Q Y+  L  LY+LGA
Sbjct  179  KLSGSLGRSIFYVGMGSNDYLNNYLMPNYNTRNEYNGDQYSTLLVQHYTKQLTSLYNLGA  238

Query  534  RKFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            R+FV+AG+G + CIP M AR+    C  +V+ ++ PFN+ +K MV   N  LP A+F+Y+
Sbjct  239  RRFVIAGVGSMACIPNMRARNPRNMCSPDVDDLIVPFNSKVKGMVNTLNVNLPRARFIYV  298

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            DT  M   ++ N   YGFSVVDRGCCG+G+  G ITC+PF  PCPNR  Y+FWDA+HPT 
Sbjct  299  DTFEMISEVLRNPLNYGFSVVDRGCCGIGRNRGVITCLPFLRPCPNRSTYIFWDAFHPTE  358

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQLA  974
             VNVL+GK A+SGG+DL YP+NIQQLA
Sbjct  359  RVNVLLGKAAYSGGTDLAYPMNIQQLA  385



>gb|KFK41586.1| hypothetical protein AALP_AA2G148200 [Arabis alpina]
Length=386

 Score =   370 bits (949),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 181/325 (56%), Positives = 240/325 (74%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID GNNNN+ + AKANY PYGIDF  GPTGRF NG T+VD I Q LGLPL PA S
Sbjct  61   FGDSLIDDGNNNNIASFAKANYFPYGIDFNGGPTGRFCNGLTMVDGIAQLLGLPLIPANS  120

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-V  359
              + + DQ+  GVNYASAAAGIL  TG  FV R+P   QI NF  TL+Q++      V +
Sbjct  121  --EATGDQVLRGVNYASAAAGILPETGGNFVGRIPFDEQIKNFETTLNQVATKSGGAVAM  178

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
             + + + +FFVG+GSNDYL NYLMP   T   Y  QQYADLL+Q+Y+  L RLY+ G RK
Sbjct  179  ADSVSQSLFFVGMGSNDYLNNYLMPNFPTRNQYNAQQYADLLVQRYTDQLTRLYNNGGRK  238

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            FV+AG+G +GCIP+++A+  +G+C +EVNQ+V PFN N+K M++N N  LP +KF+YLD 
Sbjct  239  FVVAGLGRMGCIPSILAQGTDGKCSEEVNQLVLPFNTNVKTMISNLNQNLPGSKFIYLDI  298

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
             +M  +I+A+  TYG + +D+GCCG+G+  G+ITC+PFETPCPNR++Y+FWDA+HPT  V
Sbjct  299  AHMLEDIVASPATYGITTLDKGCCGIGRNRGQITCLPFETPCPNRDQYLFWDAFHPTEKV  358

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N+++ K A++G     +PINI++LA
Sbjct  359  NLIMAKKAYAGDRTDAFPINIRELA  383



>ref|NP_001150393.1| anther-specific proline-rich protein APG precursor [Zea mays]
 gb|ACG38924.1| anther-specific proline-rich protein APG [Zea mays]
Length=389

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 188/329 (57%), Positives = 233/329 (71%), Gaps = 5/329 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL D+GNNN+L +LAKANYPPYGIDF  GPTGRFSNGYT+VD I Q LGLPL P+++
Sbjct  57   FGDSLTDNGNNNDLNSLAKANYPPYGIDFAGGPTGRFSNGYTMVDEIAQLLGLPLLPSHT  116

Query  183  TPDPSI--DQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV  356
                S   D    GVNYASAAAGILD TGQ FV R+P   QI NF +TL+QL    +   
Sbjct  117  DAASSGGGDAALHGVNYASAAAGILDNTGQNFVGRIPFNQQIKNFEQTLEQLRRRTTTTR  176

Query  357  VKEG---IPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDL  527
               G   + + IF+VG+GSNDYL NYLMP  +T   Y   QY+ LL++QY+  L  LY L
Sbjct  177  PGAGAGGLARSIFYVGMGSNDYLNNYLMPNYNTRNEYNGDQYSTLLVRQYARQLDALYGL  236

Query  528  GARKFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            GAR+FV+AG+G + CIP M ARS    C  +V+ ++ PFN  +K MVT+ N   PDAKF+
Sbjct  237  GARRFVIAGVGSMACIPNMRARSPVNMCSPDVDDLIIPFNTKVKAMVTSLNANRPDAKFI  296

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y+D   M   I++N  +YGFSV DRGCCG+G+  G ITC+PF  PC NR  Y+FWDA+HP
Sbjct  297  YVDNYAMISQILSNPWSYGFSVADRGCCGIGRNRGMITCLPFLRPCLNRNSYIFWDAFHP  356

Query  888  TSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            T  VNVL+G+ AFSGG+D+VYP+NIQQLA
Sbjct  357  TERVNVLLGRAAFSGGNDVVYPMNIQQLA  385



>ref|NP_001055574.1| Os05g0419800 [Oryza sativa Japonica Group]
 gb|AAV25648.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17488.1| Os05g0419800 [Oryza sativa Japonica Group]
 dbj|BAG94851.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 185/327 (57%), Positives = 234/327 (72%), Gaps = 5/327 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL D+GNNN++ +LAKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL P+++
Sbjct  65   FGDSLTDNGNNNDMTSLAKANYLPYGIDFAGGPTGRFSNGYTMVDEIAELLGLPLLPSHN  124

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              D + D    GVNYASAAAGILD TGQ FV R P   QI NF  TL Q+S  L      
Sbjct  125  --DATGDAALHGVNYASAAAGILDNTGQNFVGRSPFNQQIKNFEATLQQISGKLGGGAAG  182

Query  363  EGIP---KCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            +  P   + IF+VG+GSNDYL NYLMP  +T   Y   QY+ LL+QQY+  L RLY+LGA
Sbjct  183  KLAPSLARSIFYVGMGSNDYLNNYLMPNYNTRNEYNGDQYSTLLVQQYTKQLTRLYNLGA  242

Query  534  RKFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            R+FV+AG+G + CIP M AR+    C  +V+ ++ PFN+ +K MV   N  LP AKF+++
Sbjct  243  RRFVIAGVGSMACIPNMRARNPANMCSPDVDDLIIPFNSKVKSMVNTLNVNLPRAKFIFV  302

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            DT  M   ++ N  +YGFSVVDRGCCG+G+  G ITC+PF+ PC NR  Y+FWDA+HPT 
Sbjct  303  DTYAMISEVLRNPWSYGFSVVDRGCCGIGRNRGMITCLPFQRPCLNRNTYIFWDAFHPTE  362

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQLA  974
             VN+L+GK A+SGG+DLV+P+NIQQLA
Sbjct  363  RVNILLGKAAYSGGADLVHPMNIQQLA  389



>ref|NP_001147753.1| anther-specific proline-rich protein APG precursor [Zea mays]
 gb|ACG28564.1| anther-specific proline-rich protein APG [Zea mays]
 gb|AFW78046.1| anther-specific proline-rich protein APG [Zea mays]
Length=391

 Score =   369 bits (946),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 188/329 (57%), Positives = 233/329 (71%), Gaps = 5/329 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL D+GNNN+L +LAKANYPPYGIDF  GPTGRFSNGYT+VD I Q LGLPL P+++
Sbjct  59   FGDSLTDNGNNNDLNSLAKANYPPYGIDFAGGPTGRFSNGYTMVDEIAQLLGLPLLPSHT  118

Query  183  TPDPSI--DQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV  356
                S   D    GVNYASAAAGILD TGQ FV R+P   QI NF +TL+QL    +   
Sbjct  119  DAASSGGGDAALHGVNYASAAAGILDNTGQNFVGRIPFNQQIKNFEQTLEQLRRRTTTTR  178

Query  357  VKEG---IPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDL  527
               G   + + IF+VG+GSNDYL NYLMP  +T   Y   QY+ LL++QY+  L  LY L
Sbjct  179  PGAGAGGLARSIFYVGMGSNDYLNNYLMPNYNTRNEYNGDQYSTLLVRQYARQLDALYGL  238

Query  528  GARKFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            GAR+FV+AG+G + CIP M ARS    C  +V+ ++ PFN  +K MVT+ N   PDAKF+
Sbjct  239  GARRFVIAGVGSMACIPNMRARSPVNMCSPDVDDLIIPFNTKVKAMVTSLNANRPDAKFI  298

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y+D   M   I++N  +YGFSV DRGCCG+G+  G ITC+PF  PC NR  Y+FWDA+HP
Sbjct  299  YVDNYAMISQILSNPWSYGFSVADRGCCGIGRNRGMITCLPFLRPCLNRNSYIFWDAFHP  358

Query  888  TSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            T  VNVL+G+ AFSGG+D+VYP+NIQQLA
Sbjct  359  TERVNVLLGRAAFSGGNDVVYPMNIQQLA  387



>dbj|BAJ92238.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=394

 Score =   365 bits (937),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 184/327 (56%), Positives = 230/327 (70%), Gaps = 4/327 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPA--  176
            FGDSL D+GNNN+L +LAKANY PYGIDF  GPTGRFSNGYT+VDAI + LGLPL P+  
Sbjct  65   FGDSLTDNGNNNDLTSLAKANYLPYGIDFAGGPTGRFSNGYTMVDAIAELLGLPLLPSNN  124

Query  177  -YSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ  353
              S  D     ++ GVNYASAAAGILD TGQ FV R+P   QI NF  TL+Q+   L A 
Sbjct  125  DASNADSDGGALQ-GVNYASAAAGILDNTGQNFVGRIPFNQQIKNFQATLNQIKGRLGAS  183

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
             +   + + IF+VG+GSNDYL NYLMP  +T   Y   QY+ LL+Q Y+  L  LY+LGA
Sbjct  184  KLASSLGRSIFYVGMGSNDYLNNYLMPNYNTRNEYNGDQYSTLLVQHYTKQLTSLYNLGA  243

Query  534  RKFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            R+FV+AG+G + CIP M AR+    C  +V++++ PFN  +K MV   N  LP AK +Y+
Sbjct  244  RRFVIAGVGSMACIPNMRARNPANMCSPDVDELIAPFNGKVKGMVDTLNLNLPRAKLIYI  303

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            D   M   ++ +   YGFSVVDRGCCG+G+  G ITC+PF  PCPNR  Y+FWDA+HPT 
Sbjct  304  DNFEMISEVLRSPWNYGFSVVDRGCCGIGRNRGVITCLPFLRPCPNRNTYIFWDAFHPTE  363

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQLA  974
             VNVL+GK A+SGG+DL YP+NIQQLA
Sbjct  364  RVNVLLGKAAYSGGTDLAYPMNIQQLA  390



>ref|XP_004973035.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Setaria italica]
Length=368

 Score =   362 bits (929),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 184/325 (57%), Positives = 234/325 (72%), Gaps = 1/325 (0%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLIDSGNNNNL +LAKANY PYGIDFT GPTGRFSNGYTIVD + + LGLPL P YS
Sbjct  44   FGDSLIDSGNNNNLASLAKANYFPYGIDFTAGPTGRFSNGYTIVDELAELLGLPLVPPYS  103

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                S+ ++  G NYASAAAGILD +G  F  R+P   QI NF  T+ Q++A        
Sbjct  104  QTS-SVQEVLQGANYASAAAGILDDSGGNFAGRIPFNQQIRNFESTVAQIAAAAGDAAAA  162

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + + + I FVG+GSNDYL NYL P   T   Y   Q+A LL +Q++  L RLY  GARKF
Sbjct  163  DRVARSILFVGMGSNDYLNNYLAPNYDTRRRYDPHQFAGLLARQFASQLTRLYKAGARKF  222

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            V+AG+G +GCIPT++A+S  G+C  EV+ +V PFNAN++ M+   N  LP A+F YLD  
Sbjct  223  VVAGVGSMGCIPTVLAQSLAGRCSPEVDGLVLPFNANVRAMLDGLNADLPGARFTYLDNF  282

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVN  902
             +F+ I+AN   +GFSVVDRGCCG+G+  G+ITC+PF  PC +RE Y+FWDAYHPT+AVN
Sbjct  283  RIFKAILANPAAFGFSVVDRGCCGIGRNGGQITCLPFMPPCADRERYLFWDAYHPTAAVN  342

Query  903  VLVGKMAFSGGSDLVYPINIQQLAR  977
            V++ + AF GG+D++ PIN+ QLAR
Sbjct  343  VMIAREAFHGGADVMAPINVGQLAR  367



>ref|XP_009804132.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Nicotiana sylvestris]
Length=372

 Score =   358 bits (919),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/278 (59%), Positives = 217/278 (78%), Gaps = 2/278 (1%)
 Frame = +3

Query  147  QQLGLPLAPAYS--TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKT  320
            + LGLPL PAY+  + D S D+MR+GVNYASAAAGILD+TG+ FV R+P   QI NF  T
Sbjct  93   ELLGLPLIPAYTEASADTSGDKMRYGVNYASAAAGILDITGRNFVGRIPFNRQIKNFENT  152

Query  321  LDQLSANLSAQVVKEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYS  500
            LDQ++ NL A  V + + KC+FFVG+GSNDYL NYLMP   T   Y  QQYA+LL+QQYS
Sbjct  153  LDQITDNLGAPDVAQALAKCMFFVGMGSNDYLNNYLMPNYDTKNRYNPQQYANLLVQQYS  212

Query  501  LNLQRLYDLGARKFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFN  680
              L RLY+LGARKFV+ G+G +GCIP+++A+     C +EVNQ+V PF+ N+K M++N N
Sbjct  213  QQLTRLYNLGARKFVIGGVGLMGCIPSILAQGNGNVCSEEVNQLVLPFSNNVKSMLSNLN  272

Query  681  TALPDAKFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREE  860
              LP +KF+Y D +NMF++++ N + YGFSV++RGCCG+G+  G+ITC+P +TPCPNR++
Sbjct  273  ANLPGSKFIYADIKNMFQDLLTNYRRYGFSVINRGCCGIGRNRGQITCLPLQTPCPNRDQ  332

Query  861  YVFWDAYHPTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            Y+FWDA+HPT AVN+L G+ AF+GG +LVYPINIQQLA
Sbjct  333  YIFWDAFHPTEAVNILFGRRAFNGGPELVYPINIQQLA  370



>ref|XP_006441602.1| hypothetical protein CICLE_v10023728mg, partial [Citrus clementina]
 gb|ESR54842.1| hypothetical protein CICLE_v10023728mg, partial [Citrus clementina]
Length=300

 Score =   353 bits (906),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 174/287 (61%), Positives = 219/287 (76%), Gaps = 2/287 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAYS
Sbjct  8    FGDSLIDNGNNNNLPSFAKANYYPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPAYS  67

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S  Q+  GV+YASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A  V 
Sbjct  68   --EASGAQVLHGVSYASAAAGILDITGRNFVGRIPFDQQIRNFQNTLDQVTDNLGASDVS  125

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              I +CIFFVG+GSNDYL NYLMP  +T   Y  QQYADLL+ +YS  L  LY+LGARKF
Sbjct  126  NAIARCIFFVGMGSNDYLNNYLMPNYNTKNQYNAQQYADLLVSEYSRQLTTLYNLGARKF  185

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            VLAG+G +GCIP ++A+++  +C +EVNQ+V PFNAN+K M+ N N  LP A+F ++D  
Sbjct  186  VLAGLGRIGCIPRILAQNQMDRCSEEVNQLVMPFNANVKTMINNLNANLPGARFTFIDIA  245

Query  723  NMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEY  863
             MF +++ N ++YGFSV+DRGCCG+G+  G+ITC+PF+ PC NRE+Y
Sbjct  246  RMFEDLLTNYRSYGFSVIDRGCCGIGRNGGQITCLPFQIPCANREQY  292



>gb|EEC82803.1| hypothetical protein OsI_27577 [Oryza sativa Indica Group]
Length=381

 Score =   356 bits (913),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/326 (53%), Positives = 232/326 (71%), Gaps = 2/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRF NGYTIVD + + LGLPL P YS
Sbjct  54   FGDSLIDNGNNNNLASFAKANYYPYGIDFAAGPTGRFCNGYTIVDELAELLGLPLVPPYS  113

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSA-QVV  359
                 + Q+  GVN+ASAAAGILD +G  FV R+P   QI NF  T++Q++  +   +  
Sbjct  114  QASGHVQQLLQGVNFASAAAGILDESGGNFVGRIPFNQQIDNFEATVEQIAGAVGGKEAA  173

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
               + + I FVG+GSNDYL NYLMP  +T   YT +Q+ADLL  +Y+  L RLY  GARK
Sbjct  174  ASMVARSILFVGLGSNDYLNNYLMPNYNTRRRYTPRQFADLLADRYAAQLTRLYKAGARK  233

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFN-TALPDAKFVYLD  716
            FV+AG+G +GCIP ++A+S   +C  EV+ +V PFNAN++ M+   +   LP A  V+LD
Sbjct  234  FVVAGVGSMGCIPNVLAQSVESRCSPEVDALVVPFNANVRAMLGRLDGGGLPGASLVFLD  293

Query  717  TQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSA  896
               +F+ I+ +   +GF+VVDRGCCG+G+  G++TC+PF  PC  R+ YVFWDA+HPT+A
Sbjct  294  NYGVFKAILGDPAAHGFAVVDRGCCGIGRNAGQVTCLPFMPPCDGRDRYVFWDAFHPTAA  353

Query  897  VNVLVGKMAFSGGSDLVYPINIQQLA  974
            VNVL+ + AF GG+D+V PIN+++LA
Sbjct  354  VNVLIAREAFYGGADVVSPINVRRLA  379



>ref|NP_001060835.1| Os08g0112900 [Oryza sativa Japonica Group]
 dbj|BAD09513.1| putative GDSL-motif lipase/hydrolase protein [Oryza sativa Japonica 
Group]
 dbj|BAF22749.1| Os08g0112900 [Oryza sativa Japonica Group]
 gb|EEE67926.1| hypothetical protein OsJ_25801 [Oryza sativa Japonica Group]
Length=381

 Score =   356 bits (913),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/326 (53%), Positives = 232/326 (71%), Gaps = 2/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRF NGYTIVD + + LGLPL P YS
Sbjct  54   FGDSLIDNGNNNNLASFAKANYYPYGIDFAAGPTGRFCNGYTIVDELAELLGLPLVPPYS  113

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSA-QVV  359
                 + Q+  GVN+ASAAAGILD +G  FV R+P   QI NF  T++Q++  +   +  
Sbjct  114  QASGHVQQLLQGVNFASAAAGILDESGGNFVGRIPFNQQIDNFEATVEQIAGAVGGKEAA  173

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
               + + I FVG+GSNDYL NYLMP  +T   YT +Q+ADLL  +Y+  L RLY  GARK
Sbjct  174  ASMVARSILFVGLGSNDYLNNYLMPNYNTRRRYTPRQFADLLADRYAAQLTRLYKAGARK  233

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFN-TALPDAKFVYLD  716
            FV+AG+G +GCIP ++A+S   +C  EV+ +V PFNAN++ M+   +   LP A  V+LD
Sbjct  234  FVVAGVGSMGCIPNVLAQSVESRCSPEVDALVVPFNANVRAMLGRLDGGGLPGASLVFLD  293

Query  717  TQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSA  896
               +F+ I+ +   +GF+VVDRGCCG+G+  G++TC+PF  PC  R+ YVFWDA+HPT+A
Sbjct  294  NYGVFKAILGDPAAHGFAVVDRGCCGIGRNAGQVTCLPFMPPCDGRDRYVFWDAFHPTAA  353

Query  897  VNVLVGKMAFSGGSDLVYPINIQQLA  974
            VNVL+ + AF GG+D+V PIN+++LA
Sbjct  354  VNVLIAREAFYGGADVVSPINVRRLA  379



>gb|EAY98084.1| hypothetical protein OsI_20002 [Oryza sativa Indica Group]
 gb|EEE63762.1| hypothetical protein OsJ_18581 [Oryza sativa Japonica Group]
Length=425

 Score =   352 bits (903),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 185/359 (52%), Positives = 234/359 (65%), Gaps = 37/359 (10%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAI-------------  143
            FGDSL D+GNNN++ +LAKANY PYGIDF  GPTGRFSNGYT+VD I             
Sbjct  65   FGDSLTDNGNNNDMTSLAKANYLPYGIDFAGGPTGRFSNGYTMVDEIENLTGINEDFPNQ  124

Query  144  -------------------GQQLGLPLAPAYSTPDPSIDQMRFGVNYASAAAGILDMTGQ  266
                                + LGLPL P+++  D + D    GVNYASAAAGILD TGQ
Sbjct  125  VESKAHNNSYNGLLEMGVVTELLGLPLLPSHN--DATGDAALHGVNYASAAAGILDNTGQ  182

Query  267  IFVERVPLKNQITNFAKTLDQLSANLSAQVVKEGIP---KCIFFVGIGSNDYLTNYLMPG  437
             FV R P   QI NF  TL Q+S  L      +  P   + IF+VG+GSNDYL NYLMP 
Sbjct  183  NFVGRSPFNQQIKNFEATLQQISGKLGGGAAGKLAPSLARSIFYVGMGSNDYLNNYLMPN  242

Query  438  SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKFVLAGIGELGCIPTMVARSENGQCLD  617
             +T   Y   QY+ LL+QQY+  L RLY+LGAR+FV+AG+G + CIP M AR+    C  
Sbjct  243  YNTRNEYNGDQYSTLLVQQYTKQLTRLYNLGARRFVIAGVGSMACIPNMRARNPANMCSP  302

Query  618  EVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGV  797
            +V+ ++ PFN+ +K MV   N  LP AKF+++DT  M   ++ N  +YGFSVVDRGCCG+
Sbjct  303  DVDDLIIPFNSKVKSMVNTLNVNLPRAKFIFVDTYAMISEVLRNPWSYGFSVVDRGCCGI  362

Query  798  GKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            G+  G ITC+PF+ PC NR  Y+FWDA+HPT  VN+L+GK A+SGG+DLV+P+NIQQLA
Sbjct  363  GRNRGMITCLPFQRPCLNRNTYIFWDAFHPTERVNILLGKAAYSGGADLVHPMNIQQLA  421



>gb|KDP45642.1| hypothetical protein JCGZ_17249 [Jatropha curcas]
Length=280

 Score =   346 bits (887),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 162/274 (59%), Positives = 210/274 (77%), Gaps = 2/274 (1%)
 Frame = +3

Query  153  LGLPLAPAYSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQL  332
            LGLPL PAYS  + S D +  GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ+
Sbjct  7    LGLPLIPAYS--EASGDDVLHGVNYASAAAGILDITGRNFVGRIPFNQQIKNFQNTLDQI  64

Query  333  SANLSAQVVKEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQ  512
            + NL A  V   I + IFFVG+GSNDYL NYLMP   T   Y   QYA+LL+QQY+  L 
Sbjct  65   TDNLGAIDVASAIARSIFFVGMGSNDYLNNYLMPNYPTKNQYDGPQYANLLVQQYTQQLT  124

Query  513  RLYDLGARKFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALP  692
             LY+LGARKF+LAG+G +GCIP+++A+S  G C +EVNQ+V PFN N+K M+ N N+ LP
Sbjct  125  TLYNLGARKFILAGLGVMGCIPSILAQSPAGLCSEEVNQLVLPFNENVKTMMNNLNSNLP  184

Query  693  DAKFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFW  872
             AKF+Y+D   MFR+I+ NS  YGFSV++RGCCG+G+  G++TC+PF+TPC NRE+Y+FW
Sbjct  185  GAKFIYIDVHRMFRDILTNSPAYGFSVINRGCCGIGRNRGQVTCLPFQTPCQNREQYIFW  244

Query  873  DAYHPTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            DA+HPT AVN+L+G+ AF+G + +VYP+NI+QLA
Sbjct  245  DAFHPTEAVNILMGRKAFNGDTSIVYPMNIKQLA  278



>gb|AFW74302.1| hypothetical protein ZEAMMB73_454294 [Zea mays]
Length=366

 Score =   349 bits (895),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 176/328 (54%), Positives = 230/328 (70%), Gaps = 5/328 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLIDSGNNNNL +LAKANY PYGIDF  GPTGRF NGYTIVD + + LGLPL P YS
Sbjct  38   FGDSLIDSGNNNNLASLAKANYFPYGIDFAGGPTGRFCNGYTIVDELAELLGLPLVPPYS  97

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                S+  +  GVNYASAAAGILD +G  FV R+P   QI NF  T+ +++    A    
Sbjct  98   EAS-SVQHVLQGVNYASAAAGILDDSGGNFVGRIPFNQQIQNFETTVARIAGAAGAAAAA  156

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + + + + FVG+GSNDYL NYLMP   T   Y  QQ+ADLL +Q +  L RL+  G R+F
Sbjct  157  DLVARSVLFVGMGSNDYLNNYLMPNYDTRRRYGPQQFADLLARQLAAQLARLHGAGGRRF  216

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFN----TALPDAKFVY  710
            V+AG+G +GCIP++ A+S  G+C   V+ +V PFNAN++ +V   N      LP A   Y
Sbjct  217  VVAGVGSVGCIPSVRAQSLAGRCSRAVDDLVLPFNANVRALVDRLNGNAAAGLPGASLTY  276

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
            LD   +FR I+ +   +GF+VVDRGCCG+G+  G++TC+PF  PC +RE YVFWDAYHPT
Sbjct  277  LDNFAVFRAILTDPAAFGFAVVDRGCCGIGRNAGQVTCLPFMPPCDHRERYVFWDAYHPT  336

Query  891  SAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            +AVNV+V ++AF GG+D+V P+N+++LA
Sbjct  337  AAVNVIVARLAFHGGADVVSPVNVRELA  364



>ref|XP_008648378.1| PREDICTED: LOW QUALITY PROTEIN: GDSL esterase/lipase At1g71691-like 
[Zea mays]
Length=366

 Score =   347 bits (891),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 176/328 (54%), Positives = 228/328 (70%), Gaps = 5/328 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLIDSGNNNNL +LAKANY PYGIDF  GPTGRF NGYTIVD + + LGLPL P YS
Sbjct  38   FGDSLIDSGNNNNLASLAKANYFPYGIDFAGGPTGRFCNGYTIVDELAELLGLPLVPPYS  97

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                S+  +  GVNYASAAAGILD +G  FV R+P   QI NF  T+ +++    A    
Sbjct  98   EAS-SVQHVLQGVNYASAAAGILDDSGGNFVGRIPFNQQIQNFETTVARIAGAAGAAAAA  156

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + + + + FVG+GSNDYL NYLMP   T   Y  QQ+ADLL +Q +  L RL+  G R+F
Sbjct  157  DLVARSVLFVGMGSNDYLNNYLMPNYDTRRRYGPQQFADLLARQLAAQLARLHGAGGRRF  216

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFN----TALPDAKFVY  710
            V+AG+G +GCIP++ A+S  G+C   VN +V PFNAN++ +V   N      LP A   Y
Sbjct  217  VVAGVGSVGCIPSVRAQSLAGRCSRAVNDLVLPFNANVRALVDRLNGNAAAGLPGASLTY  276

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
            LD   +FR I+A+   +GF+VVDRGCCG+G+  G++TC PF  PC +RE YVFWDAYHPT
Sbjct  277  LDNFAVFRAILADPAAFGFAVVDRGCCGIGRNAGQVTCQPFMPPCDHREHYVFWDAYHPT  336

Query  891  SAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            +AVNV+V ++   GG+D+V P+N+++LA
Sbjct  337  AAVNVIVARLVLHGGADVVSPVNVRELA  364



>ref|XP_002443746.1| hypothetical protein SORBIDRAFT_07g001270 [Sorghum bicolor]
 gb|EES13241.1| hypothetical protein SORBIDRAFT_07g001270 [Sorghum bicolor]
Length=376

 Score =   348 bits (892),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 177/332 (53%), Positives = 236/332 (71%), Gaps = 9/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLIDSGNNNNL +LAKANY PYGIDF  GPTGRF NGYTIVD + + LGLPL P YS
Sbjct  44   FGDSLIDSGNNNNLASLAKANYFPYGIDFADGPTGRFCNGYTIVDELAELLGLPLVPPYS  103

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                S+ Q+  G NYASAAAGILD +G  FV R+P   QI NF  T+ +++A + A    
Sbjct  104  EAS-SVQQVLQGTNYASAAAGILDDSGGNFVGRIPFNQQIKNFESTMAEITAAMGASAAA  162

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + + + I FVG+GSNDYL NYLMP   T   Y+ QQ+ADLL +Q +  L RLY+ G R+F
Sbjct  163  DLMSRSILFVGMGSNDYLNNYLMPNYDTRRRYSPQQFADLLARQLAAQLTRLYNAGGRRF  222

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMV--------TNFNTALPDA  698
            V+AG+G +GCIP+++A+S  G+C  EV+ +V PFNAN++ ++              LP A
Sbjct  223  VVAGVGSMGCIPSVLAQSVAGRCSQEVDDLVLPFNANVRALLDGLNAAAGGAGGGGLPGA  282

Query  699  KFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDA  878
            +  YLD   +FR I+ +   +GF+VVDRGCCG+G+  G++TC+PF  PC +RE YVFWDA
Sbjct  283  RLTYLDNFRIFRAILGDPAAFGFTVVDRGCCGIGRNGGQVTCLPFMAPCDDRERYVFWDA  342

Query  879  YHPTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            YHPT+AVN+++ ++AF GG+D++ PIN++QLA
Sbjct  343  YHPTAAVNIIIARLAFHGGTDVISPINVRQLA  374



>ref|NP_565021.2| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE35215.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=283

 Score =   334 bits (856),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/279 (56%), Positives = 206/279 (74%), Gaps = 3/279 (1%)
 Frame = +3

Query  141  IGQQLGLPLAPAYSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKT  320
            + Q LGLPL PAYS  + + DQ+  GVNYASAAAGIL  TG  FV R+P   QI NF  T
Sbjct  4    VTQLLGLPLIPAYS--EATGDQVLRGVNYASAAAGILPDTGGNFVGRIPFDQQIHNFETT  61

Query  321  LDQLSANLSAQV-VKEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQY  497
            LDQ+++     V + + + + +FF+G+GSNDYL NYLMP   T   Y  QQ+ DLL+Q Y
Sbjct  62   LDQVASKSGGAVAIADSVTRSLFFIGMGSNDYLNNYLMPNFPTRNQYNSQQFGDLLVQHY  121

Query  498  SLNLQRLYDLGARKFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNF  677
            +  L RLY+LG RKFV+AG+G +GCIP+++A+  +G+C +EVNQ+V PFN N+K M++N 
Sbjct  122  TDQLTRLYNLGGRKFVVAGLGRMGCIPSILAQGNDGKCSEEVNQLVLPFNTNVKTMISNL  181

Query  678  NTALPDAKFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNRE  857
            N  LPDAKF+YLD  +MF +I+AN   YG + +D+GCCG+GK  G+ITC+PFETPCPNR+
Sbjct  182  NQNLPDAKFIYLDIAHMFEDIVANQAAYGLTTMDKGCCGIGKNRGQITCLPFETPCPNRD  241

Query  858  EYVFWDAYHPTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            +YVFWDA+HPT  VN+++ K AF+G   + YPINIQQLA
Sbjct  242  QYVFWDAFHPTEKVNLIMAKKAFAGDRTVAYPINIQQLA  280



>ref|XP_003571310.2| PREDICTED: GDSL esterase/lipase At1g71691-like [Brachypodium 
distachyon]
Length=354

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 172/336 (51%), Positives = 229/336 (68%), Gaps = 13/336 (4%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDF-----TQGPTGRFSNGYTIVDAIGQQLGLPL  167
            FGDSL+D+GNNN L +LAKANY PYG+DF        PTGRF NGYTIVD + + LGLPL
Sbjct  20   FGDSLVDNGNNNGLPSLAKANYLPYGVDFGPAGGEGSPTGRFCNGYTIVDYLAELLGLPL  79

Query  168  APAYSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLS  347
             P YS    S      G NYASAAAGILD +G  F  R+P   QI+NF +T+  + A  S
Sbjct  80   VPPYSQLLSSGSVPTNGANYASAAAGILDDSGANFAGRIPFDEQISNFERTVAAMGAAGS  139

Query  348  AQVVKEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDL  527
            +  +  G  + + FVG+GSNDYL NYLMP   T   +T  Q+ADLL+ +Y+  L RLY  
Sbjct  140  STNLVVG--RSMVFVGMGSNDYLNNYLMPNYDTRRHHTPAQFADLLLSRYAAQLTRLYRA  197

Query  528  GARKFVLAGIGELGCIPTMVARSENGQCLDEVNQ-VVDPFNANMKQMVTNFNTA-----L  689
            GAR+FV+AG+G LGCIPT++AR+  G+C + V++ +V PFNA +K M+   N       L
Sbjct  198  GARRFVVAGLGSLGCIPTILARTTEGRCDEPVDRDLVAPFNAGVKAMLDRLNDDDDDGEL  257

Query  690  PDAKFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVF  869
            P A+F +LD   + R ++A+   YGFSVVDRGCCGVG   G++TC+PF  PC +R  Y+F
Sbjct  258  PGARFAFLDNYRIVRLMLADPAAYGFSVVDRGCCGVGLNAGQMTCLPFMEPCADRGRYLF  317

Query  870  WDAYHPTSAVNVLVGKMAFSGGSDLVYPINIQQLAR  977
            WDAYHPT+AVN ++ + AF GG D+V+P+N+++LA+
Sbjct  318  WDAYHPTAAVNEVIARAAFDGGDDVVFPVNVRRLAQ  353



>ref|XP_006659756.1| PREDICTED: GDSL esterase/lipase At1g71691-like [Oryza brachyantha]
Length=366

 Score =   328 bits (840),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 173/330 (52%), Positives = 228/330 (69%), Gaps = 6/330 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL +LAKANY PYGIDF  G TGRF NGYTIVD + + LGLPL P YS
Sbjct  35   FGDSLIDNGNNNNLASLAKANYYPYGIDFAGGATGRFCNGYTIVDELAELLGLPLLPPYS  94

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                +  Q+  GVN+ASAAAGILD TG  FV R+P   QI NF   ++Q++  +  +   
Sbjct  95   QASGNGKQLLHGVNFASAAAGILDDTGGNFVGRIPFNQQIDNFEAAVEQIAGAVGKEAAA  154

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              + + I FVG+GSNDYL NYLMP  +T   Y+  Q+ADLL  +Y+  L RLY+ GARKF
Sbjct  155  AMVARSILFVGLGSNDYLNNYLMPNYNTRRQYSPAQFADLLAARYAAQLTRLYEAGARKF  214

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFN------TALPDAKF  704
            V+AG+G +GCIP ++A+S    C  EV+ +V PFNAN++ M+   N        L  A+ 
Sbjct  215  VVAGVGSMGCIPNVLAQSVESLCSPEVDGLVLPFNANVRAMIDRLNGGAGAGGGLAGARL  274

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            V+LD   +F+ I+ +   +GF VVDRGCCG+G+  G++TC+PF  PC +R  YVFWDA+H
Sbjct  275  VFLDNYGVFKGILGDPAAHGFRVVDRGCCGIGRNSGQVTCLPFMPPCDDRRGYVFWDAFH  334

Query  885  PTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            PT+AVNVLV ++AF G +D+V PIN+ +LA
Sbjct  335  PTAAVNVLVARLAFYGSADVVSPINVGRLA  364



>ref|XP_007200393.1| hypothetical protein PRUPE_ppa008473mg [Prunus persica]
 gb|EMJ01592.1| hypothetical protein PRUPE_ppa008473mg [Prunus persica]
Length=330

 Score =   325 bits (834),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 219/325 (67%), Gaps = 1/325 (0%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID GNNN L +LAK+NY PYG DF  GPTGRFSNG T+VD +G  LGLP  P ++
Sbjct  4    FGDSLIDVGNNNYLSSLAKSNYYPYGCDFRAGPTGRFSNGRTVVDMLGNLLGLPYVPPFA  63

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P+    ++  GVNYASAAAGILD TGQ F +R  L  Q+ NF  TLDQL   +S   + 
Sbjct  64   DPNTKGTKILGGVNYASAAAGILDETGQHFGQRYSLSQQVLNFESTLDQLRPMMSGANMT  123

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + + K I  +  GSNDY+ NYL+P   S++ IYT   +A+LL+ +Y+  +  L+ +G +K
Sbjct  124  QYLAKSIAVLEFGSNDYINNYLLPSLYSSSYIYTPPAFANLLLNRYTQQILALHSVGLKK  183

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            FVLAGIG LGCIP   A ++ G+C+D VNQ++  FN  ++ +    NT  P A FVY +T
Sbjct  184  FVLAGIGPLGCIPNQRALAQPGRCVDYVNQILGSFNEGLRSLANQLNTNHPGAIFVYANT  243

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
               F +++ N   YGFSV+DRGCCG+G+  G+ITC+P+  PC NR +Y+FWDAYHPT A 
Sbjct  244  YAAFGDMLNNPALYGFSVIDRGCCGIGRDRGQITCLPYSVPCANRNQYIFWDAYHPTEAA  303

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N ++   AF+G     YPIN+QQ+A
Sbjct  304  NAVLAWRAFNGPPSDCYPINVQQMA  328



>ref|XP_008237811.1| PREDICTED: GDSL esterase/lipase At1g71250 [Prunus mume]
Length=382

 Score =   327 bits (837),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 218/325 (67%), Gaps = 1/325 (0%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID GNNN L + AK+NY PYG DF  GPTGRFSNG T+VD +G  LGLP  P ++
Sbjct  56   FGDSLIDVGNNNYLSSFAKSNYYPYGCDFRAGPTGRFSNGRTVVDMLGNLLGLPYVPPFA  115

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P+    ++  GVNYASAAAGILD TGQ F +R  L  Q+ NF  TLDQL   +S   + 
Sbjct  116  DPNTKGTKILGGVNYASAAAGILDETGQHFGQRYSLSQQVLNFESTLDQLRPMMSGANMT  175

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + + K I  +  GSNDY+ NYL+P   S++ IYT   +A+LL+ +Y+  +  L+ +G RK
Sbjct  176  KYLAKSIAVLEFGSNDYINNYLLPSLYSSSYIYTPPAFANLLLNRYTQQILALHSVGLRK  235

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
            FVLAGIG LGCIP   A ++ G+C+D VNQ++  FN  ++ +    NT  P A FVY +T
Sbjct  236  FVLAGIGPLGCIPNQRALAQPGRCVDYVNQILGSFNEGLRSLANQLNTNHPGAIFVYANT  295

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
               F +++ N   YGFSV+DRGCCG+G+  G+ITC+P+  PC NR +Y+FWDAYHPT A 
Sbjct  296  YAAFGDMLNNPALYGFSVIDRGCCGIGRNRGQITCLPYSVPCANRNQYIFWDAYHPTEAA  355

Query  900  NVLVGKMAFSGGSDLVYPINIQQLA  974
            N ++   AF+G     YPIN+QQ+A
Sbjct  356  NAVLAWRAFNGPPSDCYPINVQQIA  380



>ref|XP_004154173.1| PREDICTED: GDSL esterase/lipase At1g71250-like [Cucumis sativus]
 ref|XP_004161958.1| PREDICTED: GDSL esterase/lipase At1g71250-like [Cucumis sativus]
Length=342

 Score =   322 bits (824),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 216/327 (66%), Gaps = 3/327 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D GNNN L + A+ANY PYG+DFT GPTGRFSNG T++D     LG+P AP +S
Sbjct  14   FGDSLVDVGNNNFLHSAARANYYPYGVDFTDGPTGRFSNGRTVIDMFVDMLGIPNAPEFS  73

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             PD S D++  GVNYASAAAGILD TG+ + +R  L  Q+ NF  TL+ L  ++ +  + 
Sbjct  74   NPDTSGDRILNGVNYASAAAGILDETGRHYGDRYTLSQQVVNFESTLNDLRRSMGSWNLT  133

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
              + K I F+  GSNDY+ NYLMP   +T   Y   Q+A+LL+ +YS  L  L  +G +K
Sbjct  134  RYLSKSIAFLAFGSNDYINNYLMPNLYTTRFRYNSNQFANLLLNRYSRQLLALQSVGVKK  193

Query  540  FVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
             V+AG+G LGCIP   A      G+C D+VN+++  FN  +K +VT  N+  PD KFVY 
Sbjct  194  LVIAGLGPLGCIPNQRATGVTLPGRCADKVNEMLGAFNEGLKSLVTQLNSQYPDTKFVYT  253

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +   +F +I+ N +TYGFSVVD  CCGVG   G+ITC+P + PC NR EYVFWDA+HPT 
Sbjct  254  NIYGIFGDILNNPETYGFSVVDTACCGVGLNRGQITCLPLQFPCLNRNEYVFWDAFHPTE  313

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQLA  974
            A + ++   AF G     YPIN+QQLA
Sbjct  314  AASYILAGRAFRGPPSDSYPINVQQLA  340



>ref|XP_004145208.1| PREDICTED: GDSL esterase/lipase At1g71250-like [Cucumis sativus]
 gb|KGN64457.1| hypothetical protein Csa_1G056930 [Cucumis sativus]
Length=360

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 216/327 (66%), Gaps = 3/327 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D GNNN L + A+ANY PYG+DFT GPTGRFSNG T++D     LG+P AP +S
Sbjct  32   FGDSLVDVGNNNFLHSAARANYYPYGVDFTDGPTGRFSNGRTVIDMFVDMLGIPNAPEFS  91

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             PD S D++  GVNYASAAAGILD TG+ + +R  L  Q+ NF  TL+ L  ++ +  + 
Sbjct  92   NPDTSGDRILNGVNYASAAAGILDETGRHYGDRYTLSQQVVNFESTLNDLRRSMGSWNLT  151

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
              + K I F+  GSNDY+ NYLMP   +T   Y   Q+A+LL+ +YS  L  L  +G +K
Sbjct  152  RYLSKSIAFLAFGSNDYINNYLMPNLYTTRFRYNSNQFANLLLNRYSRQLLALQSVGVKK  211

Query  540  FVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
             V+AG+G LGCIP   A      G+C D+VN+++  FN  +K +VT  N+  PD KFVY 
Sbjct  212  LVIAGLGPLGCIPNQRATGVTLPGRCADKVNEMLGAFNEGLKSLVTQLNSQYPDTKFVYT  271

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +   +F +I+ N +TYGFSVVD  CCGVG   G+ITC+P + PC NR EYVFWDA+HPT 
Sbjct  272  NIYGIFGDILNNPETYGFSVVDTACCGVGLNRGQITCLPLQFPCLNRNEYVFWDAFHPTE  331

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQLA  974
            A + ++   AF G     YPIN+QQLA
Sbjct  332  AASYILAGRAFRGPPSDSYPINVQQLA  358



>ref|XP_008381690.1| PREDICTED: GDSL esterase/lipase At1g71250 [Malus domestica]
Length=371

 Score =   322 bits (825),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/326 (50%), Positives = 221/326 (68%), Gaps = 2/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID GNNN L +LAK+NY PYG DF  GPTGRF+NG T VD +G  LGLP  PA++
Sbjct  44   FGDSLIDVGNNNFLNSLAKSNYYPYGCDFRAGPTGRFTNGRTFVDLLGNLLGLPYVPAFA  103

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P+    +M  GVNYASAAAGILD TGQ + ER  L  Q+ NF  TL+QL + +S   + 
Sbjct  104  DPNTKGTRMLGGVNYASAAAGILDETGQHYGERYXLSQQVLNFESTLNQLRSMMSGTNLT  163

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + + K I  +  GSNDY+ NYL+P   +++  YT   +A+LL+ +Y+  +  L+ +G RK
Sbjct  164  QMLAKSIAVLAFGSNDYINNYLLPSLYTSSYYYTPPAFANLLLNRYTRQILALHSVGLRK  223

Query  540  FVLAGIGELGCIPTMVAR-SENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLD  716
            FVLAGIG LGCIP   A  ++  +CLD VNQ++  +N  ++ +V  FNT  PDA FVY +
Sbjct  224  FVLAGIGPLGCIPNQRASAAQPERCLDYVNQILGTYNEGLRSLVNQFNTNHPDAIFVYAN  283

Query  717  TQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSA  896
            T   F +++ N   YGFSV+DRGCCG+G+  G+ITC+P+  PC NR +Y+FWDA+HPT A
Sbjct  284  TYGAFGDMLNNPAPYGFSVIDRGCCGIGRNRGQITCLPYAVPCSNRNQYMFWDAFHPTEA  343

Query  897  VNVLVGKMAFSGGSDLVYPINIQQLA  974
             N ++   A++G     YPIN+QQ+A
Sbjct  344  ANAILAWRAYNGPPSDSYPINVQQMA  369



>ref|XP_010930550.1| PREDICTED: GDSL esterase/lipase At1g71250 [Elaeis guineensis]
Length=369

 Score =   319 bits (817),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 224/329 (68%), Gaps = 4/329 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID GNNN L ++AKANY PYGIDF QGPTGRFSNG T++D +   LGLP  P Y+
Sbjct  40   FGDSLIDDGNNNYLSSIAKANYYPYGIDFFQGPTGRFSNGKTVIDVLCDLLGLPYLPPYT  99

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-V  359
            +P  +  ++  GVNYASAA GILD TG+   ER  L  Q+ NF   LD+L   +  +  +
Sbjct  100  SPGLNGTRLLGGVNYASAAGGILDETGEYLGERFSLNQQVLNFENNLDELRTLMGGERNL  159

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGAR  536
             + + + I  +  GSNDY+ NYL+P    T+  YT ++YA+LL+  Y+  +  LY +G R
Sbjct  160  SQYLARSIVVMVFGSNDYINNYLLPPLYPTSYNYTPEEYANLLLNHYTRQILALYSVGLR  219

Query  537  KFVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVY  710
            KFVL+G+G LGCIP   A   +   QC+D+VNQ+V  FN  ++ +V   NT  P A FVY
Sbjct  220  KFVLSGVGPLGCIPNQRASGFAPADQCIDQVNQMVSLFNGGLRSLVQQLNTNHPGAIFVY  279

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
             +T     +I+ N  TYGF+VV+RGCCG+G+  G+ITC+PF  PC NR +++FWDA+HPT
Sbjct  280  GNTYGALGDILNNPSTYGFTVVERGCCGLGRFQGQITCLPFSVPCLNRSQHIFWDAFHPT  339

Query  891  SAVNVLVGKMAFSGGSDLVYPINIQQLAR  977
             AVN+++G+ AF+G  + +YP+N+QQLA+
Sbjct  340  QAVNLILGQRAFTGPPNDMYPVNVQQLAQ  368



>ref|XP_010252444.1| PREDICTED: GDSL esterase/lipase At1g71250 [Nelumbo nucifera]
Length=369

 Score =   318 bits (815),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/326 (49%), Positives = 221/326 (68%), Gaps = 3/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D GNNN L ++AKANY PYGIDF QGPTGRFSNG T++D +G+ LGLP  PA++
Sbjct  41   FGDSLVDDGNNNYLRSIAKANYIPYGIDFNQGPTGRFSNGRTVIDMLGEMLGLPYPPAFA  100

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P+ +  +M  GVNYASAAAGILD TG+ + ER  L  Q+ NF  TL+QL        + 
Sbjct  101  DPNTAGPRMLRGVNYASAAAGILDETGRHYGERFTLSQQVLNFETTLNQLRQYTGGSNLT  160

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + + K +  +  GSNDY+ NYL+P   S++  Y    +A+LL+  Y+  +  LY+LG RK
Sbjct  161  QYLSKSLAVLVFGSNDYINNYLLPSLYSSSYNYDPPAFANLLLNHYTRQILALYNLGLRK  220

Query  540  FVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            F+++G+G LGCIP  +A  +   G+C+D+VNQ++  FN  +K +V   N     A FVY 
Sbjct  221  FLISGVGPLGCIPNQIATGQAPPGRCVDKVNQMLGTFNQGLKTIVDQLNANHRGAIFVYA  280

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T     +I+ N   YGFSV+++GCCG+G+  G+ITC+P+  PC NR  YVFWDA+HPT 
Sbjct  281  NTYGAMGDILNNPARYGFSVLNQGCCGLGRNQGQITCLPYSIPCQNRNRYVFWDAFHPTQ  340

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQL  971
            AVN ++ + AFSG  D VYPIN+QQ+
Sbjct  341  AVNAILAQKAFSGSPDDVYPINVQQM  366



>ref|XP_008786569.1| PREDICTED: GDSL esterase/lipase At1g71250 [Phoenix dactylifera]
Length=370

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 162/329 (49%), Positives = 224/329 (68%), Gaps = 4/329 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID GNNN L ++AKANY PYGIDF QGPTGRF NG T+VD +   LGLP  P Y+
Sbjct  41   FGDSLIDDGNNNYLSSIAKANYYPYGIDFFQGPTGRFCNGKTVVDVLCDLLGLPYLPPYT  100

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-V  359
            +P  +  ++  GVNYASAA GILD TGQ   ER  L  Q+ NF   L++L   +  +  +
Sbjct  101  SPGLNGTRLLGGVNYASAAGGILDETGQYLGERFSLNQQVLNFENNLNELKTLMGGERNL  160

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGAR  536
             + + + I  +  GSNDY+ NYL+P   +T+  YT ++YA+LL+  Y+  +  LY +G R
Sbjct  161  SQYLARSIVVMVFGSNDYINNYLLPPQYATSYNYTPEEYANLLLNHYTRQILALYSVGLR  220

Query  537  KFVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVY  710
            KFVLAG+G LGCIP   A   +   +C+D+VNQ+V  FN  ++ +V   NT  P A FVY
Sbjct  221  KFVLAGVGPLGCIPNQRASGLTPADRCVDQVNQMVGLFNVGLRSLVQQLNTDHPGAIFVY  280

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
             +T     +I+ N  TYGF+VV+RGCCG+G+  G+ITC+PF  PC NR +++FWDA+HPT
Sbjct  281  GNTYGALGDILNNPSTYGFTVVERGCCGLGRFQGQITCLPFSVPCLNRSQHIFWDAFHPT  340

Query  891  SAVNVLVGKMAFSGGSDLVYPINIQQLAR  977
             AVN+++G+ AF+G  + +YP+N+QQLA+
Sbjct  341  QAVNLILGQRAFTGPPNDMYPVNVQQLAQ  369



>ref|XP_008440329.1| PREDICTED: GDSL esterase/lipase At1g71250 [Cucumis melo]
Length=370

 Score =   317 bits (811),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 166/328 (51%), Positives = 216/328 (66%), Gaps = 5/328 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D GNNN L + A+ANY PYGIDF+ GPTGRFSNG T++D     LG+P AP ++
Sbjct  42   FGDSLVDVGNNNFLHSAARANYYPYGIDFSDGPTGRFSNGRTVIDMFVDMLGIPNAPEFA  101

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             PD S D++  GVNYASAAAGILD TG+ + +R  L  Q+ NF  TL+ L  ++ +  + 
Sbjct  102  NPDTSGDRILNGVNYASAAAGILDETGRHYGDRYSLSQQVVNFESTLNDLRRSMGSWNLT  161

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
              + K I F+  GSNDY+ NYLMP   +T   Y   Q+A+LL+ +YS  L  L  +G RK
Sbjct  162  RYLSKSIAFLAFGSNDYINNYLMPNLYTTRFRYNSNQFANLLLNRYSRQLLALRSVGLRK  221

Query  540  FVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
             V+AG+G LGCIP   A      G+C D VN+++  FN  +K +VT  N+  PD+ FVY 
Sbjct  222  LVVAGVGPLGCIPNQRATGLTIPGRCADNVNEMLGAFNEGLKSLVTQLNSQYPDSNFVYT  281

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +   +F +I+ N +TYGF VVD  CCGVG   G+ITC+P + PC NR EYVFWDA+HPT 
Sbjct  282  NIYGIFGDILNNPETYGFRVVDTACCGVGLNRGQITCLPLQFPCLNRNEYVFWDAFHPTE  341

Query  894  AV-NVLVGKMAFSGGSDLVYPINIQQLA  974
            A  NVL G+ AF G     YPIN+QQLA
Sbjct  342  AASNVLAGR-AFRGPPSDSYPINVQQLA  368



>ref|XP_004290271.1| PREDICTED: GDSL esterase/lipase At1g71250-like [Fragaria vesca 
subsp. vesca]
Length=385

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 219/326 (67%), Gaps = 2/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID GNNN + + A++NY PYGIDF  GP+GRF+NG T +D +G  LGLP APA++
Sbjct  58   FGDSLIDVGNNNFISSFARSNYYPYGIDFRGGPSGRFTNGRTSIDMLGNLLGLPYAPAFA  117

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P+   +++  GVNYASAAAGILD TG+ + +R  L  Q+ NF  TL+QL   +    + 
Sbjct  118  DPNTKGNRILRGVNYASAAAGILDETGRHYGDRYSLSRQVMNFESTLNQLRTMMGGTNLT  177

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + + K I  +  GSNDY+ NYLMP  +++  Y+   +A+LL+ +Y+  +  L+ LG RKF
Sbjct  178  QYLAKSIAVLVFGSNDYINNYLMPFYNSSYTYSPPAFANLLLSRYATQILALHSLGLRKF  237

Query  543  VLAGIGELGCIPTMVA--RSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLD  716
            +L GIG LGCIP   A  R++ G+C+D VNQ++  FN  ++ + T  N+  P A FVY +
Sbjct  238  MLVGIGPLGCIPNQRASGRAQPGRCVDNVNQILGSFNQGLRSLATQLNSNHPGAIFVYGN  297

Query  717  TQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSA  896
                F +I+ N  +YGF+V+DR CCG+G+  G+ITC+PF  PC NR +Y+FWDA+HPT A
Sbjct  298  AYGAFGDILNNPLSYGFTVIDRACCGIGRNQGQITCLPFAVPCSNRNQYMFWDAFHPTEA  357

Query  897  VNVLVGKMAFSGGSDLVYPINIQQLA  974
             N ++   AF+G     YPIN+QQ++
Sbjct  358  ANAVLAWRAFNGPPSDSYPINVQQMS  383



>ref|XP_006836894.1| hypothetical protein AMTR_s00099p00119900 [Amborella trichopoda]
 gb|ERM99747.1| hypothetical protein AMTR_s00099p00119900 [Amborella trichopoda]
Length=351

 Score =   313 bits (802),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/329 (50%), Positives = 216/329 (66%), Gaps = 5/329 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL D GNNNNL +LAK+NY PYGIDF  GPTGRF NG TI D +G+ LGLP  P + 
Sbjct  21   FGDSLTDCGNNNNLASLAKSNYVPYGIDFFMGPTGRFCNGRTIADFLGELLGLPYIPPFE  80

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSA--QV  356
             P+     +  GVNYASAAAGILD TG    +R+ L  Q+ NF  TL++L   L      
Sbjct  81   DPNTKDRNLLSGVNYASAAAGILDETGYQLGDRISLSQQVLNFESTLNELRGVLGGVNPR  140

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            + E + K I FV  GSNDY+ NYL+P   +T+  Y+ + Y++LL+  Y+  +  L+ LG 
Sbjct  141  LMEFLSKSIAFVVFGSNDYINNYLLPSLYTTSYNYSPEAYSNLLLTHYTRQILALHSLGL  200

Query  534  RKFVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKFVLAG+G LGCIP  +A   +  G C+  VN++V  FN  ++ +VT  N   P+A F+
Sbjct  201  RKFVLAGVGPLGCIPNQLATGLAPIGSCVTYVNEIVGSFNIGLRDLVTQLNANHPNATFI  260

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y +      +I+ N  TYGF V +RGCCG+G+ +G+ITC+P  TPCPNR EYVFWDA+HP
Sbjct  261  YGNVYGALGDILHNPSTYGFKVANRGCCGLGRNEGQITCLPLATPCPNRNEYVFWDAFHP  320

Query  888  TSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            T AVN ++   AF+G   + YPIN+Q+LA
Sbjct  321  TEAVNNILAHRAFTGPPSVCYPINVQELA  349



>ref|XP_009787100.1| PREDICTED: GDSL esterase/lipase At1g71250 [Nicotiana sylvestris]
Length=373

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/328 (48%), Positives = 224/328 (68%), Gaps = 4/328 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D+GNNN + ++AK+NY PYGIDF +GPTGRFSNG T +D +G+ LG+   P ++
Sbjct  41   FGDSLVDNGNNNFINSIAKSNYYPYGIDFNRGPTGRFSNGKTFIDILGELLGIASPPPFA  100

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P     ++  GVNYASAAAGILD TGQ ++ER PL  Q+ NF  TL QL   +S   + 
Sbjct  101  DPSTRGGRILGGVNYASAAAGILDETGQHYLERYPLSQQVINFESTLSQLRTMMSPGDLN  160

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNII-YTVQQYADLLIQQYSLNLQRLYDLGARK  539
              + + I  +  GSNDY+ NYLMP   T+ I YT QQ+A+LL+  Y+  L  LY +G RK
Sbjct  161  TYLSRSIAVMVFGSNDYINNYLMPNLYTSSINYTPQQFANLLLNHYARQLVALYSVGLRK  220

Query  540  FVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNT-ALPDAKFVY  710
            F+LAG+G LGCIP  +A  +   G+C+D VNQ++  FN  +K +V + N  + P + FVY
Sbjct  221  FLLAGVGPLGCIPNQLATGQAPPGRCVDYVNQMLGSFNEGLKSLVASMNNGSHPGSIFVY  280

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
             +T  +  +I+ N+  YGF+V DR CCGVG+  G+ITC+P++ PC +R +Y+FWDA+HPT
Sbjct  281  GNTYAVIGDILNNAARYGFNVWDRACCGVGRNQGQITCMPYQFPCLDRSKYIFWDAFHPT  340

Query  891  SAVNVLVGKMAFSGGSDLVYPINIQQLA  974
             AV+ ++ + AFSG     YPIN+QQ++
Sbjct  341  QAVDAILAQRAFSGPPSDCYPINVQQMS  368



>ref|XP_006441595.1| hypothetical protein CICLE_v100203321mg, partial [Citrus clementina]
 gb|ESR54835.1| hypothetical protein CICLE_v100203321mg, partial [Citrus clementina]
Length=236

 Score =   306 bits (783),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 178/234 (76%), Gaps = 0/234 (0%)
 Frame = +3

Query  273  VERVPLKNQITNFAKTLDQLSANLSAQVVKEGIPKCIFFVGIGSNDYLTNYLMPGSSTNI  452
            V R+P   QI NF  TLDQ++ NL A  V   I +CIFFVG+GSNDYL NYLMP  +T  
Sbjct  1    VGRIPFDQQIRNFQNTLDQVTDNLGASDVSNAIARCIFFVGMGSNDYLNNYLMPNYNTKN  60

Query  453  IYTVQQYADLLIQQYSLNLQRLYDLGARKFVLAGIGELGCIPTMVARSENGQCLDEVNQV  632
             Y  QQYADLL+ +YS  L  LY+LGARKFVLAG+G +GCIP+++A+++  +C +EVNQ+
Sbjct  61   QYNAQQYADLLVSEYSRQLTTLYNLGARKFVLAGLGRMGCIPSILAQNQMDRCSEEVNQL  120

Query  633  VDPFNANMKQMVTNFNTALPDAKFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDG  812
            V PFNAN+K M+ N N  LP A+F ++D   MF +++ N ++YGFSV+DRGCCG+G+  G
Sbjct  121  VMPFNANVKTMINNLNANLPGARFTFIDIARMFEDLLTNYRSYGFSVIDRGCCGIGRNGG  180

Query  813  EITCVPFETPCPNREEYVFWDAYHPTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            +ITC+PF+TPC NRE+YVFWDA+HPT AVN++ G+ AF G   +VYP+NIQQLA
Sbjct  181  QITCLPFQTPCANREQYVFWDAFHPTEAVNIMFGRKAFYGDQSVVYPMNIQQLA  234



>ref|XP_009599586.1| PREDICTED: GDSL esterase/lipase At1g71250 [Nicotiana tomentosiformis]
Length=369

 Score =   310 bits (793),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 157/328 (48%), Positives = 223/328 (68%), Gaps = 4/328 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D+GNNN + ++AK+NY PYGIDF +GPTGRFSNG T +D +G+ LG+   P ++
Sbjct  37   FGDSLVDNGNNNFINSIAKSNYYPYGIDFNRGPTGRFSNGKTFIDILGELLGIASPPPFA  96

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P     ++  GVNYASAAAGILD TGQ ++ER  L  Q+ NF  TL QL   +S   + 
Sbjct  97   DPSTREGRILGGVNYASAAAGILDETGQHYLERYTLSQQVINFESTLSQLRTMMSPGDLN  156

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNII-YTVQQYADLLIQQYSLNLQRLYDLGARK  539
              + + I  +  GSNDY+ NYLMP   T+ I YT QQ+A+LL+  Y+  L  LY +G RK
Sbjct  157  TYLSRSIAVMVFGSNDYINNYLMPNLYTSSINYTPQQFANLLLNHYARQLVALYSIGLRK  216

Query  540  FVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNT-ALPDAKFVY  710
            F+LAG+G LGCIP  +A  +   G+C+D VNQ++  FN  ++ +V + N  + P + FVY
Sbjct  217  FLLAGVGPLGCIPNQLATGQAPPGRCVDYVNQILGSFNEGLRSLVASMNNGSHPGSIFVY  276

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
             +T  +  +I+ N+  YGF+V DR CCGVG+  G+ITC+P++ PC +R +Y+FWDA+HPT
Sbjct  277  GNTYAVIGDILNNAARYGFNVWDRACCGVGRNQGQITCMPYQFPCLDRSKYIFWDAFHPT  336

Query  891  SAVNVLVGKMAFSGGSDLVYPINIQQLA  974
             AVN ++ + A+SG     YPIN+QQ++
Sbjct  337  QAVNAILAQRAYSGPPSDCYPINVQQMS  364



>ref|XP_011083216.1| PREDICTED: GDSL esterase/lipase At5g08460-like [Sesamum indicum]
Length=367

 Score =   309 bits (791),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 162/327 (50%), Positives = 213/327 (65%), Gaps = 3/327 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL D GNNN L +LAKANY PYG+DF QGP+GRF NG T VD +G  LG+PL PAY+
Sbjct  39   FGDSLSDPGNNNYLNSLAKANYVPYGVDFYQGPSGRFCNGKTAVDYLGDMLGMPLLPAYT  98

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
            T   +   +  GVNYASAA GIL+ TGQ   ER  L  Q+ NF  TL+QL   +  + + 
Sbjct  99   TTFAAGRNILKGVNYASAAGGILEETGQNLGERFSLSGQVENFESTLNQLRRQMEDEELS  158

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
              + K +  + +GSNDY+ NYL P   +++  YT + YADLLI +Y+  +  L+ LG RK
Sbjct  159  NYLAKALAIMALGSNDYINNYLSPNFYTSSYFYTPKDYADLLINRYTRQILALHSLGFRK  218

Query  540  FVLAGIGELGCIPTMVARS--ENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            F+LAGIG LGCIP  +A      G+C+   N VV  FN  +  +V   N+    + F Y 
Sbjct  219  FLLAGIGPLGCIPNQLATGLPPPGKCVAYTNDVVGMFNNRLVSLVDQLNSNYNGSIFAYG  278

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T     +II N+KTYGFSV DRGCCG+G+  G+ITC+PF  PC NR +YVFWDA+HPT 
Sbjct  279  NTFGAVMDIINNAKTYGFSVTDRGCCGIGRNRGQITCLPFSMPCSNRNQYVFWDAFHPTQ  338

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQLA  974
            AVN ++ + A+SG     YP+N+QQ+A
Sbjct  339  AVNQILARRAYSGTPSDCYPVNVQQMA  365



>gb|KCW70983.1| hypothetical protein EUGRSUZ_F04092 [Eucalyptus grandis]
Length=332

 Score =   308 bits (788),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 161/328 (49%), Positives = 213/328 (65%), Gaps = 3/328 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDS++D GNNN L + AK NYPPYGID+  GP+GRF NG  IVD +G  LGLP  PAY+
Sbjct  4    FGDSIVDVGNNNYLNSYAKCNYPPYGIDYPTGPSGRFCNGKNIVDMLGDLLGLPSPPAYA  63

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P  +  ++  GVNYASAA GILD +G+ + ER  L  Q+ NF  TL+Q+   LS   + 
Sbjct  64   NPSTTGAKVLGGVNYASAAGGILDESGRHYGERYSLSQQVLNFENTLNQVRTMLSGTALS  123

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + + K I  + IGSNDY+ NYLMP   S++ IYT Q Y +LL+ +Y+  +  L  LG RK
Sbjct  124  QYLEKSIAVMVIGSNDYINNYLMPSMYSSSYIYTPQAYGNLLLNRYARQILALDSLGLRK  183

Query  540  FVLAGIGELGCIPTMVA--RSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            F LAGI  LGCIP   A  RS   +C+D VNQ++  FN  ++ +V   N+  P + F+Y 
Sbjct  184  FFLAGIAPLGCIPNQRASGRSPPDRCVDSVNQMLGTFNEGLRSLVQQLNSNHPGSIFLYG  243

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T     +I+ N   YGFSVVD+ CCG+G+  GEITC PF TPC +R ++VFWDAYH T 
Sbjct  244  NTYGAMGDILNNPAAYGFSVVDKACCGIGRNQGEITCAPFLTPCADRNQHVFWDAYHLTQ  303

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQLAR  977
            A N ++ + AF G     YPINIQQ+A+
Sbjct  304  AANSVLVQRAFYGPQSDCYPINIQQMAQ  331



>ref|XP_009596154.1| PREDICTED: GDSL esterase/lipase At1g33811 isoform X1 [Nicotiana 
tomentosiformis]
Length=367

 Score =   308 bits (790),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 162/332 (49%), Positives = 221/332 (67%), Gaps = 9/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN +LTLA+ANY PYGIDF QG TGRF+NG T VD + Q LG P   P Y
Sbjct  37   FGDSLVDNGNNNGILTLARANYMPYGIDFPQGATGRFTNGRTYVDILAQLLGFPNYIPPY  96

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ--  353
            +        +  G NYAS AAGI D TG    + +P+  Q+ NFA+T ++L         
Sbjct  97   ARVRGR--ALLRGANYASGAAGIRDETGNNLGDHMPMNQQVENFARTAEELRRLFRGNNN  154

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
             +   + KCIF+ G+GSNDYL NY M    ST+  YT Q YA  L+Q Y   L  LY+LG
Sbjct  155  TLNGYLSKCIFYSGLGSNDYLNNYFMTDYYSTHSQYTPQAYATALLQDYCKQLSELYNLG  214

Query  531  ARKFVLAGIGELGCIPTMVARSE--NGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKF  704
            ARK V+ G+G++GCIP  +AR +  + +C +E+N  +  FN+ +K++V  FN  LP AKF
Sbjct  215  ARKVVVTGVGQIGCIPYELARYDGNDSRCNEEINNAILLFNSGLKKLVVRFNKVLPGAKF  274

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            V+LD+    ++++ N+KTYGF VVD+GCCGVG+ +G+ITC+P + PC +R +Y+FWDA+H
Sbjct  275  VFLDSFESTKDLVVNAKTYGFEVVDKGCCGVGRNNGQITCLPLQQPCDDRSKYIFWDAFH  334

Query  885  PTSAVNVLVGKMAFSGGSD-LVYPINIQQLAR  977
            PT   N+++ K ++S  S    YPINIQQLAR
Sbjct  335  PTEVANIILAKKSYSSISKTFAYPINIQQLAR  366



>ref|XP_010065073.1| PREDICTED: GDSL esterase/lipase At1g71250 [Eucalyptus grandis]
Length=351

 Score =   308 bits (788),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 161/328 (49%), Positives = 213/328 (65%), Gaps = 3/328 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDS++D GNNN L + AK NYPPYGID+  GP+GRF NG  IVD +G  LGLP  PAY+
Sbjct  23   FGDSIVDVGNNNYLNSYAKCNYPPYGIDYPTGPSGRFCNGKNIVDMLGDLLGLPSPPAYA  82

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P  +  ++  GVNYASAA GILD +G+ + ER  L  Q+ NF  TL+Q+   LS   + 
Sbjct  83   NPSTTGAKVLGGVNYASAAGGILDESGRHYGERYSLSQQVLNFENTLNQVRTMLSGTALS  142

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + + K I  + IGSNDY+ NYLMP   S++ IYT Q Y +LL+ +Y+  +  L  LG RK
Sbjct  143  QYLEKSIAVMVIGSNDYINNYLMPSMYSSSYIYTPQAYGNLLLNRYARQILALDSLGLRK  202

Query  540  FVLAGIGELGCIPTMVA--RSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            F LAGI  LGCIP   A  RS   +C+D VNQ++  FN  ++ +V   N+  P + F+Y 
Sbjct  203  FFLAGIAPLGCIPNQRASGRSPPDRCVDSVNQMLGTFNEGLRSLVQQLNSNHPGSIFLYG  262

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T     +I+ N   YGFSVVD+ CCG+G+  GEITC PF TPC +R ++VFWDAYH T 
Sbjct  263  NTYGAMGDILNNPAAYGFSVVDKACCGIGRNQGEITCAPFLTPCADRNQHVFWDAYHLTQ  322

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQLAR  977
            A N ++ + AF G     YPINIQQ+A+
Sbjct  323  AANSVLVQRAFYGPQSDCYPINIQQMAQ  350



>gb|AAZ23955.1| GDSL-lipase 1 [Capsicum annuum]
Length=363

 Score =   308 bits (788),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 226/330 (68%), Gaps = 7/330 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D+GNNNN+ +LA+ANY PYGIDF  GPTGRFSNG T VD I +QLG    P Y+
Sbjct  36   FGDSLVDNGNNNNIQSLARANYLPYGIDFPGGPTGRFSNGKTTVDVIAEQLGFNNIPPYA  95

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-VV  359
            +     D +R GVNYASAAAGI + TG+    R+P   Q+ N+  T+ Q+   L  +   
Sbjct  96   SARGR-DILR-GVNYASAAAGIREETGRQLGARIPFSGQVNNYRNTVQQVVQILGNENAA  153

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGAR  536
             + + KCI+ +G+GSNDYL NY MP   ST+  +T +QYA++LIQQY+  L+ LY+ GAR
Sbjct  154  ADYLKKCIYSIGLGSNDYLNNYFMPMYYSTSRQFTPEQYANVLIQQYTQQLRILYNNGAR  213

Query  537  KFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVY  710
            KF L G+G++GC P  +A+ S +G+ C+  +N     FN  +K +V NFN   PDAKF+Y
Sbjct  214  KFALIGVGQIGCSPNALAQNSPDGRTCVQRINVANQIFNNKLKALVDNFNGNAPDAKFIY  273

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
            +D   +F+++I N   +GF V + GCCGVG+ +G+ITC+PF+ PCPNR EY+FWDA+HPT
Sbjct  274  IDAYGIFQDLIENPSAFGFRVTNAGCCGVGRNNGQITCLPFQRPCPNRNEYLFWDAFHPT  333

Query  891  SAVNVLVGKMAFSG-GSDLVYPINIQQLAR  977
             A N++VG+ ++    S   YP +I +LA+
Sbjct  334  EAANIIVGRRSYRAQRSSDAYPFDISRLAQ  363



>ref|XP_009770266.1| PREDICTED: GDSL esterase/lipase At1g33811 isoform X1 [Nicotiana 
sylvestris]
Length=367

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 162/332 (49%), Positives = 220/332 (66%), Gaps = 9/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN +LTLA+ANY PYGIDF QG TGRF+NG T VD + Q LG     P Y
Sbjct  37   FGDSLVDNGNNNGILTLARANYMPYGIDFPQGATGRFTNGRTYVDILAQLLGFSNYIPPY  96

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ--  353
            S        +  G NYAS AAGI D TG    + + +  Q+ NFA+T+++L         
Sbjct  97   SRVRGR--ALLRGANYASGAAGIRDETGNNLGDHMSMNQQVENFARTVEELRRLFRGNNN  154

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
             +   + KCIF+ G+GSNDYL NY M    ST+  YT Q YA  L+Q Y   L  LY+LG
Sbjct  155  ALNGYLSKCIFYSGLGSNDYLNNYFMTDYYSTHSQYTPQAYATALLQDYCKQLSELYNLG  214

Query  531  ARKFVLAGIGELGCIPTMVARSE--NGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKF  704
            ARK V+ G+G++GCIP  +AR +  + +C +E+N  +  FN+ +K++V  FN  LP AKF
Sbjct  215  ARKVVVTGVGQIGCIPYELARYDGNDSRCNEEINNAILLFNSGLKKLVVRFNKVLPGAKF  274

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            V+LD+    ++++ N+KTYGF VVD+GCCGVG+ +G+ITC+P + PC +R +Y+FWDA+H
Sbjct  275  VFLDSFESTKDLVVNAKTYGFEVVDKGCCGVGRNNGQITCLPLQQPCEDRSKYIFWDAFH  334

Query  885  PTSAVNVLVGKMAFSGGSD-LVYPINIQQLAR  977
            PT   N+++ K +FS  S    YPINIQQLAR
Sbjct  335  PTEVANIILAKKSFSSISKTFAYPINIQQLAR  366



>ref|XP_010687162.1| PREDICTED: GDSL esterase/lipase At5g45670 [Beta vulgaris subsp. 
vulgaris]
Length=363

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 166/333 (50%), Positives = 226/333 (68%), Gaps = 12/333 (4%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGL---PLAP  173
            FGDSL+D+GNNNN+ +LA+ANY PYGIDF  GPTGRFSNG T VD I +QLG    PLA 
Sbjct  34   FGDSLVDNGNNNNIASLARANYLPYGIDFPAGPTGRFSNGKTTVDVIAEQLGFEDYPLAY  93

Query  174  AYSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ  353
            A ++ +   D +R GVNYASAAAGI + TGQ    R+    Q+ N+  T+ Q+   L  +
Sbjct  94   AQASGE---DILR-GVNYASAAAGIREETGQQLGGRISFGGQVRNYQSTVSQVVQILGDE  149

Query  354  -VVKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDL  527
                  + +CI+ +G+GSNDYL NY MP    T+  Y  QQYAD+LIQ+YS +++ LY+ 
Sbjct  150  DQASSYLSRCIYSIGLGSNDYLNNYFMPMYYQTSRQYNPQQYADVLIQEYSQHIRSLYNY  209

Query  528  GARKFVLAGIGELGCIPTMVA-RSENG-QCLDEVNQVVDPFNANMKQMVTNFNTALPDAK  701
            GARKF L GIG++GC P  +A RS +G  C D VN     FN+ ++ +V   N  L DA+
Sbjct  210  GARKFALIGIGQIGCSPNQLAQRSPDGATCDDTVNSANRIFNSGLRSLVQQLNNELSDAR  269

Query  702  FVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAY  881
            F Y++  +MF+++I N   YGF V + GCCGVG+ +G+ITC+P +TPCPNR+EYVFWDA+
Sbjct  270  FAYINVYDMFQDLIENPSNYGFRVTNAGCCGVGRNNGQITCLPLQTPCPNRDEYVFWDAF  329

Query  882  HPTSAVNVLVGKMAFSG-GSDLVYPINIQQLAR  977
            HP  A NV++G+ ++S   S   YP +IQ+LA+
Sbjct  330  HPGEAANVIIGRRSYSAQSSSDAYPFDIQRLAQ  362



>ref|NP_001149080.1| anther-specific proline-rich protein APG precursor [Zea mays]
 gb|ACF78736.1| unknown [Zea mays]
 gb|ACF85836.1| unknown [Zea mays]
 gb|ACG32365.1| anther-specific proline-rich protein APG [Zea mays]
 gb|ACG34104.1| anther-specific proline-rich protein APG [Zea mays]
 tpg|DAA57639.1| TPA: anther-specific proline-rich protein APG [Zea mays]
Length=369

 Score =   307 bits (786),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 166/332 (50%), Positives = 228/332 (69%), Gaps = 11/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN++ +LA+ANYPPYGIDF  GPTGRFSNG T VDAI + LG     PAY
Sbjct  41   FGDSLVDNGNNNDIASLARANYPPYGIDFAAGPTGRFSNGLTTVDAISRLLGFDDYIPAY  100

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +    S DQ+  GVN+ASAAAGI D TGQ   +R+    Q+ N+   + QL + L  +  
Sbjct  101  A--GASGDQLLTGVNFASAAAGIRDETGQQLGQRISFGGQLQNYQAAVQQLVSILGDEDS  158

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + +CIF VG+GSNDYL NY MP   ST+  YT +QYAD+LI QYS  L+ LY  GA
Sbjct  159  AASHLSQCIFTVGMGSNDYLNNYFMPAVYSTSQQYTPEQYADVLINQYSQQLRTLYSYGA  218

Query  534  RKFVLAGIGELGCIPTMVA-RSENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK  L G+G++GC P  +A RS +G  C+ ++N  +D FN  +  +V  FN ALP A F 
Sbjct  219  RKVALMGVGQVGCSPNELAQRSTDGTTCVPQINGAIDIFNRKLVALVDQFN-ALPGAHFT  277

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F++I+    ++G +V ++GCCGVG+ +G++TC+PF+TPC NR EY+FWDA+HP
Sbjct  278  YINVYGIFQDILRAPGSHGLTVTNQGCCGVGRNNGQVTCLPFQTPCANRNEYLFWDAFHP  337

Query  888  TSAVNVLVGKMAFSGG--SDLVYPINIQQLAR  977
            T A N+LVG+ A+S    SD V+P++++ LAR
Sbjct  338  TEAANILVGRRAYSAALPSD-VHPMDLRTLAR  368



>gb|KDP21169.1| hypothetical protein JCGZ_21640 [Jatropha curcas]
Length=368

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 162/332 (49%), Positives = 231/332 (70%), Gaps = 10/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP--LAPA  176
            FGDSL+D+GNNN L +LA+ANY PYGIDF +GPTGRFSNG T VD I + LG    ++P 
Sbjct  39   FGDSLVDNGNNNQLTSLARANYLPYGIDFPRGPTGRFSNGKTTVDVIAESLGFNGYISP-  97

Query  177  YSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-  353
            YST     D +R GVNYASAAAGI + TGQ   +R+    Q+ N+  T+ Q+   L  + 
Sbjct  98   YSTARGQ-DILR-GVNYASAAAGIREETGQQLGQRISFSGQVKNYQNTVSQIVNLLGDEN  155

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
                 + KCIF +G+GSNDYL NY MP   S++  YT +QYA++LIQQY+  L+ LYD G
Sbjct  156  TTANYLSKCIFSIGLGSNDYLNNYFMPQFYSSSRQYTPEQYANVLIQQYTQQLRILYDNG  215

Query  531  ARKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKF  704
             RKFVL G+G++GC P+ +A+ S +G+ C+  +N     FN  ++ +V+ FN+  PDA+F
Sbjct  216  GRKFVLIGLGQIGCSPSELAQNSPDGRTCVQRINSANQIFNNKLRSLVSQFNSNTPDARF  275

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            +Y++   MF++I +N   YGF+V + GCCGVG+ +G+ITC+PF+TPC NR +Y+FWDA+H
Sbjct  276  IYVNVYGMFQDITSNPARYGFTVTNAGCCGVGRNNGQITCLPFQTPCQNRNQYLFWDAFH  335

Query  885  PTSAVNVLVGKMAFSG-GSDLVYPINIQQLAR  977
            PT A N+++G+ ++S   S   YP +I++LA+
Sbjct  336  PTEAANIIIGRRSYSAQSSSDAYPFDIRRLAQ  367



>emb|CBI16986.3| unnamed protein product [Vitis vinifera]
Length=363

 Score =   306 bits (784),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 163/327 (50%), Positives = 214/327 (65%), Gaps = 6/327 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID GNNN L ++AK+NY PYGIDF +GPTGRF NG TIVD + + LG+     ++
Sbjct  38   FGDSLIDDGNNNFLDSIAKSNYYPYGIDF-RGPTGRFCNGKTIVDLLAEMLGVSYPQPFA  96

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P  +  ++  GVNYASAAAGILD TGQ + +R  L  Q+ NF  TL Q+    +   + 
Sbjct  97   DPGSTGSKIFSGVNYASAAAGILDETGQNYGQRFSLSQQVLNFETTLSQMRTMANGTTLS  156

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG---SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + K I  +  GSNDYL NYLMP    SS N  Y+   +A+LL+  Y+  +  LY LG 
Sbjct  157  RYLAKSIVIMVFGSNDYLNNYLMPSLYPSSYN--YSPPDFANLLLNHYARQILALYSLGL  214

Query  534  RKFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            RKF LAGIG LGC+P   A +  G+CLD  NQ++  FN  ++ +V   N   P + FVY 
Sbjct  215  RKFFLAGIGPLGCMPNQRALAPPGRCLDYDNQILGTFNEGLRALVNQLNGNHPGSIFVYG  274

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T  +F +I+ N  TYGFSVVDRGCCG+G+  G+ITC+P + PC NR EYVFWDA+HPT+
Sbjct  275  NTYGIFGDILNNPATYGFSVVDRGCCGLGRNQGQITCLPMQMPCLNRNEYVFWDAFHPTT  334

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQLA  974
            A NV++ + AF G     YPIN+QQ+A
Sbjct  335  AANVILAQTAFYGPPSDCYPINVQQMA  361



>ref|XP_002266194.2| PREDICTED: GDSL esterase/lipase At1g71250 [Vitis vinifera]
Length=367

 Score =   306 bits (785),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 163/327 (50%), Positives = 214/327 (65%), Gaps = 6/327 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID GNNN L ++AK+NY PYGIDF +GPTGRF NG TIVD + + LG+     ++
Sbjct  42   FGDSLIDDGNNNFLDSIAKSNYYPYGIDF-RGPTGRFCNGKTIVDLLAEMLGVSYPQPFA  100

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P  +  ++  GVNYASAAAGILD TGQ + +R  L  Q+ NF  TL Q+    +   + 
Sbjct  101  DPGSTGSKIFSGVNYASAAAGILDETGQNYGQRFSLSQQVLNFETTLSQMRTMANGTTLS  160

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG---SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + K I  +  GSNDYL NYLMP    SS N  Y+   +A+LL+  Y+  +  LY LG 
Sbjct  161  RYLAKSIVIMVFGSNDYLNNYLMPSLYPSSYN--YSPPDFANLLLNHYARQILALYSLGL  218

Query  534  RKFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            RKF LAGIG LGC+P   A +  G+CLD  NQ++  FN  ++ +V   N   P + FVY 
Sbjct  219  RKFFLAGIGPLGCMPNQRALAPPGRCLDYDNQILGTFNEGLRALVNQLNGNHPGSIFVYG  278

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T  +F +I+ N  TYGFSVVDRGCCG+G+  G+ITC+P + PC NR EYVFWDA+HPT+
Sbjct  279  NTYGIFGDILNNPATYGFSVVDRGCCGLGRNQGQITCLPMQMPCLNRNEYVFWDAFHPTT  338

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQLA  974
            A NV++ + AF G     YPIN+QQ+A
Sbjct  339  AANVILAQTAFYGPPSDCYPINVQQMA  365



>ref|XP_006858605.1| hypothetical protein AMTR_s00071p00200630 [Amborella trichopoda]
 gb|ERN20072.1| hypothetical protein AMTR_s00071p00200630 [Amborella trichopoda]
Length=366

 Score =   306 bits (783),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 161/336 (48%), Positives = 229/336 (68%), Gaps = 14/336 (4%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN++LTLA+ANY PYG+DF  G TGRF NG T VD +   LG     P Y
Sbjct  33   FGDSLVDNGNNNDILTLARANYLPYGVDFPGGVTGRFCNGRTTVDFLAAFLGFSEYIPPY  92

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ--  353
            +T   +   +  GVN+AS AAGI D TG+   E + +  Q+ NFA++++++ A LS    
Sbjct  93   ATTSGT--ALLRGVNFASGAAGIRDETGRNLGEHLSMNQQVANFARSVEEMRALLSRSNI  150

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
             V   + KCIF VG+GSNDYL NY MP   +T   YT ++YA  LIQ Y   L  LY+LG
Sbjct  151  SVTAYLRKCIFSVGMGSNDYLNNYFMPDYYNTGSQYTPREYASSLIQDYGRQLMELYELG  210

Query  531  ARKFVLAGIGELGCIPTMVARSEN-----GQCLDEVNQVVDPFNANMKQMVTNFNTALPD  695
            ARK  + G+G++GCIP  +ARS N      +C+  +N  +  FN+ +  +V +FN+ LP 
Sbjct  211  ARKVAVIGVGQIGCIPYELARSTNDDANGARCVSRINNAIILFNSGLLSLVKSFNSRLPG  270

Query  696  AKFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWD  875
            AKF Y+++ + F+++IAN+ +YGF+VVD+GCCGVG+ +G++TC+PF+ PC NR EY+FWD
Sbjct  271  AKFTYINSYSSFQHLIANASSYGFTVVDKGCCGVGRNNGQVTCLPFQQPCSNRTEYIFWD  330

Query  876  AYHPTSAVNVLVGKMAFSGG--SDLVYPINIQQLAR  977
            A+HPT A N+++ + A++    SD  YPINI+QLA+
Sbjct  331  AFHPTEAANIILAQKAYASKYCSD-AYPINIRQLAK  365



>ref|XP_004250819.1| PREDICTED: GDSL esterase/lipase At1g71250 [Solanum lycopersicum]
Length=359

 Score =   305 bits (782),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 156/328 (48%), Positives = 222/328 (68%), Gaps = 4/328 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D+GNNN L T+AKANY PYGIDF++GPTGRFSNG T VD +G+ LG+P  P ++
Sbjct  28   FGDSLVDNGNNNFLNTIAKANYFPYGIDFSRGPTGRFSNGKTFVDILGELLGVPSPPPFA  87

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P    +++  GVNYASAA GILD TG+ +++R  L  Q+ NF  TL QL   +S   + 
Sbjct  88   NPSTRGERILGGVNYASAAGGILDETGKHYMDRYTLSQQVINFESTLSQLRTMMSPGDLN  147

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
              + + I  +  GSNDY+ NYL+P   ST+I Y  QQ+++LL+  Y+  L  LY +G RK
Sbjct  148  TYLSRSIAVMVFGSNDYINNYLLPSLYSTSINYNPQQFSNLLLNHYARQLVALYSVGLRK  207

Query  540  FVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNT-ALPDAKFVY  710
            F++AG+G LGCIP  +A  +   G+C+D VNQ++  FN  ++ +VT  N  + P A FVY
Sbjct  208  FLIAGVGPLGCIPNQLATGQAPPGRCVDYVNQILGSFNEGLRSLVTRLNNGSHPGAVFVY  267

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
             +T     +I+ N   YGF+V DR CCGVG+  G+ITC+P++ PC +R +Y+FWDA+HPT
Sbjct  268  GNTYAAIGDILNNPARYGFNVWDRACCGVGRNQGQITCLPYQFPCLDRSKYIFWDAFHPT  327

Query  891  SAVNVLVGKMAFSGGSDLVYPINIQQLA  974
             AV+ ++ + A+ G     YP+N+QQ+A
Sbjct  328  QAVDAILAQRAYYGPPSDCYPMNVQQMA  355



>ref|XP_006441809.1| hypothetical protein CICLE_v10023910mg [Citrus clementina]
 gb|ESR55049.1| hypothetical protein CICLE_v10023910mg [Citrus clementina]
Length=366

 Score =   305 bits (782),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 160/326 (49%), Positives = 213/326 (65%), Gaps = 4/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D GNNN L ++AK+NY PYG+DF  GPTGRFSNG T VD IG+ +GLP   A++
Sbjct  39   FGDSLVDVGNNNYLSSIAKSNYYPYGVDFEYGPTGRFSNGKTFVDFIGKIMGLPYPLAFA  98

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P+ +  ++  GV+YASAAAGILD TGQ + +R  L  Q+ NF  TL+QL   + A  + 
Sbjct  99   DPNTNGARLLGGVDYASAAAGILDETGQHYGQRYTLSQQVLNFESTLNQLRGIMGASNLT  158

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
              + K I  +  GSNDY+ NYLMP   S++  Y   QYA+LL+  Y+  L  LY +G RK
Sbjct  159  NYLSKSIAIMVFGSNDYINNYLMPSIYSSSFYYNPSQYANLLLNHYARQLLALYSVGLRK  218

Query  540  FVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            F LAGIG LGCIP      +   G+C+D VNQ++ PFN  ++ +V   N   P A FVY 
Sbjct  219  FFLAGIGPLGCIPNQRGSGQAPPGRCVDYVNQILGPFNEGLRSLVDQLNKR-PGAMFVYG  277

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T     +I+ N  T+GF+VVDR CCG+G+  G+ITC+PF  PC NR +YVFWDA+HPT 
Sbjct  278  NTYGAVGDILNNPATFGFNVVDRACCGIGRNQGQITCLPFAMPCFNRNQYVFWDAFHPTE  337

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQL  971
            AVN ++ + A  G S   YPIN+  +
Sbjct  338  AVNAILARRAIYGSSADCYPINMLNM  363



>ref|XP_007025248.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY27870.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=361

 Score =   305 bits (781),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 162/331 (49%), Positives = 226/331 (68%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+ANY PYGIDF  GPTGRFSNG T +D I + LG     P Y
Sbjct  32   FGDSLVDNGNNNQLSSLARANYLPYGIDFPNGPTGRFSNGKTTIDVIAELLGFDNYIPPY  91

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            ST   S  Q+  GVNYASAAAGI + TGQ    R+    Q+ N+ +T+ Q+   L  +  
Sbjct  92   STV--SGRQILGGVNYASAAAGIREETGQQLGGRISFSGQVRNYRETVSQVVNLLGDEDT  149

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ +G+GSNDYL NY MP   ST+  Y  +QYAD+LIQQY+  LQ LY+ GA
Sbjct  150  AANYLSKCIYSIGLGSNDYLNNYFMPAFYSTSRQYNPEQYADVLIQQYTEQLQDLYNYGA  209

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKFVL G+G++GC P  +A+ S +G+ C++ +N     FN+ ++ +V  FN    DAKF+
Sbjct  210  RKFVLVGLGQIGCSPNELAQNSGDGRTCVERINDANRIFNSKLRALVDQFNNNNSDAKFI  269

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F++I +N   YGF V + GCCGVG+ +G+ITC+P++TPC NR+EY+FWDA+HP
Sbjct  270  YINAYGIFQDITSNPAAYGFKVTNAGCCGVGRNNGQITCLPYQTPCQNRDEYLFWDAFHP  329

Query  888  TSAVNVLVGKMAFSG-GSDLVYPINIQQLAR  977
              A NV++G+ ++S   S   YPI+I++LA+
Sbjct  330  GEAANVIIGRRSYSAQSSSDAYPIDIRRLAQ  360



>gb|KDO51376.1| hypothetical protein CISIN_1g036887mg [Citrus sinensis]
Length=366

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 160/326 (49%), Positives = 212/326 (65%), Gaps = 4/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D GNNN L ++AK+NY PYG+DF  GPTGRFSNG T VD IG+ +GLP   A++
Sbjct  39   FGDSLVDVGNNNYLSSIAKSNYYPYGVDFEYGPTGRFSNGKTFVDFIGKIMGLPYPLAFA  98

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P+ +  ++  GVNYASAAAGILD TGQ + +R  L  Q+ NF  TL+QL   + A  + 
Sbjct  99   DPNTNGARLLGGVNYASAAAGILDETGQHYGQRYTLSQQVLNFESTLNQLRGIMGASNLT  158

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
              + K I  +  GSNDY+ NYLMP   S++  Y   QYA+LL+  Y+  L  LY +G R 
Sbjct  159  NYLSKSIAIMVFGSNDYINNYLMPSIYSSSFYYNPSQYANLLLNHYARQLLALYSVGLRN  218

Query  540  FVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            F LAGIG LGCIP      +   G+C+D VNQ++ PFN  ++ +V   N   P A FVY 
Sbjct  219  FFLAGIGPLGCIPNQRGSGQAPPGRCVDYVNQILGPFNEGLRSLVDQLNKR-PGAMFVYG  277

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T     +I+ N  T+GF+VVDR CCG+G+  G+ITC+PF  PC NR +YVFWDA+HPT 
Sbjct  278  NTYGSVGDILNNPATFGFNVVDRACCGIGRNQGQITCLPFAMPCFNRNQYVFWDAFHPTE  337

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQL  971
            AVN ++ + A  G S   YPIN+  +
Sbjct  338  AVNAILARRAVYGSSADCYPINMLNM  363



>ref|XP_010025680.1| PREDICTED: GDSL esterase/lipase At5g08460-like [Eucalyptus grandis]
 gb|KCW62404.1| hypothetical protein EUGRSUZ_H05057 [Eucalyptus grandis]
Length=369

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/329 (47%), Positives = 217/329 (66%), Gaps = 5/329 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID GNNN L + AKAN+ PYG+DF  GP+GRF NG TI+D +G+ L LP  PAY 
Sbjct  38   FGDSLIDDGNNNYLNSYAKANFLPYGVDFDGGPSGRFCNGKTIIDFLGELLDLPYIPAYV  97

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                    +  GVNYASAAAGILD +G+   +R  L+ Q+ NF  TL QL   +  + ++
Sbjct  98   NTLEDAQSILRGVNYASAAAGILDESGRELGDRFSLRQQVENFRSTLSQLKNQMGEEELR  157

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
              + K +  + +GSNDYL NYLMP    T+ ++    YA LLI  Y+  ++ L+DLG RK
Sbjct  158  RYLAKSLVMMNLGSNDYLNNYLMPSLYVTSSLFNPNDYAQLLITNYTTYIEALHDLGLRK  217

Query  540  FVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMV--TNFNTALPDAKFV  707
            F++ GIG LGC+P  +A   +  G+C+  VN +V  FN  ++ +V   N N     A FV
Sbjct  218  FLITGIGPLGCMPNQLATGADASGKCISSVNNMVGLFNVRLRSLVDQLNANAHGEGAIFV  277

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y +T ++F +I++N+  YGF VVDRGCCG+G+  GE++C+P + PC NR+EYVFWDA+HP
Sbjct  278  YGNTFDVFSDILSNANAYGFKVVDRGCCGLGRNQGEVSCLPLQVPCMNRDEYVFWDAFHP  337

Query  888  TSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            T A+N ++ + A++G   + YPIN++Q+A
Sbjct  338  TQAMNKIIAERAYAGPPSVCYPINVKQMA  366



>ref|XP_006478360.1| PREDICTED: GDSL esterase/lipase At1g71250-like [Citrus sinensis]
Length=375

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 160/326 (49%), Positives = 212/326 (65%), Gaps = 4/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D GNNN L ++AK+NY PYG+DF  GPTGRFSNG T VD IG+ +GLP   A++
Sbjct  48   FGDSLVDVGNNNYLSSIAKSNYYPYGVDFEYGPTGRFSNGKTFVDFIGKIMGLPYPLAFA  107

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P+ +  ++  GVNYASAAAGILD TGQ + +R  L  Q+ NF  TL+QL   + A  + 
Sbjct  108  DPNTNGARLLGGVNYASAAAGILDETGQHYGQRYTLSQQVLNFESTLNQLRGIMGASNLT  167

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
              + K I  +  GSNDY+ NYLMP   S++  Y   QYA+LL+  Y+  L  LY +G R 
Sbjct  168  NYLSKSIAIMVFGSNDYINNYLMPSIYSSSFYYNPSQYANLLLNHYARQLLALYSVGLRN  227

Query  540  FVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            F LAGIG LGCIP      +   G+C+D VNQ++ PFN  ++ +V   N   P A FVY 
Sbjct  228  FFLAGIGPLGCIPNQRGSGQAPPGRCVDYVNQILGPFNEGLRSLVDQLNKR-PGAMFVYG  286

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T     +I+ N  T+GF+VVDR CCG+G+  G+ITC+PF  PC NR +YVFWDA+HPT 
Sbjct  287  NTYGSVGDILNNPATFGFNVVDRACCGIGRNQGQITCLPFAMPCFNRNQYVFWDAFHPTE  346

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQL  971
            AVN ++ + A  G S   YPIN+  +
Sbjct  347  AVNAILARRAVYGSSADCYPINMLNM  372



>ref|XP_006339350.1| PREDICTED: GDSL esterase/lipase At1g33811-like [Solanum tuberosum]
Length=360

 Score =   303 bits (777),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 220/332 (66%), Gaps = 9/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN +LTLA+ANY PYG+DF QG TGRF+NG T VD + Q LG P   P Y
Sbjct  30   FGDSLVDNGNNNGILTLARANYMPYGLDFPQGATGRFTNGRTFVDILAQLLGFPNYIPPY  89

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSA--Q  353
            +        +  G NYAS AAGI D TG    + +P+  Q+ NF +++++L         
Sbjct  90   ARVRGRA--LLRGANYASGAAGIRDETGNNLGDHMPMNQQVGNFGRSVEELRRLFRGDNS  147

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
             +   + KCI + G+GSNDYL NY M    ST+  YT Q+YA  L+Q Y   L  LY LG
Sbjct  148  TLNAYLSKCILYSGLGSNDYLNNYFMTDYYSTHSQYTPQEYASALLQDYCQQLSELYKLG  207

Query  531  ARKFVLAGIGELGCIPTMVARSE-NG-QCLDEVNQVVDPFNANMKQMVTNFNTALPDAKF  704
             RK ++  IG++GCIP  +AR + NG +C +E+N  +  FN+ +K++V +FN  LP AKF
Sbjct  208  GRKVIVTAIGQIGCIPYQLARYDGNGSRCNEEINDAIQLFNSGLKRLVIHFNKVLPGAKF  267

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            V+LD+    ++++ N+KTYGF VVD+GCCGVG+ +G+ITC+P + PC +R +Y+FWDA+H
Sbjct  268  VFLDSFESSKDLVLNAKTYGFEVVDKGCCGVGRNNGQITCLPLQQPCEDRSKYIFWDAFH  327

Query  885  PTSAVNVLVGKMAFSGGSDLV-YPINIQQLAR  977
            PT   N+L+ K +++  S    YPINIQQLAR
Sbjct  328  PTEVANILLAKKSYTSKSKTFNYPINIQQLAR  359



>ref|XP_004969944.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Setaria italica]
Length=366

 Score =   303 bits (777),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 165/332 (50%), Positives = 226/332 (68%), Gaps = 11/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN++ +LA+ANYPPYGIDF  G TGRFSNG T VDAI + LG     PAY
Sbjct  38   FGDSLVDNGNNNDIASLARANYPPYGIDFPGGATGRFSNGLTTVDAISRLLGFDDYIPAY  97

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +    S DQ+  GVN+ASAAAGI D TGQ   +R+    Q+ N+   + QL + L  +  
Sbjct  98   A--GASNDQLLTGVNFASAAAGIRDETGQQLGQRISFGGQLQNYQAAVQQLVSILGDEDS  155

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + +CIF VG+GSNDYL NY MP   ST+  YT +QYAD L  QYS  L+ LY+ GA
Sbjct  156  AANHLSQCIFTVGMGSNDYLNNYFMPAVYSTSQQYTPEQYADALAGQYSQQLRTLYNYGA  215

Query  534  RKFVLAGIGELGCIPTMVA-RSENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK  L G+G++GC P  +A RS +G  C+ E+N  +D FN  +  +V  FN ALP A F 
Sbjct  216  RKVALMGVGQVGCSPNELAQRSPDGATCVSEINAAIDIFNRRLVALVDQFN-ALPGAHFT  274

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F +I+ +  ++G +V +RGCCGVG+ +G++TC+PF+TPC NR EY+FWDA+HP
Sbjct  275  YINAYGIFEDILRSPGSHGLTVTNRGCCGVGRNNGQVTCLPFQTPCTNRNEYLFWDAFHP  334

Query  888  TSAVNVLVGKMAFSGG--SDLVYPINIQQLAR  977
            T A N+LVG+ A+S    SD V+P++++ LA+
Sbjct  335  TEAANILVGRRAYSAALPSD-VHPVDLRTLAQ  365



>ref|XP_002456353.1| hypothetical protein SORBIDRAFT_03g034560 [Sorghum bicolor]
 gb|EES01473.1| hypothetical protein SORBIDRAFT_03g034560 [Sorghum bicolor]
Length=370

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 163/332 (49%), Positives = 225/332 (68%), Gaps = 11/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN++ +LA+ANYPPYGIDF  G TGRFSNG T VDAI + LG     PAY
Sbjct  42   FGDSLVDNGNNNDIASLARANYPPYGIDFAGGATGRFSNGLTTVDAISRLLGFDDYIPAY  101

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +    S DQ+  GVN+ASAAAGI D TGQ   +R+    Q+ N+   + QL + L  +  
Sbjct  102  A--GASGDQLLTGVNFASAAAGIRDETGQQLGQRISFGGQLQNYQAAVQQLVSILGDEDS  159

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + +CIF VG+GSNDYL NY MP   ST+  YT  QYAD+LI QYS  ++ LY+ GA
Sbjct  160  AANHLSQCIFTVGMGSNDYLNNYFMPAVYSTSQQYTPAQYADVLIDQYSQQVRTLYNYGA  219

Query  534  RKFVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK  L G+G++GC P  +A+  ++   C+ E+N  +D FN  +  +V  FN ALP A F 
Sbjct  220  RKVALMGVGQVGCSPNELAQHSADGATCVPEINGAIDIFNRKLVALVDQFN-ALPGAHFT  278

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F +I+    ++G +V +RGCCGVG+ +G++TC+PF+TPC NR EY+FWDA+HP
Sbjct  279  YINVYGIFEDILRAPGSHGLTVTNRGCCGVGRNNGQVTCLPFQTPCANRNEYLFWDAFHP  338

Query  888  TSAVNVLVGKMAFSGG--SDLVYPINIQQLAR  977
            T A NVLVG+ A+S    SD V+P++++ LA+
Sbjct  339  TEAANVLVGRRAYSAAQPSD-VHPVDLRTLAQ  369



>ref|XP_006852691.1| hypothetical protein AMTR_s00021p00254410 [Amborella trichopoda]
 gb|ERN14158.1| hypothetical protein AMTR_s00021p00254410 [Amborella trichopoda]
Length=436

 Score =   305 bits (782),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 163/335 (49%), Positives = 227/335 (68%), Gaps = 16/335 (5%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLG-----LPL  167
            FGDSL+D+GNNNN+ +LA+ANYPPYGIDF QGPTGRFSNG T  D   Q LG     LP 
Sbjct  107  FGDSLVDNGNNNNIASLARANYPPYGIDFPQGPTGRFSNGLTTTDVTAQLLGFNQLILPY  166

Query  168  APAYSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLS  347
            A A      S  Q+  GVNYASAAAGI + TGQ    R+P   QI N+  T++Q+ A L 
Sbjct  167  ATA------SGRQILRGVNYASAAAGIREETGQQLGARIPFGGQIENYRNTVNQVIALLG  220

Query  348  AQ-VVKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLY  521
             +    + + KCI+ VG+G+NDYL NY MP   ST+  YT Q YAD+LIQQY+  L +LY
Sbjct  221  DEDSAADYLSKCIYSVGMGNNDYLNNYFMPALYSTSRQYTPQAYADVLIQQYTRQLTQLY  280

Query  522  DLGARKFVLAGIGELGCIPTMVAR-SENG-QCLDEVNQVVDPFNANMKQMVTNFNTALPD  695
            +LGARK  L G+G++GC P  +A+ S NG  C+  +NQ +  FN+ ++ +V  FN     
Sbjct  281  NLGARKVALIGVGQIGCSPNALAQNSPNGATCVQRLNQPIQIFNSRLRSLVDYFNNNFQG  340

Query  696  AKFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWD  875
            A F+Y++   +F ++I+  + YGF+V + GCCGVG+ +G+ITC+P++TPC NR +YVFWD
Sbjct  341  AAFIYVNAYGIFDDLISRPRAYGFTVTNVGCCGVGRNNGQITCLPYQTPCQNRRQYVFWD  400

Query  876  AYHPTSAVNVLVGKMAFSG-GSDLVYPINIQQLAR  977
            A+HPT A N+++ + +++   S   YPI+I++LA+
Sbjct  401  AFHPTEAANIVIARRSYAAQSSSDAYPIDIRRLAQ  435



>gb|KHG24391.1| hypothetical protein F383_02353 [Gossypium arboreum]
Length=362

 Score =   302 bits (774),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 164/332 (49%), Positives = 224/332 (67%), Gaps = 10/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LAKANY PYGIDF  GPTGRFSNG T VD I + LG     P Y
Sbjct  33   FGDSLVDNGNNNRLSSLAKANYMPYGIDFPNGPTGRFSNGKTTVDVIAELLGFENYIPPY  92

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-  356
            S       Q+  GVNYASAAAGI + TGQ    R+    Q+ N+ +T+ Q+   L ++  
Sbjct  93   SAARGR--QILGGVNYASAAAGIREETGQQLGARISFSGQVRNYRQTVSQVVNLLGSEAN  150

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ +G+GSNDYL NY MP   ST+  Y  +QYA++LIQQY+  LQ LY+ GA
Sbjct  151  AANYLSKCIYSIGLGSNDYLNNYFMPLFYSTSRRYNPEQYANVLIQQYTQQLQALYNYGA  210

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKFVL G+G++GC P  +A+ S +G+ C++ +N     FN  +K +V  FN A  DAKF+
Sbjct  211  RKFVLIGLGQIGCSPNELAQNSRDGRTCVERINAANRIFNNKLKGLVDQFNNANSDAKFI  270

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y+D   +F++I +N   YGF V + GCCGVG+ +G+ITC+P + PC NR EY+FWDA+HP
Sbjct  271  YIDVYGIFQDITSNPSAYGFRVTNAGCCGVGRNNGQITCLPLQRPCRNRNEYLFWDAFHP  330

Query  888  TSAVNVLVGKMAFSGG--SDLVYPINIQQLAR  977
            T A NV++G+ +++    SD  YPI+I++LA+
Sbjct  331  TEAANVIIGRRSYNAQKPSD-AYPIDIRRLAQ  361



>ref|XP_006362723.1| PREDICTED: GDSL esterase/lipase At1g71250-like [Solanum tuberosum]
Length=357

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 157/328 (48%), Positives = 219/328 (67%), Gaps = 4/328 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D+GNNN L T+AKANY PYGIDF++GPTGRFSNG T VD +G+ LG+   P ++
Sbjct  26   FGDSLVDNGNNNFLNTIAKANYFPYGIDFSRGPTGRFSNGKTFVDILGELLGVASPPPFA  85

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P    +++  GVNYASAA GILD TG+ ++ER  L  Q+ NF  TL QL   +S   + 
Sbjct  86   NPSTRGERILGGVNYASAAGGILDETGKHYMERFTLSQQVINFESTLSQLRTMMSPGDLN  145

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNII-YTVQQYADLLIQQYSLNLQRLYDLGARK  539
              + K I  +  GSNDY+ NYL+P   T+ I Y  QQ+++LL+  Y+  L  LY +G RK
Sbjct  146  TYLSKSIAVMVFGSNDYINNYLLPSLYTSSINYNPQQFSNLLLNHYARQLVALYSVGLRK  205

Query  540  FVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNTAL-PDAKFVY  710
            F++AG+G LGCIP  +A  +   G+C+D VNQ++  FN  +K +V+  N    P A FVY
Sbjct  206  FLVAGVGPLGCIPNQLATGQAPPGRCVDYVNQILGSFNEGLKSLVSIMNNGTHPGAVFVY  265

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
             +T     +I+ N   YGF+V DR CCGVG+  G+ITC+P++ PC +R +Y+FWDA+HPT
Sbjct  266  GNTYAAIGDILNNPARYGFNVWDRACCGVGRNQGQITCLPYQFPCLDRSKYIFWDAFHPT  325

Query  891  SAVNVLVGKMAFSGGSDLVYPINIQQLA  974
             AV+ ++ + A+ G     YPIN+QQ+A
Sbjct  326  QAVDAILAQRAYYGPPSDCYPINVQQMA  353



>ref|XP_011095134.1| PREDICTED: GDSL esterase/lipase At1g71250 [Sesamum indicum]
Length=386

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 216/330 (65%), Gaps = 8/330 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D+GNNN L ++AK+NY PYG+D  +GPTGRFSNG T VD +G  LG+   P +S
Sbjct  54   FGDSLVDNGNNNFLNSIAKSNYYPYGVDSNRGPTGRFSNGDTFVDYLGAWLGIAAPPPFS  113

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P  +  ++  GVNYASAAAGILD TGQ + ER  L  Q+ NF  TL QL   +S   + 
Sbjct  114  DPSTTGTRILGGVNYASAAAGILDETGQHYGERYSLSQQVLNFESTLSQLRTMISGANLS  173

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG---SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            + + K I  +  GSNDY+ NYL+P    SS N  Y   Q+A+LL+  Y+  L  LY LG 
Sbjct  174  KYLSKAIAILVFGSNDYINNYLLPAMYPSSFN--YNPSQFANLLLNHYARQLVALYSLGL  231

Query  534  RKFVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNTAL-PDAKF  704
            RKFV+AG G LGCIP ++A  +   G+C+D VNQ++ PFN  +  +V   N    P + F
Sbjct  232  RKFVVAGTGPLGCIPNVLATGQAPPGRCVDYVNQILGPFNQGLLSLVNIMNNGTHPGSMF  291

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            VY +T     +I+ N + YGF VVDRGCCG+G+  G ITC+P+  PC NR +YVFWDA+H
Sbjct  292  VYGNTYGAIGDILNNPERYGFKVVDRGCCGIGRNQGVITCMPWVPPCSNRNQYVFWDAFH  351

Query  885  PTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            PT AV+ ++   A++G    V+PIN+QQLA
Sbjct  352  PTQAVDAILAHRAYAGPPTDVHPINVQQLA  381



>ref|XP_011004908.1| PREDICTED: GDSL esterase/lipase At1g71250 [Populus euphratica]
Length=367

 Score =   302 bits (773),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 161/325 (50%), Positives = 217/325 (67%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQ-GPTGRFSNGYTIVDAIGQQLGLPLAPAY  179
            FGDSL+D GNNN L ++AKANY PYG+DF + GPTGRFSNG T VD +G+ LG+P  PA+
Sbjct  40   FGDSLVDVGNNNYLSSIAKANYFPYGVDFAKFGPTGRFSNGKTFVDILGENLGVPYPPAF  99

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVV  359
            + P+ +   +  GVNYASAAAGILD TGQ + +R  L  Q+ NF  TL+Q+   +S +  
Sbjct  100  ADPNTAGPAILGGVNYASAAAGILDETGQHYGQRYSLSQQVLNFETTLNQIRTLMSGRNF  159

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQ-QYADLLIQQYSLNLQRLYDLGAR  536
             E + K I  +  GSNDY+ NYLMP   ++  Y     +A+LL+  Y+  L  LY+LG R
Sbjct  160  TEYLGKSIAVLVFGSNDYINNYLMPSVYSSSFYYSPPDFANLLLNHYTRQLLALYNLGLR  219

Query  537  KFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLD  716
            KF+L GIG LGCIP   A +   +C+D VNQ++  FN  ++ +V   N   P A FVY +
Sbjct  220  KFLLPGIGPLGCIPNQRASAPPDRCVDYVNQILGTFNEGLRSLVDQLNKH-PGAMFVYGN  278

Query  717  TQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSA  896
            +     +I+ N  TYGFSVVD+GCCG+G+  G+ITC+P+  PC NR  YVFWDA+HPT A
Sbjct  279  SYGSVGDILNNPGTYGFSVVDKGCCGIGRNQGQITCLPWVLPCTNRNAYVFWDAFHPTEA  338

Query  897  VNVLVGKMAFSGGSDLVYPINIQQL  971
            VNV++ + AF+G     YPIN+QQ+
Sbjct  339  VNVILAQRAFNGSQRDCYPINVQQM  363



>ref|XP_007019796.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
 gb|EOY17021.1| Zinc finger protein, putative isoform 2 [Theobroma cacao]
Length=255

 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/246 (62%), Positives = 188/246 (76%), Gaps = 2/246 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNN+L + AKANY PYGIDF  GPTGRFSNGYT+VD I + LGLPL PAYS
Sbjct  8    FGDSLIDNGNNNDLPSFAKANYFPYGIDFNGGPTGRFSNGYTMVDEIAELLGLPLIPAYS  67

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S DQ+  GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A    
Sbjct  68   --EASGDQVLHGVNYASAAAGILDITGRNFVSRIPFDQQIRNFQSTLDQITDNLGAVDAA  125

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
            + I +CIFFVG+GSNDYL NYLMP   T   Y  QQ+ADLL+QQY+  L+ LY+LGARKF
Sbjct  126  DAIARCIFFVGMGSNDYLNNYLMPNYPTRNQYNAQQFADLLVQQYTRQLRTLYNLGARKF  185

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            VLAG+G +GCIP+++A+S  G C +EVNQ+V PFNAN+K M+ N N  LP A+F+Y+D  
Sbjct  186  VLAGLGRMGCIPSILAQSTVGSCSEEVNQLVLPFNANVKTMMNNLNANLPGARFIYIDVA  245

Query  723  NMFRNI  740
            ++F +I
Sbjct  246  HLFEDI  251



>gb|KHN20550.1| GDSL esterase/lipase [Glycine soja]
Length=381

 Score =   302 bits (773),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 160/330 (48%), Positives = 218/330 (66%), Gaps = 8/330 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D+GNNN +LTLA+ANY PYGIDF  G TGRF+NG T VDA+ Q LG P   A  
Sbjct  52   FGDSLVDNGNNNGILTLARANYRPYGIDFPGGATGRFTNGRTYVDALAQLLGFPTYIAPY  111

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSA--QV  356
            +    ++ +R G NYAS AAGI + TG        L  Q+ NF  T+ QL        + 
Sbjct  112  SRARGLELLR-GANYASGAAGIREETGSNLGAHTSLNEQVANFGNTVQQLRRFFRGDNES  170

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            +   + KC+FF G+GSNDYL NY M    ST+  YTV+ +A +L+Q YS +L +LY LGA
Sbjct  171  LNSYLNKCLFFSGMGSNDYLNNYFMSDFYSTSSDYTVKAFATVLLQDYSRHLSQLYSLGA  230

Query  534  RKFVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTA-LPDAKF  704
            RK ++  +G++GCIP  +AR    N +C +++N  +  FN+ +K+MV NFN   LP AKF
Sbjct  231  RKVMVTAVGQIGCIPYQLARFHGNNSRCNEKINNAISLFNSGLKKMVQNFNGGQLPGAKF  290

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            VYLD     +++ +N  +YGF V+D+GCCGVG+ +G+ITC+P + PC NR++Y+FWDA+H
Sbjct  291  VYLDFYESSQDLSSNGTSYGFDVIDKGCCGVGRNNGQITCLPLQQPCENRQKYLFWDAFH  350

Query  885  PTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            PT   N+L+ K  +S  S   YPINIQQLA
Sbjct  351  PTELANILLAKATYSSQS-YTYPINIQQLA  379



>emb|CDM83980.1| unnamed protein product [Triticum aestivum]
Length=362

 Score =   301 bits (771),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 227/332 (68%), Gaps = 11/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN++ +LA+ANYPPYGIDF  G TGRFSNG T VDAI + LG     PAY
Sbjct  34   FGDSLVDNGNNNDIASLARANYPPYGIDFPGGATGRFSNGLTTVDAISRLLGFDDYIPAY  93

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +  +   DQ+  GVN+ASAAAGI D TGQ   +R+    Q+ N+   + QL + L  +  
Sbjct  94   AGANN--DQLLSGVNFASAAAGIRDETGQQLGQRISFGGQLQNYQAAVQQLVSILGDEDS  151

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + +CIF VG+GSNDYL NY MP   +T+  YT +QYAD+L+ QY+  L+ LY+ GA
Sbjct  152  AANHLSQCIFTVGMGSNDYLNNYFMPAVYATSRQYTPEQYADVLVSQYTQQLRILYNNGA  211

Query  534  RKFVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK  L G+G++GC P  +A+  S+   C+  +N  ++ FN  + ++V  FNT LP A F 
Sbjct  212  RKVALMGVGQVGCSPNELAQQSSDGVTCVARINGAIEIFNQKLVELVDQFNT-LPGAHFT  270

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F++II +    G +V+D+GCCGVG+ +G++TC+PF+TPC NR EY+FWDA+HP
Sbjct  271  YINAYGIFQDIIRSPGANGLTVLDKGCCGVGRNNGQVTCLPFQTPCANRNEYLFWDAFHP  330

Query  888  TSAVNVLVGKMAFSGG--SDLVYPINIQQLAR  977
            T A N+LVG+ A+S    SD V+P+++Q LAR
Sbjct  331  TEAANILVGRRAYSAAQPSD-VHPVDLQTLAR  361



>ref|XP_004166340.1| PREDICTED: GDSL esterase/lipase At1g71691-like, partial [Cucumis 
sativus]
Length=244

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 175/240 (73%), Gaps = 0/240 (0%)
 Frame = +3

Query  255  MTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVKEGIPKCIFFVGIGSNDYLTNYLMP  434
            +TG+ F+ R+P   QI NF  TLDQ++ NL A  V   + +CIFFVG+GSNDYL NYLMP
Sbjct  1    ITGRNFIGRIPFNQQIRNFENTLDQITGNLGAATVAPLVARCIFFVGMGSNDYLNNYLMP  60

Query  435  GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKFVLAGIGELGCIPTMVARSENGQCL  614
               T   Y   Q+A+LLIQQY+  L RLY+LG RKF++ GIG +GCIP ++ARS +G+C 
Sbjct  61   NYPTRSQYNSPQFANLLIQQYTQQLTRLYNLGGRKFIIPGIGTMGCIPNILARSSDGRCS  120

Query  615  DEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQNMFRNIIANSKTYGFSVVDRGCCG  794
            +EVNQ+   FNAN++ M++N N  LP ++F YLD   M ++I+AN   YGF VVDRGCCG
Sbjct  121  EEVNQLSRDFNANLRTMISNLNANLPGSRFTYLDISRMNQDILANPAAYGFRVVDRGCCG  180

Query  795  VGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            +G+  G+ITC+PF+ PC NREEYVFWDA+HPT  VN+++ + AF+G   + YP NIQQLA
Sbjct  181  IGRNRGQITCLPFQMPCLNREEYVFWDAFHPTQRVNIIMARRAFNGDLSVAYPFNIQQLA  240



>ref|XP_002522292.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40150.1| zinc finger protein, putative [Ricinus communis]
Length=365

 Score =   301 bits (770),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 159/334 (48%), Positives = 226/334 (68%), Gaps = 10/334 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGIDF  GP+GRFSNG T VD I Q LG     P Y
Sbjct  34   FGDSLVDNGNNNQLSSLARADYLPYGIDFAGGPSGRFSNGKTTVDEIAQLLGFRNYIPPY  93

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +T      Q+  GVNYASAAAGI + TGQ   +R+    Q+ N+  T+ Q+   L  +  
Sbjct  94   ATARGR--QILGGVNYASAAAGIREETGQQLGDRITFSGQVRNYRNTVSQIVNLLGGEDA  151

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + +CIF +G+GSNDYL NY MP   S++  YT  QYAD+LI+QY+  L  LY+ GA
Sbjct  152  AADYLKQCIFSIGLGSNDYLNNYFMPQFYSSSRQYTPVQYADVLIRQYTEQLTNLYNYGA  211

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKF L G+G++GC P+ +A+ S +G+ C+  +N     FN+ ++ +V  FN   PDA+F+
Sbjct  212  RKFALIGVGQIGCSPSELAQNSPDGRTCVQRINSANQIFNSRLRSLVDQFNGNTPDARFI  271

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F+++I N   YGF V + GCCGVG+ +G+ITC+PF+TPC NR +Y+FWDA+HP
Sbjct  272  YINAYGIFQDLINNPSRYGFRVTNAGCCGVGRNNGQITCLPFQTPCQNRNQYLFWDAFHP  331

Query  888  TSAVNVLVGKMAFSG--GSDLVYPINIQQLARTE  983
            T A NV++G+ ++S   GSD  YP +I++LA+  
Sbjct  332  TEAANVIIGRRSYSAQSGSD-AYPFDIRRLAQVR  364



>ref|XP_003526398.2| PREDICTED: GDSL esterase/lipase At1g33811-like [Glycine max]
Length=376

 Score =   301 bits (770),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 160/330 (48%), Positives = 217/330 (66%), Gaps = 8/330 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D+GNNN +LTLA+ANY PYGIDF  G TGRF+NG T VDA+ Q LG P   A  
Sbjct  47   FGDSLVDNGNNNGILTLARANYRPYGIDFPGGATGRFTNGRTYVDALAQLLGFPTYIAPY  106

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSA--QV  356
            +    ++ +R G NYAS AAGI + TG        L  Q+ NF  T+ QL        + 
Sbjct  107  SRARGLELLR-GANYASGAAGIREETGSNLGAHTSLNEQVANFGNTVQQLRRFFRGDNES  165

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            +   + KC+FF G+GSNDYL NY M    ST+  YTV+ +A +L+Q YS  L +LY LGA
Sbjct  166  LNSYLNKCLFFSGMGSNDYLNNYFMSDFYSTSSDYTVKAFATVLLQDYSRQLSQLYSLGA  225

Query  534  RKFVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTA-LPDAKF  704
            RK ++  +G++GCIP  +AR    N +C +++N  +  FN+ +K+MV NFN   LP AKF
Sbjct  226  RKVMVTAVGQIGCIPYQLARFHGNNSRCNEKINNAISLFNSGLKKMVQNFNGGQLPGAKF  285

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            VYLD     +++ +N  +YGF V+D+GCCGVG+ +G+ITC+P + PC NR++Y+FWDA+H
Sbjct  286  VYLDFYESSQDLSSNGTSYGFDVIDKGCCGVGRNNGQITCLPLQQPCENRQKYLFWDAFH  345

Query  885  PTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            PT   N+L+ K  +S  S   YPINIQQLA
Sbjct  346  PTELANILLAKATYSSQS-YTYPINIQQLA  374



>ref|XP_002266118.1| PREDICTED: GDSL esterase/lipase At5g45670 [Vitis vinifera]
 emb|CBI30765.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   300 bits (767),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 156/331 (47%), Positives = 223/331 (67%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN + +LA+ANY PYGIDF QGPTGRFSNG T VD I + LG     P Y
Sbjct  36   FGDSLVDNGNNNGIASLARANYLPYGIDFPQGPTGRFSNGKTTVDVIAELLGFDNYIPPY  95

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            S+     + +  GVNYASAAAGI D TGQ    R+ +  Q+ N+  T+ Q+ + L  +  
Sbjct  96   SSARG--EDILKGVNYASAAAGIRDETGQQLGGRISMNGQLRNYQTTVSQVVSILGDEDT  153

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ +G+GSNDYL NY MP   ST+  YT +QYAD+LIQQY+  ++ LY+ GA
Sbjct  154  AANYLSKCIYSLGLGSNDYLNNYFMPQYYSTSRQYTPEQYADVLIQQYAQQIRTLYNYGA  213

Query  534  RKFVLAGIGELGCIPTMVARS--ENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK VL G+G++GC P  +A++  +   C++ +N     FN  +K +V   N   PD +F+
Sbjct  214  RKVVLIGVGQIGCSPNELAQNSPDGTTCIERINYANRLFNDRLKSLVGELNNNFPDGRFI  273

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F+++I++  +YGF V + GCCGVG+ +G+ITC+PF+TPC NR EY+FWDA+HP
Sbjct  274  YINAYGIFQDLISSPSSYGFRVTNAGCCGVGRNNGQITCLPFQTPCQNRNEYLFWDAFHP  333

Query  888  TSAVNVLVGKMAFSG-GSDLVYPINIQQLAR  977
              A NV++G+ ++S   S   YPI+I+ LA+
Sbjct  334  GEAANVVIGRRSYSAQSSSDAYPIDIRSLAQ  364



>ref|XP_006371372.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|ERP49169.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=368

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 161/325 (50%), Positives = 215/325 (66%), Gaps = 3/325 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQ-GPTGRFSNGYTIVDAIGQQLGLPLAPAY  179
            FGDSL+D GNNN L ++AKANY PYG+DF + GPTGRFSNG T VD +G+ LG+P  PA+
Sbjct  41   FGDSLVDVGNNNYLSSIAKANYFPYGVDFAKFGPTGRFSNGKTFVDILGEILGVPYPPAF  100

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVV  359
            + P+ +   +  GVNYASAAAGILD TGQ + +R  L  Q+ NF  TL+Q+   +S   +
Sbjct  101  ADPNTAGPVILGGVNYASAAAGILDETGQHYGQRYSLSQQVLNFETTLNQIRTLMSGTNL  160

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQ-QYADLLIQQYSLNLQRLYDLGAR  536
             E + K I  +  GSNDY+ NYLMP   ++  Y     +A+LL+  Y+  L  LY+LG R
Sbjct  161  TEYLGKSIAVLVFGSNDYINNYLMPSVYSSSFYYSPPDFANLLVNHYTRQLLALYNLGLR  220

Query  537  KFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLD  716
            KF+L GIG LGCIP   A +   +C+D VNQ++  FN  ++ +V   N   P A FVY +
Sbjct  221  KFLLPGIGPLGCIPNQRASAPPDRCVDYVNQILGTFNEGLRSLVDQLNKH-PGAMFVYGN  279

Query  717  TQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSA  896
            T     +I+ N  TYGFSVVD+GCCG+G+  G+ITC+P+  PC NR  YVFWDA+HPT A
Sbjct  280  TYGSVGDILNNPGTYGFSVVDKGCCGIGRNQGQITCLPWVVPCSNRNTYVFWDAFHPTEA  339

Query  897  VNVLVGKMAFSGGSDLVYPINIQQL  971
            VN ++   AF+G     YPIN+QQ+
Sbjct  340  VNAILALRAFNGSQRDCYPINVQQM  364



>ref|XP_004250650.1| PREDICTED: GDSL esterase/lipase At1g33811 [Solanum lycopersicum]
Length=365

 Score =   299 bits (766),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 221/332 (67%), Gaps = 9/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN +LTLA+ANY PYG+DF QG TGRF+NG T VD + Q LG P   P Y
Sbjct  35   FGDSLVDNGNNNGILTLARANYMPYGLDFPQGATGRFTNGRTFVDILAQLLGFPNYIPPY  94

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSA--Q  353
            +        +  G NYAS AAGI D TG    + +P+K Q+ NF +++++L         
Sbjct  95   ARVRGR--NLLRGANYASGAAGIRDETGNNLGDHMPMKQQVGNFGRSVEELRRLFRGDNS  152

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
             +   + KCI + G+GSNDYL NY M    ST+  YT QQYA  L+Q YS  L  LY+LG
Sbjct  153  TLNAHLSKCILYSGLGSNDYLNNYFMTDYYSTHSQYTPQQYASALLQDYSQQLSELYNLG  212

Query  531  ARKFVLAGIGELGCIPTMVARSE-NG-QCLDEVNQVVDPFNANMKQMVTNFNTALPDAKF  704
             RK ++  IG++GCIP  +AR + NG +C +E+N  +  FN+ +K++V  FN  LP AKF
Sbjct  213  GRKVIVTAIGQIGCIPYQLARYDGNGSRCNEEINDAIQLFNSGLKRLVIRFNKVLPGAKF  272

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            V+LD+    ++++ N+KTYGF VVD+GCCGVG+ +G+ITC+P + PC +R +Y+FWDA+H
Sbjct  273  VFLDSFESSKDLVLNAKTYGFEVVDKGCCGVGRNNGQITCLPLQQPCEDRSKYIFWDAFH  332

Query  885  PTSAVNVLVGKMAFSGGSDLV-YPINIQQLAR  977
            PT   N+L+ K ++S  S    YPINIQQL R
Sbjct  333  PTEVANILLAKKSYSSKSKTFNYPINIQQLVR  364



>gb|EYU28141.1| hypothetical protein MIMGU_mgv1a008629mg [Erythranthe guttata]
Length=367

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 163/332 (49%), Positives = 226/332 (68%), Gaps = 10/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNNN+ +LAKANY PYG DF QGPTGRFSNG T VD + + LG     P Y
Sbjct  38   FGDSLVDNGNNNNIQSLAKANYLPYGTDFPQGPTGRFSNGKTTVDVVAELLGFDDYIPPY  97

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +T     +Q+  GVNYASAAAGI   TGQ    R+    QI N+  T+ Q+   L  +  
Sbjct  98   ATARG--EQILRGVNYASAAAGIRQETGQQLGARIDFSAQINNYKNTVAQVVDILGDENT  155

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + KCI+ VG+GSNDYL NY MP   ST+  YT QQYAD+LI+QYS  ++ LY+ GA
Sbjct  156  AADYLRKCIYSVGVGSNDYLNNYFMPNYYSTSRQYTPQQYADVLIRQYSEQIRTLYNYGA  215

Query  534  RKFVLAGIGELGCIPTMVAR-SENG-QCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKF L GIG++GC P  +A+ S +G  C+  +N     FN+ ++ +V  FN+   DA+F+
Sbjct  216  RKFALNGIGQIGCSPNALAQNSPDGVTCVQRINGANQIFNSRLRSLVDEFNSNSQDAQFI  275

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            YL+  ++F+++I N  ++GF V + GCCGVG+ +G+ITC+PF+  C NR+EYVFWDA+HP
Sbjct  276  YLNAYDVFQDLIDNPSSFGFRVSNAGCCGVGRNNGQITCLPFQNSCQNRDEYVFWDAFHP  335

Query  888  TSAVNVLVGKMAFSG--GSDLVYPINIQQLAR  977
            T A N++VG+ A+S    SD  +P +I++LA+
Sbjct  336  TEAANIIVGRRAYSAEKASD-AHPFDIRRLAQ  366



>gb|KHN09688.1| GDSL esterase/lipase [Glycine soja]
Length=351

 Score =   298 bits (764),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/333 (46%), Positives = 215/333 (65%), Gaps = 3/333 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+DSGNNN L +LA+AN+ PYGIDF++GPTGRFSNG T+ D +G+ +GLPL PA++
Sbjct  4    FGDSLVDSGNNNYLNSLARANFVPYGIDFSEGPTGRFSNGKTVTDILGEIIGLPLLPAFA  63

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                    + +GVNYASAAAGILD TGQ   ER+  + Q+ +F  T+ Q+   +    + 
Sbjct  64   DTLIKSRNISWGVNYASAAAGILDETGQNLGERISFRQQVQDFNTTVRQMKIQMEHNQLS  123

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNII-YTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + +   +  V  GSNDY+ NY +P   T+   Y  + YADLLI+ Y  ++  L+DLG R+
Sbjct  124  QHLANSLTVVIHGSNDYINNYFLPEQYTSSFNYDPKNYADLLIEVYKRHILSLHDLGLRR  183

Query  540  FVLAGIGELGCIPTMVARSE--NGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            F+LAG+G LGCIP  +A      G+C   +N +VD FN  +K +V   N     + F Y 
Sbjct  184  FLLAGLGPLGCIPRQLALGSVPRGECRPHINDIVDMFNVLLKSLVDQLNAEHHGSVFAYG  243

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T  +F ++I N+KTYGF+V D GCCG+G+   +ITC+    PC +R++YVFWDA+H T 
Sbjct  244  NTYGVFNDLINNAKTYGFTVTDSGCCGIGRNQAQITCLFALFPCLDRDKYVFWDAFHTTQ  303

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQLARTETWP  992
            AVN +V   AF+G     YPIN++Q+A+    P
Sbjct  304  AVNNIVAHKAFAGPPSDCYPINVKQMAQMWVLP  336



>gb|KEH33152.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=370

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 156/331 (47%), Positives = 218/331 (66%), Gaps = 9/331 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP--LAPA  176
            FGDSL+D GNNNNL +LAKANY PYGIDF  GPTGRFSNG T VD I + LG    ++P 
Sbjct  42   FGDSLVDDGNNNNLNSLAKANYLPYGIDFNGGPTGRFSNGKTTVDVIAELLGFEGYISPY  101

Query  177  YSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-  353
             +  D  I Q   GVNYASAAAGI + TGQ   +R+    Q+ N+ KT+ Q+   L  + 
Sbjct  102  STARDQEILQ---GVNYASAAAGIREETGQQLGDRISFSGQVQNYQKTVSQVVNLLGDED  158

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                 + KCI+ +G+GSNDYL NY MP   +   +T QQYAD+LIQ Y+  L+ LY+ GA
Sbjct  159  TASNYLSKCIYSIGLGSNDYLNNYFMPAYPSGRQFTPQQYADVLIQAYAQQLRILYNYGA  218

Query  534  RKFVLAGIGELGCIPTMVARS--ENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK  L GIG++GC P  +A++  +   C++ +N     FN  +K +V   N  L DA+F+
Sbjct  219  RKMALFGIGQIGCSPNELAQNSPDGTTCVERINSANQLFNNGLKSLVNQLNNELTDARFI  278

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++T  +F++II N  ++G  V + GCCG+G+ +G+ITC+P +TPC NR EY+FWDA+HP
Sbjct  279  YVNTYGIFQDIINNPSSFGIRVTNEGCCGIGRNNGQITCLPLQTPCSNRNEYLFWDAFHP  338

Query  888  TSAVNVLVGKMAFSGGSDL-VYPINIQQLAR  977
            T   N ++G+ A++  S+   YPI+I +LA+
Sbjct  339  TEVGNTIIGRRAYNAQSESDAYPIDINRLAQ  369



>gb|ACJ85846.1| unknown [Medicago truncatula]
Length=370

 Score =   298 bits (764),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 156/331 (47%), Positives = 218/331 (66%), Gaps = 9/331 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP--LAPA  176
            FGDSL+D GNNNNL +LAKANY PYGIDF  GPTGRFSNG T VD I + LG    ++P 
Sbjct  42   FGDSLVDDGNNNNLNSLAKANYLPYGIDFNGGPTGRFSNGKTTVDVIAELLGFEGYISPY  101

Query  177  YSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-  353
             +  D  I Q   GVNYASAAAGI + TGQ   +R+    Q+ N+ KT+ Q+   L  + 
Sbjct  102  STARDQEILQ---GVNYASAAAGIREETGQQLGDRISFSGQVQNYQKTVSQVVNLLGDED  158

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                 + KCI+ +G+GSNDYL NY MP   +   +T QQYAD+LIQ Y+  L+ LY+ GA
Sbjct  159  TASNYLSKCIYSIGLGSNDYLNNYFMPAYPSGRQFTPQQYADVLIQAYAQQLRILYNYGA  218

Query  534  RKFVLAGIGELGCIPTMVARS--ENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK  L GIG++GC P  +A++  +   C++ +N     FN  +K +V   N  L DA+F+
Sbjct  219  RKMTLFGIGQIGCSPNELAQNSPDGTTCVERINSANQLFNNGLKSLVNQLNNELTDARFI  278

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++T  +F++II N  ++G  V + GCCG+G+ +G+ITC+P +TPC NR EY+FWDA+HP
Sbjct  279  YVNTYGIFQDIINNPSSFGIRVTNEGCCGIGRNNGQITCLPLQTPCSNRNEYLFWDAFHP  338

Query  888  TSAVNVLVGKMAFSGGSDL-VYPINIQQLAR  977
            T   N ++G+ A++  S+   YPI+I +LA+
Sbjct  339  TEVGNTIIGRRAYNAQSESDAYPIDINRLAQ  369



>gb|KHN48037.1| GDSL esterase/lipase [Glycine soja]
Length=358

 Score =   298 bits (763),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 162/331 (49%), Positives = 225/331 (68%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGIDF  GP+GRFSNG T VDAI + LG     P Y
Sbjct  29   FGDSLVDNGNNNQLQSLARADYLPYGIDFPGGPSGRFSNGKTTVDAIAELLGFDDYIPPY  88

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +  D S D +  GVNYASAAAGI + TGQ    R+  + Q+ N+  T+ Q+   L  +  
Sbjct  89   A--DASGDAILKGVNYASAAAGIREETGQQLGGRISFRGQVQNYQNTVSQVVNLLGNEDS  146

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ +G+GSNDYL NY MP   S++  Y+  +YAD+LIQ Y+  L+ LY+ GA
Sbjct  147  AANYLSKCIYSIGLGSNDYLNNYFMPQFYSSSRQYSTDEYADVLIQAYTEQLKTLYNYGA  206

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK VL GIG++GC P  +A+ S +G+ C++ +N     FN  +K +   FN  LPDAK +
Sbjct  207  RKMVLFGIGQIGCSPNELAQNSPDGKTCVEIINTANQIFNNKLKGLTDQFNNQLPDAKVI  266

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y+++  +F++II+N   YGFSV + GCCGVG+ +G+ITC+P +TPC NR EY+FWDA+HP
Sbjct  267  YINSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNGQITCLPMQTPCQNRREYLFWDAFHP  326

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLAR  977
            T A NV+V + A+S  S    YP++IQ+LA+
Sbjct  327  TEAGNVVVAQRAYSAQSASDAYPVDIQRLAQ  357



>gb|AAX20033.1| GDSL-lipase protein [Capsicum annuum]
Length=371

 Score =   298 bits (764),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 220/331 (66%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNNN+ +LA+ANY PYGID+  GPTGRFSNG T VD I + LG     P Y
Sbjct  42   FGDSLVDNGNNNNIQSLARANYLPYGIDYPGGPTGRFSNGKTTVDVIAELLGFEDYIPPY  101

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +  D   + +  GVNYASAAAGI D TGQ    R+P   Q+ N+  T+ Q+   L  +  
Sbjct  102  A--DARGEDILKGVNYASAAAGIRDETGQQLGARIPFGGQVNNYRDTVQQVVQILGNEDS  159

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KC++ +G+GSNDYL NY MP   ST   Y  +QYAD+LIQQY+ +L+ LYD GA
Sbjct  160  AATYLSKCVYPIGLGSNDYLNNYFMPMYYSTGRQYNPEQYADILIQQYTQHLKTLYDYGA  219

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKFVL G+G++GC P  +A+ S +G+ C   +N     FN  ++ +V  FN   PDAKF+
Sbjct  220  RKFVLIGVGQIGCSPNALAQNSADGRTCAQNINAANQLFNNRLRGLVDEFNGNTPDAKFI  279

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++  ++F+++I N   +GF V + GCCGVG+ +G+ITC+P + PCPNR+EY+FWDA+HP
Sbjct  280  YINAYDIFQDLIDNPSAFGFRVTNAGCCGVGRNNGQITCLPLQNPCPNRDEYLFWDAFHP  339

Query  888  TSAVNVLVGKMAFSGG-SDLVYPINIQQLAR  977
              A N +VG+ ++    S   YP +IQ LA+
Sbjct  340  GEAANTIVGRRSYRAERSSDAYPFDIQHLAQ  370



>gb|EYU43295.1| hypothetical protein MIMGU_mgv1a008614mg [Erythranthe guttata]
Length=368

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 158/331 (48%), Positives = 219/331 (66%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNNN+ +LA+ANY PYGIDF  GPTGRFSNG T VD + + LG       Y
Sbjct  39   FGDSLVDNGNNNNIQSLARANYLPYGIDFPVGPTGRFSNGKTTVDVVAELLGFEDFIRPY  98

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +T     +Q+  GVNYASAAAGI   TGQ    R+    Q+ N+  T++Q+   L  Q  
Sbjct  99   ATARG--EQVLKGVNYASAAAGIRSETGQQLGARIDFTGQVNNYKNTVNQVVNILGDQES  156

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + KCI+ +G+GSNDYL NY MP   ST+  Y   QYAD+LIQQY+  L+ LY+ GA
Sbjct  157  ASKYLSKCIYSIGLGSNDYLNNYFMPLYYSTSRQYLPDQYADILIQQYTEQLKTLYNFGA  216

Query  534  RKFVLAGIGELGCIPTMVARS--ENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKF L GIG++GC P  +A++  +   C+  +N     FN  +K +V +FN   PDAKF 
Sbjct  217  RKFALIGIGQIGCSPNALAQNSPDGATCVQRINGANQIFNEKLKSLVDDFNRNTPDAKFT  276

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y+D   +F+++I +  ++GF V + GCCGVG+ +G+ITC+P +TPC NR+EY+FWDA+HP
Sbjct  277  YIDAYGIFQDLINSPTSFGFKVTNAGCCGVGRNNGQITCLPLQTPCQNRDEYLFWDAFHP  336

Query  888  TSAVNVLVGKMAFSG-GSDLVYPINIQQLAR  977
            T A N+ VGK +++   S   YP +I++LA 
Sbjct  337  TEAANIFVGKRSYAALKSTDAYPFDIRRLAH  367



>gb|ABF72016.1| GDSL-motif lipase/hydrolase family protein [Musa acuminata]
Length=356

 Score =   298 bits (762),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 163/332 (49%), Positives = 223/332 (67%), Gaps = 9/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNNN+ +LA ANYPPYGIDF  GP+GRF+NG T VD I Q LG     P Y
Sbjct  28   FGDSLVDNGNNNNIASLAVANYPPYGIDFPSGPSGRFTNGLTTVDVIAQLLGFDDFVPPY  87

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            ++       +  GVN+ASAAAGI + TGQ    R+P   Q+ N+   + ++ + L  +  
Sbjct  88   ASTRGQ--ALLTGVNFASAAAGIREETGQQLGGRIPFGGQLQNYQSAVQEMVSILGDEDS  145

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCIF VG+GSNDYL NY MP   ST   YT +QYAD LIQQYS  L+ LY+ GA
Sbjct  146  AANYLSKCIFSVGLGSNDYLNNYFMPAFYSTGQRYTPEQYADELIQQYSQQLRTLYNYGA  205

Query  534  RKFVLAGIGELGCIPTMVA-RSENG-QCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK VL G+G++GC P  +A RS NG  C++E+N  +  FNA +  +V  FN AL  A F+
Sbjct  206  RKVVLIGVGQVGCSPNELAQRSPNGVACVEEINSAIRIFNAKLIDLVDEFN-ALDGAHFI  264

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F +I+ N    G SV +RGCCGVG+ +G+ITC+P++ PCPNR+EY+F+DA+HP
Sbjct  265  YINGYGIFEDILRNPAANGLSVTNRGCCGVGRNNGQITCLPYQAPCPNRDEYLFFDAFHP  324

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLART  980
            T A N+++GK ++S  S    YP++I++LAR 
Sbjct  325  TEAANIIIGKRSYSARSPGDAYPMDIRRLARV  356



>ref|XP_009406156.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 163/332 (49%), Positives = 222/332 (67%), Gaps = 9/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNNN+ +LA ANYPPYGIDF  GP+GRF+NG T VD I Q LG     P Y
Sbjct  37   FGDSLVDNGNNNNIASLAVANYPPYGIDFPSGPSGRFTNGLTTVDVIAQLLGFDDFVPPY  96

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            ++       +  GVN+ASAAAGI D TGQ    R+P   Q+ N+   + ++   L  +  
Sbjct  97   ASTRGQ--ALLTGVNFASAAAGIRDETGQQLGGRIPFGGQLRNYQSAVQEMVRILGDEDS  154

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCIF VG+GSNDYL NY MP   ST   YT +QYAD LIQQYS  L+ LY+ GA
Sbjct  155  AANYLSKCIFSVGLGSNDYLNNYFMPAFYSTGQRYTPEQYADELIQQYSQQLRTLYNYGA  214

Query  534  RKFVLAGIGELGCIPTMVA-RSENG-QCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK VL G+G++GC P  +A RS NG  C++E++  +  FNA +  +V  FN AL  A F+
Sbjct  215  RKVVLIGVGQVGCSPNELAQRSPNGVACVEEIDSAIRIFNAKLIDLVDEFN-ALDGAHFI  273

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F +I+ N    G SV +RGCCGVG+ +G+ITC+P++ PCPNR+EY+F+DA+HP
Sbjct  274  YINGYGIFEDILRNPAANGLSVTNRGCCGVGRNNGQITCLPYQAPCPNRDEYLFFDAFHP  333

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLART  980
            T A N+++GK ++S  S    YP++I++LAR 
Sbjct  334  TEAANIIIGKRSYSARSPSDAYPMDIRRLARV  365



>ref|XP_006467574.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Citrus sinensis]
Length=366

 Score =   298 bits (762),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 165/331 (50%), Positives = 218/331 (66%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+ANY PYGIDF  GPTGRFSNG T VD I Q LG     P Y
Sbjct  37   FGDSLVDNGNNNQLSSLARANYLPYGIDFPNGPTGRFSNGKTTVDVIAQLLGFDGYIPPY  96

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            S      D +R GVNYASAAAGI + TG+   +R+    Q+ N+  T+ Q+   L  Q  
Sbjct  97   SAARGQ-DILR-GVNYASAAAGIREETGRQLGDRISFSGQVKNYQNTVQQVVNLLGNQDQ  154

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + +CI+ +G+GSNDYL NY  P   ST   YT +QYADLLIQQY+  LQ LY+ GA
Sbjct  155  AANYLSRCIYSIGLGSNDYLNNYFQPLYYSTGRQYTPEQYADLLIQQYTQQLQALYNYGA  214

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKFVL G+G++GC P  +A+ S +G+ C+  VN     FN  ++ +V  FN    DAKF+
Sbjct  215  RKFVLIGVGQIGCSPNQLAQNSPDGRTCVKRVNDANVIFNNKLRGLVDQFNNNDSDAKFI  274

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F++I AN   YGF V + GCCGVG+ +G+ITC+P + PCPNR EYVFWDA+HP
Sbjct  275  YINAYGIFQDITANPARYGFRVTNTGCCGVGRNNGQITCLPLQNPCPNRREYVFWDAFHP  334

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLAR  977
            T A N ++   ++S  S    YPI+I++LA+
Sbjct  335  TEAANTIIATRSYSAQSPSDAYPIDIRRLAQ  365



>ref|XP_003526907.1| PREDICTED: GDSL esterase/lipase At5g08460 [Glycine max]
Length=386

 Score =   298 bits (764),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 152/333 (46%), Positives = 215/333 (65%), Gaps = 3/333 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+DSGNNN L +LA+AN+ PYGIDF++GPTGRFSNG T+ D +G+ +GLPL PA++
Sbjct  39   FGDSLVDSGNNNYLNSLARANFVPYGIDFSEGPTGRFSNGKTVTDILGEIIGLPLLPAFA  98

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                    + +GVNYASAAAGILD TGQ   ER+  + Q+ +F  T+ Q+   +    + 
Sbjct  99   DTLIKSRNISWGVNYASAAAGILDETGQNLGERISFRQQVQDFNTTVRQMKIQMEHNQLS  158

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNII-YTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + +   +  V  GSNDY+ NY +P   T+   Y  + YADLLI+ Y  ++  L+DLG R+
Sbjct  159  QHLANSLTVVIHGSNDYINNYFLPEQYTSSFNYDPKNYADLLIEVYKRHILSLHDLGLRR  218

Query  540  FVLAGIGELGCIPTMVARSE--NGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            F+LAG+G LGCIP  +A      G+C   +N +VD FN  +K +V   N     + F Y 
Sbjct  219  FLLAGLGPLGCIPRQLALGSVPRGECRPHINDIVDMFNVLLKSLVDQLNAEHHGSVFAYG  278

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T  +F ++I N+KTYGF+V D GCCG+G+   +ITC+    PC +R++YVFWDA+H T 
Sbjct  279  NTYGVFNDLINNAKTYGFTVTDSGCCGIGRNQAQITCLFALFPCLDRDKYVFWDAFHTTQ  338

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQLARTETWP  992
            AVN +V   AF+G     YPIN++Q+A+    P
Sbjct  339  AVNNIVAHKAFAGPPSDCYPINVKQMAQMWVLP  371



>gb|KHN06446.1| GDSL esterase/lipase [Glycine soja]
Length=357

 Score =   297 bits (760),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 161/331 (49%), Positives = 225/331 (68%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGIDF  GP+GRFSNG T VDAI + LG     P Y
Sbjct  28   FGDSLVDNGNNNQLQSLARADYLPYGIDFPGGPSGRFSNGKTTVDAIAELLGFDDYIPPY  87

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +  D S D +  GVNYASAAAGI + TGQ    R+    Q+ N+  T+ Q+   L  +  
Sbjct  88   A--DASGDAILKGVNYASAAAGIREETGQQLGGRISFSGQVQNYQSTVSQVVNLLGNEDS  145

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ +G+GSNDYL NY MP   S++  Y+  +YAD+LIQ Y+  L+ LY+ GA
Sbjct  146  AANYLSKCIYSIGLGSNDYLNNYFMPQFYSSSRQYSPDEYADVLIQAYTEQLKTLYNYGA  205

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK VL GIG++GC P  +A+ S +G+ C++++N     FN  +K +   FN  LPDA+ +
Sbjct  206  RKMVLFGIGQIGCSPNELAQNSPDGKTCVEKINSANQIFNNKLKGLTDQFNNQLPDARVI  265

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y+++  +F++II+N   YGFSV + GCCGVG+ +G+ITC+P +TPC NR EY+FWDA+HP
Sbjct  266  YVNSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNGQITCLPMQTPCQNRREYLFWDAFHP  325

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLAR  977
            T A NV+V + A+S  S    YP++IQ+LA+
Sbjct  326  TEAGNVVVAQRAYSAQSASDAYPVDIQRLAQ  356



>ref|XP_003569805.1| PREDICTED: GDSL esterase/lipase At1g29660-like [Brachypodium 
distachyon]
Length=362

 Score =   297 bits (760),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 159/332 (48%), Positives = 226/332 (68%), Gaps = 11/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN++ +LA+ANYPPYGIDF  G TGRFSNG T VDAI + LG     PAY
Sbjct  34   FGDSLVDNGNNNDIASLARANYPPYGIDFPGGATGRFSNGLTTVDAISRLLGFDDYIPAY  93

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +  +   DQ+  GVN+ASAAAGI D TGQ   +R+    Q+ N+   + QL + L  +  
Sbjct  94   AGANN--DQLLTGVNFASAAAGIRDETGQQLGQRISFGGQLQNYQAAVQQLVSILGDEDS  151

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + +CIF VG+GSNDYL NY MP   S++  YT +QYAD+LI QYS  L  LY+ GA
Sbjct  152  AANHLSQCIFTVGMGSNDYLNNYFMPAVYSSSRQYTPEQYADVLINQYSQQLTTLYNNGA  211

Query  534  RKFVLAGIGELGCIPTMVAR-SENG-QCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK  L G+G++GC P  +A+ S+NG  C+D +N  ++ FN  +  +V  FN   P A F 
Sbjct  212  RKVALMGVGQVGCSPNELAQQSDNGVTCVDRINSAIEIFNQKLVDLVNQFN-GQPGAHFT  270

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F++I+     +G +V ++GCCGVG+ +G++TC+PF+TPC NR++Y+FWDA+HP
Sbjct  271  YINAYGIFQDILRAPGAHGLTVTNKGCCGVGRNNGQVTCLPFQTPCANRDQYLFWDAFHP  330

Query  888  TSAVNVLVGKMAFSGG--SDLVYPINIQQLAR  977
            T A N+LVG+ A+S    SD V+P++++ LA+
Sbjct  331  TEAANILVGRRAYSAALPSD-VHPVDLRTLAQ  361



>gb|KHG06516.1| hypothetical protein F383_33590 [Gossypium arboreum]
Length=361

 Score =   297 bits (760),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 160/331 (48%), Positives = 226/331 (68%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGIDF  GPTGRFSNG T VD I + LG     P Y
Sbjct  32   FGDSLVDNGNNNELRSLARADYLPYGIDFANGPTGRFSNGRTTVDVIAELLGFDDYIPPY  91

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            ST   S  Q+   VNYASAAAGI + TGQ    R+    Q+ N+ +T+ Q+   L  +  
Sbjct  92   STA--SGRQILGEVNYASAAAGIREETGQQLGARISFSGQVKNYQQTVQQVVNLLGDEDS  149

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + +CI+ +G+GSNDYL NY MP   ST+  Y+ ++YA+ LIQ+Y+  LQ LY+ GA
Sbjct  150  AANYLRQCIYSIGLGSNDYLNNYFMPLYYSTSRQYSPEEYANSLIQEYTEQLQALYNYGA  209

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKFVL G+G++GC P  +A+ S +G+ C++ +N     FN  ++ +V  FN A  DAKFV
Sbjct  210  RKFVLIGLGQIGCSPNELAQNSGDGRTCVERINAANRIFNNKLRGLVDQFNNANSDAKFV  269

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F++I +N   YGF V + GCCGVG+ +G+ITC+PF+TPC NR+EY+FWDA+HP
Sbjct  270  YINAYGIFQDITSNPAAYGFKVTNAGCCGVGRNNGQITCLPFQTPCQNRDEYLFWDAFHP  329

Query  888  TSAVNVLVGKMAFSGGSDL-VYPINIQQLAR  977
            + A NV++G+ ++S  S    YPI+I++LA+
Sbjct  330  SEAANVIIGRRSYSAQSPTDAYPIDIRRLAQ  360



>ref|XP_010057187.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Eucalyptus grandis]
Length=369

 Score =   297 bits (760),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 222/332 (67%), Gaps = 10/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA++NY PYGIDF  GPTGRFSNG T VD I + LG     P Y
Sbjct  40   FGDSLVDNGNNNGLNSLARSNYLPYGIDFAAGPTGRFSNGKTTVDVIAELLGFDDYIPPY  99

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +    S D +  GVNYASAAAGI   TGQ    R+  + Q+ N+  T+ QL   L  +  
Sbjct  100  TVA--SGDAILKGVNYASAAAGIRAETGQQLGARIAFEGQLQNYQSTVSQLVNILGNEDT  157

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG--SSTNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
                + KCI+ VG+GSNDYL NY MP   SS+N  +T  QYAD LIQ+YS  L+ LY+ G
Sbjct  158  AANYLSKCIYSVGMGSNDYLNNYFMPQYYSSSNQ-FTPDQYADELIQEYSQQLRTLYNYG  216

Query  531  ARKFVLAGIGELGCIPTMVARS--ENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKF  704
            ARK VL G+G++GC P  +A+S  +   C+D +N     +N  +K +V   NT L DA+F
Sbjct  217  ARKVVLIGVGQIGCSPNALAQSSADGTTCVDRINVACQIYNNKLKSLVDQLNTNLSDARF  276

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            +Y+D   +F++++    ++GFSV + GCCGVG+ +G+ITC+PF+TPC NR EY+FWDAYH
Sbjct  277  IYVDAYGIFQDLMTRPASFGFSVTNAGCCGVGRNNGQITCLPFQTPCQNRNEYLFWDAYH  336

Query  885  PTSAVNVLVGKMAFSGGSDL-VYPINIQQLAR  977
            P+ A N++VG+ ++S  +    YPI+I++LA+
Sbjct  337  PSEAANIIVGRRSYSAEAPTDAYPIDIRRLAQ  368



>ref|XP_003522601.2| PREDICTED: GDSL esterase/lipase At1g33811-like [Glycine max]
Length=376

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 216/330 (65%), Gaps = 8/330 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D+GNNN +LTLA+ANY PYGIDF  G TGRF+NG T VDA+ Q LG P   A  
Sbjct  47   FGDSLVDNGNNNGILTLARANYRPYGIDFPGGATGRFTNGRTYVDALAQLLGFPTYIAPY  106

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSA--QV  356
            +    ++ +R G NYAS AAGI + TG        L  Q+ NF  T+ QL        + 
Sbjct  107  SRARGLELLR-GANYASGAAGIREETGSNLGAHTSLNEQVANFGNTVQQLRRFFRGDNES  165

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            +   + KC+FF G+GSNDYL NY M    ST+  YTV+ +A +L+Q YS  L +LY LGA
Sbjct  166  LNSYLNKCLFFSGMGSNDYLNNYFMSDFYSTSSDYTVKAFASVLLQDYSRKLSQLYSLGA  225

Query  534  RKFVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTA-LPDAKF  704
            RK ++  +G++GCIP  +AR    + +C +++N  +  FN+ +K MV NFN   LP AKF
Sbjct  226  RKVMVTAVGQIGCIPYQLARFHGNSSRCNEKINNAISLFNSGLKTMVQNFNGGQLPGAKF  285

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            VYLD     +++ +N  +YGF V+D+GCCGVG+ +G+ITC+P + PC NR++Y+FWDA+H
Sbjct  286  VYLDFYQSSQDLSSNGTSYGFDVIDKGCCGVGRNNGQITCLPQQQPCENRQKYLFWDAFH  345

Query  885  PTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            PT   N+L+ K  +S  S   YPINIQQLA
Sbjct  346  PTELANILLAKATYSSQS-YTYPINIQQLA  374



>gb|EYU31208.1| hypothetical protein MIMGU_mgv1a026796mg [Erythranthe guttata]
Length=359

 Score =   296 bits (759),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/328 (45%), Positives = 211/328 (64%), Gaps = 4/328 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL D GNNN L +LAKANY PYG+DF QGP+GRF NG T+VD +G+ +G+P+ PAY+
Sbjct  30   FGDSLTDPGNNNYLNSLAKANYIPYGVDFYQGPSGRFCNGKTVVDFLGEMMGIPVLPAYT  89

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
            +P  +   +  GVNYASAA GIL  TG    ER  L  Q+ NF  TL+ L + +  + + 
Sbjct  90   SPFATGQNILKGVNYASAAGGILQETGHNLGERFSLSQQVENFENTLNVLRSQMEDEELS  149

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + + K +  + +GSNDY+ NYL P   +T+ IY  + YADLL+ +Y+  +  ++ LG RK
Sbjct  150  DYLAKALVVLSLGSNDYINNYLQPSFYTTSYIYNPKDYADLLVNRYTRQILAIHSLGLRK  209

Query  540  FVLAGIGELGCIPTMVARSE--NGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAK-FVY  710
            F +AGIG LGCIP  +A      G+C+D  N+VV  FN  ++ +V   N    +   F Y
Sbjct  210  FFIAGIGPLGCIPNQLATGAPGPGKCVDYTNEVVTMFNERLQSLVDELNNKYNNESIFAY  269

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
             ++     +I+ N++ YGF V D+GCCG+G+  G++TC+P   PC  R EY+FWDA+HPT
Sbjct  270  GNSFGAVVDILNNARAYGFRVTDKGCCGIGRNKGQVTCLPLSVPCIKRNEYMFWDAFHPT  329

Query  891  SAVNVLVGKMAFSGGSDLVYPINIQQLA  974
             AVN ++   AFSG +   YP+NIQQ+ 
Sbjct  330  QAVNQILADRAFSGSTFYTYPLNIQQMG  357



>ref|XP_010683187.1| PREDICTED: GDSL esterase/lipase At1g33811 [Beta vulgaris subsp. 
vulgaris]
Length=381

 Score =   297 bits (761),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 217/333 (65%), Gaps = 11/333 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN++LTLA+ANY PYGIDF QGPTGRF NG T VDA+ Q LG     P +
Sbjct  49   FGDSLVDNGNNNDILTLARANYMPYGIDFAQGPTGRFCNGRTFVDALAQLLGFSDFIPPF  108

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLS--AQ  353
            S+   S   +  GVN+AS AAGI D TG      + +  Q+ NFA+ L +L  N    A 
Sbjct  109  SSARRS--SLIRGVNFASGAAGIRDDTGNNLGAHISMSQQVYNFARVLQELRRNFRGDAS  166

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
             ++  + KCI + G+GSNDYL NY MP    T+  +T   YA+ L+Q YS  L  LY LG
Sbjct  167  GLQNYLSKCIIYSGMGSNDYLNNYFMPEYYPTSNQFTPAAYANALLQDYSRQLTDLYRLG  226

Query  531  ARKFVLAGIGELGCIPTMVARSE---NGQCLDEVNQVVDPFNANMKQMVTNFNTA-LPDA  698
             RK V+ G+G++GCIP  +ARS      +C ++ N +V  FN+ ++Q+V  FN   LP A
Sbjct  227  VRKVVVTGVGQIGCIPYELARSNGTGQSRCNEDKNNIVSLFNSGLRQLVDAFNNGQLPGA  286

Query  699  KFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDA  878
            KFVYLD+      + +N ++YG  V+DRGCCGVG+ +G+ITC+P +  C NR++Y+FWDA
Sbjct  287  KFVYLDSYRAGSEVSSNRRSYGIEVIDRGCCGVGRNNGQITCLPLQASCENRDKYLFWDA  346

Query  879  YHPTSAVNVLVGKMAFSGGSDL-VYPINIQQLA  974
            +HPT   NV++ + A+S  S    YPINIQQLA
Sbjct  347  FHPTEVANVILARKAYSSRSTTNAYPINIQQLA  379



>ref|NP_001242353.1| uncharacterized protein LOC100777335 precursor [Glycine max]
 gb|ACU17972.1| unknown [Glycine max]
Length=367

 Score =   297 bits (760),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 161/331 (49%), Positives = 225/331 (68%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGIDF  GP+GRFSNG T VDAI + LG     P Y
Sbjct  38   FGDSLVDNGNNNQLQSLARADYLPYGIDFPGGPSGRFSNGKTTVDAIAELLGFDDYIPPY  97

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +  D S D +  GVNYASAAAGI + TGQ    R+  + Q+ N+  T+ Q+   L  +  
Sbjct  98   A--DASGDAILKGVNYASAAAGIREETGQQLGGRISFRGQVQNYQNTVSQVVNLLGNEDS  155

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ +G+GSNDYL NY MP   S++  Y+   YAD+LIQ Y+  L+ LY+ GA
Sbjct  156  AANYLSKCIYSIGLGSNDYLNNYFMPQFYSSSRQYSTDGYADVLIQAYTEQLKTLYNYGA  215

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK VL GIG++GC P  +A+ S +G+ C++++N     FN  +K +   FN  LPDAK +
Sbjct  216  RKMVLFGIGQIGCSPNELAQNSPDGKTCVEKINTANQIFNNKLKGLTDQFNNQLPDAKVI  275

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y+++  +F++II+N   YGFSV + GCCGVG+ +G+ITC+P +TPC +R EY+FWDA+HP
Sbjct  276  YINSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNGQITCLPMQTPCQDRREYLFWDAFHP  335

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLAR  977
            T A NV+V + A+S  S    YP++IQ+LA+
Sbjct  336  TEAGNVVVAQRAYSAQSASDAYPVDIQRLAQ  366



>ref|XP_010273431.1| PREDICTED: GDSL esterase/lipase At4g18970-like [Nelumbo nucifera]
Length=374

 Score =   297 bits (760),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 220/331 (66%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGIDF  GPTGRF NG T  D I Q LG     P Y
Sbjct  45   FGDSLVDNGNNNQLSSLARADYMPYGIDFDGGPTGRFCNGKTTTDVIAQLLGFDDYIPPY  104

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-  356
            +T     D ++ GVN+ASAAAGI D TG+   +R+ +  Q+ N+     Q+   L  +  
Sbjct  105  ATTRGQ-DLLK-GVNFASAAAGIRDETGRQLGDRITMNGQVRNYQSVASQIVQILGDEAS  162

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + KCIF VG+GSNDYL NY MP   +T+  YT +QYAD LIQ+Y+  L+ LY+ GA
Sbjct  163  AADHLSKCIFTVGMGSNDYLNNYFMPLYYTTSQEYTPEQYADALIQEYTGQLRTLYNYGA  222

Query  534  RKFVLAGIGELGCIPTMVAR-SENG-QCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK  L G+G++GC P  +A+ S+NG  C+D +N     FN  +K +V NFN+ L  AKF 
Sbjct  223  RKVALIGVGQIGCSPNQLAQNSQNGVACVDRINVANQMFNNKLKALVDNFNSNLDGAKFT  282

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F +++ N   YGF+V + GCCGVG+ +G+ITC+P +TPC NR +Y+FWDA+HP
Sbjct  283  YINAYGIFEDMLKNPSAYGFTVTNTGCCGVGRNNGQITCLPLQTPCQNRNQYLFWDAFHP  342

Query  888  TSAVNVLVGKMAFSG-GSDLVYPINIQQLAR  977
            T A NV+VGK ++    S   YP++I++LAR
Sbjct  343  TEAANVIVGKRSYRAQSSSDAYPVDIERLAR  373



>ref|XP_006449582.1| hypothetical protein CICLE_v10015686mg [Citrus clementina]
 gb|ESR62822.1| hypothetical protein CICLE_v10015686mg [Citrus clementina]
Length=366

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 164/331 (50%), Positives = 218/331 (66%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+ANY PYGIDF  GPTGRFSNG T VD I Q LG     P Y
Sbjct  37   FGDSLVDNGNNNQLSSLARANYLPYGIDFPNGPTGRFSNGKTTVDVIAQLLGFDGYIPPY  96

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            S      D +R GVNYASAAAGI + TG+   +R+    Q+ N+  T+ Q+   L  +  
Sbjct  97   SAARGQ-DILR-GVNYASAAAGIREETGRQLGDRISFSGQVKNYQNTVQQVVNLLGNEDQ  154

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + +CI+ +G+GSNDYL NY  P   ST   YT +QYADLLIQQY+  LQ LY+ GA
Sbjct  155  AANYLSRCIYSIGLGSNDYLNNYFQPLYYSTGRQYTPEQYADLLIQQYTQQLQALYNYGA  214

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKFVL G+G++GC P  +A+ S +G+ C+  VN     FN  ++ +V  FN    DAKF+
Sbjct  215  RKFVLIGVGQIGCSPNQLAQNSPDGRTCVQRVNDANVIFNNKLRGLVDQFNNNDSDAKFI  274

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F++I AN   YGF V + GCCGVG+ +G+ITC+P + PCPNR EYVFWDA+HP
Sbjct  275  YINAYGIFQDITANPARYGFRVTNTGCCGVGRNNGQITCLPLQNPCPNRREYVFWDAFHP  334

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLAR  977
            T A N ++   ++S  S    YPI+I++LA+
Sbjct  335  TEAANTIIATRSYSAQSPSDAYPIDIRRLAQ  365



>gb|KHN47079.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 159/330 (48%), Positives = 216/330 (65%), Gaps = 8/330 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D+GNNN +LTLA+ANY PYGIDF  G TGRF+NG T VDA+ Q LG P   A  
Sbjct  41   FGDSLVDNGNNNGILTLARANYRPYGIDFPGGATGRFTNGRTYVDALAQLLGFPTYIAPY  100

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSA--QV  356
            +    ++ +R G NYAS AAGI + TG        L  Q+ NF  T+ QL        + 
Sbjct  101  SRARGLELLR-GANYASGAAGIREETGSNLGAHTSLNEQVANFGNTVQQLRRFFRGDNES  159

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            +   + KC+FF G+GSNDYL NY M    ST+  YTV+ +A +L+Q YS  L +LY LGA
Sbjct  160  LNSYLNKCLFFSGMGSNDYLNNYFMSDFYSTSSDYTVKAFASVLLQDYSRKLSQLYSLGA  219

Query  534  RKFVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTA-LPDAKF  704
            RK ++  +G++GCIP  +AR    + +C +++N  +  FN+ +K MV NFN   LP AKF
Sbjct  220  RKVMVTAVGQIGCIPYQLARFHGNSSRCNEKINNAISLFNSGLKTMVQNFNGGQLPGAKF  279

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            VYLD     +++ +N  +YGF V+D+GCCGVG+ +G+ITC+P + PC NR++Y+FWDA+H
Sbjct  280  VYLDFYQSSQDLSSNGTSYGFDVIDKGCCGVGRNNGQITCLPQQQPCENRQKYLFWDAFH  339

Query  885  PTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            PT   N+L+ K  +S  S   YPINIQQLA
Sbjct  340  PTELANILLAKATYSSQS-YTYPINIQQLA  368



>emb|CDY62118.1| BnaCnng39210D [Brassica napus]
Length=375

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 218/333 (65%), Gaps = 10/333 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQG-PTGRFSNGYTIVDAIGQQLGLPLAPAY  179
            FGDSL+D+GNNN L +LA++NY PYGIDF  G PTGRFSNG TIVD IG+ LGLP  PA+
Sbjct  44   FGDSLVDNGNNNRLNSLARSNYLPYGIDFDGGQPTGRFSNGKTIVDFIGELLGLPDIPAF  103

Query  180  -STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV  356
              T D  +D +R GVNYASAA GIL+ TG+   ER  ++ Q+ NF KTL ++S  + + V
Sbjct  104  METMDGGVDVLR-GVNYASAAGGILEETGRHLGERFSMRRQVENFDKTLMEISRGIGSSV  162

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              E + K +  V +G+NDY+ NYL P    T+ IY    +ADLL+  ++ NL  LYD G 
Sbjct  163  T-EYMAKSLVVVSLGNNDYINNYLKPSLFLTSSIYNPTSFADLLVSNFTSNLLELYDKGF  221

Query  534  RKFVLAGIGELGCIPTMVARSE--NGQCLDEVNQVVDPFNANMKQMVTNFNT---ALPDA  698
            RKFVLAG+G LGCIP  +A      G+C++ VN++ + FN  +K +V   N+      DA
Sbjct  222  RKFVLAGVGPLGCIPDQLAARAVPPGECVESVNEMAELFNNRLKSLVDRLNSDNKTGRDA  281

Query  699  KFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDA  878
             FVY +T     +I+ N   YGF V DRGCCGVG+  GEITC+P   PC  R+ +VFWDA
Sbjct  282  IFVYGNTYGAAVDILTNPIDYGFEVTDRGCCGVGRNGGEITCLPLAVPCAFRDRHVFWDA  341

Query  879  YHPTSAVNVLVGKMAFSGGSDLVYPINIQQLAR  977
            +HPT A N+++   AF+G     YPIN+ Q++R
Sbjct  342  FHPTQAFNLIIALRAFNGSKSDCYPINLLQMSR  374



>ref|XP_010924691.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Elaeis guineensis]
Length=367

 Score =   296 bits (759),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 156/332 (47%), Positives = 225/332 (68%), Gaps = 11/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP--LAPA  176
            FGDSL+D+GNNN++ +LA+ANY PYGIDF  GPTGRFSNG T VD I Q LG    ++P 
Sbjct  39   FGDSLVDNGNNNDMASLARANYMPYGIDFPGGPTGRFSNGLTAVDVIAQLLGFEDFISPY  98

Query  177  YSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-  353
             +  D +   +  GVN+ASAAAGI + TGQ   +R+    Q+ N+   + ++   L  + 
Sbjct  99   AAARDRA---LLTGVNFASAAAGIREETGQQLGDRISFSGQLENYQAAVQEVVNILGDED  155

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
                 + KCIF VG+GSNDYL NY MP   S++  YT +QYA++LI+QYS  ++ LY+ G
Sbjct  156  SAANYLSKCIFSVGMGSNDYLNNYFMPAFYSSSRQYTPEQYANVLIEQYSQQIRTLYNYG  215

Query  531  ARKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKF  704
            ARK VL G+G++GC P  +A+ S NG+ C++ +N  +  FN+ +  +V  FNT L  A F
Sbjct  216  ARKVVLMGVGQIGCSPNELAQQSSNGETCVNRINSAIQIFNSKLIALVDEFNT-LDGAHF  274

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
             Y++   +F +I+ N   +G +V +RGCCGVGK +G+ITC+P++TPCPNR EY+FWDA+H
Sbjct  275  TYINAYGIFEDILRNPSAHGLTVTNRGCCGVGKNNGQITCLPYQTPCPNRNEYLFWDAFH  334

Query  885  PTSAVNVLVGKMAFSG-GSDLVYPINIQQLAR  977
            PT A N+++GK ++S   S   YP++I+ LA+
Sbjct  335  PTEAANIVIGKRSYSAESSSDAYPMDIRHLAQ  366



>ref|XP_007019704.1| GDSL-like Lipase/Acylhydrolase superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY16929.1| GDSL-like Lipase/Acylhydrolase superfamily protein isoform 1 
[Theobroma cacao]
Length=364

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 162/326 (50%), Positives = 215/326 (66%), Gaps = 5/326 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D GNNN L ++AK+NY PYGIDF   PTGRFSNG T VD IG+ LG+P  PA++
Sbjct  37   FGDSLVDVGNNNFLSSIAKSNYFPYGIDFNMQPTGRFSNGKTFVDIIGEMLGVPYPPAFA  96

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P+    ++  G+NYASAAAGILD TGQ +  R  L  Q+ NF  TLDQL   + + V  
Sbjct  97   DPNSVGVKILGGMNYASAAAGILDETGQHYGARYSLSRQVVNFESTLDQLRTMMGSNVTN  156

Query  363  EGIPKCIFFVGIGSNDYLTNYLM-PGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
              + K I  +  GSNDY+ NYLM    S++  Y+  ++A+LL+  Y   L  LY +G RK
Sbjct  157  F-LAKSIAIMVFGSNDYINNYLMPSIYSSSYTYSPSEFANLLLNHYGRQLLALYSVGLRK  215

Query  540  FVLAGIGELGCIPTMVA--RSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            F +AG+G LGCIP   A  ++  G+C+D VNQ++  FN  +K +V   N   P A FVY 
Sbjct  216  FFIAGVGPLGCIPNQRATGQAAPGRCVDYVNQILGTFNQGIKSLVEQLNNR-PGAIFVYG  274

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T     +I+ +  TYGFSVVD+GCCG+G+  G+ITC+PF  PCP+R +YVFWDA+HPT 
Sbjct  275  NTYGAVGDILNDPSTYGFSVVDKGCCGIGRNQGQITCLPFAYPCPDRTQYVFWDAFHPTQ  334

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQL  971
            AVN ++ + AF G     YPINIQQ+
Sbjct  335  AVNSILARRAFYGPPLDSYPINIQQM  360



>ref|XP_011085304.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Sesamum indicum]
Length=367

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 222/332 (67%), Gaps = 10/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNNN+ +LAKANY PYGIDF +GPTGRFSNG T VD + + LG     P Y
Sbjct  38   FGDSLVDNGNNNNIQSLAKANYLPYGIDFPRGPTGRFSNGKTTVDVVAELLGFDGYIPPY  97

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +       ++  GVNYASAAAGI   TGQ    R+    Q+ N+  T+ Q+ + L  Q  
Sbjct  98   ARARGQ--EVLKGVNYASAAAGIRPETGQQLGGRIDFTGQVNNYKNTVAQVVSLLGGQDA  155

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ VG+GSNDYL NY MP   ST+  Y+ +QYA LLIQQY+  L+ LY+ GA
Sbjct  156  AATYLSKCIYSVGVGSNDYLNNYFMPLFYSTSRRYSPEQYATLLIQQYAQQLRNLYNYGA  215

Query  534  RKFVLAGIGELGCIPTMVARS--ENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKF L G+G++GC P  +A++  +   C+  +N     FN+ ++ +V +FN    DAKF+
Sbjct  216  RKFALVGVGQIGCSPNALAQNSPDGSTCVQRINNANRIFNSKLRALVDDFNRNATDAKFI  275

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y+D   +F+++I N  ++GF V + GCCGVG+ +G+ITC+P +TPC NR EY+FWDA+HP
Sbjct  276  YIDAYGIFQDLIDNPSSFGFRVKNAGCCGVGRNNGQITCLPLQTPCRNRNEYLFWDAFHP  335

Query  888  TSAVNVLVGKMAFSG--GSDLVYPINIQQLAR  977
            T A N++VG+ ++S    SD  YP +I++LA+
Sbjct  336  TEAANIIVGRRSYSAQKASD-AYPFDIRRLAQ  366



>ref|XP_006399344.1| hypothetical protein EUTSA_v10016068mg [Eutrema salsugineum]
 gb|ESQ40797.1| hypothetical protein EUTSA_v10016068mg [Eutrema salsugineum]
Length=373

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 165/333 (50%), Positives = 218/333 (65%), Gaps = 11/333 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQG-PTGRFSNGYTIVDAIGQQLGLPLAPAY  179
            FGDSL+D+GNNN L +LA++NY PYGIDF  G PTGRFSNG TIVD IG+ +GLP  PAY
Sbjct  43   FGDSLVDNGNNNRLNSLARSNYLPYGIDFDGGQPTGRFSNGKTIVDFIGELIGLPDIPAY  102

Query  180  -STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV  356
              T D  +D +R GVNYASAA GIL+ TG+   ER  ++ Q+ NF KTL ++S  + +  
Sbjct  103  IETVDGGVDILR-GVNYASAAGGILEETGRHLGERFSMRRQVENFEKTLMEISRGIES--  159

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            VKE + K +  V +G+NDY+ NYL P    T+ IY    +ADLL+  ++ +L  LY  G 
Sbjct  160  VKEYMAKSLVVVSLGNNDYINNYLKPSLFLTSSIYDPPSFADLLLSNFTSHLLELYGKGF  219

Query  534  RKFVLAGIGELGCIPTMVARSE--NGQCLDEVNQVVDPFNANMKQMVTNFNT---ALPDA  698
            RKFVLAG+G LGCIP  +A      G+C++EVN++   FN  +K +V   N+      DA
Sbjct  220  RKFVLAGVGPLGCIPDQLAARAVPPGECVEEVNEMAQLFNDRLKSLVDRLNSDNITARDA  279

Query  699  KFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDA  878
             FVY +T     +I+ N   YGF V DRGCCGVG+  GEITC+P   PC  R+ +VFWDA
Sbjct  280  VFVYGNTYGAAVDILTNPFAYGFEVTDRGCCGVGRNRGEITCLPLAVPCAFRDRHVFWDA  339

Query  879  YHPTSAVNVLVGKMAFSGGSDLVYPINIQQLAR  977
            +HPT A N+++   AF+G     YPIN+ QL+R
Sbjct  340  FHPTQAFNLIIALRAFNGSKSDCYPINLSQLSR  372



>ref|XP_011095907.1| PREDICTED: GDSL esterase/lipase At1g33811 [Sesamum indicum]
Length=374

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/333 (49%), Positives = 221/333 (66%), Gaps = 12/333 (4%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP--LAPA  176
            FGDSL+D+GNNN++LTLA+A+Y PYGIDF QG TGRF+NG T VD + Q LG P  + P 
Sbjct  43   FGDSLVDNGNNNDILTLARADYGPYGIDFPQGATGRFTNGRTFVDILAQLLGFPNYILPY  102

Query  177  YSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV  356
                  ++ Q   G NYAS A+GI D TG    + + +  Q+ +FA T+ QL+       
Sbjct  103  ARARGRALLQ---GANYASGASGIRDETGNNLGDHMSMNRQVDSFASTVQQLNRYFKGDG  159

Query  357  VKEG--IPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDL  527
               G  + KCIF+ G+GSNDYL NY M    ST+  YT + YA  LI+ Y+  L  LY L
Sbjct  160  NALGNYLSKCIFYSGLGSNDYLNNYFMSDYYSTSSEYTPRTYAASLIEDYTKQLTELYKL  219

Query  528  GARKFVLAGIGELGCIPTMVARSE-NG-QCLDEVNQVVDPFNANMKQMVTNFNTA-LPDA  698
            GARK V+ G+G++GCIP  +AR + NG +C +E+N  +  FN  +K++V  FN   LP A
Sbjct  220  GARKVVVTGVGQIGCIPYQLARYDGNGSRCNEEINNAIALFNTGLKRLVDRFNKGQLPGA  279

Query  699  KFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDA  878
            KF+YLD+    ++++ N+KTYGF VVD GCCGVGK +G+ITC+P + PC +R++Y+FWDA
Sbjct  280  KFIYLDSFQSSQDLVLNAKTYGFEVVDEGCCGVGKNNGQITCLPLQMPCDDRQKYLFWDA  339

Query  879  YHPTSAVNVLVGKMAF-SGGSDLVYPINIQQLA  974
            +HPT A N+L+ K A+ S      YPINIQQLA
Sbjct  340  FHPTEAANILLAKKAYISKSKSHAYPINIQQLA  372



>ref|XP_008443704.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Cucumis melo]
Length=374

 Score =   296 bits (758),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 165/331 (50%), Positives = 225/331 (68%), Gaps = 9/331 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGIDF  GPTGRFSNG T VD I + LG     P Y
Sbjct  46   FGDSLVDNGNNNQLQSLARADYLPYGIDFG-GPTGRFSNGKTTVDVIAELLGFDDYIPPY  104

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +T     D +R GVNYASAAAGI + TG+    R+    Q+ N+  T+ Q+   L  +  
Sbjct  105  ATARGR-DILR-GVNYASAAAGIREETGRQLGGRISFSGQVENYQNTVSQVVDLLGDEDS  162

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              E + KCI+ +G+GSNDYL NY MP   ST   YT QQY++ LIQQY+  L+ LY+ GA
Sbjct  163  AAEYLSKCIYSIGLGSNDYLNNYFMPQFYSTGNQYTPQQYSENLIQQYAEQLRLLYNYGA  222

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKFVL GIG++GC P  +A+ S +G+ C+  +N     FNA +K +V  FN    DAKF+
Sbjct  223  RKFVLFGIGQIGCSPNELAQNSPDGRTCVQRINSANQIFNAGLKSLVDQFNNNQADAKFI  282

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y+D+  +F+++I N   +GF VV+ GCCGVG+ +G+ITC+PF+TPC NR+EY+FWDA+HP
Sbjct  283  YIDSFGIFQDVIDNPSAFGFRVVNTGCCGVGRNNGQITCLPFQTPCSNRDEYLFWDAFHP  342

Query  888  TSAVNVLVGKMAFSGGSDL-VYPINIQQLAR  977
            T A N +VG+ A+S       YP++I++LA+
Sbjct  343  TEAGNTVVGRRAYSAQRPTDAYPVDIRRLAQ  373



>gb|AFK40262.1| unknown [Lotus japonicus]
Length=360

 Score =   295 bits (756),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 160/330 (48%), Positives = 214/330 (65%), Gaps = 8/330 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D+GNNN +LTLA+ANY PYGIDF  GPTGRF+NG T VDA+ Q +G       S
Sbjct  31   FGDSLVDNGNNNGILTLARANYRPYGIDFPLGPTGRFTNGRTYVDALAQLMGFRTYIPPS  90

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ--V  356
            +    ++ +R GVNYAS AAGI   TG        +  Q+ NF  T+ QL          
Sbjct  91   SRARGLELLR-GVNYASGAAGIRQETGDNLGAHTSMNAQVANFGNTVQQLRRYFRGDNDS  149

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            +   + KC+FF G+GSNDYL NY MP   ST+  YT   YA +L+Q Y+  L +LY LGA
Sbjct  150  LSSYLSKCMFFSGMGSNDYLNNYFMPDFYSTSSDYTASAYATVLLQDYARQLGQLYSLGA  209

Query  534  RKFVLAGIGELGCIPTMVARSE--NGQCLDEVNQVVDPFNANMKQMVTNFNTA-LPDAKF  704
            RK ++  +G++G IP  +AR+   N +C +++N V+  FN  +K+MV NFN   LP AKF
Sbjct  210  RKVMVTAVGQIGYIPYQLARTRANNTKCNEKINNVIQYFNTGLKKMVQNFNGGQLPGAKF  269

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            VYLD     +++  N  ++GF VVD+GCCGVG+ +G+ITC+P + PC NRE+Y+FWDA+H
Sbjct  270  VYLDFYKSSQDLSTNGTSFGFEVVDKGCCGVGRNNGQITCLPLQQPCENREKYLFWDAFH  329

Query  885  PTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            PT   N+L+ K  +S  S   YPINIQQLA
Sbjct  330  PTELANILLAKATYSSQS-YTYPINIQQLA  358



>emb|CAN77693.1| hypothetical protein VITISV_030206 [Vitis vinifera]
Length=385

 Score =   296 bits (758),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 164/349 (47%), Positives = 215/349 (62%), Gaps = 28/349 (8%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID GNNN L ++AK+NY PYGIDF +GPTGRF NG TIVD + + LG+     ++
Sbjct  38   FGDSLIDDGNNNFLDSIAKSNYYPYGIDF-RGPTGRFCNGKTIVDLLAEMLGVSYPQPFA  96

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFV----------------------ERVPLKN  296
             P  +  ++  GVNYASAAAGILD TGQ +V                      +R  L  
Sbjct  97   DPGSTGSKIFSGVNYASAAAGILDETGQNYVSYFYLLNSITIITWTREQAIIGQRFSLSQ  156

Query  297  QITNFAKTLDQLSANLSAQVVKEGIPKCIFFVGIGSNDYLTNYLMPG---SSTNIIYTVQ  467
            Q+ NF  TL Q+    +   +   + K I  +  GSNDYL NYLMP    SS N  Y+  
Sbjct  157  QVLNFETTLSQMRTMANGTTLSRYLAKSIVIMVFGSNDYLNNYLMPSLYPSSYN--YSPP  214

Query  468  QYADLLIQQYSLNLQRLYDLGARKFVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFN  647
             +A+LL+  Y+  +  LY LG RKF LAGIG LGC+P   A +  G+CLD  NQ++  FN
Sbjct  215  DFANLLLNHYARQILALYSLGLRKFFLAGIGPLGCMPNQRALAPPGRCLDYDNQILGTFN  274

Query  648  ANMKQMVTNFNTALPDAKFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCV  827
              ++ +V   N   P + FVY +T  +F +I+ N  TYGFSVVDRGCCG+G+  G+ITC+
Sbjct  275  EGLRALVNQLNGNHPGSIFVYGNTYGIFGDILNNPATYGFSVVDRGCCGLGRNQGQITCL  334

Query  828  PFETPCPNREEYVFWDAYHPTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            P + PC NR EYVFWDA+HPT+A NV++ + AF G     YPIN+QQ+A
Sbjct  335  PMQMPCLNRNEYVFWDAFHPTTAANVILAQTAFYGPPSDCYPINVQQMA  383



>ref|XP_004504253.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cicer arietinum]
Length=362

 Score =   295 bits (756),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 159/331 (48%), Positives = 221/331 (67%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGIDF  GP+GRFSNG T VDAI + LG     P Y
Sbjct  33   FGDSLVDNGNNNALRSLARADYLPYGIDFPGGPSGRFSNGKTTVDAIAELLGFDDYIPPY  92

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            ++   S D +  GVNYASAAAGI + TGQ    R+    Q+ N+  T+ Q+   L  +  
Sbjct  93   ASA--SDDAILKGVNYASAAAGIREETGQQLGGRISFSGQVQNYQTTVSQVVNLLGNEDQ  150

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ +G+GSNDYL NY MP   ST   YT  +YAD LIQ Y+  L+ LY+ GA
Sbjct  151  AATYLSKCIYSIGLGSNDYLNNYFMPQFYSTGSQYTPDEYADNLIQSYTEQLKTLYNYGA  210

Query  534  RKFVLAGIGELGCIPTMVARS--ENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK VL GIG++GC P  +A++  +   C++++N   + FN  +K +V  FN  LPD++ +
Sbjct  211  RKMVLFGIGQIGCSPNQLAQNSPDGTTCVEKINSANEIFNNKLKSLVDQFNNQLPDSRVI  270

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y+++  +F++II+N   YGFSV + GCCGVG+ +G+ITC+P +TPC NR EY+FWDA+HP
Sbjct  271  YINSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNGQITCLPMQTPCDNRREYLFWDAFHP  330

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLAR  977
            T A NV+V + A++  S    YPI+I  LA+
Sbjct  331  TEAGNVVVAQRAYNAQSASDAYPIDINHLAQ  361



>ref|XP_006471326.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Citrus sinensis]
Length=366

 Score =   295 bits (756),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 163/331 (49%), Positives = 217/331 (66%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+ANY PYGIDF  GPTGRFSNG T VD I Q LG     P Y
Sbjct  37   FGDSLVDNGNNNQLSSLARANYLPYGIDFPNGPTGRFSNGKTTVDVIAQLLGFDGYIPPY  96

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            S      D +R GVNYASAAAGI + TG+   +R+    Q+ N+  T+ Q+   L  +  
Sbjct  97   SAARGQ-DILR-GVNYASAAAGIREETGRQLGDRISFSGQVKNYQNTVQQVVNLLGNEDQ  154

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + +CI+ +G+GSNDYL NY  P   ST   YT +QYADLLIQQY+  LQ  Y+ GA
Sbjct  155  AANYLSRCIYSIGLGSNDYLNNYFQPLYYSTGRQYTPEQYADLLIQQYTQQLQAFYNYGA  214

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKFVL G+G++GC P  +A+ S +G+ C+  VN     FN  ++ +V  FN    DAKF+
Sbjct  215  RKFVLIGVGQIGCSPNQLAQNSPDGRTCVKRVNDANVIFNNKLRGLVDQFNNNNSDAKFI  274

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F++I AN   YGF V + GCCGVG+ +G+ITC+P + PCPNR EYVFWDA+HP
Sbjct  275  YINAYGIFQDITANPARYGFRVTNTGCCGVGRNNGQITCLPLQNPCPNRREYVFWDAFHP  334

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLAR  977
            T A N ++   ++S  S    YPI+I++LA+
Sbjct  335  TEAANTIIATRSYSAQSPSDAYPIDIRRLAQ  365



>ref|NP_001242366.1| uncharacterized protein LOC100800635 precursor [Glycine max]
 gb|ACU19711.1| unknown [Glycine max]
Length=366

 Score =   295 bits (755),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 160/331 (48%), Positives = 225/331 (68%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGIDF  GP+GRFSNG T VDAI + LG     P Y
Sbjct  37   FGDSLVDNGNNNQLQSLARADYLPYGIDFPGGPSGRFSNGKTTVDAIAELLGFDDYIPPY  96

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +  D S D +  GVNYASAAAGI + TGQ    R+    Q+ N+  T+ Q+   L  +  
Sbjct  97   A--DASGDAILKGVNYASAAAGIREETGQQLGGRISFSGQVQNYQSTVSQVVNLLGNEDS  154

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ +G+GSNDYL NY MP   S++  Y+  +YAD+LIQ Y+  L+ LY+ GA
Sbjct  155  AANYLSKCIYSIGLGSNDYLNNYFMPQFYSSSRQYSPDEYADVLIQAYTEQLKTLYNYGA  214

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK VL GIG++GC P  +A+ S +G+ C++++N     FN  +K +   F+  LPDA+ +
Sbjct  215  RKMVLFGIGQIGCSPNELAQNSPDGKTCVEKINSANQIFNNKLKGLTDQFDNQLPDARVI  274

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y+++  +F++II+N   YGFSV + GCCGVG+ +G+ITC+P +TPC NR EY+FWDA+HP
Sbjct  275  YVNSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNGQITCLPMQTPCQNRREYLFWDAFHP  334

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLAR  977
            T A NV+V + A+S  S    YP++IQ+LA+
Sbjct  335  TEAGNVVVAQRAYSAQSASDAYPVDIQRLAQ  365



>ref|XP_010471141.1| PREDICTED: GDSL esterase/lipase At1g71250 [Camelina sativa]
Length=374

 Score =   295 bits (756),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 151/326 (46%), Positives = 205/326 (63%), Gaps = 3/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
             GDSL+DSGNNN L ++A+ANY PYGID    PTGRFSNG T +D + Q LG+P  PA++
Sbjct  45   LGDSLVDSGNNNFLQSVARANYLPYGIDLNFRPTGRFSNGLTFIDLLAQLLGIPSPPAFA  104

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P  S +++  GVN+ASAAAGILD +G  +  R  L  Q+ N   TL QL   +S Q   
Sbjct  105  DPTTSGNRILQGVNHASAAAGILDESGYHYGARFTLSQQMVNLETTLSQLRTMMSPQNFT  164

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + + + +  +  GSNDY+ NYLMP   S++  Y    +A+LL+ QY+  L  LY LG RK
Sbjct  165  DYLARSLVVLVFGSNDYINNYLMPNLYSSSFRYRPADFANLLLSQYARQLLTLYSLGLRK  224

Query  540  FVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
              + G+  LGCIP   A      G+C+D VNQ++  FN  +K +V   N   P A FVY 
Sbjct  225  IFIPGVAPLGCIPNQRATGAGPPGRCVDSVNQILGTFNEGLKSLVDQLNQRSPGAIFVYG  284

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T +   +I+ N   YGFSVVDR CCG+G+  G+ITC+P + PCPNR +YVFWDA+HPT 
Sbjct  285  NTYSAIGDILNNPAAYGFSVVDRACCGIGRNQGQITCLPMQNPCPNRSQYVFWDAFHPTQ  344

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQL  971
              N ++ + AF G     YP+N+QQ+
Sbjct  345  TANSILARRAFYGPPSDAYPVNVQQM  370



>ref|XP_003629880.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AET04356.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=363

 Score =   295 bits (755),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 164/331 (50%), Positives = 222/331 (67%), Gaps = 9/331 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGIDF  GPTGRFSNG T VDAI + LG     P Y
Sbjct  35   FGDSLVDNGNNNGLQSLARADYLPYGIDFG-GPTGRFSNGKTTVDAIAELLGFDDYIPPY  93

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            ++   S D +  GVNYASAAAGI + TG+    R+    Q+ N+  T+ Q+   L  +  
Sbjct  94   ASA--SDDAILKGVNYASAAAGIREETGRQLGARLSFSAQVQNYQSTVSQVVNILGTEDQ  151

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ +G+GSNDYL NY MP   +T+  YT  +YAD LIQ Y+  L+ LY+ GA
Sbjct  152  AASHLSKCIYSIGLGSNDYLNNYFMPQFYNTHDQYTPDEYADDLIQSYTEQLRTLYNNGA  211

Query  534  RKFVLAGIGELGCIPTMVA-RSENG-QCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK VL GIG++GC P  +A RS +G  C++E+N     FN  +K +V  FN  LPD+K +
Sbjct  212  RKMVLFGIGQIGCSPNELATRSADGVTCVEEINSANQIFNNKLKGLVDQFNNQLPDSKVI  271

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y+++  +F++II+N   YGFSV + GCCGVG+ +G+ TC+P +TPC NR EY+FWDA+HP
Sbjct  272  YVNSYGIFQDIISNPSAYGFSVTNAGCCGVGRNNGQFTCLPLQTPCENRREYLFWDAFHP  331

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLAR  977
            T A NV+V + A+S  S D  YPI+I  LA+
Sbjct  332  TEAGNVVVAQRAYSAQSPDDAYPIDISHLAQ  362



>ref|XP_007148614.1| hypothetical protein PHAVU_005G001200g [Phaseolus vulgaris]
 gb|ESW20608.1| hypothetical protein PHAVU_005G001200g [Phaseolus vulgaris]
Length=371

 Score =   295 bits (755),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 158/330 (48%), Positives = 216/330 (65%), Gaps = 8/330 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D+GNNN +LTLA+ANY PYGIDF  G TGRF+NG T VDA+ Q LG P     +
Sbjct  42   FGDSLVDNGNNNGILTLARANYRPYGIDFPGGATGRFTNGRTYVDALAQLLGFPTYIPPN  101

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ--V  356
            +    ++ +R G NYAS AAGI D TG        + +Q+ NF  T+ QL          
Sbjct  102  SRARGLELLR-GANYASGAAGIRDETGNNLGGHTSMNDQVANFGNTVQQLRRFFRGDNDS  160

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            +   + KC+FF G+GSNDYL NY MP   ST+  +TV+ +A  L+Q YS  L +LY LGA
Sbjct  161  LNSYLSKCLFFSGMGSNDYLNNYFMPDFYSTSSDFTVKAFASALLQDYSRQLSQLYSLGA  220

Query  534  RKFVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTA-LPDAKF  704
            RK ++  +G++GCIP  +AR    + +C +++N  +  FN+ +K+MV NFN   LP AKF
Sbjct  221  RKVMVTAVGQIGCIPYQLARFHGNSTKCNEKINSAILLFNSGLKKMVQNFNGGQLPGAKF  280

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            V+LD      ++ +N  +YGF V+D+GCCGVGK +G+ITC+P + PC NR++Y+FWDA+H
Sbjct  281  VFLDFYQSSSDLSSNGTSYGFDVMDKGCCGVGKNNGQITCLPLQQPCENRQKYLFWDAFH  340

Query  885  PTSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            PT   N+L+ K  +S  S   YPINIQQLA
Sbjct  341  PTEVANILLAKATYSSQS-YTYPINIQQLA  369



>gb|KHN11641.1| GDSL esterase/lipase [Glycine soja]
Length=370

 Score =   295 bits (754),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 151/329 (46%), Positives = 214/329 (65%), Gaps = 7/329 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL++ GNNN L T+A+ANY PYGIDF +G TGRFSNG +++D IG  LG+P  P ++
Sbjct  42   FGDSLVEVGNNNFLNTIARANYFPYGIDFGRGSTGRFSNGKSLIDFIGDLLGIPSPPPFA  101

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P     ++ +GVNYASA+AGILD +G+ + +R  L  Q+ NF  TL+Q    ++   + 
Sbjct  102  DPSTVGTRILYGVNYASASAGILDESGRHYGDRYSLSQQVLNFENTLNQYRTMMNGSALN  161

Query  363  EGIPKCIFFVGIGSNDYLTNYLMP---GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            + + K I  V  GSNDY+ NYL+P   GSS N  YT Q + +LL+  Y   +  L+ +G 
Sbjct  162  QFLAKSIAVVVTGSNDYINNYLLPGLYGSSRN--YTAQDFGNLLVNSYVRQILALHSVGL  219

Query  534  RKFVLAGIGELGCIPTM--VARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKF LAGIG LGCIP++   A +  G+C+D VNQ+V  FN  ++ MV   N   P+A FV
Sbjct  220  RKFFLAGIGPLGCIPSLRAAALAPTGRCVDLVNQMVGTFNEGLRSMVDQLNRNHPNAIFV  279

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y +T  +F +I+ N   + F+VVDR CCG+G+  G++TC+P + PC +R +YVFWDA+HP
Sbjct  280  YGNTYRVFGDILNNPAAFAFNVVDRACCGIGRNRGQLTCLPLQFPCTSRNQYVFWDAFHP  339

Query  888  TSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            T +   +      +G  D  YPIN+QQ+A
Sbjct  340  TESATYVFAWRVVNGAPDDSYPINMQQMA  368



>ref|XP_004147394.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cucumis sativus]
Length=366

 Score =   295 bits (754),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 161/331 (49%), Positives = 223/331 (67%), Gaps = 9/331 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGIDF  GPTGRFSNG T VD I + LG     P Y
Sbjct  38   FGDSLVDNGNNNQLQSLARADYLPYGIDFG-GPTGRFSNGKTTVDVIAELLGFDDYIPPY  96

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +T       +  GVNYASAAAGI + TG+    R+    Q+ N+  T+ Q+   L  +  
Sbjct  97   ATARGR--DILGGVNYASAAAGIREETGRQLGGRISFSGQVENYQNTVSQVVELLGDEDS  154

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              E + KCI+ +G+GSNDYL NY MP   ST   YT QQY++ LIQQY+  L+ LY+ GA
Sbjct  155  AAEYLSKCIYSIGLGSNDYLNNYFMPQFYSTGNQYTPQQYSENLIQQYAEQLRLLYNYGA  214

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKFVL GIG++GC P  +A+ S +G+ C+  +N     FNA +K +V  FN    DAKF+
Sbjct  215  RKFVLFGIGQIGCSPNELAQNSPDGRTCVQRINSANQIFNAGLKSLVDQFNNNQADAKFI  274

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            ++D+  +F+++I N   +GF VV+ GCCGVG+ +G+ITC+PF+TPC NR+EY+FWDA+HP
Sbjct  275  FIDSYGIFQDVIDNPSAFGFRVVNAGCCGVGRNNGQITCLPFQTPCSNRDEYLFWDAFHP  334

Query  888  TSAVNVLVGKMAFSGGSDL-VYPINIQQLAR  977
            T A N ++G+ A+S       YP++I++LA+
Sbjct  335  TEAGNAVIGRRAYSAQQQTDAYPVDIRRLAQ  365



>ref|XP_009596155.1| PREDICTED: GDSL esterase/lipase At1g33811 isoform X2 [Nicotiana 
tomentosiformis]
Length=359

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 216/332 (65%), Gaps = 17/332 (5%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN +LTLA+ANY PYGIDF QG TGRF+N         Q LG P   P Y
Sbjct  37   FGDSLVDNGNNNGILTLARANYMPYGIDFPQGATGRFTNA--------QLLGFPNYIPPY  88

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ--  353
            +        +  G NYAS AAGI D TG    + +P+  Q+ NFA+T ++L         
Sbjct  89   ARVRGR--ALLRGANYASGAAGIRDETGNNLGDHMPMNQQVENFARTAEELRRLFRGNNN  146

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
             +   + KCIF+ G+GSNDYL NY M    ST+  YT Q YA  L+Q Y   L  LY+LG
Sbjct  147  TLNGYLSKCIFYSGLGSNDYLNNYFMTDYYSTHSQYTPQAYATALLQDYCKQLSELYNLG  206

Query  531  ARKFVLAGIGELGCIPTMVARSE--NGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKF  704
            ARK V+ G+G++GCIP  +AR +  + +C +E+N  +  FN+ +K++V  FN  LP AKF
Sbjct  207  ARKVVVTGVGQIGCIPYELARYDGNDSRCNEEINNAILLFNSGLKKLVVRFNKVLPGAKF  266

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            V+LD+    ++++ N+KTYGF VVD+GCCGVG+ +G+ITC+P + PC +R +Y+FWDA+H
Sbjct  267  VFLDSFESTKDLVVNAKTYGFEVVDKGCCGVGRNNGQITCLPLQQPCDDRSKYIFWDAFH  326

Query  885  PTSAVNVLVGKMAFSGGSD-LVYPINIQQLAR  977
            PT   N+++ K ++S  S    YPINIQQLAR
Sbjct  327  PTEVANIILAKKSYSSISKTFAYPINIQQLAR  358



>ref|XP_004233002.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Solanum lycopersicum]
Length=365

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 162/332 (49%), Positives = 220/332 (66%), Gaps = 8/332 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNNN+ +LAKANY PYGIDF+ GPTGRFSNG T VD I +QLG     P Y
Sbjct  36   FGDSLVDNGNNNNIQSLAKANYLPYGIDFSGGPTGRFSNGKTTVDVIAEQLGFNGNIPPY  95

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +T     D +R GVNYASAAAGI D TG+    R+    Q+ N+  T+ Q+   L  +  
Sbjct  96   ATARGR-DVLR-GVNYASAAAGIRDETGRQLGGRISFSGQVNNYRNTVQQVVQILGNENA  153

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + KCI+ VG+GSNDYL NY MP    T+  +T  QYA +LIQQY+  L+ LY  GA
Sbjct  154  AADYLKKCIYSVGLGSNDYLNNYFMPLYYPTSRQFTPDQYATVLIQQYTQQLKILYSNGA  213

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKF L G+G++GC P  +A+ S +G+ C+  +N     FN  +K +V N N   PDAKF+
Sbjct  214  RKFALIGVGQIGCSPNALAQNSPDGRTCVQRINVANQLFNNKLKALVDNLNGNTPDAKFI  273

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y+D   +F+++I N   +GF V + GCCGVG+ +G+ITC+PF+ PC NR EY+FWDA+HP
Sbjct  274  YIDAYGIFQDLIENPAAFGFRVTNAGCCGVGRNNGQITCLPFQRPCRNRNEYLFWDAFHP  333

Query  888  TSAVNVLVGKMAFSG-GSDLVYPINIQQLART  980
            T A N++VG+ ++    S   YP +I +LA+ 
Sbjct  334  TEAANIVVGRRSYRAQKSSDAYPYDISRLAQA  365



>gb|KDP24218.1| hypothetical protein JCGZ_25875 [Jatropha curcas]
Length=361

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 214/332 (64%), Gaps = 7/332 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D GNNN L +LAK+NY PYGIDF  GPTGRF NG TI+D +G+ +GLP  P ++
Sbjct  29   FGDSLVDDGNNNYLNSLAKSNYFPYGIDFHGGPTGRFCNGKTIIDFLGELIGLPPIPPFA  88

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
                +   +  GVNYASAAAGILD +G+   +R  L  Q+ NF  TL QL   +  + ++
Sbjct  89   ATFSTGTDILSGVNYASAAAGILDDSGKNLGDRYTLGQQVLNFGSTLSQLKTQMDDKKLR  148

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + + K +  + IGSNDY+ NYLMP   ST+  Y  + +A LLI  Y+  +  L  LG RK
Sbjct  149  QYLAKSLVVLNIGSNDYINNYLMPSLYSTSFTYNPKDFAHLLINTYTEQILMLQSLGLRK  208

Query  540  FVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFN---TAL-PDAK  701
            F+LA +G LGCIP  +A   +  GQCL  VN +V  FN  ++  V   N   T+L  D+ 
Sbjct  209  FLLAAVGPLGCIPNQLATGLAPPGQCLSFVNNMVQLFNTQLRSAVDELNKNSTSLRTDSV  268

Query  702  FVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAY  881
            FV+ DT   F +I+ N  +YGF+V DRGCCG+G+  G ITC+P   PC NR++Y+FWDAY
Sbjct  269  FVFGDTYGAFEDILDNHTSYGFAVTDRGCCGIGRNQGLITCLPLAFPCFNRDQYIFWDAY  328

Query  882  HPTSAVNVLVGKMAFSGGSDLVYPINIQQLAR  977
            HPT A N ++ + A+SG     YPIN++QLA+
Sbjct  329  HPTQAFNRIIAQRAYSGPPSDCYPINVKQLAQ  360



>gb|ABY59947.1| nectar protein 1 [Jacaranda mimosifolia]
Length=339

 Score =   293 bits (751),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 157/332 (47%), Positives = 219/332 (66%), Gaps = 10/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNNN+ +LA+ANY PYG+DF  GPTGRFSNG T VD I + LG     P Y
Sbjct  10   FGDSLVDNGNNNNIQSLARANYLPYGVDFPDGPTGRFSNGKTTVDVIAELLGFDDYIPPY  69

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            ++   S DQ+  GVNYASAAAGI   TGQ    R+    Q+ N+  T+ Q+   L  +  
Sbjct  70   ASA--SGDQILRGVNYASAAAGIRSETGQQLGARIDFTGQVNNYKNTVAQVVDILGDEDS  127

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ VG+GSNDYL NY MP   S+   Y+ +QY+DLLIQQYS  ++ LY+ GA
Sbjct  128  AANYLSKCIYSVGVGSNDYLNNYFMPLYYSSGRQYSPEQYSDLLIQQYSEQIRTLYNYGA  187

Query  534  RKFVLAGIGELGCIPTMVARS--ENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKF L G+G++GC P  +A++  +   C+  +N     FN  ++ +V   N    DAKF+
Sbjct  188  RKFSLIGVGQIGCSPNALAQNSPDGSTCIRRINDANQMFNNKLRALVDELNNGAQDAKFI  247

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F+++I N   +GF V + GCCGVG+ +G+ITC+P +TPC NR+EY+FWDA+HP
Sbjct  248  YINAYGIFQDLIDNPSAFGFRVTNAGCCGVGRNNGQITCLPMQTPCQNRDEYLFWDAFHP  307

Query  888  TSAVNVLVGKMAFSG--GSDLVYPINIQQLAR  977
            T A NV+VG+ ++     SD  YP +IQ+LA+
Sbjct  308  TEAANVVVGRRSYRAEKASD-AYPFDIQRLAQ  338



>ref|XP_006422361.1| hypothetical protein CICLE_v10018420mg, partial [Citrus clementina]
 gb|ESR35601.1| hypothetical protein CICLE_v10018420mg, partial [Citrus clementina]
Length=289

 Score =   291 bits (746),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/253 (59%), Positives = 190/253 (75%), Gaps = 2/253 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNNNL + AKANY PYGIDF  GPTGRFS+GYT+VD I + LGLPL PAYS
Sbjct  39   FGDSLIDNGNNNNLPSFAKANYYPYGIDFNGGPTGRFSSGYTMVDEIAELLGLPLIPAYS  98

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
              + S  Q+  GVNYASAAAGILD+TG+ FV R+P   QI NF  TLDQ++ NL A  V 
Sbjct  99   --EASGAQVLHGVNYASAAAGILDITGRNFVGRIPFDQQIRNFQNTLDQVTDNLGASDVS  156

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKF  542
              I +CIFFVG+GSNDYL NYLMP  +T   Y  QQYADLL+ +YS  L  LY+LGARKF
Sbjct  157  NAIARCIFFVGMGSNDYLNNYLMPNYNTKNQYNAQQYADLLVSEYSRQLTTLYNLGARKF  216

Query  543  VLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQ  722
            VL+G+G +GCIP+++A+++  +C +EVNQ+V PFNAN+K ++ N N  LP A+F ++D  
Sbjct  217  VLSGLGRMGCIPSILAQNQMDRCSEEVNQLVMPFNANVKTVINNLNANLPGARFTFIDIA  276

Query  723  NMFRNIIANSKTY  761
             MF +++ N ++Y
Sbjct  277  RMFEDLLTNYRSY  289



>ref|XP_007159508.1| hypothetical protein PHAVU_002G243500g [Phaseolus vulgaris]
 gb|AGV54372.1| GDSL esterase/lipase [Phaseolus vulgaris]
 gb|AHA84183.1| GDSL esterase/lipase [Phaseolus vulgaris]
 gb|ESW31502.1| hypothetical protein PHAVU_002G243500g [Phaseolus vulgaris]
Length=365

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 155/331 (47%), Positives = 220/331 (66%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGIDF  GP+GRFSNG T VD I + LG     P Y
Sbjct  36   FGDSLVDNGNNNQLQSLARADYLPYGIDFPGGPSGRFSNGKTTVDGIAELLGFDDFIPPY  95

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +  + S D +  GVNYASAAAGI + TGQ    R+    Q+ N+  T+ Q+   L  +  
Sbjct  96   A--EASGDAVLKGVNYASAAAGIREETGQQLGGRISFSGQVQNYQNTVSQVVNLLGDEDS  153

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ +G+GSNDYL NY MP   +++  YT  Q+AD+LI  Y+  L+ LY+ GA
Sbjct  154  AANYLSKCIYSIGLGSNDYLNNYFMPQFYTSSREYTPDQFADVLIGAYTDQLKTLYNYGA  213

Query  534  RKFVLAGIGELGCIPTMVARS--ENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK VL G+G++GC P  +AR+  +   C+D +N     FN  +K +   FN  +PDA+ +
Sbjct  214  RKMVLFGLGQIGCSPNELARNSPDGNTCVDRINNANQMFNTRLKTLTDQFNNQMPDARVI  273

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y+++  +F+++I+N   YGFSV++ GCCGVG+ +G+ITC+P +TPCPNR EY+FWDA+HP
Sbjct  274  YINSFGIFQDVISNPAAYGFSVINAGCCGVGRNNGQITCLPMQTPCPNRREYLFWDAFHP  333

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLAR  977
            T A N++V + A+S  S    YP +IQ LA+
Sbjct  334  TEAGNLIVAQRAYSAQSASDAYPFDIQHLAQ  364



>ref|XP_010273430.1| PREDICTED: GDSL esterase/lipase At4g18970-like [Nelumbo nucifera]
Length=365

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 158/331 (48%), Positives = 216/331 (65%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D GNNN L +LA+A+Y PYGIDF  GPTGRF NG T  D I Q LG     P Y
Sbjct  36   FGDSLVDDGNNNQLSSLARADYMPYGIDFDGGPTGRFRNGKTTTDVIAQLLGFDDYIPPY  95

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV-  356
            +T     D ++ GVN+ASAAAGI D TG+ F +R+ +  Q+ N+     Q+   L  +  
Sbjct  96   ATTGGQ-DLLK-GVNFASAAAGIRDETGRHFGDRISMNRQVRNYQSVFSQIVEILGDEAS  153

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
             K+ + KCIF VG+GSNDYL NY MP   +T+  YT +QYAD LIQ+Y+  L+ LY+ GA
Sbjct  154  AKDHLSKCIFTVGMGSNDYLNNYFMPLYYTTSQEYTPEQYADALIQEYTGQLKTLYNYGA  213

Query  534  RKFVLAGIGELGCIPTMVAR-SENG-QCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK  L G+G++GC P  +A+ S NG  C+D +N     FN  +K +V +FN  L   KF 
Sbjct  214  RKVSLFGVGQIGCTPNELAKNSPNGVTCVDRINVANQMFNNKLKALVNDFNNNLVGTKFT  273

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F +++ N   YGF+V + GCCG+G+ +G+ITC+P +TPC NR +Y+FWDA+HP
Sbjct  274  YINANGIFEDMLKNPSAYGFTVTNTGCCGMGQNNGQITCLPLQTPCQNRNQYLFWDAFHP  333

Query  888  TSAVNVLVGKMAFSG-GSDLVYPINIQQLAR  977
            T A NV+VG  ++    S   YP++IQ LAR
Sbjct  334  TEAANVIVGGRSYRAQSSSDAYPVDIQHLAR  364



>gb|KHG17696.1| hypothetical protein F383_20601 [Gossypium arboreum]
Length=362

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 156/326 (48%), Positives = 212/326 (65%), Gaps = 4/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D GNNN L ++AK+NY PYGIDF   PTGRF NG T VD IG+ LG+P    ++
Sbjct  34   FGDSLVDVGNNNFLNSIAKSNYFPYGIDFNMQPTGRFCNGKTFVDIIGEMLGVPYPSPFA  93

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P+ +  ++  GVNYASAAAGILD +GQ + ER  L+ Q+ NF  TLDQL   +    + 
Sbjct  94   DPNTAGVKLLGGVNYASAAAGILDESGQHYGERYSLRQQVLNFETTLDQLRTMMGHDNLT  153

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
              + K I     GSNDY+ NYLMP   S++  Y   Q+++LL+ +Y+  L  LY+LG RK
Sbjct  154  SFLAKSIAISVFGSNDYINNYLMPSIYSSSFNYNPAQFSNLLLNRYAPQLLTLYNLGIRK  213

Query  540  FVLAGIGELGCIPTMVA--RSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
              +AGIG LGCIP   A  ++  G+C+D VN ++  FN  +K +V   N   P A   Y 
Sbjct  214  MFIAGIGPLGCIPNQRATGQAAPGRCVDYVNDILGTFNQGLKSLVDQLNKR-PGAIVTYG  272

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T     +I+ N  TYGF+VV++GCCG+G+  G+ITC+PF  PC NR++YVFWDA+HPT 
Sbjct  273  NTYGAVGDILNNPSTYGFNVVEKGCCGIGRNQGQITCLPFAYPCTNRDQYVFWDAFHPTQ  332

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQL  971
            A NV++ + AF G     YP+NIQQ+
Sbjct  333  AANVILARRAFYGPPLDTYPLNIQQM  358



>ref|XP_010415834.1| PREDICTED: GDSL esterase/lipase At1g71250-like [Camelina sativa]
Length=374

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 151/326 (46%), Positives = 205/326 (63%), Gaps = 3/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
             GDSL+DSGNNN L ++A+ANY PYGID    PTGRFSNG T VD + Q LGLP  PA++
Sbjct  45   LGDSLVDSGNNNFLQSVARANYLPYGIDLNFRPTGRFSNGLTFVDLLAQLLGLPSPPAFA  104

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P  + +++  GVN+ASAAAGILD +G  +  R  L  Q+ N   TL QL   +S Q   
Sbjct  105  DPTTTGNRILQGVNHASAAAGILDESGYHYGARFTLSQQMVNLETTLSQLRTMMSPQNFT  164

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + + + +  +  GSNDY+ NYL+P   S++  Y    +A+LL+ QY+  L  LY LG RK
Sbjct  165  DYLARSLVVLVFGSNDYINNYLLPNLYSSSFRYRPADFANLLLSQYARQLLTLYSLGLRK  224

Query  540  FVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
              + G+  LGCIP   A      G+C+D VNQ++  FN  +K +V   N   P A FVY 
Sbjct  225  IFIPGVAPLGCIPNQRATGAGPPGRCVDSVNQILGTFNEGLKSLVDQLNQRSPGAIFVYG  284

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T +   +I+ N   YGFSVVDR CCG+G+  G+ITC+P + PCPNR +YVFWDA+HPT 
Sbjct  285  NTYSAIGDILNNPAAYGFSVVDRACCGIGRNQGQITCLPMQNPCPNRSQYVFWDAFHPTQ  344

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQL  971
              N ++ + AF G     YP+N+QQ+
Sbjct  345  TANSILARRAFYGPPSDAYPVNVQQM  370



>emb|CBI16914.3| unnamed protein product [Vitis vinifera]
Length=332

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 154/329 (47%), Positives = 213/329 (65%), Gaps = 5/329 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNN + T+A+ANY PYGIDF   PTGRF NG T+VD     LGLPL P + 
Sbjct  4    FGDSLIDNGNNNFIPTMARANYFPYGIDFGL-PTGRFCNGLTVVDYGAHHLGLPLIPPFL  62

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANL--SAQV  356
            +P     ++  G+NYASAAAGILD TGQ +  R P   QI+ FA T  Q    L  +   
Sbjct  63   SPLSKGKKILRGLNYASAAAGILDETGQHYGGRTPFNGQISQFAITTSQQLPPLLGTPSE  122

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGSS-TNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            +   + K +F + IGSNDY+ NYL+P    ++ +Y+ + YADLLI   S  L +LY LGA
Sbjct  123  LTNYLAKSVFLINIGSNDYINNYLLPRRYISSHVYSGEVYADLLINNLSNQLSKLYRLGA  182

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVY  710
            RK VL GIG LGCIP+ ++  S N  C+D VN +V  FN+ + Q+ +  N +LP + FVY
Sbjct  183  RKMVLVGIGPLGCIPSQLSMVSSNNGCVDRVNNLVTLFNSRLIQLTSTLNASLPGSFFVY  242

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
             +  N+F N++ +   YGF+V +  CCG G+  G++TC+P E PC NR++Y+FWD++HPT
Sbjct  243  QNIYNIFSNMVRDPSKYGFTVPNSACCGNGRYGGDLTCLPLEQPCKNRDQYIFWDSFHPT  302

Query  891  SAVNVLVGKMAFSGGSDLVYPINIQQLAR  977
             AVN ++ +  ++      YPI+I QLA+
Sbjct  303  QAVNAMIAESCYTESGTECYPISIYQLAK  331



>ref|XP_002278194.1| PREDICTED: GDSL esterase/lipase At1g33811 [Vitis vinifera]
 emb|CBI39224.3| unnamed protein product [Vitis vinifera]
Length=368

 Score =   294 bits (753),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 216/333 (65%), Gaps = 12/333 (4%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP--LAPA  176
            FGDSL+D+GNNN +LTL++ANY PYGIDF QG TGRF+NG T VDA+ Q LG    + P 
Sbjct  37   FGDSLVDNGNNNGILTLSRANYRPYGIDFPQGVTGRFTNGRTYVDALAQLLGFSNYIPPY  96

Query  177  YSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSA--  350
              T  P+   +  GVNYAS AAGI D TG    + +P+  Q++NFA T+ Q+        
Sbjct  97   ARTRGPA---LLGGVNYASGAAGIRDETGNNLGDHIPMNQQVSNFANTVVQMRRFFRGDT  153

Query  351  QVVKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDL  527
              +   + KCIF+ G+GSNDYL NY MP   ST   YT + YA  L+Q YS  L  LY+L
Sbjct  154  NALNSYLSKCIFYSGMGSNDYLNNYFMPDFYSTGSDYTTKAYAAALLQDYSRQLTELYEL  213

Query  528  GARKFVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTA-LPDA  698
            GARK V+  +G++GCIP  +AR      QC + +N+ +  FN  ++++V  FN   LP A
Sbjct  214  GARKVVVTSVGQIGCIPYQLARFNGSGSQCNESINKAIILFNTGLRKLVDRFNNGQLPGA  273

Query  699  KFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDA  878
            KFVYLD+    ++++ N+ TYGF VVD+GCCGVGK +G+ITC+P + PC +R +Y+FWDA
Sbjct  274  KFVYLDSFQNSKDLVLNAATYGFEVVDKGCCGVGKNNGQITCLPLQEPCDDRRKYIFWDA  333

Query  879  YHPTSAVNVLVG-KMAFSGGSDLVYPINIQQLA  974
            +HPT   N+++  K   S      YPINIQQLA
Sbjct  334  FHPTDVANIIMAKKSFSSKSQSYAYPINIQQLA  366



>dbj|BAJ85694.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 162/336 (48%), Positives = 215/336 (64%), Gaps = 18/336 (5%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGL-----PL  167
            FGDSL+D+GNNN +++LA+ANYPPYG+DF  GPTGRFSNG T VD I Q LG      P 
Sbjct  36   FGDSLVDNGNNNGIVSLARANYPPYGVDFAGGPTGRFSNGLTTVDVISQLLGFDDFIPPF  95

Query  168  APAYSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLS  347
            A A S      DQ+  GVN+ASAAAGI + TGQ    R+    Q+ N+   ++QL + + 
Sbjct  96   AGATS------DQLLTGVNFASAAAGIREETGQQLGGRISFSGQVQNYQSAVEQLVSIMG  149

Query  348  AQ-VVKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLY  521
             +      + +CIF VG+GSNDYL NY MP    T   YT  QYAD L  +Y+  L+ LY
Sbjct  150  DEGAAANRLSQCIFTVGMGSNDYLNNYFMPAFYDTGSRYTPTQYADDLAARYTPLLRALY  209

Query  522  DLGARKFVLAGIGELGCIPTMVA-RSENG-QCLDEVNQVVDPFNANMKQMVTNFNTALPD  695
              GARK  L G+G++GC P  +A +S NG  C+D +N  V  FN  +  MV  FN  LP 
Sbjct  210  SYGARKVALIGVGQVGCSPNELATQSANGVACVDRINVAVRMFNQRLVGMVDQFNRLLPG  269

Query  696  AKFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWD  875
            A F Y++   +F +I+     +G  V +RGCCGVG+ +G++TC+PF+TPCPNR EY+FWD
Sbjct  270  AHFTYINIDGIFSDILRAPGGHGLRVTNRGCCGVGRNNGQVTCLPFQTPCPNRNEYLFWD  329

Query  876  AYHPTSAVNVLVGKMAFSG--GSDLVYPINIQQLAR  977
            A+HPT A NVLVG+ A++    SD V+P++I  LA 
Sbjct  330  AFHPTEAANVLVGQRAYAARLASD-VHPVDISTLAH  364



>ref|XP_009122453.1| PREDICTED: GDSL esterase/lipase At5g08460 [Brassica rapa]
 emb|CDX69951.1| BnaA10g23000D [Brassica napus]
Length=377

 Score =   294 bits (753),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 164/333 (49%), Positives = 218/333 (65%), Gaps = 10/333 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQG-PTGRFSNGYTIVDAIGQQLGLPLAPAY  179
            FGDSL+D+GNNN L +LA++NY PYGIDF  G PTGRFSNG TIVD IG+ LGLP  PA+
Sbjct  46   FGDSLVDNGNNNRLNSLARSNYLPYGIDFDGGQPTGRFSNGKTIVDFIGELLGLPDIPAF  105

Query  180  -STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV  356
              T D  ++ +R GVNYASAA GIL+ TG+   ER  ++ Q+ NF KTL ++S  + + V
Sbjct  106  METIDGGVNVLR-GVNYASAAGGILEETGRHLGERFSMRRQVENFDKTLMEISRGIGSSV  164

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              E + K +  V +G+NDY+ NYL P    T+ IY    +ADLL+  ++ NL  LYD G 
Sbjct  165  -PEYMAKSLVVVSLGNNDYINNYLKPSLFLTSSIYDPTSFADLLVSNFTSNLLELYDKGF  223

Query  534  RKFVLAGIGELGCIPTMVARSE--NGQCLDEVNQVVDPFNANMKQMVTNFNT---ALPDA  698
            RKFVLAG+G LGCIP  +A      GQC++ VN++ + FN  +K +V   N+      DA
Sbjct  224  RKFVLAGVGPLGCIPDQLAARAVPPGQCVEAVNEMAELFNNRLKSLVDRLNSDNKTGRDA  283

Query  699  KFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDA  878
             FVY +T     +I+ N   YGF V DRGCCGVG+  GEITC+P   PC  R+ +VFWDA
Sbjct  284  IFVYGNTYGAAVDILNNPINYGFEVTDRGCCGVGRNRGEITCLPLAVPCAFRDRHVFWDA  343

Query  879  YHPTSAVNVLVGKMAFSGGSDLVYPINIQQLAR  977
            +HPT A N+++   AF+G     YPIN+ Q++R
Sbjct  344  FHPTQAFNLIIALRAFNGSKSDCYPINLLQMSR  376



>emb|CDY35297.1| BnaC03g59260D [Brassica napus]
Length=364

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 163/331 (49%), Positives = 215/331 (65%), Gaps = 9/331 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGID   GPTGRFSNG T VD I + LG     PAY
Sbjct  36   FGDSLVDNGNNNGLSSLARADYLPYGIDLG-GPTGRFSNGKTTVDEIAELLGFDNYIPAY  94

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            S  D S +Q+  GVNYASAAAGI + TGQ   +R+P   Q+ N+  T+ Q+   L  +  
Sbjct  95   S--DVSGEQILQGVNYASAAAGIREETGQQLGQRIPFSGQVQNYQNTVAQVVELLGDENT  152

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + KCI+ VG+GSNDYL NY MP   ST+  YT +QYAD LI +Y   L  LY+ GA
Sbjct  153  AADYLRKCIYSVGLGSNDYLNNYFMPQYYSTSRQYTPEQYADDLINRYRDQLNALYNYGA  212

Query  534  RKFVLAGIGELGCIPTMVARS--ENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKF L G+G +GC P  +A+   +   C++ +N     FN  +K MV   N    DAKF 
Sbjct  213  RKFALVGVGAIGCSPNALAQGSPDGTTCVERLNSANRIFNNRLKSMVQQLNNEHSDAKFT  272

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F++IIAN  TYGF+V +  CCGVGK  G++TC+P + PCPNR EYVFWDA+HP
Sbjct  273  YINAYGVFQDIIANPSTYGFTVTNAACCGVGKNGGQLTCLPGQGPCPNRNEYVFWDAFHP  332

Query  888  TSAVNVLVGKMAFSG-GSDLVYPINIQQLAR  977
            T A N ++ + +++   S  VYPI+I  LAR
Sbjct  333  TDAANTIIAQRSYNARSSSDVYPIDISALAR  363



>emb|CDP15726.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 161/329 (49%), Positives = 213/329 (65%), Gaps = 4/329 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQG-PTGRFSNGYTIVDAIGQQLGLPLAPAY  179
            FGDSLID GNNN+L +LAKANY PYG+DF  G PTGRF NG TIVD +G  L LPL P Y
Sbjct  43   FGDSLIDPGNNNDLNSLAKANYAPYGVDFNGGVPTGRFCNGKTIVDYLGDLLELPLLPPY  102

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVV  359
            ++   +   +  GVNYASAAAGIL+ TGQ   ER  L  Q+ NF  TL+QL   ++ Q +
Sbjct  103  TSSSVNTGNIHGGVNYASAAAGILEETGQNLGERFTLSGQVQNFDNTLNQLKGQMNEQEL  162

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGAR  536
               +   +  + +GSNDY+ NYL P   +T+  YT + YADLLIQ+Y   +  L+ LG R
Sbjct  163  SHYLASSLVVMVLGSNDYINNYLQPSFYTTSYFYTPEDYADLLIQRYRRQILALHSLGTR  222

Query  537  KFVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVY  710
            KF L GIG LGCIP  +A   S  G+C+  VN  V  FN  ++ +V  FN     + FVY
Sbjct  223  KFFLGGIGPLGCIPNQLATGLSSPGKCVSFVNDYVGMFNVRLRSLVDQFNRDYEGSIFVY  282

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
             +T     +II N+ TYG +V DRGCCG+G+  G+ITC+PF +PC NR +Y+FWDA+HPT
Sbjct  283  GNTFAALGDIIRNASTYGITVTDRGCCGIGRNQGQITCLPFSSPCTNRNQYIFWDAFHPT  342

Query  891  SAVNVLVGKMAFSGGSDLVYPINIQQLAR  977
            + VN ++   A+ G     YP+N+QQ+A+
Sbjct  343  AIVNQILASKAYGGTPSDCYPMNVQQMAQ  371



>ref|XP_009612511.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Nicotiana tomentosiformis]
Length=367

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 225/332 (68%), Gaps = 10/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNNN+ +LA+ANY PYGID+  GPTGRFSNG T VD I + LG     P Y
Sbjct  38   FGDSLVDNGNNNNIQSLARANYLPYGIDYPGGPTGRFSNGKTTVDVIAELLGFEDYIPPY  97

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +      D +R GVNYASAAAGI + TGQ    R+    Q+ N+  T+ Q+   L  +  
Sbjct  98   AAARGE-DILR-GVNYASAAAGIREETGQQLGARISFAAQVNNYRNTVQQVVQILGDEDS  155

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ VG+GSNDYL NY MP   ST+  +  +QYAD+LIQQY+  L+ LYD GA
Sbjct  156  AANYLSKCIYSVGLGSNDYLNNYFMPLYYSTSRQFNPEQYADVLIQQYTQQLKTLYDYGA  215

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKFVL G+G++GC P  +A+ S +G+ C   +N     FN+ ++ +V +FN+  PDAKF+
Sbjct  216  RKFVLIGVGQIGCSPNSLAQNSPDGKTCAQNINVANQLFNSRLRGIVDDFNSNTPDAKFI  275

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++  ++F+++I N   +GF V + GCCGVG+ +G+ITC+P + PCPNR+EY+FWDA+HP
Sbjct  276  YINAYDIFQDLIDNPSAFGFRVTNAGCCGVGRNNGQITCLPLQNPCPNRDEYLFWDAFHP  335

Query  888  TSAVNVLVGKMAFSGG--SDLVYPINIQQLAR  977
              A NV+VG+ ++     SD  YP +IQ+LA+
Sbjct  336  GEAANVIVGRRSYRAERPSD-SYPFDIQRLAQ  366



>ref|XP_009105797.1| PREDICTED: GDSL esterase/lipase At1g71250 [Brassica rapa]
Length=366

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/324 (47%), Positives = 201/324 (62%), Gaps = 1/324 (0%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
             GDSL+D GNNN L ++A+ANY PYGID    PTGRFSNG   VD + Q LG+   P ++
Sbjct  39   LGDSLVDVGNNNFLASVARANYLPYGIDLNYRPTGRFSNGMNFVDLLAQLLGISSPPPFA  98

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P     ++  GVNYASAA GILD +GQ + +R  L  Q+ N   TL QL   +S Q   
Sbjct  99   DPTTWGTRILGGVNYASAAGGILDESGQHYGDRFSLSQQVVNLEGTLSQLRTMMSPQNFT  158

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + + K +  +  GSNDYL NYLMP   S++  Y   ++A+LLI QY+  L  LY LG RK
Sbjct  159  DYLKKSLVVLVFGSNDYLNNYLMPNLYSSSFRYRPPEFANLLINQYARQLLTLYSLGLRK  218

Query  540  FVLAGIGELGCIPTMVARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDT  719
              +AG+G LGCIP   A +  G+C+D VN+++  FN  ++ +V   N   P A FVY +T
Sbjct  219  IFIAGVGPLGCIPNQRATAPPGRCVDNVNEILGTFNQGLRALVDQLNQRSPGAIFVYGNT  278

Query  720  QNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAV  899
                 +I+ N  TYGFSV DR CCG G+  G+ITC+P + PCPNR +YVFWDA+HPT   
Sbjct  279  FRAVGDILNNPATYGFSVADRACCGTGRNQGQITCLPLQNPCPNRSQYVFWDAFHPTQTA  338

Query  900  NVLVGKMAFSGGSDLVYPINIQQL  971
            N  + + AF G     YP+N+QQ+
Sbjct  339  NSFLVRRAFYGPPSDAYPVNVQQM  362



>ref|XP_010427953.1| PREDICTED: GDSL esterase/lipase At1g71250-like [Camelina sativa]
Length=374

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/326 (46%), Positives = 205/326 (63%), Gaps = 3/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
             GDSL+DSGNNN L ++A+ANY PYGID    PTGRFSNG T +D + Q LG+P  P ++
Sbjct  45   LGDSLVDSGNNNFLQSVARANYLPYGIDLNFRPTGRFSNGLTFIDLLAQLLGIPSPPVFA  104

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P  S +++  GVN+ASAAAGILD +G  +  R  L  Q+ N   TL QL   +S Q   
Sbjct  105  DPTTSGNRILQGVNHASAAAGILDESGYHYGARFTLSQQMVNLETTLSQLRTMMSPQNFT  164

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + + + +  +  GSNDY+ NYL+P   S++I Y    +A+LL+ QY+  L  LY LG RK
Sbjct  165  DYLARSLVVLVFGSNDYINNYLLPDLYSSSIRYRPADFANLLLSQYARQLLTLYSLGLRK  224

Query  540  FVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
              + G+  LGCIP   A      G+C+D VNQ++  FN  +K +V   N   P A FVY 
Sbjct  225  IFIPGVAPLGCIPNQRATGAGPPGRCVDSVNQILGTFNEGLKSLVDQLNQRSPGAIFVYG  284

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T +   +I+ N   YGFSVVDR CCG+G+  G+ITC+P + PCPNR +YVFWDA+HPT 
Sbjct  285  NTYSAIGDILNNPAAYGFSVVDRACCGIGRNQGQITCLPMQNPCPNRSQYVFWDAFHPTQ  344

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQL  971
              N ++ + AF G     YP+N+QQ+
Sbjct  345  TANSILARRAFYGPPSDAYPVNVQQM  370



>ref|XP_011102152.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Sesamum indicum]
Length=360

 Score =   293 bits (750),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 221/333 (66%), Gaps = 18/333 (5%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D+GNNNN+ +LA+ANY PYGIDF  GPTGRFSNG T VD I + LG        
Sbjct  37   FGDSLVDNGNNNNIQSLARANYLPYGIDFPDGPTGRFSNGKTTVDVIAELLGF-------  89

Query  183  TPDPSI--DQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-  353
              D  I  +Q+  GVNYASAAAGI   TGQ    R+    Q+ N+  T++Q+   L  + 
Sbjct  90   --DDYIPGEQILRGVNYASAAAGIRSETGQQLGARIDFTGQVNNYKDTVEQVVNILGDED  147

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
                 + KCI+ +G+GSNDYL NY MP   ST+  Y+ +QYAD+LIQQYS  ++ LY+ G
Sbjct  148  SAANYLSKCIYSIGVGSNDYLNNYFMPLYYSTSRQYSPEQYADILIQQYSQQIRTLYNYG  207

Query  531  ARKFVLAGIGELGCIPTMVARS--ENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKF  704
            ARKF L G+G++GC P  +A++  +   C+  +N     FN  ++ +V  FN+   DAKF
Sbjct  208  ARKFALIGVGQIGCSPNALAQNSPDGSTCVQRINGANQIFNNKLRALVDEFNSDAQDAKF  267

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            +Y++   +F+++I N   +GF V + GCCGVG+ +G+ITC+P +TPC NR+EY+FWDA+H
Sbjct  268  IYINAYGIFQDLIENPSAFGFRVTNAGCCGVGRNNGQITCLPLQTPCQNRDEYLFWDAFH  327

Query  885  PTSAVNVLVGKMAFSG--GSDLVYPINIQQLAR  977
            PT A N++VG+ ++S    SD  YP +I++LA+
Sbjct  328  PTEAANIIVGRRSYSAQKASD-AYPFDIRRLAQ  359



>ref|XP_002278481.1| PREDICTED: GDSL esterase/lipase 7-like [Vitis vinifera]
Length=372

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 154/329 (47%), Positives = 213/329 (65%), Gaps = 5/329 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSLID+GNNN + T+A+ANY PYGIDF   PTGRF NG T+VD     LGLPL P + 
Sbjct  44   FGDSLIDNGNNNFIPTMARANYFPYGIDFGL-PTGRFCNGLTVVDYGAHHLGLPLIPPFL  102

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANL--SAQV  356
            +P     ++  G+NYASAAAGILD TGQ +  R P   QI+ FA T  Q    L  +   
Sbjct  103  SPLSKGKKILRGLNYASAAAGILDETGQHYGGRTPFNGQISQFAITTSQQLPPLLGTPSE  162

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGSS-TNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            +   + K +F + IGSNDY+ NYL+P    ++ +Y+ + YADLLI   S  L +LY LGA
Sbjct  163  LTNYLAKSVFLINIGSNDYINNYLLPRRYISSHVYSGEVYADLLINNLSNQLSKLYRLGA  222

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVY  710
            RK VL GIG LGCIP+ ++  S N  C+D VN +V  FN+ + Q+ +  N +LP + FVY
Sbjct  223  RKMVLVGIGPLGCIPSQLSMVSSNNGCVDRVNNLVTLFNSRLIQLTSTLNASLPGSFFVY  282

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
             +  N+F N++ +   YGF+V +  CCG G+  G++TC+P E PC NR++Y+FWD++HPT
Sbjct  283  QNIYNIFSNMVRDPSKYGFTVPNSACCGNGRYGGDLTCLPLEQPCKNRDQYIFWDSFHPT  342

Query  891  SAVNVLVGKMAFSGGSDLVYPINIQQLAR  977
             AVN ++ +  ++      YPI+I QLA+
Sbjct  343  QAVNAMIAESCYTESGTECYPISIYQLAK  371



>ref|XP_011010176.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Populus euphratica]
Length=365

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 155/331 (47%), Positives = 222/331 (67%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LAKANY PYGIDF +GPTGRFSNG T VD I QQLG     P Y
Sbjct  36   FGDSLVDNGNNNQLSSLAKANYMPYGIDFPRGPTGRFSNGRTTVDVIAQQLGFRNYIPPY  95

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +T       +  GVNYASAAAGI + TG+   +R+    Q+ N+  T+ Q+   L  +  
Sbjct  96   ATARGR--DILGGVNYASAAAGIREETGRQLGDRISFSGQVRNYQNTVSQIVNILGDKNT  153

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI  + +GSNDYL NY MP   S++  YT +QYA++LIQQY+  L+ LY+ GA
Sbjct  154  TANYLSKCIVSIALGSNDYLNNYFMPQFYSSSRQYTPEQYANVLIQQYTQQLRILYNNGA  213

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKF L G+G++GC P+ +A+ S +G+ C+  +N     FN  ++ +V  FN   PDA+F+
Sbjct  214  RKFALIGLGQIGCSPSELAQNSPDGRTCVQRINSANQIFNNKLRSLVAQFNGNTPDARFI  273

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F+++I     YGF+  + GCCGVG+ +G+ITC+P ++PC NR +YVFWDA+HP
Sbjct  274  YINVYGIFQDLITRPAAYGFTNTNAGCCGVGRNNGQITCLPLQSPCQNRNQYVFWDAFHP  333

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLAR  977
            T AVN+++G+ ++S  S    YP +I++LA+
Sbjct  334  TEAVNIIIGRRSYSAQSASDAYPYDIRRLAQ  364



>ref|XP_009770267.1| PREDICTED: GDSL esterase/lipase At1g33811 isoform X2 [Nicotiana 
sylvestris]
Length=359

 Score =   293 bits (749),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 215/332 (65%), Gaps = 17/332 (5%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN +LTLA+ANY PYGIDF QG TGRF+N         Q LG     P Y
Sbjct  37   FGDSLVDNGNNNGILTLARANYMPYGIDFPQGATGRFTNA--------QLLGFSNYIPPY  88

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ--  353
            S        +  G NYAS AAGI D TG    + + +  Q+ NFA+T+++L         
Sbjct  89   SRVRGR--ALLRGANYASGAAGIRDETGNNLGDHMSMNQQVENFARTVEELRRLFRGNNN  146

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
             +   + KCIF+ G+GSNDYL NY M    ST+  YT Q YA  L+Q Y   L  LY+LG
Sbjct  147  ALNGYLSKCIFYSGLGSNDYLNNYFMTDYYSTHSQYTPQAYATALLQDYCKQLSELYNLG  206

Query  531  ARKFVLAGIGELGCIPTMVARSE--NGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKF  704
            ARK V+ G+G++GCIP  +AR +  + +C +E+N  +  FN+ +K++V  FN  LP AKF
Sbjct  207  ARKVVVTGVGQIGCIPYELARYDGNDSRCNEEINNAILLFNSGLKKLVVRFNKVLPGAKF  266

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            V+LD+    ++++ N+KTYGF VVD+GCCGVG+ +G+ITC+P + PC +R +Y+FWDA+H
Sbjct  267  VFLDSFESTKDLVVNAKTYGFEVVDKGCCGVGRNNGQITCLPLQQPCEDRSKYIFWDAFH  326

Query  885  PTSAVNVLVGKMAFSGGSD-LVYPINIQQLAR  977
            PT   N+++ K +FS  S    YPINIQQLAR
Sbjct  327  PTEVANIILAKKSFSSISKTFAYPINIQQLAR  358



>ref|XP_003534425.2| PREDICTED: GDSL esterase/lipase At1g71250 [Glycine max]
Length=460

 Score =   296 bits (757),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 151/329 (46%), Positives = 214/329 (65%), Gaps = 7/329 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL++ GNNN L T+A+ANY PYGIDF +G TGRFSNG +++D IG  LG+P  P ++
Sbjct  132  FGDSLVEVGNNNFLNTIARANYFPYGIDFGRGSTGRFSNGKSLIDFIGDLLGIPSPPPFA  191

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P     ++ +GVNYASA+AGILD +G+ + +R  L  Q+ NF  TL+Q    ++   + 
Sbjct  192  DPSTVGTRILYGVNYASASAGILDESGRHYGDRYSLSQQVLNFENTLNQYRTMMNGSALN  251

Query  363  EGIPKCIFFVGIGSNDYLTNYLMP---GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            + + K I  V  GSNDY+ NYL+P   GSS N  YT Q + +LL+  Y   +  L+ +G 
Sbjct  252  QFLAKSIAVVVTGSNDYINNYLLPGLYGSSRN--YTAQDFGNLLVNSYVRQILALHSVGL  309

Query  534  RKFVLAGIGELGCIPTM--VARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKF LAGIG LGCIP++   A +  G+C+D VNQ+V  FN  ++ MV   N   P+A FV
Sbjct  310  RKFFLAGIGPLGCIPSLRAAALAPTGRCVDLVNQMVGTFNEGLRSMVDQLNRNHPNAIFV  369

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y +T  +F +I+ N   + F+VVDR CCG+G+  G++TC+P + PC +R +YVFWDA+HP
Sbjct  370  YGNTYRVFGDILNNPAAFAFNVVDRACCGIGRNRGQLTCLPLQFPCTSRNQYVFWDAFHP  429

Query  888  TSAVNVLVGKMAFSGGSDLVYPINIQQLA  974
            T +   +      +G  D  YPIN+QQ+A
Sbjct  430  TESATYVFAWRVVNGAPDDSYPINMQQMA  458



>gb|ACN29259.1| unknown [Zea mays]
 tpg|DAA57789.1| TPA: anther-specific proline-rich protein APG isoform 1 [Zea 
mays]
 tpg|DAA57790.1| TPA: anther-specific proline-rich protein APG isoform 2 [Zea 
mays]
Length=368

 Score =   293 bits (749),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 152/330 (46%), Positives = 222/330 (67%), Gaps = 9/330 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN +++LA+ANYPPYGIDF  GP+GRF+NG T VD I Q LG     P +
Sbjct  40   FGDSLVDNGNNNYIVSLARANYPPYGIDFAAGPSGRFTNGLTTVDVIAQLLGFDNFIPPF  99

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +    S DQ+  G N+ASAAAGI   TGQ    R+P   Q+ N+   +  L + L  Q  
Sbjct  100  AAT--SADQLLGGANFASAAAGIRAETGQQLGGRIPFAGQVQNYQTAVQTLVSILGDQDT  157

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + +CIF VG+GSNDYL NY MP   +T   YT +Q+AD LI  Y  +L+ LY+ GA
Sbjct  158  ASDHLSRCIFSVGMGSNDYLNNYFMPAFYNTGSRYTPEQFADSLIADYRRHLRVLYNYGA  217

Query  534  RKFVLAGIGELGCIPTMVAR-SENG-QCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK V+ G+G++GC P  +AR S +G  C+D ++  +  FN  +  +V  FN ALP A F 
Sbjct  218  RKVVMIGVGQVGCSPNELARYSADGVTCVDRIDDAIQMFNRRLVGLVDEFN-ALPGAHFT  276

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            +++  N+F +I+AN+ +YGF+V + GCCGVG+ +G++TC+P++ PC NR++++FWDA+HP
Sbjct  277  FINAYNIFDDILANAASYGFTVTNAGCCGVGRNNGQVTCLPYQAPCANRDQHIFWDAFHP  336

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLA  974
            + A N++VG+ ++   S + VYP++I  LA
Sbjct  337  SEAANIIVGRRSYRAESPNDVYPMDISTLA  366



>gb|KHG10246.1| hypothetical protein F383_10927 [Gossypium arboreum]
Length=363

 Score =   293 bits (749),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 160/328 (49%), Positives = 217/328 (66%), Gaps = 4/328 (1%)
 Frame = +3

Query  6    GDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYST  185
            GDSL+D+GNNN L +LAK+NYPPYGIDF  GPTGRF+NG +I+D +G  LGLPL PA++ 
Sbjct  35   GDSLVDNGNNNGLSSLAKSNYPPYGIDFQGGPTGRFTNGKSIIDLLGDLLGLPLLPAFTV  94

Query  186  PDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVKE  365
                   +R GVNYASAAAGILD +G    +R  L+ Q+ NF  TL+QL   +    + +
Sbjct  95   TFTGQQDIRVGVNYASAAAGILDESGLNLGDRFSLRQQVENFKTTLNQLRNQMEQDTLNQ  154

Query  366  GIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTV-QQYADLLIQQYSLNLQRLYDLGARKF  542
             + K +  + IGSNDY+ NYLMP   ++      + +A+ LI  Y   +  LY+LG RKF
Sbjct  155  YLAKSLVVINIGSNDYINNYLMPSIYSSSSTYTPEAFAEHLINDYDAQIMALYNLGLRKF  214

Query  543  VLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTA-LPDAKFVYL  713
            +LA IG LGCIP  +A+  +  G+C+  VN +V+ FN  +K +V   N     +A FVY 
Sbjct  215  LLAAIGPLGCIPNQLAKGFAPPGKCVSAVNDMVEIFNRRLKNLVDQLNHGNYTEAIFVYG  274

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T   F +I+ N  TYGF VVD+GCCGVG+  G+ITC+PF  PC NR+EYVFWDAYHPT 
Sbjct  275  NTYGAFNDILGNPATYGFKVVDKGCCGVGRNKGQITCLPFSIPCTNRDEYVFWDAYHPTQ  334

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQLAR  977
            A N ++ + A+SG     YPIN++Q+A+
Sbjct  335  AFNKIIAQKAYSGPQSACYPINVKQMAQ  362



>ref|NP_001149980.1| anther-specific proline-rich protein APG precursor [Zea mays]
 gb|ACG37397.1| anther-specific proline-rich protein APG [Zea mays]
Length=368

 Score =   293 bits (749),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 152/330 (46%), Positives = 222/330 (67%), Gaps = 9/330 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN +++LA+ANYPPYGIDF  GP+GRF+NG T VD I Q LG     P +
Sbjct  40   FGDSLVDNGNNNYIVSLARANYPPYGIDFAAGPSGRFTNGLTTVDVIAQLLGFDNFIPPF  99

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +    S DQ+  G N+ASAAAGI   TGQ    R+P   Q+ N+   +  L + L  Q  
Sbjct  100  AAT--SADQLLGGANFASAAAGIRAETGQQLGGRIPFAGQVQNYQTAVQTLVSILGDQDT  157

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + +CIF VG+GSNDYL NY MP   +T   YT +Q+AD LI  Y  +L+ LY+ GA
Sbjct  158  ASDHLSRCIFSVGMGSNDYLNNYFMPAFYNTGSRYTPEQFADSLIADYRRHLRVLYNYGA  217

Query  534  RKFVLAGIGELGCIPTMVAR-SENG-QCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK V+ G+G++GC P  +AR S +G  C+D ++  +  FN  +  +V  FN ALP A F 
Sbjct  218  RKVVMIGVGQVGCSPNELARYSADGVTCVDRIDDAIQMFNRRLVGLVDEFN-ALPGAHFT  276

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            +++  N+F +I+AN+ +YGF+V + GCCGVG+ +G++TC+P++ PC NR++++FWDA+HP
Sbjct  277  FINAYNIFDDILANAASYGFTVTNAGCCGVGRNNGQVTCLPYQAPCANRDQHIFWDAFHP  336

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLA  974
            + A N++VG+ ++   S + VYP++I  LA
Sbjct  337  SEAANIIVGRRSYRAESPNDVYPMDISTLA  366



>ref|XP_009769556.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Nicotiana sylvestris]
Length=367

 Score =   293 bits (749),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 224/332 (67%), Gaps = 10/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNNN+ +LA+ANY PYGID+  GPTGRFSNG T VD I + LG     P Y
Sbjct  38   FGDSLVDNGNNNNIQSLARANYLPYGIDYPGGPTGRFSNGKTTVDVIAELLGFEDYIPPY  97

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +      D +R GVNYASAAAGI + TGQ    R+    Q+ N+  T+ Q+   L  +  
Sbjct  98   AAARGE-DILR-GVNYASAAAGIREETGQQLGARISFAAQVNNYRNTVQQVVQILGDEDS  155

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ VG+GSNDYL NY MP   ST+  +  +QYAD+LIQQY+  L+ LYD GA
Sbjct  156  AANYLSKCIYSVGLGSNDYLNNYFMPLYYSTSRQFNPEQYADVLIQQYTQQLKTLYDYGA  215

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKFVL G+G++GC P  +A+ S +G+ C   +N     FN  ++ +V +FN+  PDAKF+
Sbjct  216  RKFVLIGVGQIGCSPNSLAQNSPDGKTCAQNINVANQIFNNRLRGIVDDFNSNTPDAKFI  275

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++  ++F+++I N   +GF V + GCCGVG+ +G+ITC+P + PCPNR+EY+FWDA+HP
Sbjct  276  YINAYDIFQDLIDNPSAFGFRVTNAGCCGVGRNNGQITCLPLQNPCPNRDEYLFWDAFHP  335

Query  888  TSAVNVLVGKMAFSGG--SDLVYPINIQQLAR  977
              A NV+VG+ ++     SD  YP +IQ+LA+
Sbjct  336  GEAANVIVGRRSYRAERPSD-SYPFDIQRLAQ  366



>gb|KGN65589.1| hypothetical protein Csa_1G467090 [Cucumis sativus]
Length=408

 Score =   294 bits (752),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 161/331 (49%), Positives = 223/331 (67%), Gaps = 9/331 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGIDF  GPTGRFSNG T VD I + LG     P Y
Sbjct  80   FGDSLVDNGNNNQLQSLARADYLPYGIDFG-GPTGRFSNGKTTVDVIAELLGFDDYIPPY  138

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +T       +  GVNYASAAAGI + TG+    R+    Q+ N+  T+ Q+   L  +  
Sbjct  139  ATARGR--DILGGVNYASAAAGIREETGRQLGGRISFSGQVENYQNTVSQVVELLGDEDS  196

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              E + KCI+ +G+GSNDYL NY MP   ST   YT QQY++ LIQQY+  L+ LY+ GA
Sbjct  197  AAEYLSKCIYSIGLGSNDYLNNYFMPQFYSTGNQYTPQQYSENLIQQYAEQLRLLYNYGA  256

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKFVL GIG++GC P  +A+ S +G+ C+  +N     FNA +K +V  FN    DAKF+
Sbjct  257  RKFVLFGIGQIGCSPNELAQNSPDGRTCVQRINSANQIFNAGLKSLVDQFNNNQADAKFI  316

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            ++D+  +F+++I N   +GF VV+ GCCGVG+ +G+ITC+PF+TPC NR+EY+FWDA+HP
Sbjct  317  FIDSYGIFQDVIDNPSAFGFRVVNAGCCGVGRNNGQITCLPFQTPCSNRDEYLFWDAFHP  376

Query  888  TSAVNVLVGKMAFSGGSDL-VYPINIQQLAR  977
            T A N ++G+ A+S       YP++I++LA+
Sbjct  377  TEAGNAVIGRRAYSAQQQTDAYPVDIRRLAQ  407



>ref|XP_006355559.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Solanum tuberosum]
Length=366

 Score =   292 bits (748),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 162/332 (49%), Positives = 220/332 (66%), Gaps = 8/332 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNNN+ +LA+ANY PYGIDF  GPTGRFSNG T VD I +QLG     P Y
Sbjct  37   FGDSLVDNGNNNNIQSLARANYLPYGIDFPGGPTGRFSNGKTTVDVIAEQLGFNGNIPPY  96

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            ++     D +R GVNYASAAAGI D TG+    R+    Q+ N+  T+ Q+   L  +  
Sbjct  97   ASARGR-DVLR-GVNYASAAAGIRDETGRQLGGRISFSGQVNNYRNTVQQVVQILGNENA  154

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + KCI+ VG+GSNDYL NY MP +  T+  +T  QYA +LIQQY+  L+ LY  GA
Sbjct  155  TADYLKKCIYSVGLGSNDYLNNYFMPLTYPTSRQFTPDQYATVLIQQYTQQLKILYSNGA  214

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKF L G+G++GC P  +A+ S +G+ C+  +N     FN  +K +V N N   PDAKF+
Sbjct  215  RKFALIGVGQIGCSPNALAQNSPDGRTCVQRINVANQLFNNKLKALVDNLNGNTPDAKFI  274

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            YLD   +F+++I N   +GF V + GCCGVG+ +G+ITC+PF+TPC NR EY+FWDA+HP
Sbjct  275  YLDAYGIFQDLIDNPAAFGFRVTNAGCCGVGRNNGQITCLPFQTPCRNRGEYLFWDAFHP  334

Query  888  TSAVNVLVGKMAFSG-GSDLVYPINIQQLART  980
            T A N++VG+  +    S   YP +I +LA+ 
Sbjct  335  TEAANIVVGRRQYRAQKSSDAYPYDISRLAQA  366



>ref|XP_002456282.1| hypothetical protein SORBIDRAFT_03g033460 [Sorghum bicolor]
 gb|EES01402.1| hypothetical protein SORBIDRAFT_03g033460 [Sorghum bicolor]
Length=364

 Score =   292 bits (747),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 220/330 (67%), Gaps = 9/330 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN +++LA+ANYPPYGIDF  GP+GRF+NG T VD I Q LG     P +
Sbjct  36   FGDSLVDNGNNNYIVSLARANYPPYGIDFAGGPSGRFTNGLTTVDVIAQLLGFDNFIPPF  95

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +    S DQ+  G N+ASAAAGI   TGQ    R+P   Q+ N+   +  L + L  Q  
Sbjct  96   AAT--SGDQLLGGANFASAAAGIRAETGQQLGGRIPFAGQVQNYQTAVQTLVSILGDQDT  153

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + +CIF +G+GSNDYL NY MP   +T   YT +QYAD LI  Y   LQ LY  GA
Sbjct  154  ASDHLSRCIFSIGMGSNDYLNNYFMPAFYNTGSRYTPEQYADSLIADYRRYLQTLYSYGA  213

Query  534  RKFVLAGIGELGCIPTMVAR-SENG-QCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK V+ G+G++GC P  +AR S +G  C+D ++  +  FN  +  +V  FN ALP A F 
Sbjct  214  RKVVMIGVGQVGCAPNELARYSADGVTCVDRIDDAIQMFNRRLVGLVDEFN-ALPGAHFT  272

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            +++  N+F +I+AN+ +YGF+V + GCCGVG+ +G++TC+P++ PC NR++++FWDA+HP
Sbjct  273  FINAYNIFDDILANAASYGFTVTNAGCCGVGRNNGQVTCLPYQAPCANRDQHIFWDAFHP  332

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLA  974
            + A N++VG+ ++   S + VYP++I  LA
Sbjct  333  SEAANIIVGRRSYRAESPNDVYPMDISTLA  362



>ref|XP_010534848.1| PREDICTED: GDSL esterase/lipase At1g71250 isoform X1 [Tarenaya 
hassleriana]
Length=367

 Score =   292 bits (747),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 155/327 (47%), Positives = 207/327 (63%), Gaps = 3/327 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
             GDSL+D GNNN L ++A+ANY PYGIDF   PTGRF NG T VD +G  LG+   PA++
Sbjct  38   LGDSLVDVGNNNYLASIARANYFPYGIDFNFRPTGRFCNGKTFVDLLGDLLGVSSPPAFA  97

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P+ S  ++  GVNYASAAAGIL+ TGQ +  R  L  Q+ N   TL+QL   LS     
Sbjct  98   DPNTSGIRILGGVNYASAAAGILEETGQHYGARYSLSQQVLNLETTLNQLRGMLSPANFT  157

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + + K I  +  GSNDY+ NYLMP   S++  YT   +A+LL+ +Y+  L  L  LG RK
Sbjct  158  DYLAKAIVVLVFGSNDYINNYLMPDLYSSSFTYTPPAFANLLLNRYARQLLALNSLGLRK  217

Query  540  FVLAGIGELGCIPTMVA--RSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
              +AGIG LGCIP   A  R+  G+CLD VNQ++  FN  ++ +V   N     A F Y 
Sbjct  218  LFIAGIGPLGCIPNQRASGRAPLGRCLDSVNQMLGTFNEGLRSLVDQLNQRSQGAIFAYG  277

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T     +I+ N   YGFSV+DR CCG+G+  G+ITC+P + PCPNR +YVFWDA+HPT 
Sbjct  278  NTYGAVGDILNNPTAYGFSVIDRACCGIGRNQGQITCMPLQYPCPNRTQYVFWDAFHPTQ  337

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQLA  974
             VN ++ + AF G     YP+N+QQ++
Sbjct  338  TVNSILARRAFYGPPSDSYPVNVQQMS  364



>ref|XP_008786406.1| PREDICTED: GDSL esterase/lipase At1g33811 [Phoenix dactylifera]
Length=369

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/337 (47%), Positives = 218/337 (65%), Gaps = 14/337 (4%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGL-PLAPAY  179
            FGDSL+D+GNNN +L+LA+ANY PYG+DF QG +GRF+NG T+VD + Q LG     P Y
Sbjct  34   FGDSLVDNGNNNGILSLARANYRPYGVDFPQGASGRFTNGRTMVDILAQFLGFRSFIPPY  93

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVV  359
            +T     D++  G+NYAS AAG+   TG    +  P   QI +F  T+  +         
Sbjct  94   ATARG--DEVLRGLNYASGAAGLRSETGSNLGQHYPFAEQINHFRNTVQYMRRTFKGNTT  151

Query  360  K--EGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
            K  + + KCI+FVG+GSNDYL NY MP    T+  Y+   +A LL+Q YS  L +LY+LG
Sbjct  152  KLRDHLSKCIYFVGMGSNDYLNNYFMPFYYPTSYEYSPSTFATLLLQAYSQQLMQLYNLG  211

Query  531  ARKFVLAGIGELGCIPTMVARSENG-------QCLDEVNQVVDPFNANMKQMVTNFNTAL  689
            ARK  + GIG++GCIP  +AR+ N        QC + +N+ +  FN  + QMV  FN   
Sbjct  212  ARKVAIIGIGQVGCIPYELARNRNSNNGRNNSQCNETINKDITIFNNGLVQMVNRFNKQK  271

Query  690  PDAKFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVF  869
              AKF+Y++T    ++I AN+ +YGF VVDRGCCGVG+ +G+ITC+P++TPC +R +Y+F
Sbjct  272  SGAKFIYVNTFQTSKDIAANAASYGFKVVDRGCCGVGRNNGQITCLPYQTPCSDRTKYLF  331

Query  870  WDAYHPTSAVNVLVGKMAFSGGSDL-VYPINIQQLAR  977
            WDA+HPT   NV+  + A+S  S    YP+NIQQLAR
Sbjct  332  WDAFHPTEVANVIYARKAYSSKSKSDAYPMNIQQLAR  368



>ref|XP_004232990.1| PREDICTED: GDSL esterase/lipase At5g45670 [Solanum lycopersicum]
Length=367

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 157/331 (47%), Positives = 220/331 (66%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNNN+ +LA+ANY PYGID+  GPTGRFSNG T VD I + LG     P Y
Sbjct  38   FGDSLVDNGNNNNIQSLARANYLPYGIDYPDGPTGRFSNGKTTVDVIAELLGFDDYIPPY  97

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            ++     + +  GVN+ASAAAGI + TGQ    R+    Q+ N+  T+ Q+   L  +  
Sbjct  98   ASARG--EDILKGVNFASAAAGIREETGQQLGARITFGGQVNNYRNTVQQVVQILGDENS  155

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ +G+GSNDYL NY MP   ST+  +   QYAD+LIQQYS  L+ LYD GA
Sbjct  156  AANYLSKCIYSIGLGSNDYLNNYFMPQYYSTSRQFNPDQYADVLIQQYSQQLKTLYDYGA  215

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKFVL G+G++GC P  +A+ S +G+ C + +N     FN  +K +V  FN   PDAKF+
Sbjct  216  RKFVLIGVGQIGCSPNALAQNSPDGRTCAENINNANKLFNNRLKGIVDEFNGNTPDAKFI  275

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++  ++F+++I N   +GF V + GCCGVG+ +G+ITC+P + PC NR+EYVFWDA+HP
Sbjct  276  YINAYDIFQDLIDNPSAFGFRVTNAGCCGVGRNNGQITCLPLQNPCQNRDEYVFWDAFHP  335

Query  888  TSAVNVLVGKMAFSGG-SDLVYPINIQQLAR  977
              A N++VG+ ++    S   YP +IQ+LA+
Sbjct  336  GEAANIVVGRRSYRAERSSDAYPFDIQRLAQ  366



>ref|XP_006655493.1| PREDICTED: GDSL esterase/lipase At4g18970-like [Oryza brachyantha]
Length=364

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 160/336 (48%), Positives = 222/336 (66%), Gaps = 19/336 (6%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGL-----PL  167
            FGDSL+D+GNNN++++LA+ANYPPYGIDF  GPTGRFSNG T VD I + LG      P 
Sbjct  36   FGDSLVDNGNNNDIVSLARANYPPYGIDFAGGPTGRFSNGLTTVDVISKLLGFDDFIPPF  95

Query  168  APAYSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLS  347
            A A S      DQ+  GVN+ASAAAGI + TGQ    R+    Q+ N+   + QL + L 
Sbjct  96   AGASS------DQLLTGVNFASAAAGIREETGQQLGARISFSGQVQNYQSAVQQLVSILG  149

Query  348  AQ-VVKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLY  521
             +      + +CIF VG+GSNDYL NY MP   +T   YT +QYAD LI +Y+  L+ +Y
Sbjct  150  DEDTAAAHLSQCIFTVGMGSNDYLNNYFMPAFYNTGSQYTPEQYADDLIGRYTQLLRAMY  209

Query  522  DLGARKFVLAGIGELGCIPTMVAR-SENG-QCLDEVNQVVDPFNANMKQMVTNFNTALPD  695
              GARK  L G+G++GC P  +A+ S NG  C++ +N  +  FN  +  +V  FNT LP 
Sbjct  210  SNGARKVALVGVGQVGCSPNELAQQSANGVTCVERINSAIRMFNQKLSGLVDQFNT-LPG  268

Query  696  AKFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWD  875
            A F Y++   +F +I+ +  ++G  V ++GCCGVG+ +G++TC+PF+TPC NR EYVFWD
Sbjct  269  AHFTYINIYGIFEDILRSPGSHGLKVTNQGCCGVGRNNGQVTCLPFQTPCANRHEYVFWD  328

Query  876  AYHPTSAVNVLVGKMAFSGG--SDLVYPINIQQLAR  977
            A+HPT A NVLVG+ A++    SD V+P++++ LAR
Sbjct  329  AFHPTEAANVLVGQRAYAARLPSD-VHPVDLRTLAR  363



>ref|XP_002871328.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH47587.1| GDSL-motif lipase/hydrolase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=384

 Score =   292 bits (748),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 159/333 (48%), Positives = 219/333 (66%), Gaps = 9/333 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFT-QGPTGRFSNGYTIVDAIGQQLGLPLAPAY  179
            FGDSL+D+GNNN+L +LA++NY PYGIDF    PTGRFSNG TIVD IG+ LGLP  PA+
Sbjct  52   FGDSLVDNGNNNHLNSLARSNYLPYGIDFAGNQPTGRFSNGKTIVDFIGELLGLPEIPAF  111

Query  180  -STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV  356
              T D  +D ++ GVNYASAA GIL+ TG+   ER  +  Q+ NF KTL ++S ++  + 
Sbjct  112  MDTVDGGVDILQ-GVNYASAAGGILEETGRHLGERFSMGRQVENFEKTLMEISRSMRKES  170

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            VKE + K +  V +G+NDY+ NYL P    ++ IY    +ADLL+  ++ +L  LY  G 
Sbjct  171  VKEYMAKSLVVVSLGNNDYINNYLKPTLFLSSSIYDPTSFADLLLSNFTTHLLVLYGKGF  230

Query  534  RKFVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNT---ALPDA  698
            RKFV+AG+G LGCIP  +A  E   G+C++ VN++ + FN  +  +V   N+      +A
Sbjct  231  RKFVIAGVGPLGCIPDQLAAREAPPGECVEAVNEMAELFNNGLVSLVDRLNSNSKTASEA  290

Query  699  KFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDA  878
             FVY +T     +I+ N  +YGF V DRGCCGVG+  GEITC+P   PC  R+ +VFWDA
Sbjct  291  IFVYGNTYGAAVDILTNPFSYGFEVTDRGCCGVGRNRGEITCLPLAVPCAFRDRHVFWDA  350

Query  879  YHPTSAVNVLVGKMAFSGGSDLVYPINIQQLAR  977
            +HPT A N+++   AF+G     YPIN+ QL+R
Sbjct  351  FHPTQAFNLIIALRAFNGSKSDCYPINLSQLSR  383



>gb|EMT18311.1| hypothetical protein F775_52607 [Aegilops tauschii]
Length=362

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 151/310 (49%), Positives = 191/310 (62%), Gaps = 39/310 (13%)
 Frame = +3

Query  54   AKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPA---YSTPDPSIDQMRFGVN  224
            AKANY PYGID   GPTGRFSNGYT+VDAI + LGLPL P+    S  D     ++ GVN
Sbjct  85   AKANYLPYGIDLAGGPTGRFSNGYTMVDAIAELLGLPLLPSNNEASNADSDAGALQ-GVN  143

Query  225  YASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVKEGIPKCIFFVGIGS  404
            YASAAAGILD TGQ FV R+P   QI NF  TL+Q+   L A  +   + + IF+VG+GS
Sbjct  144  YASAAAGILDNTGQNFVGRIPFNQQIKNFQTTLNQIKGKLGAGKLASSLGRSIFYVGMGS  203

Query  405  NDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARKFVLAGIGELGCIPTM  584
            NDYL NYLMP  +T   Y   QY+ LL+Q Y+  L  LY+LGAR+FV+AG+G + CIP M
Sbjct  204  NDYLNNYLMPNYNTRNEYNGDQYSTLLVQHYTKQLTSLYNLGARRFVIAGVGSMACIPNM  263

Query  585  VARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYLDTQNMFRNIIANSKTYG  764
             AR+    C  +V++++ PFN+ +K MV + N  LP AK +Y+D   M            
Sbjct  264  RARNPTNMCSPDVDELIAPFNSKVKGMVDSLNANLPRAKLIYIDNFEMI-----------  312

Query  765  FSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTSAVNVLVGKMAFSGGSDL  944
                                    + CPNR  Y+FWDA+HPT  VNVL+GK A+SGG+DL
Sbjct  313  ------------------------SECPNRNTYIFWDAFHPTERVNVLLGKAAYSGGTDL  348

Query  945  VYPINIQQLA  974
             YP+NIQQLA
Sbjct  349  AYPMNIQQLA  358



>ref|XP_008459640.1| PREDICTED: GDSL esterase/lipase At1g33811 [Cucumis melo]
Length=380

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 218/333 (65%), Gaps = 11/333 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGL-PLAPAY  179
            FGDSL+D+GNNN LLTLA+ANY PYG+DF QG TGRF+NG T VD + Q LG     P Y
Sbjct  48   FGDSLVDNGNNNGLLTLARANYRPYGVDFPQGTTGRFTNGRTFVDVLAQLLGFRTFIPPY  107

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSA--Q  353
            S        +  G N+AS AAGI D TG      + + NQ+ NF + ++++S       +
Sbjct  108  SRTRGR--ALLRGANFASGAAGIRDETGNNLGAHLSMNNQVENFGRAVEEMSRFFRGDTE  165

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
             +   + KCIF+ G+GSNDYL NY M    +T   +T Q YA  L+Q Y   L++LY LG
Sbjct  166  ALSCYLSKCIFYSGMGSNDYLNNYFMTDFYNTKSQFTPQAYASSLLQDYDRQLRQLYQLG  225

Query  531  ARKFVLAGIGELGCIPTMVARSE--NGQCLDEVNQVVDPFNANMKQMVTNFNTA--LPDA  698
            ARK V+ G+G++GCIP  +AR +  + +C +E+N  +  FN+ ++++V  FN+   LP A
Sbjct  226  ARKVVVTGVGQIGCIPYELARYQGNSSRCNEEINGAIALFNSGLRKLVDRFNSGRVLPGA  285

Query  699  KFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDA  878
            KFVYLDT     ++I N+  YGF+VVD+GCCGVG+ +G+ITC+P + PC +R  Y+FWDA
Sbjct  286  KFVYLDTYKSNIDLIENASNYGFTVVDKGCCGVGRNNGQITCLPLQQPCQDRRGYLFWDA  345

Query  879  YHPTSAVNVLVGKMAFSGGSD-LVYPINIQQLA  974
            +HPT   N+++ KMAF+  S    YPINIQQLA
Sbjct  346  FHPTEDANIVLAKMAFTSPSRAYAYPINIQQLA  378



>ref|XP_004497726.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cicer arietinum]
Length=367

 Score =   291 bits (746),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 156/331 (47%), Positives = 218/331 (66%), Gaps = 9/331 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP--LAPA  176
            FGDSL+D GNNN L +LAKANY PYGIDF  GPTGRFSNG T VD I + LG    ++P 
Sbjct  39   FGDSLVDDGNNNQLSSLAKANYFPYGIDFPGGPTGRFSNGKTTVDVIAELLGFEDYISPY  98

Query  177  YSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-  353
             +  D  I +   GVNYASAAAGI + TGQ   +R+    Q+ N+ KT+ Q+   L  + 
Sbjct  99   ATARDRDILK---GVNYASAAAGIREETGQQLGDRISFSGQVQNYQKTVSQMVNLLGDEN  155

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                 + K I+ +G+GSNDYL NY MP  S++  YT QQ+AD+LIQ Y+  L+ LY+ GA
Sbjct  156  TTANYLSKYIYSIGLGSNDYLNNYFMPAYSSSRQYTPQQFADVLIQAYAEQLRILYNYGA  215

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK  L G+GE+GC P  +A+ S +G+ C++ ++     FN  +K +V   N  LPDA+F+
Sbjct  216  RKMALFGVGEIGCSPNELAQNSPDGRTCVERIDSANQLFNNGLKSLVDQLNNQLPDARFI  275

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F++II N  ++G  V + GCCGVG+ +G+ITC+P +TPC NR EY+FWDA+HP
Sbjct  276  YVNVYGIFQDIINNPSSFGLRVTNEGCCGVGRNNGQITCLPLQTPCNNRNEYLFWDAFHP  335

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLAR  977
            T   N ++GK A++  S    YPI+I +L +
Sbjct  336  TEIGNTIIGKRAYNAQSASDAYPIDINRLTQ  366



>ref|XP_010549442.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Tarenaya hassleriana]
Length=363

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/330 (48%), Positives = 217/330 (66%), Gaps = 7/330 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGIDF  GPTGRFSNG T VD I + LG     P Y
Sbjct  35   FGDSLVDNGNNNQLSSLARADYLPYGIDFPGGPTGRFSNGQTTVDVIAELLGFDDYIPPY  94

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            S  +    ++  GVNYASAAAGI + +GQ   +R+    Q+ N+  T+ Q+   L  +  
Sbjct  95   SGVNGQ--EILTGVNYASAAAGIREESGQQLGQRITFSGQVQNYQNTVAQVVNLLGDENT  152

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + KCI+ +G+GSNDYL NY MP   S++  +T +QYAD LI +YS  L  LY+ GA
Sbjct  153  AADYLRKCIYSIGLGSNDYLNNYFMPTFYSSSRQFTPEQYADDLIDRYSQQLNALYNYGA  212

Query  534  RKFVLAGIGELGCIPTMVARSENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVY  710
            RKF L G+G +GC P  +A S +G  C DE+N     FN  ++ +V   N  L DAKF +
Sbjct  213  RKFALIGVGAIGCSPNKLANSPDGTTCDDEINSANQIFNNKLRSLVDRLNNELSDAKFTF  272

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
            ++   +F+++I N   YGFSV + GCCGVG+ +G+ITC+P + PCPNR+EYVFWDA+HPT
Sbjct  273  VNAYGIFQDLINNPSAYGFSVTNAGCCGVGRNNGQITCLPGQNPCPNRKEYVFWDAFHPT  332

Query  891  SAVNVLVGKMAFSGGS-DLVYPINIQQLAR  977
             A N ++G+ ++   S   VYPI+I +LA+
Sbjct  333  EAANAIIGQRSYRAQSYSDVYPIDISRLAQ  362



>ref|XP_006355561.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Solanum tuberosum]
Length=368

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/331 (47%), Positives = 220/331 (66%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNNN+ +LA+ANY PYGID+  GPTGRFSNG T VD I + LG     P Y
Sbjct  39   FGDSLVDNGNNNNIQSLARANYLPYGIDYPDGPTGRFSNGKTTVDVIAELLGFDDYIPPY  98

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            ++     + +  GVNYASAAAGI + TGQ    R+    Q+ N+  T+ Q+   L  +  
Sbjct  99   ASARG--EDILKGVNYASAAAGIREETGQQLGARITFGGQVNNYRNTVQQVVQILGDENS  156

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ +G+GSNDYL NY MP   ST+  +   QYAD+LIQQY+  L+ LYD GA
Sbjct  157  AANYLSKCIYSIGLGSNDYLNNYFMPQYYSTSRQFNPDQYADVLIQQYTQQLKSLYDYGA  216

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKFVL G+G++GC P  +A+ S +G+ C + +N     FN  +K +V  FN   PDAKF+
Sbjct  217  RKFVLIGVGQIGCSPNSLAQNSPDGRTCAENINNANKLFNNRLKGIVDEFNGNTPDAKFI  276

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++  ++F+++I N   +GF V + GCCGVG+ +G+ITC+P + PC NR+EY+FWDA+HP
Sbjct  277  YINAYDIFQDLIDNPSAFGFRVTNAGCCGVGRNNGQITCLPLQNPCQNRDEYLFWDAFHP  336

Query  888  TSAVNVLVGKMAFSGG-SDLVYPINIQQLAR  977
              A N++VG+ ++    S   YP +IQ+LA+
Sbjct  337  GEAANIVVGRRSYRAERSSDAYPFDIQRLAQ  367



>gb|KGN52691.1| hypothetical protein Csa_5G650560 [Cucumis sativus]
Length=380

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 217/333 (65%), Gaps = 11/333 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGL-PLAPAY  179
            FGDSL+D+GNNN LLTLA+ANY PYG+DF QG TGRF+NG T VD + Q LG     P Y
Sbjct  48   FGDSLVDNGNNNGLLTLARANYRPYGVDFPQGTTGRFTNGRTFVDVLAQLLGFRTFIPPY  107

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSA--Q  353
            S        +  G N+AS AAGI D TG      + + NQ+ NF + ++++S       +
Sbjct  108  SRTRGR--ALLRGANFASGAAGIRDETGNNLGAHLSMNNQVENFGRAVEEMSRFFRGDTE  165

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
             +   + KCIF+ G+GSNDYL NY M    +T   +T Q YA  L+Q Y   L++LY  G
Sbjct  166  ALSCYLSKCIFYSGMGSNDYLNNYFMTDFYNTKSQFTPQAYASSLLQDYDRQLRQLYQFG  225

Query  531  ARKFVLAGIGELGCIPTMVARSE--NGQCLDEVNQVVDPFNANMKQMVTNFNTA--LPDA  698
            ARK V+ G+G++GCIP  +AR +  + +C +E+N  +  FN+ ++++V  FN+   LP A
Sbjct  226  ARKLVVTGVGQIGCIPYELARYQGNSSRCNEEINGAITLFNSGLRKLVDRFNSGRVLPGA  285

Query  699  KFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDA  878
            KFVYLDT     ++I N+  YGF+VVD+GCCGVG+ +G+ITC+P + PC +R  Y+FWDA
Sbjct  286  KFVYLDTYKSNIDLIENASNYGFTVVDKGCCGVGRNNGQITCLPLQQPCQDRRGYLFWDA  345

Query  879  YHPTSAVNVLVGKMAFSGGSD-LVYPINIQQLA  974
            +HPT   N+++ KMAF+  S    YPINIQQLA
Sbjct  346  FHPTEDANIVLAKMAFTSPSRAYAYPINIQQLA  378



>ref|XP_002887358.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63617.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=374

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 152/326 (47%), Positives = 207/326 (63%), Gaps = 3/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
             GDSL+D+GNNN + TLA+AN+ PYGID    PTGRFSNG T +D + Q L +P  PA++
Sbjct  45   LGDSLVDAGNNNFIQTLARANFLPYGIDLNFRPTGRFSNGLTFIDLLAQLLQIPSPPAFA  104

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P  S  ++  GVNYASAAAGILD +G  +  R  L  Q+ N   TL QL   +S Q   
Sbjct  105  DPTTSGSRILQGVNYASAAAGILDESGFNYGGRFSLSQQMVNLETTLSQLRTMMSPQNFT  164

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + + + +  +  GSNDY+ NYLMP   S++I YT   +A+LL+ QY+  L  LY LG RK
Sbjct  165  DYLARSLVVLVFGSNDYINNYLMPNLYSSSIRYTPPVFANLLLSQYARQLLTLYGLGLRK  224

Query  540  FVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
              + G+  LGCIP   AR  S   +C+D VNQ++  FN  ++ +V   N  LP A +VY 
Sbjct  225  IFIPGVAPLGCIPNQRARGVSPPDRCVDSVNQILGTFNQGLRSLVDQLNQRLPGAIYVYG  284

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T +   +I+ N   YGFSVVDR CCG+G+  G+ITC+P + PCPNR +YVFWDA+HPT 
Sbjct  285  NTYSAIGDILNNPAAYGFSVVDRACCGIGRNQGQITCLPGQNPCPNRSQYVFWDAFHPTQ  344

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQL  971
              N ++ + AF G     YP+N+QQ+
Sbjct  345  TANSILARRAFYGPPSDAYPVNVQQM  370



>ref|XP_004141643.1| PREDICTED: GDSL esterase/lipase At1g33811-like [Cucumis sativus]
 ref|XP_004166339.1| PREDICTED: GDSL esterase/lipase At1g33811-like [Cucumis sativus]
Length=378

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 217/333 (65%), Gaps = 11/333 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGL-PLAPAY  179
            FGDSL+D+GNNN LLTLA+ANY PYG+DF QG TGRF+NG T VD + Q LG     P Y
Sbjct  46   FGDSLVDNGNNNGLLTLARANYRPYGVDFPQGTTGRFTNGRTFVDVLAQLLGFRTFIPPY  105

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSA--Q  353
            S        +  G N+AS AAGI D TG      + + NQ+ NF + ++++S       +
Sbjct  106  SRTRGR--ALLRGANFASGAAGIRDETGNNLGAHLSMNNQVENFGRAVEEMSRFFRGDTE  163

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
             +   + KCIF+ G+GSNDYL NY M    +T   +T Q YA  L+Q Y   L++LY  G
Sbjct  164  ALSCYLSKCIFYSGMGSNDYLNNYFMTDFYNTKSQFTPQAYASSLLQDYDRQLRQLYQFG  223

Query  531  ARKFVLAGIGELGCIPTMVARSE--NGQCLDEVNQVVDPFNANMKQMVTNFNTA--LPDA  698
            ARK V+ G+G++GCIP  +AR +  + +C +E+N  +  FN+ ++++V  FN+   LP A
Sbjct  224  ARKLVVTGVGQIGCIPYELARYQGNSSRCNEEINGAITLFNSGLRKLVDRFNSGRVLPGA  283

Query  699  KFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDA  878
            KFVYLDT     ++I N+  YGF+VVD+GCCGVG+ +G+ITC+P + PC +R  Y+FWDA
Sbjct  284  KFVYLDTYKSNIDLIENASNYGFTVVDKGCCGVGRNNGQITCLPLQQPCQDRRGYLFWDA  343

Query  879  YHPTSAVNVLVGKMAFSGGSD-LVYPINIQQLA  974
            +HPT   N+++ KMAF+  S    YPINIQQLA
Sbjct  344  FHPTEDANIVLAKMAFTSPSRAYAYPINIQQLA  376



>ref|XP_002305046.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE85557.1| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=367

 Score =   291 bits (745),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 156/333 (47%), Positives = 225/333 (68%), Gaps = 9/333 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQ-GPTGRFSNGYTIVDAIGQQLGLP-LAPA  176
            FGDSL+D+GNNN L +LA+A+Y PYGIDF    PTGRF NG T VD I +QLG     P 
Sbjct  37   FGDSLVDNGNNNQLSSLARADYLPYGIDFRPPRPTGRFCNGRTTVDVIAEQLGFRNYIPP  96

Query  177  YSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-  353
            Y+T       +  GVNYASAAAGI D TGQ   +R+    Q+ N+  T+ Q+   L  + 
Sbjct  97   YATARGRA--ILGGVNYASAAAGIRDETGQQLGDRISFSGQVRNYQNTVSQIVNILGDED  154

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
                 + +CIF +G+GSNDYL NY MP   S++  YT +QYA++LIQQY+  L+ LY+ G
Sbjct  155  TAANYLSRCIFSIGLGSNDYLNNYFMPQIYSSSRQYTPEQYANVLIQQYTDQLKILYNYG  214

Query  531  ARKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKF  704
            ARKFVL G+G++GC P+ +A+ S +G+ C+ ++N     FN  ++ +V  FN   PDA+F
Sbjct  215  ARKFVLIGVGQIGCSPSQLAQNSPDGRTCVQKINSANQIFNNKLRSLVAQFNGNTPDARF  274

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            +Y++   +F++II    T+GF+V + GCCGVG+ +G+ITC+P + PC NR++YVFWDA+H
Sbjct  275  IYINAYGIFQDIINRPATFGFTVTNAGCCGVGRNNGQITCLPLQNPCRNRDQYVFWDAFH  334

Query  885  PTSAVNVLVGKMAFSGGS-DLVYPINIQQLART  980
            PT A NV++G+ ++S  S    YP +I++LA++
Sbjct  335  PTEAANVIIGRRSYSAQSASDAYPFDIRRLAQS  367



>ref|XP_010677280.1| PREDICTED: GDSL esterase/lipase At1g71250 [Beta vulgaris subsp. 
vulgaris]
Length=391

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 146/327 (45%), Positives = 211/327 (65%), Gaps = 7/327 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDS+IDSGNNN L ++AK+NY PYG DF QGPTGRF NG T++D +G++L +P  P ++
Sbjct  67   FGDSIIDSGNNNFLGSVAKSNYWPYGCDFNQGPTGRFCNGKTVIDLLGEKLAMPYLPPFA  126

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P     ++  G+NYASA  GILD TG+ + +R  L  Q+ NF +TLDQL + ++ + + 
Sbjct  127  DPTAIGARIMGGINYASAGGGILDETGRHWGDRFSLSQQVLNFERTLDQLRSTMTGRNMT  186

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
              + K I F+  GSNDY+ NYLM     ++  Y   ++A+LL+ +Y+  +  LY++G RK
Sbjct  187  RYLEKAIAFMSFGSNDYINNYLMSSLYDSSFTYKPPEFANLLLNRYARQILALYNVGLRK  246

Query  540  FVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            F +AGI  +GCIP   A  +   G+C+D VNQ++  FN  ++ +V   N   P   FVY 
Sbjct  247  FFIAGIAPIGCIPNQRATGQAPPGRCVDSVNQMLGTFNEGLRSLVAQLNANHPAGIFVYY  306

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T  +  +++ N   YGFSV+DR CCG+    G+ITC+P   PCP+R++Y+FWDAYH T 
Sbjct  307  NTYCVLGDLLNNPAAYGFSVIDRACCGL----GQITCMPSAVPCPDRKQYLFWDAYHTTE  362

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQLA  974
            A N ++ + AF G     YPIN QQLA
Sbjct  363  AANSILAQRAFVGPPTDCYPINFQQLA  389



>gb|KEH29338.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=363

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 150/330 (45%), Positives = 212/330 (64%), Gaps = 7/330 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL++ GNNN L T AK+N+ PYGID+   PTGRFSNG +++D IG  LG+P  P + 
Sbjct  35   FGDSLVEVGNNNFLSTFAKSNFYPYGIDYNGRPTGRFSNGKSLIDFIGDMLGVPSPPPFL  94

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P  + +++  GVNYAS + GILD +G+ + +R  +  Q+ NF +TL+Q    ++   + 
Sbjct  95   DPTSTENKLLNGVNYASGSGGILDDSGRHYGDRHSMSRQLQNFERTLNQYKKMMNETALS  154

Query  363  EGIPKCIFFVGIGSNDYLTNYLMP---GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            + + K I  V  GSNDY+ NYL P   G+S N  Y+V Q+ +LL+  +   +  LY LG 
Sbjct  155  QFLAKSIVIVVTGSNDYINNYLRPEYYGTSRN--YSVPQFGNLLLNTFGRQILALYSLGL  212

Query  534  RKFVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKF LAG+G LGCIP   A   +  G+C+D VNQ+V  +N  ++ MV  FN    DAKFV
Sbjct  213  RKFFLAGVGPLGCIPNQRANGFAPPGRCVDSVNQMVGTYNGGLRSMVEQFNRDHSDAKFV  272

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y +T  +F +I+ N   Y FSV+DR CCG+G+  G+I+C+P + PC NR +YVFWDA+HP
Sbjct  273  YGNTYGVFGDILNNPAAYAFSVIDRACCGLGRNRGQISCLPMQFPCANRAQYVFWDAFHP  332

Query  888  TSAVNVLVGKMAFSGGSDLVYPINIQQLAR  977
            T +   +    A +G  +  YPINIQQLA+
Sbjct  333  TQSATYVFAWRAVNGPQNDAYPINIQQLAQ  362



>ref|XP_002521611.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF40882.1| zinc finger protein, putative [Ricinus communis]
Length=368

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 210/326 (64%), Gaps = 3/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D+GNNN L ++AKANY PYGIDF  G TGRFSNG T VD +G+ +  P   A++
Sbjct  39   FGDSLVDNGNNNWLRSIAKANYYPYGIDFNIGSTGRFSNGKTFVDILGEMVSAPYPSAFT  98

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P  +  ++  GVNYASAAAGILD TGQ + ER  L  Q+ NF  +L++L   ++   + 
Sbjct  99   DPATAGARILGGVNYASAAAGILDETGQHYGERYSLSQQVLNFESSLNELRRMMNGTNLT  158

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPGSSTNIIYTVQ-QYADLLIQQYSLNLQRLYDLGARK  539
            E + K +  +  GSNDY+ NYLMP   ++       Q+A+LL+  Y+  L  +Y +G RK
Sbjct  159  EFLGKSLAVLVFGSNDYINNYLMPSIYSSSYIYSPPQFANLLLNHYARQLYAMYSIGLRK  218

Query  540  FVLAGIGELGCIPTM--VARSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
            F++AG+G LGCIP      +S   +C+D VNQ++  FN  +K +V   N +   A F Y 
Sbjct  219  FLIAGVGPLGCIPNQRGTGQSPPDRCVDYVNQMLGSFNEGLKSLVDQLNRSCKGAIFAYG  278

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T     +I+ N  TYGF+VVD+GCCG+G+  GE+TC+PF  PC NR  YVFWDA+HPT 
Sbjct  279  NTYAAVGDILNNPSTYGFTVVDKGCCGIGRNQGEVTCLPFVVPCANRNVYVFWDAFHPTQ  338

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQL  971
            AVN ++   AFSG     YPIN+QQ+
Sbjct  339  AVNSILAHRAFSGPPTDCYPINVQQM  364



>emb|CDX90201.1| BnaA08g17830D [Brassica napus]
Length=364

 Score =   291 bits (744),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 161/331 (49%), Positives = 213/331 (64%), Gaps = 9/331 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGID   GPTGRFSNG T VD I + LG     PAY
Sbjct  36   FGDSLVDNGNNNGLSSLARADYYPYGIDLG-GPTGRFSNGKTTVDEIAELLGFDNYIPAY  94

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            S  D S +Q+  GVNYASAAAGI + TGQ   +R+P   Q+ N+  T+ Q+   L  +  
Sbjct  95   S--DVSGEQILQGVNYASAAAGIREETGQQLGQRIPFSGQVQNYQNTVAQVVELLGDENT  152

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + KCI+ VG+GSNDYL NY MP   ST+  YT +QYAD LI +Y   L  LY+ GA
Sbjct  153  AADYLRKCIYSVGLGSNDYLNNYFMPQYYSTSRQYTPEQYADDLINRYRDQLNALYNYGA  212

Query  534  RKFVLAGIGELGCIPTMVARS--ENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKF L G+G +GC P  +A+   +   C++ +N     FN  +K MV   N    DAKF 
Sbjct  213  RKFALVGVGAIGCSPNALAQGSPDGTTCVERLNSANRIFNNRLKSMVQQLNNEHSDAKFT  272

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F++IIAN   YGF+V +  CCGVG+  G++TC+P + PCPNR EYVFWDA+HP
Sbjct  273  YINAYGVFQDIIANPSAYGFTVTNAACCGVGRNGGQLTCLPGQGPCPNRNEYVFWDAFHP  332

Query  888  TSAVNVLVGKMAFSG-GSDLVYPINIQQLAR  977
            T A N ++ + ++    S  VYPI+I  LAR
Sbjct  333  TDAANTIIAQRSYKAQSSSDVYPIDISALAR  363



>ref|XP_002316749.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE97361.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=365

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 154/331 (47%), Positives = 221/331 (67%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LAKANY PYGIDF +GPTGRFSNG T VD I +QLG     P Y
Sbjct  36   FGDSLVDNGNNNQLSSLAKANYMPYGIDFPRGPTGRFSNGRTTVDVIAEQLGFRNYIPPY  95

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +T       +  GVNYASAAAGI + TG+   +R+    Q+ N+  T+ Q+   L  +  
Sbjct  96   ATARGR--DILGGVNYASAAAGIREETGRQLGDRISFSGQVRNYQNTVSQIVNILGDKNT  153

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI  + +GSNDYL NY MP   S++  YT +QYA++LIQQY+  L+ LY+ GA
Sbjct  154  TANYLSKCILSIALGSNDYLNNYFMPQLYSSSQQYTPEQYANVLIQQYTQQLRILYNNGA  213

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKF L G+G++GC P+ +A+ S +G+ C+  +N     FN  ++ +V  FN   PDA+F+
Sbjct  214  RKFALIGLGQIGCSPSELAQNSPDGRTCVQRINSANQIFNDKLRSLVAQFNGNTPDARFI  273

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F+++I     +GF+  + GCCGVG+ +G+ITC+P + PC NR +YVFWDA+HP
Sbjct  274  YINAYGIFQDLITRPAAFGFTNTNTGCCGVGRNNGQITCLPLQAPCRNRNQYVFWDAFHP  333

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLAR  977
            T AVN+++G+ ++S  S    YP +I+QLA+
Sbjct  334  TEAVNLIIGRRSYSAQSASDAYPYDIRQLAQ  364



>ref|XP_008792294.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Phoenix dactylifera]
Length=367

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/331 (47%), Positives = 219/331 (66%), Gaps = 9/331 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN++ +LA+A+Y PYGIDF  GPTGRF NG T VD I Q LG     P Y
Sbjct  39   FGDSLVDNGNNNDIASLARADYMPYGIDFAGGPTGRFGNGLTTVDVIAQLLGFEDFIPPY  98

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +        +  GVN+ASAAAGI + TGQ   +R+    Q+ N+   + ++ + L  +  
Sbjct  99   AAARGR--ALLTGVNFASAAAGIREETGQQLGDRISFSGQLQNYQAAVQEVVSILGDEDS  156

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCIF VG+GSNDYL NY MP   S++  YT +QYAD+LI+QYS  ++ LY+ GA
Sbjct  157  AANYLSKCIFSVGMGSNDYLNNYFMPAFYSSSSQYTPEQYADVLIEQYSQQIRTLYNYGA  216

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK VL G+G++GC P  +A+ S NGQ C+  +N  +  FN  +  +V  FNT L  A F 
Sbjct  217  RKVVLMGVGQIGCSPNELAQNSPNGQTCVHRINSGIQIFNRKLIALVDQFNT-LNQANFT  275

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F +I  N   +G +V +RGCCGVGK +G+ITC+P++TPCPNR EY+FWDA+HP
Sbjct  276  YINAYGIFEDIWRNPSKHGLTVTNRGCCGVGKNNGQITCLPYQTPCPNRNEYLFWDAFHP  335

Query  888  TSAVNVLVGKMAFSG-GSDLVYPINIQQLAR  977
            + A N+++GK ++S   S   YP++I+ LA+
Sbjct  336  SEAANIIIGKRSYSAESSSDAYPMDIRHLAQ  366



>ref|XP_009109657.1| PREDICTED: GDSL esterase/lipase At1g29660 [Brassica rapa]
Length=364

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 161/331 (49%), Positives = 213/331 (64%), Gaps = 9/331 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGID   GPTGRFSNG T VD I + LG     PAY
Sbjct  36   FGDSLVDNGNNNGLSSLARADYYPYGIDLG-GPTGRFSNGKTTVDEIAELLGFDNYIPAY  94

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            S  D S +Q+  GVNYASAAAGI + TGQ   +R+P   Q+ N+  T+ Q+   L  +  
Sbjct  95   S--DVSGEQILQGVNYASAAAGIREETGQQLGQRIPFSGQVQNYQNTVAQVVELLGDENT  152

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + KCI+ VG+GSNDYL NY MP   ST+  YT +QYAD LI +Y   L  LY+ GA
Sbjct  153  AADYLRKCIYSVGLGSNDYLNNYFMPQYYSTSRQYTPEQYADDLINRYRDQLNALYNYGA  212

Query  534  RKFVLAGIGELGCIPTMVARS--ENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKF L G+G +GC P  +A+   +   C++ +N     FN  +K MV   N    DAKF 
Sbjct  213  RKFALVGVGAIGCSPNALAQGSPDGTTCVERLNSANRIFNNRLKSMVQQLNNEHSDAKFS  272

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F++IIAN   YGF+V +  CCGVG+  G++TC+P + PCPNR EYVFWDA+HP
Sbjct  273  YINAYGVFQDIIANPSAYGFTVTNAACCGVGRNGGQLTCLPGQGPCPNRNEYVFWDAFHP  332

Query  888  TSAVNVLVGKMAFSG-GSDLVYPINIQQLAR  977
            T A N ++ + ++    S  VYPI+I  LAR
Sbjct  333  TDAANTIIAQRSYKAQSSSDVYPIDISSLAR  363



>dbj|BAB56037.1| putative proline-rich protein [Oryza sativa Japonica Group]
 gb|EAY75815.1| hypothetical protein OsI_03729 [Oryza sativa Indica Group]
 gb|EAZ13534.1| hypothetical protein OsJ_03450 [Oryza sativa Japonica Group]
Length=363

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/332 (47%), Positives = 219/332 (66%), Gaps = 10/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNNN+ ++A+ANYPPYG+DF  G TGRFSNG T  DAI + LG     P Y
Sbjct  34   FGDSLVDNGNNNNIASMARANYPPYGVDFPGGATGRFSNGLTTADAISRLLGFDDYIPPY  93

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +    + +Q+  GVN+ASAAAGI D TGQ   ER+    Q+ N+   + QL + L  +  
Sbjct  94   A--GATSEQLLTGVNFASAAAGIRDDTGQQLGERISFSAQLQNYQAAVRQLVSILGGEDA  151

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + +CIF VG+GSNDYL NY MP    T+  YT +QYAD+LI QY+  L+ LY+ GA
Sbjct  152  AANRLSQCIFTVGMGSNDYLNNYFMPAFYPTSRQYTPEQYADVLINQYAQQLRTLYNYGA  211

Query  534  RKFVLAGIGELGCIPTMVAR-SENG-QCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK  + G+G++GC P  +A+ S NG  C++ +N  V  FN  +  +V  FN  LP A F 
Sbjct  212  RKVAVFGVGQVGCSPNELAQNSRNGVTCIERINSAVRMFNRRVVVLVNQFNRLLPGALFT  271

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++   +F +I+     +G +V +RGCCGVG+ +G++TC+P++ PC NR+EY+FWDA+HP
Sbjct  272  YINCYGIFESIMRTPVEHGLAVTNRGCCGVGRNNGQVTCLPYQAPCANRDEYLFWDAFHP  331

Query  888  TSAVNVLVGKMAFSGG--SDLVYPINIQQLAR  977
            T A N+ VG+ A+S    SD VYP+++  LA+
Sbjct  332  TEAANIFVGRRAYSAAMRSD-VYPVDLSTLAQ  362



>ref|XP_011035467.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Populus euphratica]
Length=367

 Score =   290 bits (743),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 155/333 (47%), Positives = 225/333 (68%), Gaps = 9/333 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQ-GPTGRFSNGYTIVDAIGQQLGLP-LAPA  176
            FGDSL+D+GNNN L +LA+A+Y PYGIDF    PTGRFSNG T VD I +QLG     P 
Sbjct  37   FGDSLVDNGNNNQLSSLARADYLPYGIDFRPPRPTGRFSNGKTTVDVIAEQLGFRNYIPP  96

Query  177  YSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-  353
            Y+T       +  GVNYASAAAGI D TG+   +R+    Q+ N+  T+ Q+   L  + 
Sbjct  97   YATARGRA--ILGGVNYASAAAGIRDETGRQLGDRISFSGQVRNYQNTVSQIVNILGDED  154

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
                 + +CIF + +GSNDYL NY MP   S++  YT +QYA++LIQQY+  L+ LY+ G
Sbjct  155  TAANYLSRCIFSIALGSNDYLNNYFMPQIYSSSRQYTPEQYANVLIQQYTDQLKILYNYG  214

Query  531  ARKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKF  704
            ARKFVL G+G++GC P+ +A+ S +G+ C+ ++N     FN  ++ +V  FN   PDA+F
Sbjct  215  ARKFVLVGVGQIGCSPSQLAQNSPDGRTCVQKINSANQIFNNKLRSLVAQFNGNTPDARF  274

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            +Y++   +F++II+   T+GF+V + GCCGVG+ +G+ITC+P + PC NR +YVFWDA+H
Sbjct  275  IYINAYGIFQDIISRPATFGFTVTNAGCCGVGRNNGQITCLPLQNPCRNRNQYVFWDAFH  334

Query  885  PTSAVNVLVGKMAFSGGS-DLVYPINIQQLART  980
            PT A NV++G+ ++S  S    YP +I++LA++
Sbjct  335  PTEAANVIIGRRSYSAQSASDAYPFDIRRLAQS  367



>ref|XP_008439698.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cucumis melo]
Length=375

 Score =   290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 162/331 (49%), Positives = 218/331 (66%), Gaps = 9/331 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGIDF +GPTGRFSNG T VD I + LG     P Y
Sbjct  47   FGDSLVDNGNNNRLSSLARADYLPYGIDFPRGPTGRFSNGKTTVDVIAELLGFNGYIPPY  106

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            S      D +R GVNYASAAAGI + TGQ    R+    Q+ N    + Q+   L  Q  
Sbjct  107  SNTR-GRDILR-GVNYASAAAGIREETGQQLGGRISFSGQVRNHQNIVRQIVNILGDQNA  164

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + KCI+ VG+GSNDYL NY MP   S++  Y+  QYA +LIQQY+  L  LYD GA
Sbjct  165  AADYLNKCIYSVGLGSNDYLNNYFMPLIYSSSRQYSPDQYAQILIQQYTQQLSILYDNGA  224

Query  534  RKFVLAGIGELGCIPTMVARSENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVY  710
            RKF L G+G++GC P  +A S +G+ C    N     FN  +K +V   N   PDA+F+Y
Sbjct  225  RKFALFGVGQIGCSPNALASSPDGRSCNQRYNFANQMFNNRLKSLVDQLNRDQPDARFIY  284

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
            +D+  +F++II +  ++GF V + GCCG+G+ +G+ITC+PF+TPC NR EY+FWDA+HPT
Sbjct  285  IDSYGIFQDIINSPSSFGFRVTNAGCCGIGRNNGQITCLPFQTPCSNRREYLFWDAFHPT  344

Query  891  SAVNVLVGKMAFSGG--SDLVYPINIQQLAR  977
             A N +VG+ A+S    SD  YPI+I++LA+
Sbjct  345  EAGNTIVGRRAYSAQRPSD-AYPIDIRRLAQ  374



>gb|KFK31816.1| hypothetical protein AALP_AA6G162300 [Arabis alpina]
Length=376

 Score =   290 bits (743),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 153/326 (47%), Positives = 203/326 (62%), Gaps = 3/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
             GDSL+D GNNN + ++A+ANY PYGID    PTGRFSNG   VD + Q LG+   P ++
Sbjct  47   LGDSLVDVGNNNFIASIARANYLPYGIDLNFRPTGRFSNGMNFVDLLAQLLGISSPPPFA  106

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P  S  ++  GVNYASAAAGILD TGQ + +R  L  Q+ N   TL +L   +S Q   
Sbjct  107  DPSTSGIRILGGVNYASAAAGILDETGQNYGDRYSLSRQVVNLEATLSKLRTMMSPQNFT  166

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
                K +  +  GSNDY+ NYLMP   S++  Y   ++A+LL+ QY+  L  LY LG RK
Sbjct  167  NYKAKSLVVLVFGSNDYINNYLMPNIYSSSARYKPPEFANLLLSQYARQLLTLYSLGLRK  226

Query  540  FVLAGIGELGCIPTMVA--RSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
              + G+G LGCIP+  A  R+  G+CLD VNQ++  FN  +K +V   N   P A FVY 
Sbjct  227  VFIPGVGPLGCIPSQRASGRAPPGRCLDSVNQILGTFNKGLKSLVDQINQRSPGAIFVYG  286

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T      I+ N  +YGFSVVDR CCG+G+  GEITC+P + PC NR +YVFWDA+HPT 
Sbjct  287  NTYRAVGEILNNPASYGFSVVDRACCGIGRNQGEITCMPLQFPCLNRSQYVFWDAFHPTQ  346

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQL  971
              N ++ + AF G     YP+N+QQ+
Sbjct  347  TANSILVRRAFYGPLSDAYPVNVQQM  372



>ref|XP_010062377.1| PREDICTED: GDSL esterase/lipase At1g33811 [Eucalyptus grandis]
 gb|KCW69516.1| hypothetical protein EUGRSUZ_F02958 [Eucalyptus grandis]
Length=388

 Score =   290 bits (743),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 154/334 (46%), Positives = 215/334 (64%), Gaps = 12/334 (4%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP--LAPA  176
            FGDSL+D+GNNN +LTLA+ANY PYGIDF  G TGRF+NG T VDA+ Q LG P  + P 
Sbjct  57   FGDSLVDNGNNNQILTLARANYRPYGIDFPLGATGRFTNGRTYVDALAQLLGFPTYVPPY  116

Query  177  YSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSA--  350
              T  P++ +   G NYAS AAGI D TG    +   +  Q+ NF  T+ Q+        
Sbjct  117  ARTRGPALLR---GANYASGAAGIRDETGNNLGDHTSMDQQVANFGYTVAQMRRYFRGDT  173

Query  351  QVVKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDL  527
              +   + KCIF+ G+GSNDYL NY MP   ST+  +T + YA +L+  YS  L +LY L
Sbjct  174  NALNSYLSKCIFYSGLGSNDYLNNYFMPNFYSTSSEFTAKAYAAVLLNDYSRQLTQLYGL  233

Query  528  GARKFVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTA-LPDA  698
            GARK ++  +G++GCIP  +AR    N +C + +N  +  FN+ +++MV  FN   LP A
Sbjct  234  GARKVIVTAVGQIGCIPYQLARYNGNNSRCNENINNAIVLFNSGLRKMVDAFNNGQLPGA  293

Query  699  KFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDA  878
            KFVYLD+    + +  ++  YGF V+D+GCCGVG+ +G+ITC+P +  C NR +Y+FWDA
Sbjct  294  KFVYLDSFESTKYLSQSAANYGFEVIDKGCCGVGRNNGQITCLPLQQACTNRTKYLFWDA  353

Query  879  YHPTSAVNVLVGKMAFSGGS-DLVYPINIQQLAR  977
            +HPT A N+++ K ++S  +    YPINIQQLA+
Sbjct  354  FHPTEAANIMLAKASYSSRTQSFTYPINIQQLAQ  387



>ref|NP_196463.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FNP2.1|GDL75_ARATH RecName: Full=GDSL esterase/lipase At5g08460; AltName: Full=Extracellular 
lipase At5g08460; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB09995.1| GDSL-motif lipase/acylhydrolase-like protein [Arabidopsis thaliana]
 gb|AED91306.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=385

 Score =   290 bits (743),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 216/333 (65%), Gaps = 9/333 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFT-QGPTGRFSNGYTIVDAIGQQLGLPLAPAY  179
            FGDSL+D+GNNN+L +LA++NY PYGIDF    PTGRFSNG TIVD IG+ LGLP  PA+
Sbjct  53   FGDSLVDNGNNNHLNSLARSNYLPYGIDFAGNQPTGRFSNGKTIVDFIGELLGLPEIPAF  112

Query  180  -STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV  356
              T D  +D +  GVNYASAA GIL+ TG+   ER  +  Q+ NF KTL ++S ++  + 
Sbjct  113  MDTVDGGVDILH-GVNYASAAGGILEETGRHLGERFSMGRQVENFEKTLMEISRSMRKES  171

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            VKE + K +  V +G+NDY+ NYL P    ++ IY    +ADLL+  ++ +L  LY  G 
Sbjct  172  VKEYMAKSLVVVSLGNNDYINNYLKPRLFLSSSIYDPTSFADLLLSNFTTHLLELYGKGF  231

Query  534  RKFVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNT---ALPDA  698
            RKFV+AG+G LGCIP  +A      G+C++ VN++ + FN  +  +V   N+      +A
Sbjct  232  RKFVIAGVGPLGCIPDQLAAQAALPGECVEAVNEMAELFNNRLVSLVDRLNSDNKTASEA  291

Query  699  KFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDA  878
             FVY +T     +I+ N   YGF V DRGCCGVG+  GEITC+P   PC  R+ +VFWDA
Sbjct  292  IFVYGNTYGAAVDILTNPFNYGFEVTDRGCCGVGRNRGEITCLPLAVPCAFRDRHVFWDA  351

Query  879  YHPTSAVNVLVGKMAFSGGSDLVYPINIQQLAR  977
            +HPT A N+++   AF+G     YPIN+ QL+R
Sbjct  352  FHPTQAFNLIIALRAFNGSKSDCYPINLSQLSR  384



>ref|XP_004134596.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cucumis sativus]
 ref|XP_004169530.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cucumis sativus]
 gb|KGN49344.1| hypothetical protein Csa_6G520420 [Cucumis sativus]
Length=374

 Score =   290 bits (742),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 160/330 (48%), Positives = 217/330 (66%), Gaps = 7/330 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN L +LA+A+Y PYGIDF +GPTGRFSNG T VD I + LG     P Y
Sbjct  46   FGDSLVDNGNNNRLSSLARADYLPYGIDFPRGPTGRFSNGKTTVDVIAELLGFNGYIPPY  105

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            S      D +R GVNYASAAAGI + TGQ    R+    Q+ N    + Q+   L  +  
Sbjct  106  SNTRGR-DILR-GVNYASAAAGIREETGQQLGGRISFSGQVRNHQNIVTQIVNILGDENT  163

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + KCI+ +G+GSNDYL NY MP   S++  Y   QYA +LIQQY+  L  LYD GA
Sbjct  164  AADYLNKCIYSIGLGSNDYLNNYFMPQIYSSSRQYAPDQYAQILIQQYTQQLSILYDNGA  223

Query  534  RKFVLAGIGELGCIPTMVARSENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVY  710
            RKFVL G+G++GC P  +A S +G+ C    N     FN  +K +V   N   PDA+F+Y
Sbjct  224  RKFVLFGVGQIGCSPNALASSPDGRSCNQRYNFANQLFNNRLKGLVDQLNRNQPDARFIY  283

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
            +D+  +F++II +  ++GF V + GCCG+G+ +G+ITC+PF+TPC NR EY+FWDA+HPT
Sbjct  284  IDSYGIFQDIINSPSSFGFRVTNAGCCGIGRNNGQITCLPFQTPCANRREYLFWDAFHPT  343

Query  891  SAVNVLVGKMAFSG-GSDLVYPINIQQLAR  977
             A N +VG+ A+S   S   YPI+I++LA+
Sbjct  344  EAGNSIVGRRAYSAQRSSDAYPIDIRRLAQ  373



>ref|XP_010669494.1| PREDICTED: GDSL esterase/lipase At1g33811-like [Beta vulgaris 
subsp. vulgaris]
Length=369

 Score =   290 bits (741),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 164/337 (49%), Positives = 220/337 (65%), Gaps = 18/337 (5%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP--LAPA  176
            FGDSL+DSGNNN++LT  K+N+ PYGIDF QGPTGRF NG T VD + + LG P  + P 
Sbjct  36   FGDSLVDSGNNNDMLTFVKSNFIPYGIDFPQGPTGRFCNGRTFVDVLAEFLGFPDYIPPF  95

Query  177  YSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-  353
                D  I +   GVN+AS AAGI D TG      VP+  QI+NFA  ++Q+   L    
Sbjct  96   SRASDYDITK---GVNFASGAAGIRDETGNYLGANVPMNTQISNFAMIVEQIREYLKGDE  152

Query  354  -VVKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDL  527
              VK  + KC+++ GIG+NDYL NY M     T+ IYT Q+YA  L+Q Y L L  LYDL
Sbjct  153  IAVKNYLSKCMYYSGIGNNDYLNNYFMAWRYPTSSIYTPQEYAVDLLQAYKLQLTALYDL  212

Query  528  GARKFVLAGIGELGCIPTMVARSENGQ----CLDEVNQVVDPFNANMKQMVTNFNTA-LP  692
            GARK ++  IG++GCIP  + R +NG     C ++ N VV  FN+ ++ +V  FN A LP
Sbjct  213  GARKVIVPNIGQMGCIP--IRRVKNGTQESLCNEDDNYVVKLFNSGLRDLVDTFNNARLP  270

Query  693  DAKFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMD--GEITCVPFETPCPNREEYV  866
             AKFVY+D     +++ +N   +GF VVD+GCCGVG+    GEITC+P +TPC +R +Y+
Sbjct  271  GAKFVYVDFFQGCKDLHSNRTYFGFEVVDKGCCGVGENTNGGEITCLPLQTPCKDRTKYL  330

Query  867  FWDAYHPTSAVNVLVGKMAFSGGSD-LVYPINIQQLA  974
            FWDA+HP+  V+V++ K A+S  +D   YPINI+QLA
Sbjct  331  FWDAFHPSELVHVILAKKAYSSKTDSYAYPINIKQLA  367



>ref|XP_006300432.1| hypothetical protein CARUB_v10022173mg [Capsella rubella]
 gb|EOA33330.1| hypothetical protein CARUB_v10022173mg [Capsella rubella]
Length=367

 Score =   290 bits (741),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 149/326 (46%), Positives = 207/326 (63%), Gaps = 3/326 (1%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
             GDSL+DSGNNN L T+A+ANY PYGID    PTGRFSNG T +D + Q LG+P  PA++
Sbjct  38   LGDSLVDSGNNNFLQTVARANYLPYGIDLNFRPTGRFSNGLTFIDLLAQLLGIPPPPAFA  97

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
             P  +  ++  GVN+ASAAAGILD +G  +  R  L  Q+ N   TL Q+   +S Q   
Sbjct  98   DPTTAGYRILQGVNHASAAAGILDESGYNYGARYSLSQQMVNLETTLSQIRTMMSPQNFT  157

Query  363  EGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGARK  539
            + + + +  +  GSNDY+ NYLMP   S+++ +    +A+LL+ QY+  L  LY LG RK
Sbjct  158  DYLARSLVVLVFGSNDYINNYLMPNFYSSSLRFRPPDFANLLLSQYARQLLTLYRLGLRK  217

Query  540  FVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVYL  713
              + G+  LGCIP   A   +  G+C+D VNQ++  FN  +K +V   N   P A +VY 
Sbjct  218  IFIPGVAPLGCIPNQRATGAAPPGRCVDSVNQILGTFNQGLKSLVDQLNQRSPGAIYVYG  277

Query  714  DTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPTS  893
            +T +   +I+ N   YGFSVVDR CCG+G+  G+ITC+P +TPCPNR +YVFWDA+HPT 
Sbjct  278  NTYSAIGDILNNPAAYGFSVVDRACCGIGRNQGQITCLPMQTPCPNRNQYVFWDAFHPTQ  337

Query  894  AVNVLVGKMAFSGGSDLVYPINIQQL  971
              N ++ + AF G     YP+N+QQ+
Sbjct  338  TANSILARRAFYGPPSDAYPVNVQQM  363



>ref|XP_007147964.1| hypothetical protein PHAVU_006G169100g [Phaseolus vulgaris]
 gb|ESW19958.1| hypothetical protein PHAVU_006G169100g [Phaseolus vulgaris]
Length=365

 Score =   290 bits (741),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 222/332 (67%), Gaps = 10/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP--LAPA  176
            FGDSL+D+GNNN L +LAKANY PYGIDF+ GPTGRFSNG T VD + + LG    ++P 
Sbjct  36   FGDSLVDNGNNNRLNSLAKANYLPYGIDFSGGPTGRFSNGKTTVDVVAELLGFNGYISP-  94

Query  177  YSTPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-  353
            Y+T     D +R GVNYASAAAGI D TGQ    R+    Q+ N+ +T+ Q+   L  + 
Sbjct  95   YATARGR-DILR-GVNYASAAAGIRDETGQQLGGRISFSGQVQNYQRTVSQIVNLLGDEN  152

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLG  530
                 + KCI+ +G+GSNDYL NY MP   S++  YT QQYADLLIQ Y+  L+ LY+ G
Sbjct  153  TAANYLSKCIYSIGLGSNDYLNNYFMPLVYSSSRRYTPQQYADLLIQAYTQQLRILYNNG  212

Query  531  ARKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKF  704
            ARK  L G+G++GC P  +A+ S +G+ C+  +N     FN  ++ +V  FN   PDA+ 
Sbjct  213  ARKMALFGVGQIGCSPNALAQNSPDGRTCVARINSANQLFNNGLRSLVDQFNNQFPDARV  272

Query  705  VYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYH  884
            +Y++   +F++II N  ++GF V + GCCGVG+ +G+ITC+P + PC NR EY+FWDA+H
Sbjct  273  IYVNVYGIFQDIINNPASFGFRVTNAGCCGVGRNNGQITCLPLQPPCRNRREYLFWDAFH  332

Query  885  PTSAVNVLVGKMAFSGGS-DLVYPINIQQLAR  977
            PT + N ++G+ A++  S    YPI+I +LA+
Sbjct  333  PTESANTVIGRRAYNAQSASDAYPIDINRLAQ  364



>ref|XP_009767072.1| PREDICTED: GDSL esterase/lipase At5g08460 [Nicotiana sylvestris]
Length=359

 Score =   289 bits (740),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 157/329 (48%), Positives = 213/329 (65%), Gaps = 8/329 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnl-ltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAY  179
            FGDSLID GNNN L  +LAKAN+ PYG+DF  GPTGRF NG T++D +G  +GLPL PAY
Sbjct  34   FGDSLIDPGNNNYLPHSLAKANFVPYGVDFI-GPTGRFCNGRTMIDYLGDLVGLPLIPAY  92

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVV  359
            +        +  GVNYASAAAGILD TG+   ER  L  QI NF  TLDQL   +  Q +
Sbjct  93   TATITMGSDISKGVNYASAAAGILDETGKSLGERFSLNQQIQNFEDTLDQLKQQMEEQDL  152

Query  360  KEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGAR  536
               + K +  + +G+NDY+ NYL P   +T+  Y  + YADLLI+ YS  +  L+ +G R
Sbjct  153  SYYLAKSLVVMNLGNNDYINNYLQPSLYTTSSNYKPRDYADLLIKHYSRQILALHAIGLR  212

Query  537  KFVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVY  710
            KF+L  IG LGCIP+ V    +  G+C+  VN+++  FN+ ++ +V   N   P++ F+Y
Sbjct  213  KFLLGAIGPLGCIPSQVGTGLAPPGKCVSIVNEMIGMFNSQLRFLVDQLNKDNPNSIFIY  272

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
             +T   F  I  N+  YGF V DRGCCGVG+    ITC+P   PC NR++Y+FWDA+HPT
Sbjct  273  GNTFGGFIEIFNNASVYGFEVKDRGCCGVGR---RITCLPLSVPCFNRDQYLFWDAFHPT  329

Query  891  SAVNVLVGKMAFSGGSDLVYPINIQQLAR  977
             AVN ++ + A+SG  D  YP+N+QQ+A+
Sbjct  330  QAVNQILARKAYSGSLDDCYPMNVQQMAQ  358



>emb|CDO96913.1| unnamed protein product [Coffea canephora]
Length=367

 Score =   290 bits (741),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 222/330 (67%), Gaps = 6/330 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL+D+GNNNN+ +LAKANY PYGIDF  GPTGRF NG T VD I + LG        
Sbjct  38   FGDSLVDNGNNNNINSLAKANYLPYGIDFPGGPTGRFCNGKTTVDVITELLGFNGYIQPF  97

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQVVK  362
            T     D ++ GVNYASAAAGI + TGQ    R     Q+ N+  T+ Q+ + L  Q   
Sbjct  98   TRAQGQDILK-GVNYASAAAGIREETGQQLGARTSFTGQVNNYNSTVSQIVSLLGDQNRA  156

Query  363  EG-IPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGAR  536
               + KCI+ VG+GSNDYL NY MP   S++  +T +Q+A+ LI QYS  ++RLY+LGAR
Sbjct  157  AAYLSKCIYSVGLGSNDYLNNYFMPLFYSSSRQFTPEQFANALIGQYSQQIRRLYNLGAR  216

Query  537  KFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFVY  710
            K VL G+G++GC P  +A+ S +G+ C+  +N     FN+ +K +V   N    DA+F+Y
Sbjct  217  KLVLIGVGQIGCSPNELAQNSPDGRTCVARINSANQMFNSKLKSLVDTLNNQFTDARFIY  276

Query  711  LDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHPT  890
            +D   +F+++I++   +GF+V +RGCCGVG+ +G+ITC+PF+TPCPNR +++FWDA+HPT
Sbjct  277  IDAYGIFQDLISSPSAFGFTVTNRGCCGVGRNNGQITCLPFQTPCPNRNQHLFWDAFHPT  336

Query  891  SAVNVLVGKMAFSG-GSDLVYPINIQQLAR  977
             A N++VG+ ++    S   YPI+I +LA+
Sbjct  337  EAANIIVGRRSYRAQKSSDAYPIDISRLAQ  366



>ref|XP_009612510.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Nicotiana tomentosiformis]
Length=369

 Score =   290 bits (741),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 161/332 (48%), Positives = 222/332 (67%), Gaps = 10/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNNN+ +LA+ANY PYGIDF  GPTGRFSNG T VD I +QLG     P Y
Sbjct  40   FGDSLVDNGNNNNIQSLARANYLPYGIDFPGGPTGRFSNGKTTVDVIAEQLGFNGYIPPY  99

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +T     D +R GVNYASAAAGI D TG+    R+    Q+ N+  T+ Q+   L  +  
Sbjct  100  ATARGR-DILR-GVNYASAAAGIRDETGRQLGGRISFSGQVNNYINTVQQVVQILGDENA  157

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMP-GSSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + KCI+ VG+GSNDYL NY MP    T+  +T +QYA +LIQQY+  L+ LY+ GA
Sbjct  158  AADYLSKCIYSVGLGSNDYLNNYFMPLYYPTSRQFTPEQYASVLIQQYTQQLKILYNNGA  217

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKF L G+G++GC P  +A+ S +G+ C+  +N     FN  +K +V N N   PDAKF+
Sbjct  218  RKFALIGVGQIGCSPNALAQNSPDGRTCVQRINVANQLFNNKLKALVDNLNRNTPDAKFI  277

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y+D   +F+++I N   +G SV + GCCGVG+ +G+ITC+PF+ PC NR +Y+FWDA+HP
Sbjct  278  YIDAYGIFQDLIDNPFAFGLSVTNAGCCGVGRNNGQITCLPFQRPCRNRNQYLFWDAFHP  337

Query  888  TSAVNVLVGKMAFSGG--SDLVYPINIQQLAR  977
            T A N++VG+ ++     SD  YP +I +LA+
Sbjct  338  TEAANIVVGRRSYRAQKPSD-AYPFDISRLAQ  368



>gb|ABD96893.1| hypothetical protein [Cleome spinosa]
Length=363

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 151/330 (46%), Positives = 214/330 (65%), Gaps = 6/330 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLPLAPAYS  182
            FGDSL D GNNN + TLA+ANY PYGIDF   PTGRF NG T+VD +   LGLPL P Y 
Sbjct  34   FGDSLADCGNNNYIPTLARANYLPYGIDFGF-PTGRFCNGRTVVDYVAMHLGLPLVPPYL  92

Query  183  TPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANL--SAQV  356
            +P     ++  GVNYASAAAGILD TGQ +  R  L  QI+ F  T++     L      
Sbjct  93   SPFFIGAKVLRGVNYASAAAGILDETGQHYGARTTLNEQISQFEITVELKLQPLFQDPAE  152

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGSS-TNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            +++ + K I  +  GSNDY+ NYL+P    ++ IYT + +A+LL +  S  L RLY+LGA
Sbjct  153  LRQHLAKSIILINTGSNDYINNYLLPDRYLSSQIYTGEDFAELLTKTLSAQLSRLYNLGA  212

Query  534  RKFVLAGIGELGCIPTMVA--RSENGQCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RKFVLAG+G LGCIP+ ++     N  C+ +VN +V  FN+ + ++    N++LPD+ F+
Sbjct  213  RKFVLAGVGPLGCIPSQLSTVNGNNSGCVAKVNNLVSAFNSRVIKLADTLNSSLPDSFFI  272

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y D  ++F +I+ N  +YGF + D+ CCG G+  G +TC+P + PC +R +YVFWD++HP
Sbjct  273  YQDIYDLFHDIVVNPSSYGFLIPDKACCGNGRYGGVLTCLPLQEPCADRHQYVFWDSFHP  332

Query  888  TSAVNVLVGKMAFSGGSDLVYPINIQQLAR  977
            T AVN ++   +FS  +   YPI++ +LA+
Sbjct  333  TEAVNKIIADRSFSNSAGFSYPISLYELAK  362



>ref|XP_010491482.1| PREDICTED: GDSL esterase/lipase At5g08460 [Camelina sativa]
Length=371

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 157/333 (47%), Positives = 215/333 (65%), Gaps = 9/333 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFT-QGPTGRFSNGYTIVDAIGQQLGLPLAPAY  179
            FGDSL+D+GNNN+L +LA++NY PYGIDF    PTGRF NG TIVD +G+ LGLP  PA+
Sbjct  39   FGDSLVDNGNNNHLNSLARSNYLPYGIDFAGNQPTGRFCNGKTIVDFVGELLGLPDIPAF  98

Query  180  -STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQV  356
              T D  +D +  GVNYASAA GIL+ TG+   ER  +  Q+ NF KTL +++    ++ 
Sbjct  99   MDTVDGEVD-ISGGVNYASAAGGILEETGRQLGERFSMARQVENFEKTLVEITRMSRSES  157

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPGS-STNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
            VKE + K +  V +G+NDY+ NYL P    TN IY    +ADLL+  ++ +L +LY  G 
Sbjct  158  VKEYMAKSLVVVSLGNNDYINNYLKPSLFLTNSIYDPTSFADLLVSNFTTHLLKLYGKGF  217

Query  534  RKFVLAGIGELGCIPTMVARSEN--GQCLDEVNQVVDPFNANMKQMVTNFNT---ALPDA  698
            RKFVLAG+G LGCIP  +A      G+C++ VN++ + FN  +  +V   N+      + 
Sbjct  218  RKFVLAGVGPLGCIPDQLAARAAPPGECVEAVNEMAELFNNRLISLVDRLNSDNKTASEG  277

Query  699  KFVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDA  878
             FVY +T     +I+ N   YGF V DRGCCGVG+  GEITC+P   PC  R+ +VFWDA
Sbjct  278  IFVYGNTYGAAVDILTNPFAYGFEVTDRGCCGVGRNRGEITCLPLAVPCAFRDRHVFWDA  337

Query  879  YHPTSAVNVLVGKMAFSGGSDLVYPINIQQLAR  977
            +HPT A N+++ + AF+G     YPIN+ QL+R
Sbjct  338  FHPTEAFNLIIARRAFNGSKSDCYPINLSQLSR  370



>ref|XP_004485963.1| PREDICTED: GDSL esterase/lipase At1g29670-like [Cicer arietinum]
Length=367

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 155/331 (47%), Positives = 223/331 (67%), Gaps = 8/331 (2%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGL-PLAPAY  179
            FGDSL+D+GNNN L +LAKANY PYGIDF  GP+GRFSNG T VD I + LG     P+Y
Sbjct  38   FGDSLVDNGNNNQLTSLAKANYFPYGIDFPGGPSGRFSNGKTAVDVIAENLGFNSYIPSY  97

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            ++     D ++ GVNYASAAAGI + TGQ   +R+  + Q+ N+ +T+ Q+   L  +  
Sbjct  98   ASARGQ-DILK-GVNYASAAAGIREETGQQLGQRISFRGQVQNYQRTVSQVVNILGDENT  155

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
                + KCI+ +G+GSNDYL NY MP   S++  YT QQYAD LIQ Y+  L+ LY+ GA
Sbjct  156  AANYLSKCIYTIGLGSNDYLNNYFMPTIYSSSRQYTPQQYADALIQAYAQQLRILYNYGA  215

Query  534  RKFVLAGIGELGCIPTMVAR-SENGQ-CLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK  L GIG +GC P+ +A+ S +G+ C+  +N     FN  +K +V  FN   PDA+F+
Sbjct  216  RKMALFGIGAIGCSPSELAQNSPDGRTCVSRINSANQLFNNGLKSLVDQFNNQFPDARFI  275

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            Y++  ++F++II N  +YGF V + GCCG+GK +G+ITC+P + PC +R+ ++FWDA+HP
Sbjct  276  YINVYDIFQDIINNPSSYGFRVTNAGCCGIGKNNGQITCLPLQAPCRDRKGFLFWDAFHP  335

Query  888  TSAVNVLVGKMAFSGGSDL-VYPINIQQLAR  977
            T A N ++G+ A++  S L  +P +I +LA+
Sbjct  336  TEAGNSVIGRRAYNAQSALDAHPYDINRLAQ  366



>ref|XP_007226475.1| hypothetical protein PRUPE_ppa027202mg, partial [Prunus persica]
 gb|EMJ27674.1| hypothetical protein PRUPE_ppa027202mg, partial [Prunus persica]
Length=351

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/332 (47%), Positives = 214/332 (64%), Gaps = 10/332 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGL-PLAPAY  179
            FGDSL+D+GNNN ++TLA+ANY PYGIDF QG TGRF+NG T VD + Q LG     P Y
Sbjct  20   FGDSLVDNGNNNGIVTLARANYRPYGIDFPQGVTGRFTNGRTYVDVLAQLLGFQTYIPPY  79

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLS--AQ  353
            S    +   +  GVNYAS AAGI D TG        +  Q++NF  T+ ++       A 
Sbjct  80   SRTRGAA--LLRGVNYASGAAGIRDETGDNLGAHTSMNQQVSNFGNTVAEMRRFFRGDAN  137

Query  354  VVKEGIPKCIFFVGIGSNDYLTNYLMPGSSTNII-YTVQQYADLLIQQYSLNLQRLYDLG  530
             +   + +CIF+ G+GSNDYL NY MP   T+   YT + YA  L+Q YS  L +LY LG
Sbjct  138  ALSNYLGRCIFYSGMGSNDYLNNYFMPNFYTSSSDYTTKAYAAALLQDYSRQLSQLYALG  197

Query  531  ARKFVLAGIGELGCIPTMVAR--SENGQCLDEVNQVVDPFNANMKQMVTNFNTA-LPDAK  701
            ARK ++ G+G++GCIP  +AR  S + +C + +N  +  FN+ +K+MV NFN   LP AK
Sbjct  198  ARKVIVTGVGQIGCIPYQLARYHSNSSRCNENINNAILIFNSGLKKMVDNFNRGQLPGAK  257

Query  702  FVYLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAY  881
            FVYLD+     ++  N+   GF V+D+GCCGVG+ +G+ITC+P +  C +R +Y+FWDA+
Sbjct  258  FVYLDSYQSTFDLFQNASAAGFEVIDKGCCGVGRNNGQITCLPLQQACRDRTKYMFWDAF  317

Query  882  HPTSAVNVLVGKMAFSGGS-DLVYPINIQQLA  974
            HPT A N+L+GK ++S  +     PINIQQLA
Sbjct  318  HPTEAANILLGKASYSSNTQSYTCPINIQQLA  349



>ref|XP_004969823.1| PREDICTED: GDSL esterase/lipase At5g45670-like [Setaria italica]
Length=361

 Score =   289 bits (739),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 152/330 (46%), Positives = 221/330 (67%), Gaps = 9/330 (3%)
 Frame = +3

Query  3    FGDSLIDSGnnnnlltlAKANYPPYGIDFTQGPTGRFSNGYTIVDAIGQQLGLP-LAPAY  179
            FGDSL+D+GNNN +++LA+ANYPPYGIDF  GP+GRF+NG T VD I Q LG     P +
Sbjct  33   FGDSLVDNGNNNYIVSLARANYPPYGIDFAGGPSGRFTNGLTTVDVIAQLLGFDNFIPPF  92

Query  180  STPDPSIDQMRFGVNYASAAAGILDMTGQIFVERVPLKNQITNFAKTLDQLSANLSAQ-V  356
            +    S DQ+  G N+ASAAAGI   TGQ    R+P   Q+ N+   +  L + L  Q  
Sbjct  93   AAT--SGDQLLGGANFASAAAGIRAETGQQLGGRIPFAGQVQNYQTAVQTLVSILGDQDT  150

Query  357  VKEGIPKCIFFVGIGSNDYLTNYLMPG-SSTNIIYTVQQYADLLIQQYSLNLQRLYDLGA  533
              + + +CIF VG+GSNDYL NY MP   +T   Y+ +Q+AD LI  Y   LQ LY+ GA
Sbjct  151  ASDHLSRCIFSVGMGSNDYLNNYFMPAFYNTGSRYSPEQFADALIADYRRYLQVLYNYGA  210

Query  534  RKFVLAGIGELGCIPTMVAR-SENG-QCLDEVNQVVDPFNANMKQMVTNFNTALPDAKFV  707
            RK VL G+G++GC P  +AR S +G  C+D ++  +  FN  +  +V  FN ALP A F 
Sbjct  211  RKVVLIGVGQVGCSPNELARYSADGVTCVDRIDGAIQIFNRRLVGLVDEFN-ALPGAHFT  269

Query  708  YLDTQNMFRNIIANSKTYGFSVVDRGCCGVGKMDGEITCVPFETPCPNREEYVFWDAYHP  887
            +++  N+F +++AN+ +YGF+V + GCCGVG+ +G++TC+P++ PC NR++++FWDA+HP
Sbjct  270  FINAYNIFDDLLANAASYGFTVTNAGCCGVGRNNGQVTCLPYQAPCANRDQHIFWDAFHP  329

Query  888  TSAVNVLVGKMAFSGGS-DLVYPINIQQLA  974
            + A N++VG+ ++   S + VYP++I  LA
Sbjct  330  SEAANIIVGRRSYRAESPNDVYPMDISTLA  359



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2899735426956