BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16766_g1_i1 len=991 path=[969:0-103 1073:104-157 1127:158-990]

Length=991
                                                                      Score     E

ref|XP_009773625.1|  PREDICTED: uncharacterized protein LOC104223821    151   2e-40   
ref|XP_009590285.1|  PREDICTED: uncharacterized protein LOC104087498    149   1e-39   
ref|XP_009757696.1|  PREDICTED: uncharacterized protein LOC104210486    142   1e-36   
ref|XP_011086267.1|  PREDICTED: uncharacterized protein LOC105168050    137   3e-35   
ref|XP_004250260.2|  PREDICTED: uncharacterized protein LOC101254753    135   1e-34   
ref|XP_006352362.1|  PREDICTED: uncharacterized protein LOC102598521    135   2e-34   
ref|XP_009631224.1|  PREDICTED: uncharacterized protein LOC104121033    135   3e-34   
emb|CDP04533.1|  unnamed protein product                                134   4e-34   
emb|CBI18639.3|  unnamed protein product                                133   5e-34   
ref|XP_002275440.1|  PREDICTED: uncharacterized protein LOC100263809    133   1e-33   Vitis vinifera
gb|KDP35508.1|  hypothetical protein JCGZ_08946                         130   1e-32   
ref|XP_002307854.1|  hypothetical protein POPTR_0006s00740g             129   7e-32   Populus trichocarpa [western balsam poplar]
ref|XP_007026368.1|  Pollen Ole e 1 allergen and extensin family ...    127   3e-31   
ref|XP_011095911.1|  PREDICTED: uncharacterized protein LOC105175232    125   9e-31   
ref|XP_010252764.1|  PREDICTED: uncharacterized protein LOC104594245    125   1e-30   
ref|XP_006449928.1|  hypothetical protein CICLE_v10016770mg             125   1e-30   
gb|EYU33834.1|  hypothetical protein MIMGU_mgv1a025015mg                125   2e-30   
ref|XP_002322501.2|  hypothetical protein POPTR_0016s00790g             125   2e-30   Populus trichocarpa [western balsam poplar]
ref|XP_006467274.1|  PREDICTED: uncharacterized protein LOC102611527    124   4e-30   
gb|KHG07811.1|  Elongation factor Ts                                    124   8e-30   
ref|XP_011002371.1|  PREDICTED: uncharacterized protein LOC105109369    123   1e-29   
ref|XP_010686624.1|  PREDICTED: uncharacterized protein LOC104900801    122   3e-29   
ref|XP_010039483.1|  PREDICTED: uncharacterized protein LOC104428178    117   9e-28   
ref|XP_010039440.1|  PREDICTED: uncharacterized protein LOC104428144    114   1e-26   
ref|XP_011040166.1|  PREDICTED: uncharacterized protein LOC105136486    113   4e-26   
ref|XP_006352324.1|  PREDICTED: uncharacterized protein LOC102586293    112   4e-26   
gb|AFK48643.1|  unknown                                                 111   9e-26   
ref|XP_009374857.1|  PREDICTED: uncharacterized protein LOC103963728    111   3e-25   
ref|XP_008224628.1|  PREDICTED: uncharacterized protein LOC103324359    112   4e-25   
ref|XP_004250296.1|  PREDICTED: uncharacterized protein LOC101265501    108   1e-24   
ref|XP_010087660.1|  hypothetical protein L484_010612                   108   2e-24   
ref|NP_001235461.1|  uncharacterized protein LOC100527138 precursor     107   2e-24   
ref|XP_008384181.1|  PREDICTED: uncharacterized protein LOC103446815    108   3e-24   
ref|XP_004139527.1|  PREDICTED: uncharacterized protein LOC101215830    107   6e-24   
ref|XP_004166075.1|  PREDICTED: uncharacterized protein LOC101231184    107   6e-24   
ref|XP_009372506.1|  PREDICTED: uncharacterized protein LOC103961353    107   1e-23   
ref|XP_009396441.1|  PREDICTED: uncharacterized protein LOC103981437    105   2e-23   
gb|KCW75105.1|  hypothetical protein EUGRSUZ_E03855                     105   2e-23   
ref|XP_010057789.1|  PREDICTED: uncharacterized protein LOC104445586    105   2e-23   
ref|XP_008463598.1|  PREDICTED: uncharacterized protein LOC103501709    105   4e-23   
ref|XP_010530071.1|  PREDICTED: uncharacterized protein LOC104806736    103   5e-23   
ref|XP_007154046.1|  hypothetical protein PHAVU_003G086700g             103   9e-23   
ref|XP_008345789.1|  PREDICTED: uncharacterized protein LOC103408743    104   1e-22   
ref|XP_002522879.1|  conserved hypothetical protein                     102   1e-22   Ricinus communis
ref|XP_006856296.1|  hypothetical protein AMTR_s00047p00112050          100   1e-21   
ref|XP_008790321.1|  PREDICTED: uncharacterized protein LOC103707566  99.4    3e-21   
gb|EYU27658.1|  hypothetical protein MIMGU_mgv1a025896mg              97.8    4e-21   
ref|XP_008785642.1|  PREDICTED: uncharacterized protein LOC103704219  98.6    5e-21   
ref|XP_004507594.1|  PREDICTED: uncharacterized protein LOC101497330  98.2    8e-21   
ref|XP_010481298.1|  PREDICTED: uncharacterized protein LOC104760...  97.4    9e-21   
ref|XP_010440040.1|  PREDICTED: uncharacterized protein LOC104723382  95.1    3e-20   
ref|XP_004293399.1|  PREDICTED: uncharacterized protein LOC101300...  97.1    3e-20   
ref|XP_010936417.1|  PREDICTED: uncharacterized protein LOC105056054  95.9    4e-20   
gb|KEH32686.1|  pollen Ole e I family allergen                        95.5    9e-20   
ref|XP_010441432.1|  PREDICTED: uncharacterized protein LOC104724601  94.4    1e-19   
ref|XP_010481300.1|  PREDICTED: uncharacterized protein LOC104760...  94.0    1e-19   
ref|XP_006295116.1|  hypothetical protein CARUB_v10024190mg           93.6    2e-19   
ref|XP_006411260.1|  hypothetical protein EUTSA_v10017342mg           93.2    3e-19   
emb|CDY17718.1|  BnaA06g35370D                                        92.4    5e-19   
ref|XP_002863328.1|  hypothetical protein ARALYDRAFT_330672           92.4    5e-19   
ref|XP_010517410.1|  PREDICTED: uncharacterized protein LOC104792861  92.0    7e-19   
ref|XP_010505718.1|  PREDICTED: uncharacterized protein LOC104782478  92.0    8e-19   
ref|XP_010508913.1|  PREDICTED: uncharacterized protein LOC104785405  91.7    1e-18   
ref|XP_010939224.1|  PREDICTED: uncharacterized protein LOC105058...  91.3    2e-18   
ref|XP_010495000.1|  PREDICTED: uncharacterized protein LOC104772052  90.5    2e-18   
ref|XP_006281226.1|  hypothetical protein CARUB_v10027269mg           90.1    3e-18   
gb|KFK31357.1|  hypothetical protein AALP_AA6G101900                  90.1    3e-18   
ref|XP_009143252.1|  PREDICTED: uncharacterized protein LOC103866982  90.1    4e-18   
emb|CDX74807.1|  BnaA05g05530D                                        90.1    4e-18   
ref|XP_009101400.1|  PREDICTED: uncharacterized protein LOC103827630  89.7    4e-18   
emb|CDY20519.1|  BnaC04g05250D                                        89.0    9e-18   
ref|NP_568686.1|  pollen Ole e 1 allergen and extensin family pro...  88.6    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010518741.1|  PREDICTED: uncharacterized protein LOC104798379  87.8    1e-17   
ref|XP_002879845.1|  hypothetical protein ARALYDRAFT_483053           88.2    1e-17   
emb|CDY61707.1|  BnaC04g56700D                                        87.8    2e-17   
ref|XP_006398462.1|  hypothetical protein EUTSA_v10001056mg           87.8    2e-17   
ref|XP_009144665.1|  PREDICTED: uncharacterized protein LOC103868310  87.4    2e-17   
gb|AAM62822.1|  unknown                                               87.0    4e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDY41060.1|  BnaA09g18390D                                        86.3    6e-17   
ref|XP_009114262.1|  PREDICTED: uncharacterized protein LOC103839515  85.5    1e-16   
ref|NP_850326.2|  pollen Ole e 1 allergen and extensin family pro...  85.5    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009419523.1|  PREDICTED: uncharacterized protein LOC103999488  85.9    1e-16   
gb|ABD65108.1|  hypothetical protein 31.t00008                        84.3    3e-16   Brassica oleracea
dbj|BAJ99708.1|  predicted protein                                    84.3    5e-16   
emb|CDY69950.1|  BnaCnng66060D                                        84.0    5e-16   
ref|XP_010449652.1|  PREDICTED: uncharacterized protein LOC104731856  82.8    8e-16   
emb|CDY07055.1|  BnaA04g22600D                                        83.2    9e-16   
emb|CDY25956.1|  BnaC09g20310D                                        83.2    1e-15   
ref|XP_002466758.1|  hypothetical protein SORBIDRAFT_01g013620        84.0    1e-15   Sorghum bicolor [broomcorn]
ref|XP_010434705.1|  PREDICTED: uncharacterized protein LOC104718625  81.3    3e-15   
ref|XP_009141866.1|  PREDICTED: uncharacterized protein LOC103865...  80.5    4e-15   
ref|XP_009141865.1|  PREDICTED: uncharacterized protein LOC103865...  80.1    1e-14   
ref|XP_007212536.1|  hypothetical protein PRUPE_ppa019383mg           77.8    7e-14   
gb|AAM67093.1|  unknown                                               76.3    2e-13   Arabidopsis thaliana [mouse-ear cress]
gb|ABD65131.1|  hypothetical protein 40.t00006                        76.3    2e-13   Brassica oleracea
ref|XP_009136830.1|  PREDICTED: uncharacterized protein LOC103860901  75.5    4e-13   
gb|EEC66705.1|  hypothetical protein OsI_33026                        76.3    4e-13   Oryza sativa Indica Group [Indian rice]
ref|XP_004956162.1|  PREDICTED: uncharacterized protein LOC101776137  76.3    4e-13   
ref|NP_001064319.1|  Os10g0208600                                     76.3    4e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003571441.1|  PREDICTED: uncharacterized protein LOC100842350  75.9    6e-13   
ref|NP_001064313.1|  Os10g0206500                                     75.9    6e-13   Oryza sativa Japonica Group [Japonica rice]
ref|NP_567524.1|  pollen Ole e 1 allergen and extensin family pro...  74.3    1e-12   Arabidopsis thaliana [mouse-ear cress]
gb|EEC66696.1|  hypothetical protein OsI_33016                        74.7    1e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_002870116.1|  hypothetical protein ARALYDRAFT_493155           72.8    3e-12   
ref|XP_006414259.1|  hypothetical protein EUTSA_v10026465mg           72.4    5e-12   
ref|NP_001131971.2|  uncharacterized protein LOC100193369             70.9    2e-11   Zea mays [maize]
ref|XP_006284709.1|  hypothetical protein CARUB_v10005967mg           70.1    3e-11   
tpg|DAA50324.1|  TPA: hypothetical protein ZEAMMB73_534968            71.2    4e-11   
ref|XP_006665084.1|  PREDICTED: uncharacterized protein LOC102720850  65.1    7e-09   
gb|EMT25847.1|  hypothetical protein F775_16133                       61.2    2e-08   
gb|AAL82668.2|AC092387_16  expressed protein                          58.2    5e-07   Oryza sativa Japonica Group [Japonica rice]
gb|AAM18143.1|AC092172_3  Hypothetical protein                        57.8    6e-07   Oryza sativa Japonica Group [Japonica rice]
gb|AAM18169.1|AC092172_29  Unknown protein                            56.2    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008387510.1|  PREDICTED: proline-rich protein 3-like           51.6    1e-04   
gb|ACN41080.1|  unknown                                               52.0    3e-04   Picea sitchensis
gb|ABK26139.1|  unknown                                               52.0    3e-04   Picea sitchensis



>ref|XP_009773625.1| PREDICTED: uncharacterized protein LOC104223821 [Nicotiana sylvestris]
Length=187

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 116/175 (66%), Gaps = 15/175 (9%)
 Frame = +3

Query  162  LVLTLFLILDSPAAM--GNPVVDFSSIEE----AGYGEEKLSTVLIDGTVLCHPCLYAQK  323
            +++  F IL   +A+   NP+V+ S+ EE    AGYGEEKLSTV+I GT+LCH   + Q 
Sbjct  8    IIVVFFFILPIYSAILSENPLVELSNGEELGKMAGYGEEKLSTVIIHGTLLCH---HHQS  64

Query  324  AAARHDRLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIP  503
             A   D   Q PP P+SGA V VYCG   G      W++N T+E G+FLIDLPSHLH+IP
Sbjct  65   CADIIDT--QLPPHPVSGAYVAVYCGTSEGKVRGSSWSKNITNENGKFLIDLPSHLHSIP  122

Query  504  NLQNNCWVKVLHLPRDSTCSSHPSFTRK--RKGMKLTAIRGDTGLRTYTAHNIHI  662
            NL+N+C ++VLHLP+DS C  H SFT K  ++ +KLT+I GD G+R Y  H I +
Sbjct  123  NLENSCKIQVLHLPKDSLCHRHYSFTTKQYKRSIKLTSI-GD-GIRIYKTHRIQL  175



>ref|XP_009590285.1| PREDICTED: uncharacterized protein LOC104087498 [Nicotiana tomentosiformis]
Length=195

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 118/175 (67%), Gaps = 16/175 (9%)
 Frame = +3

Query  162  LVLTLFLILDSPAAM--GNPVVDFSSIEE----AGYGEEKLSTVLIDGTVLCHPCLYAQK  323
            +++  F +L   +A+   NP+V+FS+ EE    AGYGEEKLSTV+I GT+LCH   + Q 
Sbjct  8    IIVVFFFVLPIYSAILSDNPLVEFSNGEELGKMAGYGEEKLSTVIIHGTLLCH---HHQS  64

Query  324  AAARHDRLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIP  503
             A   D     PP P+SGA+V V+CG   G      W++N T+E G+F+IDLPSHLH+IP
Sbjct  65   CADIIDT--HLPPHPVSGANVAVFCGTSEGKVRGSSWSKNITNESGKFVIDLPSHLHSIP  122

Query  504  NLQNNCWVKVLHLPRDSTCSSHPSFTRK--RKGMKLTAIRGDTGLRTYTAHNIHI  662
            NL+N C +++LHLP+DS C  H SFTRK  ++ +KLT+I GD G+R YT H I +
Sbjct  123  NLENTCKIQLLHLPKDSLCRRH-SFTRKQYKRSIKLTSI-GD-GIRIYTTHKIQL  174



>ref|XP_009757696.1| PREDICTED: uncharacterized protein LOC104210486 [Nicotiana sylvestris]
Length=214

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 97/150 (65%), Gaps = 7/150 (5%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrg  413
            I+ AGYGEEKLSTV I G V+C           + D + +  P+PI GASV V+CG    
Sbjct  56   IKMAGYGEEKLSTVFIHGKVVCDNNSGCNNNNIK-DEISELGPRPIPGASVAVFCGSSGK  114

Query  414  grwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRK  593
             R    WARNTTDE GEFLIDLPSHLHAIPNL+  C VKVLHLPR++ C    +F  K K
Sbjct  115  ARRS--WARNTTDEDGEFLIDLPSHLHAIPNLEKTCLVKVLHLPRNTICGH--AFRGKHK  170

Query  594  GMKLTAIRGDTGLRTYTAHNIHINDKACTK  683
            G++LT+I GD G+RTYT   IH+  K   +
Sbjct  171  GLELTSI-GD-GIRTYTTDTIHLTPKVSQR  198



>ref|XP_011086267.1| PREDICTED: uncharacterized protein LOC105168050 [Sesamum indicum]
Length=199

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 93/146 (64%), Gaps = 15/146 (10%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrg  413
            ++ AGYGEEKLSTV+I G +LCH       A A H     P   P+SGA V V+C     
Sbjct  50   VKWAGYGEEKLSTVVIGGKLLCH-------ATASHKLSSHP--HPVSGALVAVFCAMGGK  100

Query  414  grwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRK  593
             R    WA+ +T+ YGEFLIDLPSHLHAIPNL+  C V+VLHLPR S C    SFT K K
Sbjct  101  TRKS--WAKGSTNSYGEFLIDLPSHLHAIPNLEKVCIVQVLHLPRSSPCRH--SFTGKHK  156

Query  594  GMKLTAIRGDTGLRTYTAHNIHINDK  671
             MKLT++    G+R+YT HNIH+  K
Sbjct  157  AMKLTSV--GEGVRSYTTHNIHLMPK  180



>ref|XP_004250260.2| PREDICTED: uncharacterized protein LOC101254753 [Solanum lycopersicum]
Length=186

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 93/150 (62%), Gaps = 11/150 (7%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAAR---HDRLRQPPPQPISGASVGVYCgg  404
            I+ AGYGEEKLSTV I G ++CH   Y           D   Q    PI GASVGV+CG 
Sbjct  35   IKMAGYGEEKLSTVFIHGKIVCHE--YDDHGCNNIIIKDDNFQLESTPIQGASVGVFCGS  92

Query  405  rrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTR  584
                R    WARNTTDE G+FLIDLPSHLHAIPNL+  C VKVL LPR++ C    +FT 
Sbjct  93   SGKTRRS--WARNTTDEDGDFLIDLPSHLHAIPNLEKTCLVKVLRLPRNTICEH--AFTG  148

Query  585  KRKGMKLTAIRGDTGLRTYTAHNIHINDKA  674
            K KG++L +I G  G+RTYT   IH+  K 
Sbjct  149  KHKGLELISIGG--GIRTYTIQTIHLTPKV  176



>ref|XP_006352362.1| PREDICTED: uncharacterized protein LOC102598521 [Solanum tuberosum]
Length=200

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 94/150 (63%), Gaps = 11/150 (7%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARH---DRLRQPPPQPISGASVGVYCgg  404
            I+ AGYGEEKLSTV I G ++CH   Y       +   D   +    PI GASVGV+CG 
Sbjct  48   IKMAGYGEEKLSTVFIHGKIVCHE--YDDHGCNNNIIKDDNFELGSTPIQGASVGVFCGS  105

Query  405  rrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTR  584
                R    WARNTTDE G+FLIDLPSHLHAIPNL+  C VKVLHLPR++ C    +F  
Sbjct  106  SGKTRRS--WARNTTDEDGDFLIDLPSHLHAIPNLEKTCLVKVLHLPRNTICEH--AFRG  161

Query  585  KRKGMKLTAIRGDTGLRTYTAHNIHINDKA  674
            K KG++L +I G  G+RTYT   IH+  K 
Sbjct  162  KHKGLELISIGG--GIRTYTTQTIHLTPKV  189



>ref|XP_009631224.1| PREDICTED: uncharacterized protein LOC104121033 [Nicotiana tomentosiformis]
Length=216

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 94/144 (65%), Gaps = 7/144 (5%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLC-HPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrr  410
            I+ AGYGEEKLSTV I G V+C +            D + +  P+ + GASV V+CG   
Sbjct  56   IKMAGYGEEKLSTVFIHGKVVCDNDSGCNNNNNNIKDEISELGPRAVPGASVAVFCGSSG  115

Query  411  ggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKR  590
              R    WARNTTDE GEFLIDLPSHLHAIPNL+  C VKVLHLPR++ C    SF  K 
Sbjct  116  KARRS--WARNTTDEDGEFLIDLPSHLHAIPNLEKTCLVKVLHLPRNTICEH--SFRGKH  171

Query  591  KGMKLTAIRGDTGLRTYTAHNIHI  662
            KG++LT+I GD G+RTYT   IH+
Sbjct  172  KGLELTSI-GD-GIRTYTTDTIHL  193



>emb|CDP04533.1| unnamed protein product [Coffea canephora]
Length=165

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 93/145 (64%), Gaps = 8/145 (6%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQP--PPQPISGASVGVYCggrrgg  416
            AGYGEEKLSTV I G +LCH C        + ++L QP   P P+SGASV V+CG     
Sbjct  2    AGYGEEKLSTVTISGKLLCHACADIHDHHHQANQLDQPLPAPAPVSGASVAVFCGTSWKS  61

Query  417  rwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKG  596
            R     AR TTDEYG+FLIDLPSHLHAIPNL+  C V+VLHL ++S C   P+FT K K 
Sbjct  62   RKS--CARGTTDEYGDFLIDLPSHLHAIPNLEKVCLVRVLHLSKNSDCR--PAFTGKHKA  117

Query  597  MKLTAIRGDTGLRTYTAHNIHINDK  671
            ++L +I  + G R YT   IH+  K
Sbjct  118  IRLLSI--EDGSRAYTVKTIHLTTK  140



>emb|CBI18639.3| unnamed protein product [Vitis vinifera]
Length=153

 Score =   133 bits (335),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 91/145 (63%), Gaps = 14/145 (10%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrg  413
            ++ AGYGEEKLSTVL+ GTVLCH CL         D+  Q P  PISGASV V C     
Sbjct  2    VQVAGYGEEKLSTVLVTGTVLCHTCL---------DKESQNPSLPISGASVSVTCHASGK  52

Query  414  grwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRK  593
             R   L A+  TDE G+F+IDLPS LHA+PNL+  C V+V  LPR+S C   P F RK +
Sbjct  53   KRRSTL-AQGVTDENGDFIIDLPSELHAVPNLEKTCSVEVHQLPRNSLC--QPGFVRKHR  109

Query  594  GMKLTAIRGDTGLRTYTAHNIHIND  668
            G++L+++    G+RTYTA  I   D
Sbjct  110  GIRLSSV--GNGIRTYTARTISFMD  132



>ref|XP_002275440.1| PREDICTED: uncharacterized protein LOC100263809 [Vitis vinifera]
Length=196

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 91/145 (63%), Gaps = 14/145 (10%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrg  413
            ++ AGYGEEKLSTVL+ GTVLCH CL         D+  Q P  PISGASV V C     
Sbjct  45   VQVAGYGEEKLSTVLVTGTVLCHTCL---------DKESQNPSLPISGASVSVTCHASGK  95

Query  414  grwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRK  593
             R   L A+  TDE G+F+IDLPS LHA+PNL+  C V+V  LPR+S C   P F RK +
Sbjct  96   KRRSTL-AQGVTDENGDFIIDLPSELHAVPNLEKTCSVEVHQLPRNSLC--QPGFVRKHR  152

Query  594  GMKLTAIRGDTGLRTYTAHNIHIND  668
            G++L+++    G+RTYTA  I   D
Sbjct  153  GIRLSSV--GNGIRTYTARTISFMD  175



>gb|KDP35508.1| hypothetical protein JCGZ_08946 [Jatropha curcas]
Length=181

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 107/184 (58%), Gaps = 31/184 (17%)
 Frame = +3

Query  162  LVLTLFLILDSPAAMGNPVVDFSSIEE----AGYGEEKLSTVLIDGTVLCHPCLYAQKAA  329
            L++ +FL   S  A G    +FSS EE    AGYGEEKLSTVLI G++LC  CL++Q   
Sbjct  6    LLMMIFLQRSSSMAEG---FEFSSREEMVRFAGYGEEKLSTVLITGSILCEACLHSQ---  59

Query  330  ARHDRLRQPPPQ--PISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIP  503
                    P  Q  P+SGA V + C  +         A+  TDEYG+F IDLPSHLHAIP
Sbjct  60   --------PKLQTWPLSGALVAINCDMKGKWIKASS-AQAVTDEYGDFQIDLPSHLHAIP  110

Query  504  NLQNNCWVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIND-----  668
            NL++ C VKVL +P++S C   P+F RK K + L++  GD G+R YTA  I   D     
Sbjct  111  NLESTCSVKVLRIPKNSAC--KPAFARKHKALTLSSA-GD-GIRVYTAEKIKFLDLKSRS  166

Query  669  -KAC  677
             KAC
Sbjct  167  LKAC  170



>ref|XP_002307854.1| hypothetical protein POPTR_0006s00740g [Populus trichocarpa]
 gb|EEE91377.1| hypothetical protein POPTR_0006s00740g [Populus trichocarpa]
Length=201

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 96/159 (60%), Gaps = 18/159 (11%)
 Frame = +3

Query  192  SPAAMGNPVVDFSSIEE----AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPP  359
            S A   NP+ +FSS EE    AGYGEEKLSTVL+ GTVLC  CL+ +          Q  
Sbjct  32   STAKAENPLQEFSSTEELVQWAGYGEEKLSTVLVTGTVLCEACLHGE---------NQLH  82

Query  360  PQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLH  539
              PISGA V V C        +   A+  TDEYG+FLIDLPSHLH IP+L+  C VKVL 
Sbjct  83   AWPISGALVNVECHTSTKRSKKSS-AQAITDEYGDFLIDLPSHLHGIPHLERICSVKVLR  141

Query  540  LPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNI  656
            LP++S C   P+  RK+K +KL+++    G+R Y+A  I
Sbjct  142  LPQNSVC--RPAHARKQKALKLSSV--GNGIRNYSAGEI  176



>ref|XP_007026368.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
 gb|EOY28990.1| Pollen Ole e 1 allergen and extensin family protein, putative 
[Theobroma cacao]
Length=187

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 103/179 (58%), Gaps = 25/179 (14%)
 Frame = +3

Query  165  VLTLFLILDSPAAMGNP---VVDFSSIEE----AGYGEEKLSTVLIDGTVLCHPCLYAQK  323
            V+ + L++ S  A  +    + + SS EE    AGYGEEKLSTVL+ GTVLC  CL+A+ 
Sbjct  13   VVVMLLLIQSSMAESDEHPLLYESSSREEMMQMAGYGEEKLSTVLVTGTVLCEACLHAEP  72

Query  324  AAARHDRLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIP  503
                     Q    PISGA V V C            A+  TDEYG+FLIDLPSHLH IP
Sbjct  73   ---------QLRAWPISGALVAVKCQTPCKRISGS--AQAVTDEYGDFLIDLPSHLHGIP  121

Query  504  NLQNNCWVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNI---HINDK  671
            NL   C VKVL +P++S C   P+F +K KG++ +++    G+RTYTA  I   HI  K
Sbjct  122  NLPKICAVKVLRIPKNSMC--RPAFVKKHKGLRFSSV--GNGIRTYTAGRIRFQHITSK  176



>ref|XP_011095911.1| PREDICTED: uncharacterized protein LOC105175232 [Sesamum indicum]
Length=180

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 104/176 (59%), Gaps = 24/176 (14%)
 Frame = +3

Query  156  VSLVLTLFLILDSPAAMGNPVVDFSS-------IEEAGYGEEKLSTVLIDGTVLCHPCLY  314
            V +V  + + L SPA     +   +        ++ AGYG+EKLSTVLIDG +LCH    
Sbjct  14   VFMVFIVLVFLGSPAIATGKLDLLAELYGREDMVKWAGYGDEKLSTVLIDGKLLCHGSGG  73

Query  315  AQKAAARHDRLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLH  494
              +A             P+SGA+VGV+CG R   +    W++ +TD YGEF+ID+PSHLH
Sbjct  74   KDEA------------HPVSGATVGVFCGARGKAKQA--WSKGSTDSYGEFVIDVPSHLH  119

Query  495  AIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHI  662
            AIPNL+  C VKV+HLPR S C   P   + +  MKLT++ GD G RTYT +NI +
Sbjct  120  AIPNLEKICHVKVVHLPRSSPC-RQPCIGKHKWMMKLTSV-GD-GTRTYTTNNIRL  172



>ref|XP_010252764.1| PREDICTED: uncharacterized protein LOC104594245 [Nelumbo nucifera]
Length=208

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 100/166 (60%), Gaps = 17/166 (10%)
 Frame = +3

Query  192  SPAAMGNPVVDFSS----IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPP  359
            S A   NP+V+ S+    I+ AGYG EKLS+VL+ GT+LC  CL+ +        LRQ  
Sbjct  27   SVAGRKNPLVELSTHTDLIQLAGYGLEKLSSVLVTGTLLCEACLHGE----MEPELRQ--  80

Query  360  PQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLH  539
              PISGA +GV C   R    +  WAR  TDEYGEF+IDLPS LHAIP L   C VKV+ 
Sbjct  81   -WPISGAVIGVACKTSRRKMSK-YWARGKTDEYGEFIIDLPSQLHAIPELDKACSVKVVA  138

Query  540  LPR-DSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHINDKA  674
            LP+  S CS   +F  K +G++L+++    G+RTYTA  I    ++
Sbjct  139  LPKIKSACSR--AFVGKSQGIRLSSV--GNGIRTYTAGEIAFQKQS  180



>ref|XP_006449928.1| hypothetical protein CICLE_v10016770mg [Citrus clementina]
 gb|ESR63168.1| hypothetical protein CICLE_v10016770mg [Citrus clementina]
Length=200

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 91/141 (65%), Gaps = 14/141 (10%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrg  413
            ++ AGYGEEKLSTVL+ G+VLC  CL+ Q      D+LR     PI+GA V VYC     
Sbjct  49   VQMAGYGEEKLSTVLVTGSVLCEACLHGQD-----DQLR---AWPITGALVSVYCHNSHR  100

Query  414  grwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRK  593
             +  +   +  TDEYG+F+IDLPSHLHA PNL   C VKVL LP++S C   P++ +K K
Sbjct  101  KKISK--TQTFTDEYGDFMIDLPSHLHATPNLDKTCSVKVLRLPKNSHC--RPAYVKKHK  156

Query  594  GMKLTAIRGDTGLRTYTAHNI  656
            G+KL+++    G+RTY A  I
Sbjct  157  GLKLSSV--GNGIRTYAAGRI  175



>gb|EYU33834.1| hypothetical protein MIMGU_mgv1a025015mg [Erythranthe guttata]
Length=209

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 88/140 (63%), Gaps = 15/140 (11%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrggrw  422
             GYGEEKLSTV+I G +LCH        A  HD+L    P P+SGAS+ V+CG     + 
Sbjct  49   GGYGEEKLSTVVISGKLLCH--------AGAHDKL-SGHPYPVSGASMAVFCGTSEKKKK  99

Query  423  rrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKGMK  602
               WA   T+ YGEF+IDLPSHLHAIPNL+  C VKVLH+P+ S C    +FT K K +K
Sbjct  100  S--WAVGRTNNYGEFVIDLPSHLHAIPNLEKTCVVKVLHVPKSSPCGR--AFTGKNKRIK  155

Query  603  LTAIRGDTGLRTYTAHNIHI  662
            L ++  D   R YT HNI++
Sbjct  156  LKSVGEDA--RIYTTHNINL  173



>ref|XP_002322501.2| hypothetical protein POPTR_0016s00790g [Populus trichocarpa]
 gb|EEF04262.2| hypothetical protein POPTR_0016s00790g [Populus trichocarpa]
Length=201

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 108/193 (56%), Gaps = 35/193 (18%)
 Frame = +3

Query  156  VSLVLTLFLIL--DSPAAMGNPVVDFSSIEE----AGYGEEKLSTVLIDGTVLCHPCLYA  317
            +S V  +F+I    S A   NP+ +FS+ EE    AGYGEEKLSTVL+ GT+LC  CL  
Sbjct  17   ISTVFIIFIITFQASMAKAENPLQEFSNREELVQLAGYGEEKLSTVLVTGTILCEACL--  74

Query  318  QKAAARHDRLRQPPPQPISGASVGVYCggrrggrwrrLWARNT-----TDEYGEFLIDLP  482
                  +   +     P+SGA V V C           W++ T     TDEYG+FLIDLP
Sbjct  75   ------NGGTQLLHAWPVSGALVYVECHTGVK------WSKTTSSQAMTDEYGDFLIDLP  122

Query  483  SHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHI  662
            SHLH IPNL+  C VKVL LP++S C   P+  RK+K ++L+++    G+R Y+A  I  
Sbjct  123  SHLHGIPNLERTCSVKVLRLPQNSVC--RPAHARKQKALELSSV--GNGIRNYSAGEIKF  178

Query  663  ND------KACTK  683
                    +ACT+
Sbjct  179  LQVTSKPLQACTQ  191



>ref|XP_006467274.1| PREDICTED: uncharacterized protein LOC102611527 [Citrus sinensis]
 gb|KDO78556.1| hypothetical protein CISIN_1g029046mg [Citrus sinensis]
Length=200

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 89/141 (63%), Gaps = 14/141 (10%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrg  413
            ++ AGYGEEKLSTVL+ G VLC  CL+ Q      D+LR     PI+GA V VYC     
Sbjct  49   VQMAGYGEEKLSTVLVTGFVLCEACLHGQD-----DQLR---AWPITGALVSVYCHNSHR  100

Query  414  grwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRK  593
                +   +  TDEYG+F+IDLPSHLHA PNL   C VKVL LP++S C   P++ +K K
Sbjct  101  KIISK--TQTFTDEYGDFMIDLPSHLHATPNLDKTCSVKVLRLPKNSHC--RPAYVKKHK  156

Query  594  GMKLTAIRGDTGLRTYTAHNI  656
            G+KL+++    G+RTY A  I
Sbjct  157  GLKLSSV--GNGIRTYAAGRI  175



>gb|KHG07811.1| Elongation factor Ts [Gossypium arboreum]
Length=212

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 98/172 (57%), Gaps = 27/172 (16%)
 Frame = +3

Query  177  FLILDSPAAMGNPVVDFSSIEE----AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDR  344
            F+I + P      + +FSS +E    AGYGEEKLSTVL+ GTVLC  C           R
Sbjct  38   FIIKNKPT-----LYEFSSRDEMVHLAGYGEEKLSTVLVTGTVLCEAC--------HGRR  84

Query  345  LRQPPPQ----PISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQ  512
             R P PQ    PISGA V V C      +      R TTDEYG+F+IDLPSHLH + +LQ
Sbjct  85   RRDPQPQLRSWPISGALVSVKCETPCKTKSST--TRATTDEYGDFMIDLPSHLHGVADLQ  142

Query  513  NNCWVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIND  668
              C VKV+ +P++S C   P F +K + ++L+++    G+RTYTA  I   D
Sbjct  143  KICTVKVIGIPKESMC--RPVFVKKHEHLRLSSV--GNGIRTYTAGRIRFQD  190



>ref|XP_011002371.1| PREDICTED: uncharacterized protein LOC105109369 [Populus euphratica]
Length=197

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 96/159 (60%), Gaps = 18/159 (11%)
 Frame = +3

Query  192  SPAAMGNPVVDFSSIEE----AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPP  359
            S A   NP+ +FSS EE    AGYGEEKLSTVL+ GTVLC  CL+ +          Q  
Sbjct  32   STAKAENPLHEFSSREELVQWAGYGEEKLSTVLVTGTVLCEACLHGEN---------QLH  82

Query  360  PQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLH  539
              PISGA V V C        +   A+  TDEYG+FLIDLPSHLH IP+L+  C V+ L 
Sbjct  83   AWPISGALVNVECHTGTKRSKKSS-AQAITDEYGDFLIDLPSHLHGIPHLERICSVQALR  141

Query  540  LPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNI  656
            LP++S C+  P+  RK+K ++L+++    G+R Y+A  I
Sbjct  142  LPQNSVCT--PAHARKQKALELSSV--GNGIRNYSAGEI  176



>ref|XP_010686624.1| PREDICTED: uncharacterized protein LOC104900801 [Beta vulgaris 
subsp. vulgaris]
Length=215

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 92/156 (59%), Gaps = 12/156 (8%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrg  413
            ++ AGYGEEKLSTVLI G V+C+    A K ++ H +L Q  PQPISGA VGV C  ++ 
Sbjct  60   VQLAGYGEEKLSTVLITGGVVCNKACLATKHSSNHHQL-QLSPQPISGALVGVACHTKKD  118

Query  414  grwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRK  593
                  W +  TD +G+F IDLPSHLH IP+L   C VK+L LP+DS+C    S + K K
Sbjct  119  KSTH--WVKAVTDNFGDFTIDLPSHLHGIPDLDKACSVKILDLPKDSSCHQSASAS-KHK  175

Query  594  GMKLTAIRGDTGLRTYTA------HNIHINDKACTK  683
             +KL + R   G RTY        H +  N  AC K
Sbjct  176  EIKLASTR--NGKRTYMVRGLALQHTLPENSAACMK  209



>ref|XP_010039483.1| PREDICTED: uncharacterized protein LOC104428178 [Eucalyptus grandis]
 gb|KCW45987.1| hypothetical protein EUGRSUZ_L00155 [Eucalyptus grandis]
Length=175

 Score =   117 bits (292),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 102/172 (59%), Gaps = 17/172 (10%)
 Frame = +3

Query  162  LVLTLFLIL-DSPAAMGNPVVDFSS----IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKA  326
             +  +FL++ D  A+    ++ FSS    +E AGYGE+K+ST+L+ G+VLC   L  +  
Sbjct  5    FIFFIFLVISDGAASTEGSLLKFSSRDELVEMAGYGEKKVSTILVVGSVLCVARLPRE--  62

Query  327  AARHDRLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPN  506
             A H    Q    P+SGA +GV C   +       W + +TDE+G+F IDLPSHLHA+P+
Sbjct  63   -AHH----QLHAWPVSGALIGVKCQKSKSRIRSN-WTQGSTDEFGDFTIDLPSHLHAVPD  116

Query  507  LQNNCWVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHI  662
            L   C V++L +PR STC   P+   + K +KL ++R   G+RTY A NI +
Sbjct  117  LPKKCSVRLLRVPRSSTC--RPAHGHRHKRLKLASVR--DGVRTYKAGNIRL  164



>ref|XP_010039440.1| PREDICTED: uncharacterized protein LOC104428144 [Eucalyptus grandis]
 gb|KCW45986.1| hypothetical protein EUGRSUZ_L00154 [Eucalyptus grandis]
Length=184

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 97/166 (58%), Gaps = 16/166 (10%)
 Frame = +3

Query  177  FLILDSPAAMGNPVVDFSS----IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDR  344
             ++ D  A+    +++FSS    +E AGYG +K+STVL+ G+V C     A+   A H R
Sbjct  11   LVVSDGAASTEGSLLEFSSQDELVEMAGYGVKKVSTVLVAGSVSC----VARLPGAAHHR  66

Query  345  LRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCW  524
            L      P+SGA VGV C   +       W R +TDE+G+F +DLPSHLHA+P+L   C 
Sbjct  67   LH---AWPVSGALVGVKCQKSKSRISSN-WTRGSTDEFGDFTMDLPSHLHAVPDLPKKCS  122

Query  525  VKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHI  662
            V++L +PR S C   P+   + K +KL ++R   G+RTY A NI +
Sbjct  123  VRLLRVPRSSPC--RPTHGHRHKRLKLASVR--DGVRTYKAGNIRL  164



>ref|XP_011040166.1| PREDICTED: uncharacterized protein LOC105136486 [Populus euphratica]
Length=200

 Score =   113 bits (283),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 94/166 (57%), Gaps = 28/166 (17%)
 Frame = +3

Query  192  SPAAMGNPVVDFSSIEE----AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPP  359
            S A   NP+ +FS+ EE    AGYGE+KLSTVL+ GT+LC  CL             Q  
Sbjct  31   SMAKAENPLQEFSNREELVQLAGYGEDKLSTVLVTGTILCEACLNGGT---------QLH  81

Query  360  PQPISGASVGVYCggrrggrwrrLWARNT-----TDEYGEFLIDLPSHLHAIPNLQNNCW  524
              P+SGASV V C           W++ +     TDEYG+FLIDLPS LH IPNL+  C 
Sbjct  82   AWPVSGASVYVECHTGGK------WSKTSSSQAMTDEYGDFLIDLPSPLHGIPNLERTCS  135

Query  525  VKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHI  662
            VKVL LP++S C    +  RK+K ++L+++    G+R Y+A  I  
Sbjct  136  VKVLRLPQNSVC--RLAHARKQKALELSSL--GNGIRYYSAGEIKF  177



>ref|XP_006352324.1| PREDICTED: uncharacterized protein LOC102586293 [Solanum tuberosum]
Length=167

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 97/166 (58%), Gaps = 25/166 (15%)
 Frame = +3

Query  201  AMGNPVVDFSSIEE----AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQP  368
            A+ NP+++ SS EE    AGYGEEKLSTV + GT+LC                    P P
Sbjct  21   AINNPLIELSSREELAKIAGYGEEKLSTVFLHGTLLC-----------------GHTPYP  63

Query  369  ISGASVGVYCggrr-ggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLP  545
            + GASV V+CG    G   +  WA+N T+E GEF+ID+PSHLHA  +  N C +++LHLP
Sbjct  64   VPGASVAVFCGTSGPGRVRKSSWAKNVTNESGEFIIDVPSHLHANIHDPNLCHIQILHLP  123

Query  546  RDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHINDKACTK  683
            +D +   H SFT KRK   LT+   + G+R YT   I++  KA ++
Sbjct  124  KDYSHCHHHSFT-KRKTFTLTS--SNIGVRVYTTPTIYLTPKASSR  166



>gb|AFK48643.1| unknown [Lotus japonicus]
Length=182

 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 89/145 (61%), Gaps = 15/145 (10%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYC-ggrr  410
            ++ AGYGEEKLSTVLI G+V C          AR     QP   PI GA VGV+C     
Sbjct  48   VQMAGYGEEKLSTVLITGSVNCQ---------ARFHNGDQPHAWPIPGAWVGVHCHSSAS  98

Query  411  ggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKR  590
              + + +  R  TDE+G+F++DLPSHLH+IPNL+N C VKV  +P+ S C   P+  +K 
Sbjct  99   ERKGKSMEVRGVTDEFGDFMVDLPSHLHSIPNLENICVVKVHRIPKGSLCQ--PAHVKKH  156

Query  591  KG-MKLTAIRGDTGLRTYTAHNIHI  662
            KG ++L++I    G+RTY A +I I
Sbjct  157  KGVLELSSI--GNGIRTYDAGSIRI  179



>ref|XP_009374857.1| PREDICTED: uncharacterized protein LOC103963728 [Pyrus x bretschneideri]
Length=226

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 68/148 (46%), Positives = 91/148 (61%), Gaps = 12/148 (8%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLC-HPCLYAQKAAARH----DRLRQPPPQ--PISGASVGV  392
            ++ AGYGEEKLSTVLI G+V C   C+      + H    DR  Q      P+SGA V V
Sbjct  62   MQVAGYGEEKLSTVLITGSVHCEQACINPNNLNSLHSDQTDRDHQLHRHAWPLSGALVSV  121

Query  393  YCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHP  572
             C      R   L A++ TDE+GEF+IDLPS+LHAIPNL   C V+VL +P+++ C   P
Sbjct  122  NCRVSGRRRKSSL-AQSVTDEFGEFMIDLPSNLHAIPNLDKTCCVRVLGIPKNAQC--RP  178

Query  573  SFTRKRKGMKLTAIRGDTGLRTYTAHNI  656
            +  R+ KG+KL+++    G+RTYTA  I
Sbjct  179  ASVRRHKGLKLSSV--GNGIRTYTAGRI  204



>ref|XP_008224628.1| PREDICTED: uncharacterized protein LOC103324359 [Prunus mume]
Length=266

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 93/157 (59%), Gaps = 12/157 (8%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARH-DRLRQPPPQPISGASVGVYCggrr  410
            ++ AGYGEEKLSTVLI G+V C        A   H D        P+SGA V V C    
Sbjct  111  VQIAGYGEEKLSTVLITGSVHCEEACNNLHAQTHHPDHQLHLHAWPLSGALVSVNCHVSG  170

Query  411  ggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKR  590
              R    +A+  TDE+G+F+IDLPS+LHAIPNL   C V+V+ +P+++ C   P++ R+ 
Sbjct  171  RKRKSS-FAQGFTDEFGDFIIDLPSNLHAIPNLHKTCSVRVVRIPKNTQC--RPAYVRRH  227

Query  591  KGMKLTAIRGDTGLRTYTAHNI---HINDK---ACTK  683
            KG+KL+++    G+RTY A NI   H+  K   AC K
Sbjct  228  KGLKLSSV--GNGIRTYNAGNIRFQHLTSKPSEACIK  262



>ref|XP_004250296.1| PREDICTED: uncharacterized protein LOC101265501 [Solanum lycopersicum]
Length=166

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 96/167 (57%), Gaps = 28/167 (17%)
 Frame = +3

Query  201  AMGNPVVDFSSIEE----AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQP  368
            A+ NP+++ SS EE    AGYGEEKLSTV + GT+LC                    P P
Sbjct  21   AINNPLIELSSREELAKIAGYGEEKLSTVFLHGTLLC-----------------GHTPHP  63

Query  369  ISGASVGVYCggrr-ggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLP  545
            + GASV VYCG    G   +  WA+N T+E G+F+ID+PSHLHA  +  N C +++LHLP
Sbjct  64   VPGASVAVYCGTSGPGRVRKSSWAKNVTNESGDFIIDVPSHLHANIHDPNLCHIQILHLP  123

Query  546  RD-STCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHINDKACTK  683
            +D S C  H   + KRK   LT+   + G+R YT   I++  KA ++
Sbjct  124  KDYSLCHHH---STKRKTFTLTS--SNIGVRVYTTPTIYLTPKASSR  165



>ref|XP_010087660.1| hypothetical protein L484_010612 [Morus notabilis]
 gb|EXB29553.1| hypothetical protein L484_010612 [Morus notabilis]
Length=203

 Score =   108 bits (271),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 80/138 (58%), Gaps = 15/138 (11%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrg  413
            ++ AGYGEEKLSTVLI G+V C  CL   +  A           P+SGA V V C     
Sbjct  53   VKIAGYGEEKLSTVLITGSVHCEACLNEAQLYA----------WPVSGALVAVNCHINGK  102

Query  414  grwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRK  593
                  W +  TDEYG+F +DLPS+LHAIPNL   C VKVL +P++S C   P+  R+ K
Sbjct  103  KGKSS-WTKCVTDEYGDFAVDLPSNLHAIPNLDRKCSVKVLRVPKNSLC--RPANVRRNK  159

Query  594  GMKLTAIRGDTGLRTYTA  647
            G++  ++    G+RTY A
Sbjct  160  GLRFLSV--GNGIRTYDA  175



>ref|NP_001235461.1| uncharacterized protein LOC100527138 precursor [Glycine max]
 gb|ACU16187.1| unknown [Glycine max]
 gb|KHN03546.1| hypothetical protein glysoja_004572 [Glycine soja]
Length=176

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 96/178 (54%), Gaps = 24/178 (13%)
 Frame = +3

Query  159  SLVLTLFLILDSPAAMGN-PVVDFSS-----IEEAGYGEEKLSTVLIDGTVLCHPCLYAQ  320
             LV+ L LI        N P+++  S     ++ AGYGEEKLSTVLI G+V C       
Sbjct  10   GLVIILVLIASPAEGEDNHPLLELLSSRDEVVQIAGYGEEKLSTVLITGSVTC-------  62

Query  321  KAAARHDRLRQPPPQPISGASVGVYCggrrggrw----rrLWARNTTDEYGEFLIDLPSH  488
            +A  R     QP   PI GASVGV C            + + A   TDE+G+F+IDLPSH
Sbjct  63   EAPHR----PQPHAWPIQGASVGVNCKSHGRNNKWNKGKSMVATGVTDEFGDFMIDLPSH  118

Query  489  LHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHI  662
            LHAIPNL+  C VK+  +P+ S C       +K KG+ L++     G+RTY A NI I
Sbjct  119  LHAIPNLEKVCIVKIHRIPKASLCRP-AHVIKKHKGLTLSSF--GNGIRTYNAGNIRI  173



>ref|XP_008384181.1| PREDICTED: uncharacterized protein LOC103446815 [Malus domestica]
Length=226

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 88/150 (59%), Gaps = 16/150 (11%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPC---------LYAQKAAARHDRLRQPPPQPISGASV  386
            ++ AGYGEEKLSTVLI G+V C            L++ +    H   R   P P  GA V
Sbjct  62   MQVAGYGEEKLSTVLITGSVHCEEACINRNNLNSLHSDQTDRDHQLHRHAWPLP--GALV  119

Query  387  GVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSS  566
             V C      R   L A+  TDE+GEF+IDLPS+LHAIPNL   C V+VL +P+++ C  
Sbjct  120  SVNCRVSGRRRKSSL-AQGVTDEFGEFMIDLPSNLHAIPNLDKTCCVRVLGIPKNAQC--  176

Query  567  HPSFTRKRKGMKLTAIRGDTGLRTYTAHNI  656
             P+  R+ KG+KL+++    G+RTYTA  I
Sbjct  177  RPASVRRHKGLKLSSV--GNGIRTYTAGRI  204



>ref|XP_004139527.1| PREDICTED: uncharacterized protein LOC101215830 [Cucumis sativus]
 gb|KGN65025.1| hypothetical protein Csa_1G181380 [Cucumis sativus]
Length=205

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 80/137 (58%), Gaps = 12/137 (9%)
 Frame = +3

Query  237  EEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrgg  416
            E AGYGEE+LSTVL+ G+VLC  CL+  +         Q    PI GA VGV C      
Sbjct  53   EIAGYGEERLSTVLVTGSVLCEACLHGDEP--------QVHAWPIKGAMVGVNCHNTGKN  104

Query  417  rwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKG  596
                 W    TDE+G+F+ID+PSHLHA  + +N C +K+L  P+++ C   P+    RK 
Sbjct  105  SKSSDWVHGVTDEFGDFVIDIPSHLHATRSFENVCSIKILRTPKNTHCR--PAHLAGRKP  162

Query  597  MKLTAIRGDTGLRTYTA  647
            ++L++  G  G+RTYT+
Sbjct  163  LQLSSFGG--GIRTYTS  177



>ref|XP_004166075.1| PREDICTED: uncharacterized protein LOC101231184 [Cucumis sativus]
Length=205

 Score =   107 bits (267),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 80/137 (58%), Gaps = 12/137 (9%)
 Frame = +3

Query  237  EEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrgg  416
            E AGYGEE+LSTVL+ G+VLC  CL+  +         Q    PI GA VGV C      
Sbjct  53   EIAGYGEERLSTVLVTGSVLCEACLHGDEP--------QVHAWPIKGAMVGVNCHNTGKN  104

Query  417  rwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKG  596
                 W    TDE+G+F+ID+PSHLHA  + +N C +K+L  P+++ C   P+    RK 
Sbjct  105  SKSSDWVHGVTDEFGDFVIDIPSHLHATRSFENVCSIKILRTPKNTHCR--PAHLAGRKL  162

Query  597  MKLTAIRGDTGLRTYTA  647
            ++L++  G  G+RTYT+
Sbjct  163  LQLSSFGG--GIRTYTS  177



>ref|XP_009372506.1| PREDICTED: uncharacterized protein LOC103961353 [Pyrus x bretschneideri]
Length=245

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 92/166 (55%), Gaps = 29/166 (17%)
 Frame = +3

Query  210  NPVVDFSSIEE-----AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQ---  365
            NP+    S +E     AGYGEEKLSTVLI G+V C      ++A   H+ L    P    
Sbjct  69   NPLEQLMSSQEDMMQVAGYGEEKLSTVLITGSVHC------EEACINHNNLNILHPDQTD  122

Query  366  ---------PISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNN  518
                     P+SGA V V C      +     A+  TDE+G+F+IDLPS+LH IPNL   
Sbjct  123  RDQLHLHAWPLSGALVSVNCRVSGRRKSS--LAQGVTDEFGDFMIDLPSNLHTIPNLDKT  180

Query  519  CWVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNI  656
            C V+VL +P+++ C   P+  R+ KG+KL+++    G+RTYTA  I
Sbjct  181  CCVRVLGIPKNAQC--RPASVRRHKGLKLSSV--GNGIRTYTAGTI  222



>ref|XP_009396441.1| PREDICTED: uncharacterized protein LOC103981437 [Musa acuminata 
subsp. malaccensis]
Length=192

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 82/147 (56%), Gaps = 13/147 (9%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrggrw  422
            AGYGEE++S+VL+ GT+LC  CL              P   P+ GA +GV C        
Sbjct  49   AGYGEERISSVLVAGTLLCDACLRPGS---------DPVTFPVPGARIGVGCRTNGESTR  99

Query  423  rrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKGMK  602
            +  W   TTDE+GEFL+DLPSHLHA P L+ +C V+VL +P++  C S+P      + +K
Sbjct  100  KTNWTCGTTDEFGEFLVDLPSHLHAAPWLEESCMVRVLLMPKECLCRSNPGMV--FRDLK  157

Query  603  LTAIRGDTGLRTYTAHNIHINDKACTK  683
            L++  G   +R Y+A  +    +  ++
Sbjct  158  LSS--GGNSIRVYSAGTLRCRSEVVSE  182



>gb|KCW75105.1| hypothetical protein EUGRSUZ_E03855 [Eucalyptus grandis]
Length=175

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 80/147 (54%), Gaps = 14/147 (10%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrg  413
            +E AGYGEEKLSTVL+ G+VLC  CL             Q    P+SGASV V C     
Sbjct  23   VEMAGYGEEKLSTVLVTGSVLCEACLPGDP---------QLHAWPLSGASVAVNCHADDK  73

Query  414  grwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRK  593
                       TDE G+F IDLPS LHA+PNL   C V ++ +PR+S C   P+  RK K
Sbjct  74   ESKSS-RIHGLTDENGDFFIDLPSELHAVPNLNKRCSVNLVRMPRNSLC--RPAHIRKHK  130

Query  594  GMKLTAIRGDTGLRTYTAHNIHINDKA  674
             ++L+++    G+RTY A  I +   A
Sbjct  131  RVRLSSV--GNGIRTYEAGTIRLQHSA  155



>ref|XP_010057789.1| PREDICTED: uncharacterized protein LOC104445586 [Eucalyptus grandis]
Length=212

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 80/147 (54%), Gaps = 14/147 (10%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrg  413
            +E AGYGEEKLSTVL+ G+VLC  CL             Q    P+SGASV V C     
Sbjct  60   VEMAGYGEEKLSTVLVTGSVLCEACLPGDP---------QLHAWPLSGASVAVNCHADDK  110

Query  414  grwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRK  593
                       TDE G+F IDLPS LHA+PNL   C V ++ +PR+S C   P+  RK K
Sbjct  111  ESKSS-RIHGLTDENGDFFIDLPSELHAVPNLNKRCSVNLVRMPRNSLC--RPAHIRKHK  167

Query  594  GMKLTAIRGDTGLRTYTAHNIHINDKA  674
             ++L+++    G+RTY A  I +   A
Sbjct  168  RVRLSSV--GNGIRTYEAGTIRLQHSA  192



>ref|XP_008463598.1| PREDICTED: uncharacterized protein LOC103501709 [Cucumis melo]
Length=205

 Score =   105 bits (261),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 79/137 (58%), Gaps = 12/137 (9%)
 Frame = +3

Query  237  EEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrgg  416
            E AGYGEE+LSTVL+ G+VLC  CL+  +         Q    PI GA VGV C      
Sbjct  53   EIAGYGEERLSTVLVTGSVLCESCLHGDEP--------QVHAWPIRGAMVGVNCHNTGKN  104

Query  417  rwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKG  596
                 W    TDE+G+F+ID+PS LHA  + +N C +K+L  P+++ C   P+    RK 
Sbjct  105  SKSSDWVHGVTDEFGDFVIDIPSRLHATQSFENVCSIKILRTPKNTHC--RPAHLAGRKQ  162

Query  597  MKLTAIRGDTGLRTYTA  647
            ++L++  G  G+RTYT+
Sbjct  163  LQLSSFGG--GIRTYTS  177



>ref|XP_010530071.1| PREDICTED: uncharacterized protein LOC104806736 [Tarenaya hassleriana]
Length=155

 Score =   103 bits (257),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 81/147 (55%), Gaps = 23/147 (16%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLC--HPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggr  407
            +  AGYGEEKLS+V++ GT+LC  HP  +               P P+ GA+V + C   
Sbjct  29   VAMAGYGEEKLSSVVVTGTLLCSDHPLSF---------------PIPVPGATVAIKCQTG  73

Query  408  rggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRK  587
               R R  W +  TDE GEF++DLPSHLH IP++   C VK +H+P+   C  HPS ++K
Sbjct  74   VKRRSR--WIKTVTDELGEFVMDLPSHLHGIPDMGKTCLVKPVHVPKPYKC--HPSASKK  129

Query  588  RKGMKLTAIRGDTGLRTYTAHNIHIND  668
             +G+KL  +    G R YT   I +  
Sbjct  130  HRGLKL--VSSSNGFRMYTTGKIRLQK  154



>ref|XP_007154046.1| hypothetical protein PHAVU_003G086700g [Phaseolus vulgaris]
 gb|ESW26040.1| hypothetical protein PHAVU_003G086700g [Phaseolus vulgaris]
Length=174

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 69/179 (39%), Positives = 98/179 (55%), Gaps = 28/179 (16%)
 Frame = +3

Query  159  SLVLTLFLILDSPAAMG--NPVVDFSS-----IEEAGYGEEKLSTVLIDGTVLCHPCLYA  317
            +LV  LF+ + +  A G  NP+++  S     +  AGYGEEKLSTVLI G+V C      
Sbjct  11   TLVTLLFIFVLASLAAGEDNPLLELLSNRDEVVHIAGYGEEKLSTVLITGSVSCE-----  65

Query  318  QKAAARHDRLRQPPPQPISGASVGVYCggrrggrwrrLW---ARNTTDEYGEFLIDLPSH  488
                A H    Q    P+ GA VG+ C         + W   AR  +DE+GEF++D+PSH
Sbjct  66   ----APH----QLHAWPLQGAWVGLKCQRHGRKWKGK-WSTVARGVSDEFGEFIVDVPSH  116

Query  489  LHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
            LHAIPN +  C V++  +P+ S C +     +K+KG+ L++     G+RTY A NI I 
Sbjct  117  LHAIPNFEKECSVRIDRIPKASLCRA--VGVKKQKGLSLSSF--GNGIRTYNAGNIRIQ  171



>ref|XP_008345789.1| PREDICTED: uncharacterized protein LOC103408743 [Malus domestica]
Length=245

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 91/166 (55%), Gaps = 29/166 (17%)
 Frame = +3

Query  210  NPVVDFSSIEE-----AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQ---  365
            NP+    S +E     AGYGEEKLSTVLI G+V C      ++A   H+ L    P    
Sbjct  69   NPLEQLMSSQEDMMQVAGYGEEKLSTVLITGSVHC------EEACIDHNNLNILHPDQTD  122

Query  366  ---------PISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNN  518
                     P+SG  V V C      +     A+  TDE+G F+IDLPS+LHAIPNL   
Sbjct  123  RDQLHLHAWPLSGVLVSVNCRVSGRRKSS--LAQGITDEFGVFMIDLPSNLHAIPNLDKT  180

Query  519  CWVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNI  656
            C V+VL +P+++ C   P+  R+ KG+KL+++    G+RTYTA  I
Sbjct  181  CCVRVLGIPKNAQC--RPASVRRHKGLKLSSV--GNGIRTYTAGRI  222



>ref|XP_002522879.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39479.1| conserved hypothetical protein [Ricinus communis]
Length=182

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 81/156 (52%), Gaps = 24/156 (15%)
 Frame = +3

Query  210  NPVVDFSSIEE----AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISG  377
            N + +F S EE    AGYGEEKLSTVLI GTVLC                      P+SG
Sbjct  40   NHLQEFWSREELVRLAGYGEEKLSTVLITGTVLCDGTPLG--------------ASPVSG  85

Query  378  ASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDST  557
            A VG+ CG           A   TDEYGEF IDLPS LHAI NL+  C +KVL +P++S 
Sbjct  86   ALVGINCGEWSQQSSAA--AEAVTDEYGEFQIDLPSQLHAILNLEKACSLKVLRMPKNSA  143

Query  558  CSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
            C         ++G  LT +    G+R YTA  I ++
Sbjct  144  C----KLAFGKEGKTLTLLLARDGVRVYTAGEIKLS  175



>ref|XP_006856296.1| hypothetical protein AMTR_s00047p00112050 [Amborella trichopoda]
 gb|ERN17763.1| hypothetical protein AMTR_s00047p00112050 [Amborella trichopoda]
Length=191

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 77/148 (52%), Gaps = 17/148 (11%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQP-ISGASVGVYCggrr  410
            +  AGYG EKLS+VL+ GTV C  C             R     P +SGA+V V C    
Sbjct  44   VRTAGYGIEKLSSVLVTGTVTCDAC-------------RDTGKSPFVSGATVAVRCQTNG  90

Query  411  ggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKR  590
            G R R    R  TDEYG+F+ID+PSH+HA P L+N C V V+ +P +S C  + +    R
Sbjct  91   GKRSRHFRVRGKTDEYGDFMIDIPSHMHATPRLENTCHVTVVQIPENSDCRRNRA---GR  147

Query  591  KGMKLTAIRGDTGLRTYTAHNIHINDKA  674
            +  +L       G+R YTA  +H   + 
Sbjct  148  QAFRLRVSSVGNGIRVYTAGFLHFQPRG  175



>ref|XP_008790321.1| PREDICTED: uncharacterized protein LOC103707566 [Phoenix dactylifera]
Length=187

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 82/148 (55%), Gaps = 23/148 (16%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPIS----GASVGVYCg  401
            + +AGYGEE+LS+VLI GT+LC  CL             QP    +S    GA V + C 
Sbjct  38   VHQAGYGEERLSSVLITGTILCDACL-------------QPGSHLLSSHVRGAKVAIACK  84

Query  402  grrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFT  581
                 R    WA    DEYGEF+ID+PSHLHAIP L+ +C ++VL +P++S C       
Sbjct  85   TEERRRKTN-WAYGMADEYGEFIIDVPSHLHAIP-LEEDCVIRVLRMPKNSCCRQMSEMN  142

Query  582  RKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
               KG+KL+++     +R YTA  + ++
Sbjct  143  --HKGIKLSSV--GNSIRVYTAGVVRLS  166



>gb|EYU27658.1| hypothetical protein MIMGU_mgv1a025896mg [Erythranthe guttata]
Length=151

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 83/144 (58%), Gaps = 15/144 (10%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrg  413
            ++ AGYGEEKLSTV+I G +LCH        AA +D+     P PISG  +  Y   +  
Sbjct  14   VKWAGYGEEKLSTVVIGGKLLCHA------GAAPNDKT-SIQPYPISGIYIHKYGKKKGL  66

Query  414  grwrrLWA-RNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKR  590
                  WA R +TD  GEF ID+PSHLHA PNL+N C V+VL LP  S      +    +
Sbjct  67   K-----WAGRGSTDSSGEFQIDVPSHLHANPNLENICHVRVLRLPSSSAYRQSCTRNHGK  121

Query  591  KGMKLTAIRGDTGLRTYTAHNIHI  662
            K +KL ++    G+R+YT HNI++
Sbjct  122  KPIKLDSV--GEGVRSYTTHNINL  143



>ref|XP_008785642.1| PREDICTED: uncharacterized protein LOC103704219 [Phoenix dactylifera]
Length=189

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 80/141 (57%), Gaps = 15/141 (11%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrggrw  422
            AGYGEE+LS+VL+ GTVLC  CL     AA H         P++ A V V C      R 
Sbjct  43   AGYGEERLSSVLVTGTVLCDACL----QAASH-----VLSSPVADAKVAVACKTEGQRRK  93

Query  423  rrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKGMK  602
               W   TTD+YGEF+I+LPSHLHAIP L+ +C V VL +P+ S C         RK +K
Sbjct  94   A-YWTYGTTDDYGEFIINLPSHLHAIP-LEEDCIVGVLRMPKSSYCQQISGM--NRKAIK  149

Query  603  LTAIRGDTGLRTYTAHNIHIN  665
            L+++     +R YTA  + ++
Sbjct  150  LSSV--GNSIRVYTAGIVRLS  168



>ref|XP_004507594.1| PREDICTED: uncharacterized protein LOC101497330 [Cicer arietinum]
Length=190

 Score = 98.2 bits (243),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 80/145 (55%), Gaps = 15/145 (10%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCgg-rr  410
            +E AGYGEEKLSTVLI G++ C            H     P   PI GA V + C    +
Sbjct  51   VEIAGYGEEKLSTVLITGSLHC---------GGDH---HHPHAMPIPGALVAINCQSHAK  98

Query  411  ggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKR  590
              + + + AR  TDE+G+F++DLPS+LHAIPNL+  C VKV  +P+ S C       + +
Sbjct  99   ERKGKSMVARGVTDEFGDFMVDLPSYLHAIPNLEKICRVKVHRIPKGSPCRPARHVNKHK  158

Query  591  KGMKLTAIRGDTGLRTYTAHNIHIN  665
                L++I    G+RTY A NI I 
Sbjct  159  GLFSLSSI--GNGIRTYDAGNIRIQ  181



>ref|XP_010481298.1| PREDICTED: uncharacterized protein LOC104760129 isoform X1 [Camelina 
sativa]
 ref|XP_010481299.1| PREDICTED: uncharacterized protein LOC104760129 isoform X1 [Camelina 
sativa]
Length=165

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 86/159 (54%), Gaps = 22/159 (14%)
 Frame = +3

Query  198  AAMGNPVVDFSSIEEAGYGEEKLSTVLIDGTVLC---HPCLYAQKAAARHDRLRQPPPQP  368
             A GN       +E AGYGE+KLS+V+I G++LC   HP  ++                P
Sbjct  20   GAFGNMWTRMEMVEMAGYGEQKLSSVIITGSLLCDTSHPRFHSIAI-------------P  66

Query  369  ISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPR  548
            ++GA+V + C      R +  W +  TD+ GEF IDLPS LHAIP+L+N C++K +H+P+
Sbjct  67   VTGATVAIKCRTGSKKRSK--WIKAVTDDLGEFEIDLPSQLHAIPDLENTCFIKPVHVPK  124

Query  549  DSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
               C  + ++T   K +KL  +    G R YT+  I + 
Sbjct  125  PYRC--YHTYTNIHKRIKL--VSSTNGFRVYTSGKIRLQ  159



>ref|XP_010440040.1| PREDICTED: uncharacterized protein LOC104723382 [Camelina sativa]
Length=146

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 86/168 (51%), Gaps = 27/168 (16%)
 Frame = +3

Query  162  LVLTLFLILDSPAAMGNPVVDFSSIEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHD  341
            + +TL L++ S  A          +E AGYGE+KLS+VL+  T+L               
Sbjct  6    MSMTLVLVVASGEAARERWTRNEMVEMAGYGEQKLSSVLLTATLL---------------  50

Query  342  RLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNC  521
                  P PI GA+VG+ C  R     +  W +  T+E G+F+IDLPSHLHAIP+L   C
Sbjct  51   ---SSSPSPIHGATVGIKCHTRYRKGSK--WIKGVTNESGKFVIDLPSHLHAIPDLDKAC  105

Query  522  WVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
             +K L +P+   CSS     +  +G+KL  +   +G R Y A NI + 
Sbjct  106  IIKTLSVPKPYRCSS-----KIHRGIKL--LSSSSGSRVYAAGNITLQ  146



>ref|XP_004293399.1| PREDICTED: uncharacterized protein LOC101300601 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=220

 Score = 97.1 bits (240),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/158 (38%), Positives = 90/158 (57%), Gaps = 16/158 (10%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQ--PISGASVGVYCggr  407
            ++ AGYGEEKLSTVLI G+V C     A   +  H++  Q      P+SGA V V C   
Sbjct  63   VQIAGYGEEKLSTVLITGSVHCEE---ACSLSDDHEQAHQLHLHAWPVSGAVVSVNCRVG  119

Query  408  rggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRK  587
               R     +    DEYG+F+I+LPS LHA+PNL   C  +V+ +P+++ C +  +F ++
Sbjct  120  GRKRKSS-RSLGVADEYGDFMIELPSDLHAVPNLDKLCCARVIRVPKNTQCKA--AFVKR  176

Query  588  RKGMKLTAIRGDTGLRTYTAHNIHIND------KACTK  683
             KG+KL+++    G+RTY+A  I   +      +AC K
Sbjct  177  HKGLKLSSV--GNGIRTYSAGRIRFQNLTPKPPQACIK  212



>ref|XP_010936417.1| PREDICTED: uncharacterized protein LOC105056054 [Elaeis guineensis]
Length=182

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 77/139 (55%), Gaps = 23/139 (17%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPIS----GASVGVYCggrr  410
            AGYGEE+LS+VLI GT+LC  CL             QP    +S    GA V + C    
Sbjct  36   AGYGEERLSSVLITGTILCDACL-------------QPGSHLLSSHVQGAKVAIACKTEE  82

Query  411  ggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKR  590
              R    WA   TDEYGEF+IDLPSHLHAIP L+ +C ++VL +P++S C          
Sbjct  83   RRRKAN-WAYGMTDEYGEFIIDLPSHLHAIP-LEEDCIIRVLRMPKNSYCRQTSGMN--H  138

Query  591  KGMKLTAIRGDTGLRTYTA  647
             G+KL+++     +R YTA
Sbjct  139  VGIKLSSV--GNSIRVYTA  155



>gb|KEH32686.1| pollen Ole e I family allergen [Medicago truncatula]
Length=206

 Score = 95.5 bits (236),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 90/176 (51%), Gaps = 23/176 (13%)
 Frame = +3

Query  180  LILDSPAAMGNPVVDFSS----------IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAA  329
            +++ SP +  + V D+ +          +E AGYGEEKLSTVLI G++ C        + 
Sbjct  26   IVVGSPPSSASGVEDYQNLFGLSSREEVVEIAGYGEEKLSTVLITGSLHCDGPNNNHHSN  85

Query  330  ARHDRLRQPPPQPISGASVGVYCgg-rrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPN  506
            A           PI GA V V C         + + A   TDE+G+F++DLPS+LHAIPN
Sbjct  86   A----------WPIPGALVSVNCQSHATERTGKAMVANGVTDEFGDFMVDLPSYLHAIPN  135

Query  507  LQNNCWVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHINDKA  674
            L+  C VKV  +P+ S C       +++  +KL+ I    G+RTY A  I I   A
Sbjct  136  LEKICRVKVHKIPKGSLCRPARHVNKQKGLLKLSTI--GNGIRTYDAGTIRIQHSA  189



>ref|XP_010441432.1| PREDICTED: uncharacterized protein LOC104724601 [Camelina sativa]
Length=163

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 85/168 (51%), Gaps = 20/168 (12%)
 Frame = +3

Query  162  LVLTLFLILDSPAAMGNPVVDFSSIEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHD  341
             ++  FL+ +   A GN       +E AGYGE+KLS+V+I G++LC        +  R  
Sbjct  10   FIIIFFLLFN--GAFGNIWTRMEMVEMAGYGEQKLSSVIITGSLLC------DTSRPRFH  61

Query  342  RLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNC  521
             +  P      GA+V + C      R +  W +  TD+ GEF IDLPS LHAIP+L+N C
Sbjct  62   SIAIP------GATVAIKCHTGSKKRSK--WIKAVTDDLGEFEIDLPSQLHAIPDLENTC  113

Query  522  WVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
            ++K +H+P+   C    +   KR    +  +    G R YT+  I + 
Sbjct  114  FIKPVHVPKPYRCYHTSTNIHKR----IKLVSSTNGFRVYTSGKIRLQ  157



>ref|XP_010481300.1| PREDICTED: uncharacterized protein LOC104760129 isoform X2 [Camelina 
sativa]
Length=163

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 82/156 (53%), Gaps = 18/156 (12%)
 Frame = +3

Query  198  AAMGNPVVDFSSIEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISG  377
             A GN       +E AGYGE+KLS+V+I G++LC            H R        I G
Sbjct  20   GAFGNMWTRMEMVEMAGYGEQKLSSVIITGSLLCD---------TSHPRFHSIA---IPG  67

Query  378  ASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDST  557
            A+V + C      R +  W +  TD+ GEF IDLPS LHAIP+L+N C++K +H+P+   
Sbjct  68   ATVAIKCRTGSKKRSK--WIKAVTDDLGEFEIDLPSQLHAIPDLENTCFIKPVHVPKPYR  125

Query  558  CSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
            C  + ++T   K +KL  +    G R YT+  I + 
Sbjct  126  C--YHTYTNIHKRIKL--VSSTNGFRVYTSGKIRLQ  157



>ref|XP_006295116.1| hypothetical protein CARUB_v10024190mg [Capsella rubella]
 gb|EOA28014.1| hypothetical protein CARUB_v10024190mg [Capsella rubella]
Length=168

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 79/144 (55%), Gaps = 25/144 (17%)
 Frame = +3

Query  237  EEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrgg  416
            E AGYGE KLS+V+I G+VLC+                     P+SGA+V + C      
Sbjct  35   EMAGYGEHKLSSVVITGSVLCN--------------------TPVSGATVAIKCHTGFKK  74

Query  417  rwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSF-TRKRK  593
            R +  W +  TD++GEF+I LPSHLHAIP L+  C+VK +H+P+      H  + +   K
Sbjct  75   RSK--WVKGVTDDFGEFVIHLPSHLHAIPQLEKACFVKPIHVPKHYHRCYHTFYKSNTHK  132

Query  594  GMKLTAIRGDTGLRTYTAHNIHIN  665
            G+KL + R   G R YT+  I ++
Sbjct  133  GIKLVSSR--NGFRVYTSGTIRLH  154



>ref|XP_006411260.1| hypothetical protein EUTSA_v10017342mg [Eutrema salsugineum]
 gb|ESQ52713.1| hypothetical protein EUTSA_v10017342mg [Eutrema salsugineum]
Length=164

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/159 (36%), Positives = 85/159 (53%), Gaps = 25/159 (16%)
 Frame = +3

Query  192  SPAAMGNPVVDFSSIEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPI  371
            S AA G         E  GYGE KLS+V+I G++LC+                     P+
Sbjct  16   SFAAAGKFWSRIEMAEMNGYGEHKLSSVVITGSILCNT--------------------PV  55

Query  372  SGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRD  551
            SGA+V + C      R +  W +  TD++GEF+I LPSHLHAIP+L+  C++K +H+P+ 
Sbjct  56   SGATVAIKCHTGFKKRSK--WVKAVTDDFGEFVIHLPSHLHAIPHLEKACFIKPVHVPKH  113

Query  552  -STCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
              +C    S +   KG+KL + R   G R YT+ +I ++
Sbjct  114  YQSCYKTFSKSNIHKGIKLVSSR--NGFRVYTSGSIKLH  150



>emb|CDY17718.1| BnaA06g35370D [Brassica napus]
Length=166

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 78/146 (53%), Gaps = 21/146 (14%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQP--PPQPISGASVGVYCggr  407
            +E AGYGE+KLS+V+I G++LC             D   +P  P   I GA+V + C   
Sbjct  34   VEMAGYGEQKLSSVIITGSLLC-------------DNTSRPHLPSIAIPGATVAIKCHTG  80

Query  408  rggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRK  587
               R +  W +  TD+ GEF IDLPS LHAIP+++N C VK +H+P+   C+   S T K
Sbjct  81   YKRRSK--WIKAVTDDLGEFEIDLPSQLHAIPDMENTCVVKPVHVPKLYRCNHRSSNTHK  138

Query  588  RKGMKLTAIRGDTGLRTYTAHNIHIN  665
            R    +  +    G R YT+  I + 
Sbjct  139  R----INLVSSTNGFRVYTSGKIKLQ  160



>ref|XP_002863328.1| hypothetical protein ARALYDRAFT_330672 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39587.1| hypothetical protein ARALYDRAFT_330672 [Arabidopsis lyrata subsp. 
lyrata]
Length=163

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 79/147 (54%), Gaps = 24/147 (16%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLC---HPCLYAQKAAARHDRLRQPPPQPISGASVGVYCgg  404
            +E AGYGE+KLS+V+I G++LC    P L++                PI GA+V + C  
Sbjct  32   VEMAGYGEQKLSSVIIAGSLLCDTSRPYLHSV---------------PIPGATVAIKCQT  76

Query  405  rrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTR  584
                R +  W +  TDE GEF IDLPS LHAIP+L+N C++K +++PR   C    +   
Sbjct  77   GSKRRSK--WIKAVTDELGEFEIDLPSQLHAIPDLENKCFIKPVYVPRHYRCYHTSTNIH  134

Query  585  KRKGMKLTAIRGDTGLRTYTAHNIHIN  665
            KR    +  +    GLR YT+  I + 
Sbjct  135  KR----IKLVSSTNGLRVYTSGKIRLQ  157



>ref|XP_010517410.1| PREDICTED: uncharacterized protein LOC104792861 [Camelina sativa]
Length=171

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 79/144 (55%), Gaps = 25/144 (17%)
 Frame = +3

Query  237  EEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrgg  416
            E AGYGE KLS+V+I G+VLC+                     P+SGA+V + C      
Sbjct  37   EMAGYGEHKLSSVVITGSVLCN--------------------TPVSGATVAIKCHTEFKK  76

Query  417  rwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSF-TRKRK  593
            R +  W +  TD++GEF+I LPSHLHAIP L+  C+VK +H+P+      H  + +   K
Sbjct  77   RSK--WVKGVTDDFGEFVIHLPSHLHAIPQLEKACFVKPIHVPKHYRRCYHTFYKSNTHK  134

Query  594  GMKLTAIRGDTGLRTYTAHNIHIN  665
            G+KL + R   G R Y++  I ++
Sbjct  135  GIKLLSSR--NGFRVYSSGTIRLH  156



>ref|XP_010505718.1| PREDICTED: uncharacterized protein LOC104782478 [Camelina sativa]
Length=170

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 78/144 (54%), Gaps = 25/144 (17%)
 Frame = +3

Query  237  EEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrgg  416
            E AGYGE KLS+V+I G+VLC+                     P+SGA+V + C      
Sbjct  36   EMAGYGEHKLSSVVITGSVLCN--------------------TPVSGATVAIKCHTGFKK  75

Query  417  rwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSF-TRKRK  593
            R +  W +  TD+ GEF+I LPSHLHAIP L+  C+VK +H+P+      HP + +   K
Sbjct  76   RSK--WVKGVTDDSGEFVIHLPSHLHAIPQLEKACFVKPIHVPKHYHRCYHPFYKSNTHK  133

Query  594  GMKLTAIRGDTGLRTYTAHNIHIN  665
            G+KL + R   G R Y+   I ++
Sbjct  134  GIKLLSSR--NGFRVYSTGTIRLH  155



>ref|XP_010508913.1| PREDICTED: uncharacterized protein LOC104785405 [Camelina sativa]
Length=169

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 78/144 (54%), Gaps = 25/144 (17%)
 Frame = +3

Query  237  EEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrgg  416
            E AGYGE KLS+V+I G+VLC+                     P+SGA+V + C      
Sbjct  35   EMAGYGEHKLSSVVITGSVLCN--------------------TPVSGATVAIKCHTGLKK  74

Query  417  rwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSF-TRKRK  593
            R +  W +  TD++GEF+I LPSHLHAIP L+  C+VK +H+P+      H  + +   K
Sbjct  75   RSK--WVKGVTDDFGEFVIHLPSHLHAIPQLEKACFVKPIHVPKHYHRCYHTFYKSNTHK  132

Query  594  GMKLTAIRGDTGLRTYTAHNIHIN  665
            G+KL  +    G R YT+  I ++
Sbjct  133  GIKL--LSSKNGFRVYTSGTIRLH  154



>ref|XP_010939224.1| PREDICTED: uncharacterized protein LOC105058125 isoform X1 [Elaeis 
guineensis]
Length=188

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 76/141 (54%), Gaps = 15/141 (11%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrggrw  422
            AGYGEE+LS+VL+ G +LC  CL A                 +S A V V C      R 
Sbjct  42   AGYGEERLSSVLVTGAILCDACLQAGS---------HLLSSHVSDAKVAVACKTEGRRRK  92

Query  423  rrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKGMK  602
               W    TD+YGEF+IDLPSHLHAIP L+ +C V+VL +P++S C          K +K
Sbjct  93   A-YWVYGMTDDYGEFIIDLPSHLHAIP-LEEDCIVRVLRMPKNSYCQQISGMN--WKAIK  148

Query  603  LTAIRGDTGLRTYTAHNIHIN  665
            L+++     +R YTA  + ++
Sbjct  149  LSSV--GNSIRVYTAGVVRLS  167



>ref|XP_010495000.1| PREDICTED: uncharacterized protein LOC104772052 [Camelina sativa]
Length=163

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 80/156 (51%), Gaps = 18/156 (12%)
 Frame = +3

Query  198  AAMGNPVVDFSSIEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISG  377
             A GN       +E AGYGE+KLS+V+I G++LC        +  R   +  P      G
Sbjct  20   GAFGNIWTRTEMVEMAGYGEQKLSSVIITGSLLC------DTSRPRFHSIAIP------G  67

Query  378  ASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDST  557
            A+V + C      R +  W +  TD+ GEF IDLPS LHAIP+L+N C++K +H+P+   
Sbjct  68   ATVAIKCSTGSKKRSK--WIKAVTDDLGEFEIDLPSQLHAIPDLENTCFIKPVHVPKPYR  125

Query  558  CSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
            C    +   KR    +  +   +G R YT+  I + 
Sbjct  126  CYHTSTNIHKR----IKLVSSTSGFRVYTSGKIRLQ  157



>ref|XP_006281226.1| hypothetical protein CARUB_v10027269mg [Capsella rubella]
 gb|EOA14124.1| hypothetical protein CARUB_v10027269mg [Capsella rubella]
Length=162

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 82/166 (49%), Gaps = 22/166 (13%)
 Frame = +3

Query  174  LFLILDSPAAMGNPVVDFSSIEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQ  353
              +I     A GN       +E AGYGE+KLS+VLI G+++C               + +
Sbjct  11   FIIIFFFNGAFGNIWTRTEMVELAGYGEQKLSSVLITGSLICD--------------ISR  56

Query  354  PPPQPIS--GASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWV  527
            P    I+  GA+V + C      R R  W +  TD+ GEF IDLPS LHAIP+L+N C++
Sbjct  57   PRLHSIAIPGATVAIKCHTGSKKRSR--WIKAVTDDSGEFEIDLPSQLHAIPDLENTCFI  114

Query  528  KVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
            K LH+P+   C    +   KR    +  +    G R YT+  I + 
Sbjct  115  KPLHVPKPYRCYHTSTNIHKR----IKLVSSTNGFRVYTSGKIMLQ  156



>gb|KFK31357.1| hypothetical protein AALP_AA6G101900 [Arabis alpina]
Length=161

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 80/157 (51%), Gaps = 18/157 (11%)
 Frame = +3

Query  198  AAMGNPVVDFSSIEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISG  377
            AA G        +E AGYGE+KLS+V+I G++LC          + + RL       I G
Sbjct  17   AASGKIWSRTEMVEMAGYGEQKLSSVIITGSLLCD---------SSNPRLHSIA---IPG  64

Query  378  ASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDST  557
            A+V + C      R +  W +  TDE+GEF IDLPS LHAIPNL+N C +K +H+P+   
Sbjct  65   ATVAIKCNNGSKRRSK--WIKAVTDEFGEFEIDLPSQLHAIPNLENTCLIKPVHVPKLYR  122

Query  558  CSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIND  668
            C    +   KR    +  +    G R Y++  I +  
Sbjct  123  CYHTSTNIHKR----IKLVSSTNGFRVYSSGKIRLQQ  155



>ref|XP_009143252.1| PREDICTED: uncharacterized protein LOC103866982 [Brassica rapa]
Length=170

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 77/144 (53%), Gaps = 25/144 (17%)
 Frame = +3

Query  237  EEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrgg  416
            E  GYGE KLS+V+I G++LC+                     P+SGA+V + C      
Sbjct  37   EMNGYGEHKLSSVVITGSLLCN--------------------SPVSGATVAIKCHTGFKR  76

Query  417  rwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRD-STCSSHPSFTRKRK  593
            R    W +  TDE+GEF+I LPSHLHAIP+L+  C+VK +H+P+    C    S +   K
Sbjct  77   RSN--WIKAVTDEFGEFVIHLPSHLHAIPHLEKACFVKPVHVPKHYRRCYKTFSKSNIHK  134

Query  594  GMKLTAIRGDTGLRTYTAHNIHIN  665
            G+KL  +    G R YT+  I ++
Sbjct  135  GIKL--VSSSNGFRVYTSGTIRLH  156



>emb|CDX74807.1| BnaA05g05530D [Brassica napus]
Length=170

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 77/144 (53%), Gaps = 25/144 (17%)
 Frame = +3

Query  237  EEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrgg  416
            E  GYGE KLS+V+I G++LC+                     P+SGA+V + C      
Sbjct  37   EMNGYGEHKLSSVVITGSLLCN--------------------SPVSGATVAIKCHTGFKR  76

Query  417  rwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRD-STCSSHPSFTRKRK  593
            R    W +  TDE+GEF+I LPSHLHAIP+L+  C+VK +H+P+    C    S +   K
Sbjct  77   RSN--WIKAVTDEFGEFVIHLPSHLHAIPHLEKACFVKPVHVPKHYRRCYKTFSKSNIHK  134

Query  594  GMKLTAIRGDTGLRTYTAHNIHIN  665
            G+KL  +    G R YT+  I ++
Sbjct  135  GIKL--VSSSNGFRVYTSGTIRLH  156



>ref|XP_009101400.1| PREDICTED: uncharacterized protein LOC103827630 [Brassica rapa]
Length=166

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 77/146 (53%), Gaps = 21/146 (14%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQP--PPQPISGASVGVYCggr  407
            +E AGYGE+KLS+V+I G++LC             D    P  P   I GA+V + C   
Sbjct  34   VEMAGYGEQKLSSVIITGSLLC-------------DNTSCPHLPSIAIPGATVAIKCHTG  80

Query  408  rggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRK  587
               R +  W +  TD+ GEF IDLPS LHAIP+++N C VK +H+P+   C+   + T K
Sbjct  81   YKRRSK--WIKAVTDDLGEFEIDLPSQLHAIPDMENTCVVKPIHVPKLYRCNHRSTNTHK  138

Query  588  RKGMKLTAIRGDTGLRTYTAHNIHIN  665
            R    +  +    G R YT+  I + 
Sbjct  139  R----IKLVSSTNGFRVYTSGKIKLQ  160



>emb|CDY20519.1| BnaC04g05250D [Brassica napus]
Length=170

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 81/151 (54%), Gaps = 28/151 (19%)
 Frame = +3

Query  225  FSSIEEA---GYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVY  395
            +S IE A   GYGE KLS+V+I G++LC+                     P+SGA+V + 
Sbjct  30   WSRIEMAEMNGYGEHKLSSVVITGSLLCN--------------------SPVSGATVAIK  69

Query  396  CggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRD-STCSSHP  572
            C      R    W +  TD++GEF+I LPSHLHAIP+L+  C+VK +H+P+    C    
Sbjct  70   CHTGLKKRSN--WIKAVTDDFGEFIIHLPSHLHAIPHLEKACFVKPVHVPKHYRRCYKTF  127

Query  573  SFTRKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
            S +   KG+KL  +    G R YT+  I ++
Sbjct  128  SKSNIHKGIKL--VSSSNGFRVYTSGTIRLH  156



>ref|NP_568686.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|ABD60708.1| At5g47635 [Arabidopsis thaliana]
 gb|AED95544.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=164

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 81/147 (55%), Gaps = 24/147 (16%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLC---HPCLYAQKAAARHDRLRQPPPQPISGASVGVYCgg  404
            +E AGYGE+KLS+V+I G++LC    P L++                PI GA+V + C  
Sbjct  33   VEMAGYGEQKLSSVVITGSLLCDTSRPHLHSI---------------PIPGATVAIKCHT  77

Query  405  rrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTR  584
                R +  W +  TDE GEF IDLPS LHAIP+L+N C++K +++PR   C  + + T 
Sbjct  78   GSKRRSK--WIKAVTDELGEFEIDLPSQLHAIPHLENTCFIKPVYVPRPYRC--YNTSTN  133

Query  585  KRKGMKLTAIRGDTGLRTYTAHNIHIN  665
              K +KL  +    G R YT+  I + 
Sbjct  134  IHKPIKL--VSSTNGFRVYTSGKIRLQ  158



>ref|XP_010518741.1| PREDICTED: uncharacterized protein LOC104798379 [Tarenaya hassleriana]
Length=151

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 72/143 (50%), Gaps = 28/143 (20%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrggrw  422
            AGYGEEKLS+V++ G++L    L                  P+ GA VGV C      R 
Sbjct  32   AGYGEEKLSSVVVTGSLLSSGSL------------------PVPGAVVGVKCEAEGKRRT  73

Query  423  rrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKGMK  602
               W +  TDE+GEF I+LPS LHAIP+L N C VK +H+P    C     F   R    
Sbjct  74   G--WIKAVTDEHGEFEIELPSSLHAIPDLANACLVKPVHVPEPYKC-----FPSAR---G  123

Query  603  LTAIRGDTGLRTYTAHNIHINDK  671
            LT +    G R YTA +I I ++
Sbjct  124  LTLVSSSHGFRVYTAGSITIREE  146



>ref|XP_002879845.1| hypothetical protein ARALYDRAFT_483053 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56104.1| hypothetical protein ARALYDRAFT_483053 [Arabidopsis lyrata subsp. 
lyrata]
Length=171

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 79/144 (55%), Gaps = 25/144 (17%)
 Frame = +3

Query  237  EEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrgg  416
            + AGYGE KLS+V+I G++LC+                     PISGA+V + C      
Sbjct  36   DMAGYGEHKLSSVVITGSLLCNT--------------------PISGATVAIKCHTGFQK  75

Query  417  rwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRD-STCSSHPSFTRKRK  593
            R +  W +  T+++GEF+I LPSHLHAIP L+  C++K +H+P+    C    S +   K
Sbjct  76   RSK--WIKGVTNDFGEFVIHLPSHLHAIPQLEKACFIKPIHVPKHYHRCYHTFSKSNIHK  133

Query  594  GMKLTAIRGDTGLRTYTAHNIHIN  665
            G+KL + R   G R YT+  I ++
Sbjct  134  GIKLVSSR--NGFRVYTSGTIKLH  155



>emb|CDY61707.1| BnaC04g56700D [Brassica napus]
Length=166

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 75/141 (53%), Gaps = 25/141 (18%)
 Frame = +3

Query  237  EEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrgg  416
            E  GYGE KLS+V+I G++LC+                     P+SGA+V + C      
Sbjct  33   EMNGYGEHKLSSVVITGSLLCN--------------------TPVSGATVAIKCHTGFKK  72

Query  417  rwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRD-STCSSHPSFTRKRK  593
            R    W +  TD++GEF+I LPSHLHAIP+L+  C+VK +H+P+    C    S +   K
Sbjct  73   RSN--WIKAVTDDFGEFVIHLPSHLHAIPHLEKACFVKPIHVPKHYHRCYKALSKSNLHK  130

Query  594  GMKLTAIRGDTGLRTYTAHNI  656
            G+KL  +    G R YT+  I
Sbjct  131  GIKL--VSSKDGFRVYTSGTI  149



>ref|XP_006398462.1| hypothetical protein EUTSA_v10001056mg [Eutrema salsugineum]
 gb|ESQ39915.1| hypothetical protein EUTSA_v10001056mg [Eutrema salsugineum]
Length=167

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 79/148 (53%), Gaps = 25/148 (17%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLC----HPCLYAQKAAARHDRLRQPPPQPISGASVGVYCg  401
            +E AGYGE+KLS+V+I G++LC    HP L++                 I GA+V + C 
Sbjct  35   VEMAGYGEQKLSSVIITGSLLCDDTSHPHLHSI---------------AIPGATVAIKCH  79

Query  402  grrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFT  581
                 R +  W +  TD+ GEF IDLPS LHAIP+++N C++K +H+P+   C  + +  
Sbjct  80   TGYKKRSK--WIKAVTDDLGEFEIDLPSQLHAIPDMENKCFIKPVHVPKRYRCYHNSTNI  137

Query  582  RKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
             KR    +  +    G R YT+  I + 
Sbjct  138  HKR----IKLVSSTNGSRVYTSGKIRLQ  161



>ref|XP_009144665.1| PREDICTED: uncharacterized protein LOC103868310 [Brassica rapa]
Length=157

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 84/173 (49%), Gaps = 26/173 (15%)
 Frame = +3

Query  159  SLVLTLFLILDSPAAMGNPVVDFSSIEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARH  338
            SL L   L L   A           +E AGYGE+KLS+VL+  ++               
Sbjct  10   SLTLVFMLALGEAAGEIMRWNRKEMVEMAGYGEDKLSSVLVTASL---------------  54

Query  339  DRLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNN  518
                     PI GA+VG+ C      R +  W +  T+  G+F IDLPSHLHAIP+L+  
Sbjct  55   ---LSSSSSPIPGATVGIKCHTGYRKRSK--WIKAVTNALGQFTIDLPSHLHAIPDLEKA  109

Query  519  CWVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHINDKAC  677
            C +K L +P+   CS     T+ ++G+KL  +    GLR YTA NI ++   C
Sbjct  110  CSIKPLSVPKPYQCSP----TKTQRGIKL--VSSSNGLRVYTAGNITLHRGPC  156



>gb|AAM62822.1| unknown [Arabidopsis thaliana]
Length=164

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 81/147 (55%), Gaps = 24/147 (16%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLC---HPCLYAQKAAARHDRLRQPPPQPISGASVGVYCgg  404
            +E AGYG++KLS+V+I G++LC    P L++                PI GA+V + C  
Sbjct  33   VEMAGYGKQKLSSVVITGSLLCDTSRPHLHSI---------------PIPGATVAIKCHT  77

Query  405  rrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTR  584
                R +  W +  TDE GEF IDLPS LHAIP+L+N C++K +++PR   C  + + T 
Sbjct  78   GSKRRSK--WIKAVTDELGEFEIDLPSQLHAIPHLENTCFIKPVYVPRPYRC--YNTSTN  133

Query  585  KRKGMKLTAIRGDTGLRTYTAHNIHIN  665
              K +KL  +    G R YT+  I + 
Sbjct  134  IHKPIKL--VSSTNGFRVYTSGKIRLQ  158



>emb|CDY41060.1| BnaA09g18390D [Brassica napus]
Length=159

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 76/144 (53%), Gaps = 21/144 (15%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrg  413
            +E AGYGE+KLS+V+I G++LC                       I GA+V + C     
Sbjct  34   VEMAGYGEQKLSSVIITGSLLC----------------DTSHSISIPGATVAIKCHTGYK  77

Query  414  grwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRK  593
             R +  W +  TD+ GEF IDLPS LHAIP+L+N C +K +H+P +  C  H + T   K
Sbjct  78   RRSK--WIKAVTDDLGEFEIDLPSQLHAIPDLENTCVIKPIHVPHE-LCRCHHNSTNTHK  134

Query  594  GMKLTAIRGDTGLRTYTAHNIHIN  665
             +KL +    +G R YT+  I + 
Sbjct  135  RIKLAS--STSGFRVYTSGKIRLQ  156



>ref|XP_009114262.1| PREDICTED: uncharacterized protein LOC103839515 [Brassica rapa]
Length=159

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 76/144 (53%), Gaps = 21/144 (15%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrg  413
            +E AGYGE+KLS+V+I G++LC                       I GA+V + C     
Sbjct  34   VEMAGYGEQKLSSVIITGSLLCDT----------------SHSISIPGATVAIKCHTGCK  77

Query  414  grwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRK  593
             R +  W +  TD+ GEF IDLPS LHAIP+L+N C +K +H+P +  C  H + T   K
Sbjct  78   RRSK--WIKAVTDDLGEFEIDLPSQLHAIPDLENTCVIKPMHVPHE-LCRCHHNSTNTHK  134

Query  594  GMKLTAIRGDTGLRTYTAHNIHIN  665
             +KL  +   +G R Y++  I + 
Sbjct  135  RIKL--VSSTSGFRVYSSGKIRLQ  156



>ref|NP_850326.2| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAX55149.1| hypothetical protein At2g40113 [Arabidopsis thaliana]
 gb|AEC09782.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=169

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 79/144 (55%), Gaps = 25/144 (17%)
 Frame = +3

Query  237  EEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrgg  416
            + AGYGE KLS+V+I G++LC+                     P+SGA+V + C      
Sbjct  35   DMAGYGEHKLSSVVITGSLLCNT--------------------PVSGATVAIKCHTGLKQ  74

Query  417  rwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRD-STCSSHPSFTRKRK  593
            R +  W ++ T+++GEF+I LPSHLHAIP L+  C+VK +H+P+    C    S +   K
Sbjct  75   RSK--WIKSVTNDFGEFVIHLPSHLHAIPQLEKACFVKPIHVPKHYHRCYHTFSKSNIHK  132

Query  594  GMKLTAIRGDTGLRTYTAHNIHIN  665
             +KL + R   G R YT+  I ++
Sbjct  133  DIKLVSSR--NGFRVYTSGTIKLH  154



>ref|XP_009419523.1| PREDICTED: uncharacterized protein LOC103999488 [Musa acuminata 
subsp. malaccensis]
Length=177

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 80/146 (55%), Gaps = 14/146 (10%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrg  413
            +  AGYG+E+LSTVL+ GT+LC         +AR  R        + GA V V C     
Sbjct  43   VRVAGYGDERLSTVLVTGTLLC---------SARMHRSPGLFTSNVPGAKVAVACKTEGR  93

Query  414  grwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRK  593
                  WA   TD+YGEF++DLPSHLHA P L+ +C V+VL +P   +     S  R  K
Sbjct  94   RELS--WAYGLTDDYGEFIVDLPSHLHANPKLEEDCIVRVLRVPTKGSFCDLVSGVRS-K  150

Query  594  GMKLTAIRGDTGLRTYTAHNIHINDK  671
             + L+++ G++ +R YTA  + ++ +
Sbjct  151  HITLSSV-GES-IRVYTAGTLILSHR  174



>gb|ABD65108.1| hypothetical protein 31.t00008 [Brassica oleracea]
Length=157

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 89/173 (51%), Gaps = 30/173 (17%)
 Frame = +3

Query  168  LTLFLILDSPAAMGNPVVDFSS---IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARH  338
            LTL  +L    A G+ ++ +S    +E AGYGE+KLS+VL+  ++               
Sbjct  11   LTLVFMLALGEAAGD-IMRWSRKEMVEMAGYGEDKLSSVLVTASL---------------  54

Query  339  DRLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNN  518
                     PI GA+VG+ C      R +  W +  T+  G+F IDLPSHLHAI +L+  
Sbjct  55   ---LSSSSSPIPGATVGIKCHTGYRKRSK--WIKAVTNALGQFTIDLPSHLHAIHDLEKA  109

Query  519  CWVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHINDKAC  677
            C +K L +P+   CS     T+ ++G+KL  +    GLR YTA NI ++   C
Sbjct  110  CSIKPLSVPKPYQCSP----TKTQRGIKL--VSSSNGLRVYTAGNITLHRGPC  156



>dbj|BAJ99708.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=183

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 72/148 (49%), Gaps = 27/148 (18%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrggrw  422
            AGYGEE +STVL+ G V C  CL         D         + G+ V V C        
Sbjct  39   AGYGEEPVSTVLVSGQVACQLCLRPGSDLLTFD---------LPGSKVAVTCTTEGPNTM  89

Query  423  rrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTC-------SSHPSFT  581
                A  T +EYG F I+LPS LHA P+L+N C VKVL LP DS C       SSH    
Sbjct  90   AN-SAFATANEYGNFTIELPSRLHATPSLENACSVKVLELPPDSACRVTGGHGSSH----  144

Query  582  RKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
                G++L++   D G+RTYT   I + 
Sbjct  145  ----GLRLSS--SDGGVRTYTTGVIRLQ  166



>emb|CDY69950.1| BnaCnng66060D [Brassica napus]
Length=173

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 80/159 (50%), Gaps = 18/159 (11%)
 Frame = +3

Query  198  AAMGNPVVDFSSIEEAGYGEEKLSTVLIDGTVLC---HPCLYAQKAAARHDRLRQPPPQP  368
            AA G        +E AGYGE+KLS+V+I G++LC    P L +         +  P    
Sbjct  24   AAAGKIWSRTEMVEMAGYGEQKLSSVIIAGSLLCDTWRPHLPS---------IAIPGTYL  74

Query  369  ISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPR  548
               A+V + C      R +  W +  TD+ GEF IDLPS LHAIP+++N C VK +H+P+
Sbjct  75   FMSATVAIKCHTGYKRRSK--WIKAVTDDLGEFEIDLPSQLHAIPDMENTCVVKPVHVPK  132

Query  549  DSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
               C+   + T KR    +  +    G R YT+  I + 
Sbjct  133  LYRCNHRSTNTHKR----IKLVSSTNGFRVYTSGKIKLQ  167



>ref|XP_010449652.1| PREDICTED: uncharacterized protein LOC104731856 [Camelina sativa]
Length=146

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 85/165 (52%), Gaps = 27/165 (16%)
 Frame = +3

Query  162  LVLTLFLILDSPAAMGNPVVDFSSIEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHD  341
            + +TL L++ S  A          +E AGYGE+KLS+VL+  T+L               
Sbjct  6    MSMTLVLVVASGEAARERWTRNEMVEMAGYGEQKLSSVLLTATLL---------------  50

Query  342  RLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNC  521
                    PI GA+VG+ C  R     +  W +  T+E G+F+IDLPSHLHAIP+L   C
Sbjct  51   ---SSSSSPIHGATVGIKCHTRYRKGSK--WIKGVTNESGKFVIDLPSHLHAIPDLDKAC  105

Query  522  WVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNI  656
             +K L +P+   CSS     +  +G++L  +   +G R YTA NI
Sbjct  106  IIKTLSVPKPYRCSS-----KIHRGIQL--LSSSSGSRVYTAGNI  143



>emb|CDY07055.1| BnaA04g22600D [Brassica napus]
Length=167

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 76/144 (53%), Gaps = 25/144 (17%)
 Frame = +3

Query  237  EEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrgg  416
            E  GYGE KLS+V+I G++LC+                     P+S A+V + C      
Sbjct  34   EMNGYGEHKLSSVVITGSLLCNT--------------------PVSDATVAIKCHTGFKK  73

Query  417  rwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRD-STCSSHPSFTRKRK  593
            R    W +  T+++GEF+I LPSHLHAIP+L+  C+VK +H+P+    C    S +   K
Sbjct  74   RSN--WIKAVTNDFGEFVIHLPSHLHAIPHLEKACFVKPIHVPKHYHRCYKALSKSNLHK  131

Query  594  GMKLTAIRGDTGLRTYTAHNIHIN  665
            G+KL  +    G R YT+  I ++
Sbjct  132  GIKL--VSSKDGFRVYTSGTIRLH  153



>emb|CDY25956.1| BnaC09g20310D [Brassica napus]
Length=165

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 18/144 (13%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrg  413
            +E AGYGE+KLS+V+I G+++C+       + A            I GA+V + C     
Sbjct  34   LEMAGYGEQKLSSVIITGSLICNTSPSHLHSIA------------IPGATVAIKCHTGYK  81

Query  414  grwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRK  593
             R +  W +  TD+ GEF IDLPS LHAIP+L+N C +K +H+P    C  + + T KR 
Sbjct  82   RRSK--WIKAVTDDLGEFEIDLPSQLHAIPDLENTCVIKPIHVPELYRCHHNSTNTHKR-  138

Query  594  GMKLTAIRGDTGLRTYTAHNIHIN  665
               +  +      R YT+  I + 
Sbjct  139  ---IKLVSSTNSFRVYTSGKIRLQ  159



>ref|XP_002466758.1| hypothetical protein SORBIDRAFT_01g013620 [Sorghum bicolor]
 gb|EER93756.1| hypothetical protein SORBIDRAFT_01g013620 [Sorghum bicolor]
Length=224

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 72/143 (50%), Gaps = 14/143 (10%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrg-gr  419
            AGYGEE +S+V + G + C  CL         D         + GA V V C   R    
Sbjct  77   AGYGEEPVSSVSVSGQLTCELCLRPGSQLLALD---------MPGAKVAVTCKSDRTPSN  127

Query  420  wrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKGM  599
                +A  TTDEYG F IDLP  LHA P+L+  C VKVL LP DS    H   T    G+
Sbjct  128  QLDSFAFATTDEYGNFTIDLPPQLHATPDLEKACTVKVLQLPADSCRLRH--RTGDTYGL  185

Query  600  KLTAIRGDTGLRTYTAHNIHIND  668
            +L+++  + G+R YTA  I + D
Sbjct  186  RLSSV--EDGVRAYTAGVIRLQD  206



>ref|XP_010434705.1| PREDICTED: uncharacterized protein LOC104718625 [Camelina sativa]
Length=146

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 81/168 (48%), Gaps = 27/168 (16%)
 Frame = +3

Query  162  LVLTLFLILDSPAAMGNPVVDFSSIEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHD  341
            + +TL L++ S  A          +E AGYGE+KLS+V                      
Sbjct  6    MSMTLVLVVASGEAARERWTRNEMVEMAGYGEQKLSSV------------------LLTA  47

Query  342  RLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNC  521
             L      PI GA+VG+ C  R     +  W +  TD  G+F+IDLPSHLHAIP+L   C
Sbjct  48   TLLSSSSSPIHGATVGIKCHTRYRKGSK--WIKGVTDVSGKFVIDLPSHLHAIPDLDKAC  105

Query  522  WVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
             +K L +P+   CSS     +  +G++L  +   +G R YTA NI + 
Sbjct  106  IIKSLSVPKPYRCSS-----KIHRGIQL--LSSSSGSRVYTAGNITLQ  146



>ref|XP_009141866.1| PREDICTED: uncharacterized protein LOC103865767 isoform X2 [Brassica 
rapa]
Length=136

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 25/144 (17%)
 Frame = +3

Query  237  EEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrgg  416
            E  GY E KLS+V+I G++LC+                     P+S A+V + C      
Sbjct  3    EMNGYEEHKLSSVVITGSLLCN--------------------TPVSDATVAIKCHTGFKK  42

Query  417  rwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRD-STCSSHPSFTRKRK  593
            R    W +  T+++GEF+I LPSHLHAIP+L+  C+VK +H+P+    C    S +   K
Sbjct  43   RSN--WIKAVTNDFGEFVIHLPSHLHAIPHLEKACFVKPIHVPKHYHRCYKALSKSNLHK  100

Query  594  GMKLTAIRGDTGLRTYTAHNIHIN  665
            G+KL  +    G R YT+  I ++
Sbjct  101  GIKL--VSSKDGFRVYTSGTIRLH  122



>ref|XP_009141865.1| PREDICTED: uncharacterized protein LOC103865767 isoform X1 [Brassica 
rapa]
Length=167

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 75/144 (52%), Gaps = 25/144 (17%)
 Frame = +3

Query  237  EEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrgg  416
            E  GY E KLS+V+I G++LC+                     P+S A+V + C      
Sbjct  34   EMNGYEEHKLSSVVITGSLLCNT--------------------PVSDATVAIKCHTGFKK  73

Query  417  rwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRD-STCSSHPSFTRKRK  593
            R    W +  T+++GEF+I LPSHLHAIP+L+  C+VK +H+P+    C    S +   K
Sbjct  74   RSN--WIKAVTNDFGEFVIHLPSHLHAIPHLEKACFVKPIHVPKHYHRCYKALSKSNLHK  131

Query  594  GMKLTAIRGDTGLRTYTAHNIHIN  665
            G+KL  +    G R YT+  I ++
Sbjct  132  GIKL--VSSKDGFRVYTSGTIRLH  153



>ref|XP_007212536.1| hypothetical protein PRUPE_ppa019383mg, partial [Prunus persica]
 gb|EMJ13735.1| hypothetical protein PRUPE_ppa019383mg, partial [Prunus persica]
Length=163

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 55/97 (57%), Gaps = 2/97 (2%)
 Frame = +3

Query  234  IEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARH-DRLRQPPPQPISGASVGVYCggrr  410
            ++ AGYGEEKLSTVLI G+V C        A   H D        P+SGA V V C    
Sbjct  67   VQIAGYGEEKLSTVLITGSVHCEEACNNLHAQTHHPDYQLHLHAWPLSGALVSVNCHVSG  126

Query  411  ggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNC  521
              R   L A+   DE+G+F+IDLPS+LHAIPNL   C
Sbjct  127  RKRKSSL-AQGLADEFGDFIIDLPSNLHAIPNLHKTC  162



>gb|AAM67093.1| unknown [Arabidopsis thaliana]
Length=150

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 80/169 (47%), Gaps = 27/169 (16%)
 Frame = +3

Query  162  LVLTLFLILDSPAAMGNPVVDFSSIEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHD  341
            + +TL LI+    A+ +       +E AGYGE+K                    +     
Sbjct  6    MSMTLVLIVTFGEALSDRWSRDEMVEMAGYGEQK------------------LSSVLLTA  47

Query  342  RLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNC  521
             L      PI GA+VG+ C      R +  W +  T+E G+F+IDLPSHLHAIP+L   C
Sbjct  48   SLLSSSSSPIHGATVGINCHSGHRRRSK--WIKAVTNELGQFVIDLPSHLHAIPDLDKAC  105

Query  522  WVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIND  668
             +K L +P+   CSS     +  +G++L  +    G R YTA NI + +
Sbjct  106  IIKTLSVPKPYRCSS-----KIHRGIQL--LSSSNGSRVYTAGNITLQE  147



>gb|ABD65131.1| hypothetical protein 40.t00006 [Brassica oleracea]
Length=148

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/165 (36%), Positives = 85/165 (52%), Gaps = 29/165 (18%)
 Frame = +3

Query  168  LTLFLILDSPAAMGNPV--VDFSSIEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHD  341
            LTL  ++    A+G+ +       +E AGYGE KLS+V+          L A   ++  D
Sbjct  8    LTLVFMVALGEAVGDRMRWTRKEMVEIAGYGELKLSSVI----------LTASLLSSSSD  57

Query  342  RLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNC  521
                    PISGA+VG+ C      R + + A   T+++G+F IDLPS LHAIP+L   C
Sbjct  58   --------PISGATVGIMCHTGHRRRSKVIKA--VTNDFGQFTIDLPSDLHAIPDLDKAC  107

Query  522  WVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNI  656
             +K L +P+   CS      +  +G+KL  +    GLR YTA NI
Sbjct  108  SIKPLSVPKPYRCSH-----KIHRGIKL--VSSSNGLRFYTAGNI  145



>ref|XP_009136830.1| PREDICTED: uncharacterized protein LOC103860901 [Brassica rapa]
Length=148

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 57/165 (35%), Positives = 84/165 (51%), Gaps = 29/165 (18%)
 Frame = +3

Query  168  LTLFLILDSPAAMGNPV--VDFSSIEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHD  341
            LTL  ++    A+G+ +       +E AGYGE KLS+V++  ++L               
Sbjct  8    LTLVFMVALGEAVGDRMRWTRKEMVEIAGYGELKLSSVILTASLL---------------  52

Query  342  RLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNC  521
                    PISGA+VG+ C      R + + A   T+++G+F IDLPS LHAIP+L   C
Sbjct  53   ---SSSSHPISGATVGIMCHTGHRRRSKVIKA--VTNDFGQFTIDLPSDLHAIPDLDKAC  107

Query  522  WVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNI  656
             +K L +P+   CS      +  +G+KL  +    GLR YTA NI
Sbjct  108  SIKPLSVPKPYRCSH-----KIHRGIKL--VSSSNGLRFYTAGNI  145



>gb|EEC66705.1| hypothetical protein OsI_33026 [Oryza sativa Indica Group]
Length=197

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 72/143 (50%), Gaps = 16/143 (11%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrggrw  422
            AGYGEE +STV++ G V+C   L    +    D L    P    GA+VGV C        
Sbjct  53   AGYGEELVSTVIVSGKVVCELSLRPPGS----DLLSIELP----GATVGVACETGGIKTM  104

Query  423  rrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTC--SSHPSFTRKRKG  596
                    TDE G F I+LPS LHA PNL+  C VKVL LP D  C     PS+     G
Sbjct  105  AN-SVFTVTDENGNFTIELPSRLHATPNLEKACSVKVLQLPLDCACWPRRSPSYYH---G  160

Query  597  MKLTAIRGDTGLRTYTAHNIHIN  665
            ++L++   + G+R+YT   I + 
Sbjct  161  IQLSS--SEDGIRSYTTGVIRLQ  181



>ref|XP_004956162.1| PREDICTED: uncharacterized protein LOC101776137 [Setaria italica]
Length=194

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 69/145 (48%), Gaps = 16/145 (11%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrggrw  422
            AGYGEE +S+V + G V C  CL         +         + GA V V C        
Sbjct  47   AGYGEEPVSSVSVSGQVACELCLRPGSDLLAFE---------LPGAKVAVLCETECPNDQ  97

Query  423  rrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTC--SSHPSFTRKRKG  596
                A  TTDE+G F IDLPS LHA  NL+  C VKVL LP DS+C     PS T    G
Sbjct  98   AANSALATTDEFGNFTIDLPSQLHATANLERACTVKVLQLPADSSCRLRHQPSTT---YG  154

Query  597  MKLTAIRGDTGLRTYTAHNIHINDK  671
            + L +   + G+R YT   I + + 
Sbjct  155  LMLAS--QEDGVRAYTTGVIRLQNN  177



>ref|NP_001064319.1| Os10g0208600 [Oryza sativa Japonica Group]
 gb|ABG65993.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF26233.1| Os10g0208600 [Oryza sativa Japonica Group]
 dbj|BAG91000.1| unnamed protein product [Oryza sativa Japonica Group]
Length=197

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 72/143 (50%), Gaps = 16/143 (11%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrggrw  422
            AGYGEE +STV++ G V+C   L    +    D L    P    GA+VGV C        
Sbjct  53   AGYGEELVSTVIVSGKVVCKLSLRPPGS----DLLSIELP----GATVGVACETGGIKTM  104

Query  423  rrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTC--SSHPSFTRKRKG  596
                    TDE G F I+LPS LHA PNL+  C VKVL LP D  C     PS+     G
Sbjct  105  AN-SVFTVTDENGNFTIELPSRLHATPNLEKACSVKVLQLPLDCACWPRRSPSYYH---G  160

Query  597  MKLTAIRGDTGLRTYTAHNIHIN  665
            ++L++   + G+R+YT   I + 
Sbjct  161  IQLSS--SEDGIRSYTTGVIRLQ  181



>ref|XP_003571441.1| PREDICTED: uncharacterized protein LOC100842350 [Brachypodium 
distachyon]
Length=198

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 72/141 (51%), Gaps = 15/141 (11%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrggrw  422
            AGYGEE +STVL+ G +LC  CL         D L    P    G+ V V C        
Sbjct  48   AGYGEEPVSTVLVSGQILCVLCLRPGS-----DLLTFQLP----GSKVAVTCKSEGPNTS  98

Query  423  rrLW--ARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTC-SSHPSFTRKRK  593
                  A  TTDE G F I+LPS LHA PNL++ C V VL LP DS C + H   +  R 
Sbjct  99   TMAANSAFATTDESGNFTIELPSRLHATPNLEDACSVTVLTLPPDSACHAGHSPGSPYR-  157

Query  594  GMKLTAIRGDTGLRTYTAHNI  656
             ++ ++   D G+RTYT  +I
Sbjct  158  -LQPSSSEED-GVRTYTTGSI  176



>ref|NP_001064313.1| Os10g0206500 [Oryza sativa Japonica Group]
 gb|ABG65991.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF26227.1| Os10g0206500 [Oryza sativa Japonica Group]
 gb|EEE50721.1| hypothetical protein OsJ_31019 [Oryza sativa Japonica Group]
Length=188

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 65/143 (45%), Gaps = 13/143 (9%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrggrw  422
            AGYGEE +STV++ G V C  CL         +         + GA V V C        
Sbjct  39   AGYGEEPVSTVVVSGQVACELCLCPGSDLLTFE---------LPGAKVEVACETEGPNTQ  89

Query  423  rrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCS--SHPSFTRKRKG  596
                    TDE+G F   LPS LHA P+L+N C VKVL LP DS C     P+ + + + 
Sbjct  90   AN-SVFTATDEFGNFTFHLPSRLHATPSLENACVVKVLQLPPDSACGLRHRPAASYRIRP  148

Query  597  MKLTAIRGDTGLRTYTAHNIHIN  665
                +   D G R YTA  I + 
Sbjct  149  SSSLSSSAD-GFRAYTAGVIRLQ  170



>ref|NP_567524.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
 gb|AAL85007.1| unknown protein [Arabidopsis thaliana]
 gb|AAM45078.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83863.1| pollen Ole e 1 allergen and extensin family protein [Arabidopsis 
thaliana]
Length=150

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 78/169 (46%), Gaps = 27/169 (16%)
 Frame = +3

Query  162  LVLTLFLILDSPAAMGNPVVDFSSIEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHD  341
            + +TL LI+    A  +       +E AGYGE+K                    +     
Sbjct  6    MSMTLVLIVTFGEAFSDRWSRDEMVEMAGYGEQK------------------LSSVLLTA  47

Query  342  RLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNC  521
             L      PI GA++G  C      R +  W +  T+E G+F+IDLPSHLHAIP+L   C
Sbjct  48   SLLSSSSSPIHGATIGFKCHTGHRRRSK--WIKAVTNELGQFVIDLPSHLHAIPDLDKAC  105

Query  522  WVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIND  668
             +K L +P+   CSS     +  +G++L  +    G R YTA NI + +
Sbjct  106  IIKTLSVPKPYRCSS-----KIHRGIQL--LSSSNGSRVYTAGNITLQE  147



>gb|EEC66696.1| hypothetical protein OsI_33016 [Oryza sativa Indica Group]
Length=188

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/143 (36%), Positives = 65/143 (45%), Gaps = 13/143 (9%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrggrw  422
            AGYGEE +STV++ G V C  CL         +         + GA V V C        
Sbjct  39   AGYGEEPVSTVVVSGQVACELCLCPGSDLLTFE---------LPGAKVEVACETEGPNTQ  89

Query  423  rrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCS--SHPSFTRKRKG  596
                    TDE+G F   LPS LHA P+L+N C VKVL LP DS C     P+ + + + 
Sbjct  90   AN-SVFTATDEFGNFTFHLPSRLHATPSLENACVVKVLQLPPDSACGLRHRPAASYRIRP  148

Query  597  MKLTAIRGDTGLRTYTAHNIHIN  665
                +   D G R YTA  I + 
Sbjct  149  SPSLSSSAD-GFRAYTAGVIRLQ  170



>ref|XP_002870116.1| hypothetical protein ARALYDRAFT_493155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46375.1| hypothetical protein ARALYDRAFT_493155 [Arabidopsis lyrata subsp. 
lyrata]
Length=150

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 79/169 (47%), Gaps = 27/169 (16%)
 Frame = +3

Query  162  LVLTLFLILDSPAAMGNPVVDFSSIEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHD  341
            + +TL L++    A+ +       +E AGYGE+K                    +     
Sbjct  6    MSMTLVLMMTFGEAVRDRWSRDEMVEMAGYGEQK------------------LSSVLLTA  47

Query  342  RLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNC  521
             L      PI GA++G+ C        +  W +  T+E G+F+IDLPSHLHAIP+L   C
Sbjct  48   SLLSSSSSPIHGATIGIKCHIGYRRISK--WIKAVTNELGQFVIDLPSHLHAIPDLDKAC  105

Query  522  WVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIND  668
             +K L +P+   CSS     +  +G++L  +    G R YTA NI + +
Sbjct  106  IIKPLSVPKPYRCSS-----KIHRGIQL--LSSSNGSRVYTAGNITLQE  147



>ref|XP_006414259.1| hypothetical protein EUTSA_v10026465mg [Eutrema salsugineum]
 gb|ESQ55712.1| hypothetical protein EUTSA_v10026465mg [Eutrema salsugineum]
Length=155

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 58/104 (56%), Gaps = 9/104 (9%)
 Frame = +3

Query  366  PISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLP  545
            PI GA++G+ C      R    W +  T++ G+F+IDLPSHLHAIP+L   C +K L +P
Sbjct  60   PIPGATIGIKCHTGIRKRSN--WIKAVTNDLGQFVIDLPSHLHAIPDLDKACLIKPLSVP  117

Query  546  RDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHINDKAC  677
            +   CS  P+  R   G+KL +     G R YT  NI ++   C
Sbjct  118  KQFRCS--PNIHR---GIKLVS--SSNGFRVYTGGNITLHRAPC  154



>ref|NP_001131971.2| uncharacterized protein LOC100193369 [Zea mays]
 gb|ACF80619.2| unknown [Zea mays]
Length=171

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 65/155 (42%), Gaps = 31/155 (20%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPI-----SGASVGVYCggr  407
            AGYGEE +S+V + G + C  CL               P  P+     +GA V V C   
Sbjct  14   AGYGEEPVSSVSVSGQLTCELCLR--------------PGSPLLALEMAGAKVAVTCDCE  59

Query  408  rg------grwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSH  569
                              TTDE G F IDLP+ LHA P+L+  C VKVL LP      S 
Sbjct  60   SQHPIPSDEPDSLALVAATTDESGNFTIDLPARLHATPDLEKACAVKVLRLP----AGSG  115

Query  570  PSFTRKRKG--MKLTAIRGDTGLRTYTAHNIHIND  668
                R R G   +L     + G R YTA  I + D
Sbjct  116  SCRLRHRAGDAYRLRLASAEDGARAYTAGVIRLRD  150



>ref|XP_006284709.1| hypothetical protein CARUB_v10005967mg [Capsella rubella]
 gb|EOA17607.1| hypothetical protein CARUB_v10005967mg [Capsella rubella]
Length=147

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 58/100 (58%), Gaps = 9/100 (9%)
 Frame = +3

Query  366  PISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLP  545
            PI GA+VG+ C      R +  W +  T++ G+F+IDLPSHLHAIP+L   C +K L +P
Sbjct  57   PIPGATVGIKCRSGHKKRSK--WIKGVTNDLGQFVIDLPSHLHAIPDLNKACIIKPLSVP  114

Query  546  RDSTCSSHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
            +   CSS     +  +G++L  +    G R YTA +I + 
Sbjct  115  KPYQCSS-----KIHRGIQL--LSSSNGSRVYTAGDITLQ  147



>tpg|DAA50324.1| TPA: hypothetical protein ZEAMMB73_534968 [Zea mays]
Length=232

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 65/155 (42%), Gaps = 31/155 (20%)
 Frame = +3

Query  243  AGYGEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPI-----SGASVGVYCggr  407
            AGYGEE +S+V + G + C  CL               P  P+     +GA V V C   
Sbjct  75   AGYGEEPVSSVSVSGQLTCELCLR--------------PGSPLLALEMAGAKVAVTCDCE  120

Query  408  rg------grwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSH  569
                              TTDE G F IDLP+ LHA P+L+  C VKVL LP      S 
Sbjct  121  SQHPIPSDEPDSLALVAATTDESGNFTIDLPARLHATPDLEKACAVKVLRLP----AGSG  176

Query  570  PSFTRKRKG--MKLTAIRGDTGLRTYTAHNIHIND  668
                R R G   +L     + G R YTA  I + D
Sbjct  177  SCRLRHRAGDAYRLRLASAEDGARAYTAGVIRLRD  211



>ref|XP_006665084.1| PREDICTED: uncharacterized protein LOC102720850 [Oryza brachyantha]
Length=240

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 52/108 (48%), Gaps = 11/108 (10%)
 Frame = +3

Query  243  AGYGEEK-LSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrggr  419
            AGYGEE  +STV++ G V C  C+         +         + GA + V C      R
Sbjct  108  AGYGEEPPVSTVVVSGQVACEFCVRPGSDLLTFE---------LPGAKIAVACQTEGPIR  158

Query  420  wrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCS  563
                 A   TDE G F I LPS LHA P L+N C V+VL LP DS C 
Sbjct  159  RAN-SAFGATDELGNFTIHLPSRLHATPRLENACVVRVLRLPPDSACG  205



>gb|EMT25847.1| hypothetical protein F775_16133 [Aegilops tauschii]
Length=97

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 3/73 (4%)
 Frame = +3

Query  444  TTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKGMKLTAIRGD  623
            TT+EYG F I+LPS LHAIP+L+N C VKVL LP DS C           G++L++   D
Sbjct  8    TTNEYGNFSIELPSRLHAIPSLENACSVKVLELPPDSACRVG-GGHGSSHGLRLSS--SD  64

Query  624  TGLRTYTAHNIHI  662
              +RTYT   I +
Sbjct  65   GSVRTYTTGVIRL  77



>gb|AAL82668.2|AC092387_16 expressed protein [Oryza sativa Japonica Group]
Length=121

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 47/101 (47%), Gaps = 4/101 (4%)
 Frame = +3

Query  369  ISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPR  548
            I GA V V C                TDE+G F   LPS LHA P+L+N C VKVL LP 
Sbjct  5    IYGAKVEVACETEGPNTQAN-SVFTATDEFGNFTFHLPSRLHATPSLENACVVKVLQLPP  63

Query  549  DSTCS--SHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
            DS C     P+ + + +     +   D G R YTA  I + 
Sbjct  64   DSACGLRHRPAASYRIRPSSSLSSSAD-GFRAYTAGVIRLQ  103



>gb|AAM18143.1|AC092172_3 Hypothetical protein [Oryza sativa Japonica Group]
Length=119

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 47/101 (47%), Gaps = 4/101 (4%)
 Frame = +3

Query  369  ISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPR  548
            I GA V V C                TDE+G F   LPS LHA P+L+N C VKVL LP 
Sbjct  5    IYGAKVEVACETEGPNTQAN-SVFTATDEFGNFTFHLPSRLHATPSLENACVVKVLQLPP  63

Query  549  DSTCS--SHPSFTRKRKGMKLTAIRGDTGLRTYTAHNIHIN  665
            DS C     P+ + + +     +   D G R YTA  I + 
Sbjct  64   DSACGLRHRPAASYRIRPSSSLSSSAD-GFRAYTAGVIRLQ  103



>gb|AAM18169.1|AC092172_29 Unknown protein [Oryza sativa Japonica Group]
 gb|EAZ15621.1| hypothetical protein OsJ_31029 [Oryza sativa Japonica Group]
Length=94

 Score = 56.2 bits (134),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 7/68 (10%)
 Frame = +3

Query  447  TDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTC--SSHPSFTRKRKGMKLTAIRG  620
            TDE G F I+LPS LHA PNL+  C VKVL LP D  C     PS+     G++L++   
Sbjct  9    TDENGNFTIELPSRLHATPNLEKACSVKVLQLPLDCACWPRRSPSYYH---GIQLSS--S  63

Query  621  DTGLRTYT  644
            + G+R+YT
Sbjct  64   EDGIRSYT  71



>ref|XP_008387510.1| PREDICTED: proline-rich protein 3-like [Malus domestica]
Length=177

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 68/153 (44%), Gaps = 22/153 (14%)
 Frame = +3

Query  156  VSLVLTLFLILDSPAAMGNPVVDFSSIEEAGYGEEKLSTVLIDGTVLCHPCLYAQKAAAR  335
            V L+  + LI     AMG   +   + E + Y E K+ T+ + G VLC  C         
Sbjct  5    VVLIFAVVLI-----AMGCSSI--HTAEASNYEEPKIKTIHVGGKVLCQDCTQGWNEWVH  57

Query  336  HDRLRQPPPQPISGASVGVYCggrrggrwrrLWARNTTDEYGEFLIDLPSHLHAIPNLQ-  512
              R       PI G  V V C   R       +  + TDE G+F  DL  + + I + + 
Sbjct  58   GAR-------PIXGGKVSVTCMDDRSRVA--FYGSDLTDEKGQF--DLIVNKYTINDKEV  106

Query  513  --NNCWVKVLHLPRDSTCSSHPSFTRKRKGMKL  605
              + C V+++  P D+TC+   +F R R GMKL
Sbjct  107  KASRCSVRLVSCP-DATCNVPTNFGRGRSGMKL  138



>gb|ACN41080.1| unknown [Picea sitchensis]
Length=310

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 60/132 (45%), Gaps = 16/132 (12%)
 Frame = +3

Query  252  GEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrggrwrrL  431
            G+EK S+V++ G V C  CL  + +   +          ISGAS+ V CG  R      +
Sbjct  31   GQEKDSSVVVVGKVFCDTCLEHRLSENSYF---------ISGASIAVECGLNRKTMTLSI  81

Query  432  WARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKGMKLTA  611
                 TDE GEF ++LPS++    +  N CWV     PR+S   S           KLT 
Sbjct  82   IGE--TDENGEFRVELPSNILQSADQLNKCWVS----PRNSPLRSC-KIPSTSAPSKLTL  134

Query  612  IRGDTGLRTYTA  647
                 G+ TY+A
Sbjct  135  QSVSNGVVTYSA  146



>gb|ABK26139.1| unknown [Picea sitchensis]
Length=310

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 60/132 (45%), Gaps = 16/132 (12%)
 Frame = +3

Query  252  GEEKLSTVLIDGTVLCHPCLYAQKAAARHDRLRQPPPQPISGASVGVYCggrrggrwrrL  431
            G+EK S+V++ G V C  CL  + +   +          ISGAS+ V CG  R      +
Sbjct  31   GQEKDSSVVVVGKVFCDTCLEHRLSENSYF---------ISGASIAVECGLNRKTMTLSI  81

Query  432  WARNTTDEYGEFLIDLPSHLHAIPNLQNNCWVKVLHLPRDSTCSSHPSFTRKRKGMKLTA  611
                 TDE GEF ++LPS++    +  N CWV     PR+S   S           KLT 
Sbjct  82   IGE--TDENGEFRVELPSNILQSADQLNKCWVS----PRNSPLRSC-KIPSTSAPSKLTL  134

Query  612  IRGDTGLRTYTA  647
                 G+ TY+A
Sbjct  135  QSVSNGVVTYSA  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2193756387154