BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16725_g1_i2 len=1655 path=[1633:0-552 2186:553-652 @2286@!:653-1154
2788:1155-1654]

Length=1655
                                                                      Score     E

ref|XP_009802383.1|  PREDICTED: uncharacterized protein LOC104247928    317   6e-101   
ref|XP_009620527.1|  PREDICTED: uncharacterized protein LOC104112346    315   2e-100   
ref|XP_011086305.1|  PREDICTED: uncharacterized protein LOC105168078    309   4e-98    
ref|XP_006373548.1|  hypothetical protein POPTR_0016s00290g             309   7e-98    
ref|XP_002264671.3|  PREDICTED: uncharacterized protein LOC100247110    307   4e-97    Vitis vinifera
ref|XP_006350226.1|  PREDICTED: uncharacterized protein LOC102589126    305   2e-96    
ref|XP_004236635.1|  PREDICTED: uncharacterized protein LOC101251174    305   3e-96    
ref|XP_011040082.1|  PREDICTED: uncharacterized protein LOC105136...    305   4e-96    
ref|XP_008224669.1|  PREDICTED: uncharacterized protein LOC103324393    303   2e-95    
ref|XP_010052520.1|  PREDICTED: uncharacterized protein LOC104441...    301   4e-95    
gb|KDP29022.1|  hypothetical protein JCGZ_16411                         298   1e-93    
ref|XP_010250907.1|  PREDICTED: uncharacterized protein LOC104593...    298   2e-93    
gb|EYU33816.1|  hypothetical protein MIMGU_mgv1a013095mg                296   3e-93    
ref|XP_011005785.1|  PREDICTED: uncharacterized protein LOC105111...    297   6e-92    
ref|XP_011005786.1|  PREDICTED: uncharacterized protein LOC105111...    296   7e-92    
ref|NP_001238160.1|  uncharacterized protein LOC100305626               292   1e-91    
ref|XP_007147554.1|  hypothetical protein PHAVU_006G134500g             291   2e-91    
ref|XP_006467252.1|  PREDICTED: uncharacterized protein LOC102630...    291   4e-91    
ref|XP_004293433.1|  PREDICTED: uncharacterized protein LOC101310200    291   7e-91    
gb|EPS67529.1|  hypothetical protein M569_07243                         288   7e-91    
ref|XP_006449957.1|  hypothetical protein CICLE_v10016151mg             292   1e-90    
ref|XP_003535014.1|  PREDICTED: uncharacterized protein LOC100789290    289   2e-90    
ref|XP_009374810.1|  PREDICTED: uncharacterized protein LOC103963698    287   2e-89    
emb|CDP04563.1|  unnamed protein product                                286   3e-89    
ref|XP_004486399.1|  PREDICTED: uncharacterized protein LOC101505...    285   1e-88    
gb|KHG13569.1|  Uncharacterized protein F383_16990                      281   2e-87    
ref|XP_007026442.1|  Phosphoglycerate mutase family protein             286   2e-87    
ref|XP_004134818.1|  PREDICTED: uncharacterized protein LOC101211960    281   4e-87    
ref|XP_003594381.1|  hypothetical protein MTR_2g028000                  280   6e-87    
gb|KHN40754.1|  hypothetical protein glysoja_015121                     281   6e-87    
ref|XP_010695924.1|  PREDICTED: uncharacterized protein LOC104908...    280   1e-86    
emb|CBI35724.3|  unnamed protein product                                278   6e-86    
ref|XP_006857591.1|  hypothetical protein AMTR_s00061p00089940          278   7e-86    
ref|XP_002525240.1|  conserved hypothetical protein                     278   8e-86    Ricinus communis
ref|XP_008440939.1|  PREDICTED: uncharacterized protein LOC103485205    277   8e-86    
ref|XP_010539948.1|  PREDICTED: uncharacterized protein LOC104813862    269   9e-83    
ref|XP_010515666.1|  PREDICTED: uncharacterized protein LOC104791467    269   9e-83    
ref|XP_007212002.1|  hypothetical protein PRUPE_ppa011110mg             267   4e-82    
ref|XP_010426820.1|  PREDICTED: uncharacterized protein LOC104711768    267   5e-82    
ref|XP_010503942.1|  PREDICTED: uncharacterized protein LOC104781058    266   6e-82    
ref|XP_006292491.1|  hypothetical protein CARUB_v10018721mg             265   2e-81    
ref|XP_006467250.1|  PREDICTED: uncharacterized protein LOC102630...    265   4e-81    
ref|NP_566959.1|  phosphoglycerate mutase family protein                264   6e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006467251.1|  PREDICTED: uncharacterized protein LOC102630...    265   8e-81    
gb|KDO78606.1|  hypothetical protein CISIN_1g0263792mg                  264   9e-81    
gb|KDO78607.1|  hypothetical protein CISIN_1g0263792mg                  263   1e-80    
tpg|DAA39827.1|  TPA: hypothetical protein ZEAMMB73_861648              264   2e-80    
ref|XP_002462122.1|  hypothetical protein SORBIDRAFT_02g019520          263   5e-80    Sorghum bicolor [broomcorn]
ref|NP_001143028.1|  uncharacterized protein LOC100275495               262   7e-80    Zea mays [maize]
ref|XP_002876128.1|  hypothetical protein ARALYDRAFT_348313             270   7e-80    
ref|XP_006661201.1|  PREDICTED: uncharacterized protein LOC102719616    259   9e-80    
ref|XP_006403836.1|  hypothetical protein EUTSA_v10010705mg             261   1e-79    
dbj|BAJ92725.1|  predicted protein                                      261   2e-79    
gb|EEC84268.1|  hypothetical protein OsI_30728                          261   3e-79    Oryza sativa Indica Group [Indian rice]
ref|XP_004956482.1|  PREDICTED: uncharacterized protein LOC101780209    260   5e-79    
ref|XP_004486398.1|  PREDICTED: uncharacterized protein LOC101505...    258   2e-78    
ref|XP_010910101.1|  PREDICTED: uncharacterized protein LOC105036...    258   3e-78    
emb|CDX90616.1|  BnaA03g41650D                                          256   7e-78    
ref|XP_009136660.1|  PREDICTED: uncharacterized protein LOC103860...    256   8e-78    
emb|CDY29066.1|  BnaC07g32720D                                          255   1e-77    
tpg|DAA60894.1|  TPA: hypothetical protein ZEAMMB73_766231              255   3e-77    
ref|XP_010910100.1|  PREDICTED: uncharacterized protein LOC105036...    254   7e-77    
ref|XP_009415442.1|  PREDICTED: uncharacterized protein LOC103996278    254   1e-76    
ref|XP_003577942.1|  PREDICTED: uncharacterized protein LOC100833936    251   1e-75    
ref|NP_001145550.1|  uncharacterized protein LOC100279002               251   2e-75    Zea mays [maize]
gb|KFK34469.1|  hypothetical protein AALP_AA5G149300                    248   9e-75    
ref|XP_008782960.1|  PREDICTED: uncharacterized protein LOC103702...    248   2e-74    
ref|XP_001772111.1|  predicted protein                                  245   2e-74    
ref|XP_010096514.1|  hypothetical protein L484_017966                   260   4e-74    
gb|EEE69361.1|  hypothetical protein OsJ_28695                          243   1e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008782959.1|  PREDICTED: uncharacterized protein LOC103702...    244   5e-73    
emb|CAB41335.1|  putative protein                                       253   8e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002974533.1|  hypothetical protein SELMODRAFT_58546              239   3e-72    
ref|XP_002963230.1|  hypothetical protein SELMODRAFT_68511              239   5e-72    
gb|EMS56896.1|  hypothetical protein TRIUR3_04060                       235   8e-71    
gb|EMT07728.1|  hypothetical protein F775_14266                         234   8e-70    
gb|AAZ06218.1|  hypothetical protein TQR14A11.4                         234   2e-68    Oryza sativa Indica Group [Indian rice]
ref|XP_009136661.1|  PREDICTED: uncharacterized protein LOC103860...    226   1e-66    
ref|NP_001175750.1|  Os09g0287300                                       225   1e-65    
ref|XP_008782962.1|  PREDICTED: uncharacterized protein LOC103702...    213   2e-61    
ref|NP_001169062.1|  uncharacterized protein LOC100382903               207   1e-60    Zea mays [maize]
gb|AFK39549.1|  unknown                                                 208   7e-60    
gb|KHN14393.1|  hypothetical protein glysoja_012431                     187   4e-53    
ref|XP_010250908.1|  PREDICTED: uncharacterized protein LOC104593...    188   3e-52    
ref|XP_003594382.1|  hypothetical protein MTR_2g028000                  181   3e-50    
ref|XP_010695925.1|  PREDICTED: uncharacterized protein LOC104908...    172   2e-46    
ref|XP_008667644.1|  PREDICTED: uncharacterized protein LOC100275...    165   7e-44    
ref|XP_011040084.1|  PREDICTED: uncharacterized protein LOC105136...    158   2e-41    
ref|XP_005649041.1|  phosphoglycerate mutase-like protein               151   4e-39    
ref|XP_005847613.1|  hypothetical protein CHLNCDRAFT_23381              146   2e-37    
ref|XP_002508212.1|  predicted protein                                  148   5e-37    Micromonas commoda
ref|XP_002950070.1|  hypothetical protein VOLCADRAFT_80941              144   4e-36    
ref|XP_001702495.1|  predicted protein                                  138   8e-35    Chlamydomonas reinhardtii
ref|XP_003055847.1|  phosphohistidine phosphatase                       136   5e-32    
dbj|BAD29673.1|  hypothetical protein                                   120   2e-27    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010052521.1|  PREDICTED: uncharacterized protein LOC104441...    115   3e-26    
ref|XP_001416839.1|  predicted protein                                  112   9e-25    Ostreococcus lucimarinus CCE9901
ref|WP_002653005.1|  hypothetical protein                             97.1    1e-19    
emb|CEF96980.1|  Histidine phosphatase superfamily, clade-1           94.7    1e-18    
ref|XP_003077964.1|  Ubiquitin fusion-degradation protein (ISS)       98.6    1e-18    
ref|XP_001418728.1|  predicted protein                                95.9    2e-18    Ostreococcus lucimarinus CCE9901
ref|WP_027152623.1|  histidine phosphatase                            91.7    9e-18    
ref|WP_029354299.1|  histidine phosphatase                            90.9    2e-17    
ref|WP_022704911.1|  phosphoglycerate mutase                          89.7    4e-17    
ref|WP_023800649.1|  histidine phosphatase                            89.0    7e-17    
ref|XP_003080392.1|  FOG: RRM domain (ISS)                            90.9    2e-16    
ref|WP_023719766.1|  histidine phosphatase                            86.3    7e-16    
ref|WP_035026020.1|  MULTISPECIES: histidine phosphatase              85.9    1e-15    
ref|WP_021693329.1|  phosphoglycerate mutase family protein           84.7    2e-15    
ref|WP_006201545.1|  histidine phosphatase                            85.1    2e-15    
ref|WP_023705321.1|  MULTISPECIES: histidine phosphatase              84.3    3e-15    
ref|WP_028098226.1|  hypothetical protein                             84.0    4e-15    
ref|WP_008836009.1|  histidine phosphatase                            84.0    4e-15    
ref|WP_019857367.1|  MULTISPECIES: histidine phosphatase              83.6    5e-15    
gb|AID29199.1|  phosphoglycerate mutase family protein                83.6    5e-15    
ref|WP_023677652.1|  histidine phosphatase                            83.6    5e-15    
ref|WP_027026284.1|  histidine phosphatase                            83.2    7e-15    
ref|WP_008695654.1|  phosphohistidine phosphatase, SixA               82.8    7e-15    
ref|WP_013554060.1|  phosphohistidine phosphatase, sixa               83.2    7e-15    
ref|WP_034843649.1|  hypothetical protein                             83.2    7e-15    
ref|WP_023695552.1|  MULTISPECIES: histidine phosphatase              83.2    8e-15    
ref|WP_038291376.1|  hypothetical protein                             82.8    8e-15    
ref|WP_023761928.1|  histidine phosphatase                            83.2    9e-15    
ref|WP_018698842.1|  hypothetical protein                             82.8    1e-14    
ref|WP_021130500.1|  hypothetical protein                             82.8    1e-14    
ref|WP_018066493.1|  hypothetical protein                             82.4    1e-14    
ref|WP_023701884.1|  histidine phosphatase                            82.4    2e-14    
ref|WP_023693925.1|  MULTISPECIES: histidine phosphatase              82.4    2e-14    
ref|WP_007669979.1|  hypothetical protein                             82.0    2e-14    
gb|AIF15848.1|  phosphohistidine phosphatase (sixA)                   81.3    3e-14    
emb|CDX22081.1|  putative phosphohistidine phosphatase SixA           81.3    4e-14    
ref|WP_023715099.1|  MULTISPECIES: histidine phosphatase              81.3    4e-14    
ref|WP_027048842.1|  histidine phosphatase                            80.9    5e-14    
ref|WP_037331881.1|  histidine phosphatase                            80.5    5e-14    
ref|WP_006331885.1|  putative enzyme                                  80.5    6e-14    
ref|WP_023664575.1|  phosphoglycerate mutase                          80.5    6e-14    
ref|WP_026940892.1|  hypothetical protein                             80.5    6e-14    
ref|WP_038144665.1|  phosphoglycerate mutase                          80.5    7e-14    
emb|CDX41095.1|  putative phosphohistidine phosphatase SixA           80.5    7e-14    
ref|WP_023670280.1|  histidine phosphatase                            80.1    8e-14    
ref|WP_032929615.1|  histidine phosphatase                            79.7    1e-13    
ref|WP_013652259.1|  phosphohistidine phosphatase, SixA               79.3    2e-13    
emb|CDX41094.1|  putative phosphohistidine phosphatase SixA           79.0    2e-13    
gb|KGM47470.1|  phosphoglycerate mutase                               78.6    2e-13    
ref|WP_023733901.1|  histidine phosphatase                            78.6    3e-13    
ref|WP_025425166.1|  hypothetical protein                             79.0    3e-13    
ref|WP_028031685.1|  phosphoglycerate mutase                          78.6    3e-13    
ref|WP_036479506.1|  hypothetical protein                             78.6    3e-13    
emb|CDO60157.1|  Phosphohistidine phosphatase SixA                    78.6    3e-13    
emb|CDX19495.1|  putative phosphohistidine phosphatase SixA           78.6    3e-13    
ref|WP_008032635.1|  phosphoglycerate mutase                          78.2    3e-13    
ref|WP_013947227.1|  MULTISPECIES: phosphohistidine phosphatase       78.6    3e-13    
ref|WP_023689061.1|  histidine phosphatase                            78.2    4e-13    
ref|WP_014774177.1|  phosphoglycerate mutase                          78.2    4e-13    
ref|WP_008875035.1|  putative phosphohistidine phosphatase, SixA      78.2    4e-13    
ref|WP_023805638.1|  histidine phosphatase                            78.2    5e-13    
ref|WP_028287795.1|  phosphoglycerate mutase                          77.8    5e-13    
ref|WP_027034569.1|  histidine phosphatase                            77.8    5e-13    
ref|WP_018427151.1|  hypothetical protein                             77.8    7e-13    
ref|WP_009718986.1|  phosphohistidine phosphatase                     77.8    7e-13    
ref|WP_009094483.1|  phosphohistidine phosphatase, SixA               77.4    7e-13    
ref|WP_010915248.1|  histidine phosphatase                            77.4    8e-13    
ref|XP_007509263.1|  unknown protein                                  78.6    9e-13    
ref|WP_017928051.1|  hypothetical protein                             77.0    9e-13    
ref|WP_019598003.1|  hypothetical protein                             76.6    1e-12    
ref|WP_023727316.1|  histidine phosphatase                            77.0    1e-12    
ref|WP_028794780.1|  hypothetical protein                             76.6    1e-12    
ref|WP_023834748.1|  histidine phosphatase                            76.6    1e-12    
gb|ETW12431.1|  phosphogylcerate mutase-like protein                  76.3    1e-12    
ref|WP_027037917.1|  histidine phosphatase                            76.6    2e-12    
ref|WP_009563118.1|  Phosphoglycerate mutase family protein           76.3    2e-12    
dbj|GAK58981.1|  phosphoglycerate mutase                              75.9    2e-12    
ref|WP_024505066.1|  histidine phosphatase                            75.9    2e-12    
ref|WP_002721435.1|  phosphoglycerate mutase                          75.9    2e-12    
ref|WP_023731098.1|  histidine phosphatase                            75.9    2e-12    
ref|WP_011338695.1|  phosphoglycerate mutase                          75.9    2e-12    
ref|WP_011841849.1|  phosphoglycerate mutase                          75.9    2e-12    
ref|WP_002693842.1|  phosphoglycerate mutase family domain protein    75.9    2e-12    
ref|WP_016556668.1|  hypothetical protein                             75.9    3e-12    
ref|WP_015597990.1|  phosphohistidine phosphatase SixA                75.9    3e-12    
ref|WP_023711895.1|  MULTISPECIES: histidine phosphatase              75.5    3e-12    
gb|AHK42717.1|  putative phosphohistidine phosphatase protein         75.5    3e-12    
ref|WP_027057563.1|  histidine phosphatase                            75.5    4e-12    
ref|WP_031148959.1|  phosphohistidine phosphatase                     75.5    4e-12    
ref|WP_037930673.1|  phosphohistidine phosphatase                     75.1    4e-12    
ref|WP_011121948.1|  phosphohistidine phosphatase                     75.5    5e-12    
ref|WP_030962206.1|  phosphohistidine phosphatase                     75.1    5e-12    
gb|AHF00632.1|  histidine phosphatase                                 75.1    5e-12    
ref|WP_037165030.1|  MULTISPECIES: hypothetical protein               74.7    5e-12    
ref|WP_030318327.1|  phosphohistidine phosphatase                     74.7    6e-12    
ref|WP_019012850.1|  hypothetical protein                             74.7    6e-12    
ref|WP_019979086.1|  hypothetical protein                             74.3    7e-12    
ref|WP_011909808.1|  phosphoglycerate mutase                          74.3    7e-12    
ref|WP_037111099.1|  hypothetical protein                             74.3    8e-12    
ref|WP_030386470.1|  phosphohistidine phosphatase                     74.3    8e-12    
ref|WP_030012236.1|  MULTISPECIES: phosphohistidine phosphatase       74.3    8e-12    
ref|WP_030849757.1|  phosphohistidine phosphatase                     74.3    8e-12    
ref|WP_030720119.1|  phosphohistidine phosphatase                     74.3    9e-12    
ref|WP_022708247.1|  phosphoglycerate mutase                          74.3    9e-12    
ref|WP_023779708.1|  histidine phosphatase                            74.3    9e-12    
ref|WP_023000684.1|  MULTISPECIES: phosphohistidine phosphatase       74.3    9e-12    
ref|WP_031010384.1|  phosphohistidine phosphatase                     74.3    9e-12    
ref|WP_038076948.1|  phosphoglycerate mutase                          73.9    1e-11    
ref|WP_013896232.1|  histidine phosphatase                            73.9    1e-11    
emb|CDX25893.1|  putative phosphohistidine phosphatase SixA           73.9    1e-11    
ref|WP_018499986.1|  phosphohistidine phosphatase                     73.9    1e-11    
ref|WP_007332250.1|  phosphohistidine phosphatase                     73.9    1e-11    
ref|WP_023529149.1|  hypothetical protein                             73.9    1e-11    
ref|WP_024707039.1|  hypothetical protein                             73.6    1e-11    
ref|WP_034090529.1|  phosphohistidine phosphatase                     73.9    1e-11    
ref|WP_030858418.1|  phosphohistidine phosphatase                     73.6    1e-11    
ref|WP_030404484.1|  phosphohistidine phosphatase                     73.6    1e-11    
ref|WP_003977013.1|  MULTISPECIES: phosphohistidine phosphatase       73.6    1e-11    
ref|WP_023406531.1|  hypothetical protein                             73.6    1e-11    
ref|WP_031047691.1|  phosphohistidine phosphatase                     73.6    1e-11    
ref|WP_031087111.1|  MULTISPECIES: phosphohistidine phosphatase       73.6    1e-11    
ref|WP_020462465.1|  phosphohistidine phosphatase                     73.9    1e-11    
ref|WP_030184897.1|  phosphohistidine phosphatase                     73.6    1e-11    
ref|WP_030378935.1|  MULTISPECIES: phosphohistidine phosphatase       73.6    1e-11    
ref|WP_002731087.1|  Phosphoglycerate mutase family protein           73.6    2e-11    
ref|WP_026871934.1|  hypothetical protein                             73.6    2e-11    
ref|WP_007328176.1|  phosphohistidine phosphatase                     73.6    2e-11    
ref|WP_037493986.1|  hypothetical protein                             73.6    2e-11    
ref|WP_030203079.1|  phosphohistidine phosphatase                     73.6    2e-11    
gb|AIC17261.1|  Phosphohistidine phosphatase SixA                     73.2    2e-11    
ref|WP_020152219.1|  hypothetical protein                             73.6    2e-11    
ref|WP_014059744.1|  phosphohistidine phosphatase                     73.6    2e-11    
ref|WP_030612614.1|  phosphohistidine phosphatase                     73.6    2e-11    
ref|WP_030852315.1|  phosphohistidine phosphatase                     73.2    2e-11    
ref|WP_030841316.1|  phosphohistidine phosphatase                     73.2    2e-11    
ref|WP_031477237.1|  phosphohistidine phosphatase                     73.2    2e-11    
ref|WP_030859136.1|  phosphohistidine phosphatase                     73.2    2e-11    
ref|WP_012912471.1|  phosphohistidine phosphatase                     73.2    2e-11    
ref|WP_010987869.1|  phosphohistidine phosphatase                     73.2    2e-11    
emb|CCF21291.1|  putative phosphohistidine phosphatase protein        73.2    2e-11    
ref|WP_003989302.1|  phosphohistidine phosphatase                     73.2    2e-11    
gb|KIF05526.1|  phosphohistidine phosphatase                          73.2    2e-11    
ref|WP_028431465.1|  phosphohistidine phosphatase                     73.2    2e-11    
ref|WP_013501186.1|  phosphohistidine phosphatase                     73.2    2e-11    
ref|WP_030829498.1|  MULTISPECIES: phosphohistidine phosphatase       72.8    2e-11    
ref|WP_004989920.1|  MULTISPECIES: phosphohistidine phosphatase       72.8    3e-11    
ref|WP_006132618.1|  MULTISPECIES: hypothetical protein               72.8    3e-11    
ref|WP_011046282.1|  phosphoglycerate mutase                          72.8    3e-11    
ref|WP_037963446.1|  phosphohistidine phosphatase                     72.8    3e-11    
ref|WP_030920180.1|  MULTISPECIES: phosphohistidine phosphatase       72.8    3e-11    
ref|WP_026242760.1|  MULTISPECIES: phosphohistidine phosphatase       72.8    3e-11    
ref|WP_039637633.1|  phosphohistidine phosphatase                     72.8    3e-11    
ref|WP_030653730.1|  phosphohistidine phosphatase                     72.8    3e-11    
ref|WP_030596794.1|  phosphohistidine phosphatase                     72.8    3e-11    
ref|WP_033033293.1|  phosphohistidine phosphatase                     72.8    3e-11    
ref|WP_030372193.1|  MULTISPECIES: phosphohistidine phosphatase       72.4    3e-11    
ref|WP_030634224.1|  phosphohistidine phosphatase                     72.4    3e-11    
ref|WP_036258047.1|  histidine phosphatase                            72.4    3e-11    
ref|WP_019459775.1|  MULTISPECIES: hypothetical protein               72.4    3e-11    
ref|WP_037862070.1|  phosphohistidine phosphatase                     72.4    3e-11    
ref|WP_003985784.1|  MULTISPECIES: Phosphohistidine phosphatase SixA  72.4    3e-11    
ref|WP_026243401.1|  phosphohistidine phosphatase                     72.4    3e-11    
ref|WP_033270480.1|  phosphohistidine phosphatase                     72.4    3e-11    
ref|WP_030233518.1|  phosphohistidine phosphatase                     72.4    4e-11    
ref|WP_031129494.1|  phosphohistidine phosphatase                     72.4    4e-11    
ref|WP_031336657.1|  phosphohistidine phosphatase                     72.4    4e-11    
ref|WP_026970980.1|  hypothetical protein                             72.0    4e-11    
ref|WP_030833971.1|  phosphohistidine phosphatase                     72.4    4e-11    
ref|WP_037547072.1|  phosphohistidine phosphatase                     72.0    4e-11    
ref|WP_033275601.1|  MULTISPECIES: phosphohistidine phosphatase       72.4    4e-11    
ref|WP_010396860.1|  phosphoglycerate mutase                          72.0    4e-11    
ref|WP_024887142.1|  phosphohistidine phosphatase                     72.0    5e-11    
ref|WP_030665469.1|  MULTISPECIES: phosphohistidine phosphatase       72.0    5e-11    
ref|WP_020872337.1|  phosphohistidine phosphatase                     72.0    5e-11    
ref|WP_035230709.1|  hypothetical protein                             72.0    5e-11    
ref|WP_020140709.1|  phosphohistidine phosphatase                     72.0    5e-11    
ref|WP_030773086.1|  MULTISPECIES: phosphohistidine phosphatase       72.0    5e-11    
ref|WP_005477618.1|  hypothetical protein                             72.0    6e-11    
ref|WP_009186407.1|  phosphohistidine phosphatase SixA                71.6    6e-11    
gb|KGL00103.1|  phosphoglycerate mutase                               71.6    6e-11    
ref|WP_028485799.1|  phosphoglycolate phosphatase                     71.6    6e-11    
gb|KIF70491.1|  phosphohistidine phosphatase                          71.6    6e-11    
gb|ACY24497.1|  phosphohistidine phosphatase SixA                     71.6    6e-11    uncultured crenarchaeote 57a5
ref|WP_030087582.1|  phosphohistidine phosphatase                     71.6    6e-11    
ref|WP_033315003.1|  hypothetical protein                             70.5    6e-11    
ref|WP_011442701.1|  phosphohistidine phosphatase                     71.6    6e-11    
ref|WP_018476070.1|  hypothetical protein                             71.6    6e-11    
ref|WP_030947835.1|  phosphohistidine phosphatase                     71.6    7e-11    
ref|WP_033310968.1|  phosphohistidine phosphatase                     71.6    7e-11    
ref|WP_018567720.1|  MULTISPECIES: phosphohistidine phosphatase       71.6    7e-11    
ref|WP_027762346.1|  phosphohistidine phosphatase                     71.6    8e-11    
ref|WP_023768496.1|  histidine phosphatase                            71.2    8e-11    
ref|WP_033317766.1|  phosphohistidine phosphatase                     71.6    8e-11    
ref|WP_031118957.1|  MULTISPECIES: phosphohistidine phosphatase       71.6    8e-11    
ref|WP_036722061.1|  phosphoglycerate mutase                          71.2    8e-11    
emb|CDR12076.1|  predicted protein                                    71.2    8e-11    
ref|WP_037452634.1|  phosphohistidine phosphatase                     71.6    8e-11    
ref|WP_030619902.1|  phosphohistidine phosphatase                     71.2    9e-11    
ref|WP_037708009.1|  phosphohistidine phosphatase                     71.2    9e-11    
ref|WP_031523949.1|  phosphohistidine phosphatase                     71.2    9e-11    
ref|WP_033305591.1|  phosphohistidine phosphatase                     71.2    9e-11    
ref|WP_031047628.1|  MULTISPECIES: phosphohistidine phosphatase       71.2    9e-11    
ref|WP_024845320.1|  phosphoglycerate mutase                          71.2    9e-11    
gb|EHN73802.1|  hypothetical protein SMCF_6728                        71.2    9e-11    
ref|WP_037571575.1|  phosphohistidine phosphatase                     71.2    1e-10    
ref|WP_031147943.1|  phosphohistidine phosphatase                     71.2    1e-10    
ref|WP_028960742.1|  phosphohistidine phosphatase                     71.2    1e-10    
ref|WP_038008655.1|  MULTISPECIES: phosphoglycerate mutase            69.7    1e-10    
ref|WP_023912271.1|  phosphoglycerate mutase                          70.9    1e-10    
ref|WP_030021382.1|  phosphohistidine phosphatase                     70.9    1e-10    
ref|WP_031104177.1|  phosphohistidine phosphatase                     70.5    1e-10    
ref|WP_011290582.1|  phosphohistidine phosphatase                     70.5    1e-10    
ref|WP_014141767.1|  phosphohistidine phosphatase                     70.9    1e-10    
ref|WP_022888725.1|  phosphohistidine phosphatase                     70.5    1e-10    
ref|WP_038130322.1|  phosphoglycerate mutase                          70.9    1e-10    
ref|WP_018091766.1|  phosphohistidine phosphatase                     70.9    1e-10    
ref|WP_037797351.1|  phosphohistidine phosphatase                     70.9    1e-10    
ref|WP_036742126.1|  phosphoglycerate mutase                          70.9    1e-10    
ref|WP_005980792.1|  phosphoglycerate mutase                          70.5    1e-10    
ref|WP_013066084.1|  phosphoglycerate mutase                          70.9    1e-10    
ref|WP_008547393.1|  phosphohistidine phosphatase                     70.9    1e-10    
ref|WP_030733796.1|  phosphohistidine phosphatase                     70.9    1e-10    
ref|WP_013532447.1|  MULTISPECIES: histidine phosphatase              70.9    1e-10    
ref|WP_010037720.1|  phosphohistidine phosphatase                     70.5    1e-10    
ref|WP_024809775.1|  phosphoglycerate mutase                          70.5    1e-10    
ref|WP_004933127.1|  phosphohistidine phosphatase                     70.5    1e-10    
ref|WP_014180756.1|  phosphohistidine phosphatase                     70.5    1e-10    
ref|WP_030182701.1|  phosphohistidine phosphatase                     70.5    1e-10    
ref|WP_030717020.1|  phosphohistidine phosphatase                     70.5    2e-10    
ref|WP_020951624.1|  phosphohistidine phosphatase                     70.5    2e-10    
ref|WP_018545880.1|  phosphohistidine phosphatase                     70.5    2e-10    
ref|WP_007010460.1|  histidine phosphatase                            70.5    2e-10    
ref|WP_028714344.1|  MULTISPECIES: phosphoglycerate mutase            70.5    2e-10    
ref|WP_037311667.1|  phosphoglycerate mutase                          70.5    2e-10    
ref|WP_030162304.1|  phosphohistidine phosphatase                     70.5    2e-10    
ref|WP_031510502.1|  phosphohistidine phosphatase                     70.5    2e-10    
ref|WP_031045479.1|  phosphohistidine phosphatase                     70.5    2e-10    
ref|WP_034657820.1|  histidine phosphatase                            70.5    2e-10    
ref|WP_030051871.1|  phosphohistidine phosphatase                     70.5    2e-10    
ref|WP_030224252.1|  phosphohistidine phosphatase                     70.1    2e-10    
ref|WP_036751774.1|  phosphoglycerate mutase                          70.1    2e-10    
ref|WP_027289218.1|  hypothetical protein                             70.1    2e-10    
ref|WP_019137350.1|  hypothetical protein                             70.1    2e-10    
ref|WP_037691240.1|  phosphohistidine phosphatase                     70.1    2e-10    
ref|WP_024078653.1|  Putative phosphohistidine phosphatase            70.1    2e-10    
ref|WP_028422758.1|  phosphohistidine phosphatase                     70.1    2e-10    
ref|WP_028746431.1|  phosphoglycerate mutase                          70.1    2e-10    
ref|WP_009725685.1|  phosphohistidine phosphatase, SixA               70.1    2e-10    
ref|WP_024775142.1|  phosphohistidine phosphatase                     69.7    2e-10    
ref|WP_039012110.1|  histidine phosphatase                            69.7    2e-10    
ref|WP_030988313.1|  phosphohistidine phosphatase                     70.1    2e-10    
ref|WP_011585714.1|  phosphohistidine phosphatase                     70.1    3e-10    
ref|WP_037890040.1|  phosphohistidine phosphatase                     69.7    3e-10    
ref|WP_029651517.1|  phosphohistidine phosphatase                     70.1    3e-10    
ref|WP_007381085.1|  phosphohistidine phosphatase                     69.7    3e-10    
ref|WP_021101927.1|  Phosphoglycerate mutase family protein           69.7    3e-10    
ref|WP_037670591.1|  phosphohistidine phosphatase                     69.7    3e-10    
ref|WP_029063095.1|  phosphohistidine phosphatase                     69.7    3e-10    
ref|WP_030746459.1|  phosphohistidine phosphatase                     69.7    3e-10    
ref|WP_037746180.1|  phosphohistidine phosphatase                     69.7    3e-10    
ref|WP_016907270.1|  hypothetical protein                             69.7    3e-10    
ref|WP_014892564.1|  phosphohistidine phosphatase                     69.7    3e-10    
ref|WP_028480185.1|  phosphohistidine phosphatase                     69.7    3e-10    
ref|WP_011502082.1|  phosphohistidine phosphatase                     69.7    3e-10    
ref|WP_011747220.1|  phosphoglycerate mutase                          69.7    3e-10    
ref|WP_007263351.1|  phosphohistidine phosphatase                     69.7    3e-10    
ref|WP_016571710.1|  histidine phosphatase super family protein       69.3    3e-10    
ref|WP_028808284.1|  phosphohistidine phosphatase                     69.3    3e-10    
ref|WP_038063087.1|  phosphoglycerate mutase                          69.3    4e-10    
ref|WP_027736518.1|  phosphohistidine phosphatase                     69.3    4e-10    
gb|ETW95286.1|  hypothetical protein ETSY1_31260                      69.3    4e-10    
ref|WP_009293831.1|  phosphoglycerate mutase family protein           69.3    4e-10    
ref|WP_033819332.1|  phosphohistidine phosphatase                     69.3    4e-10    
ref|WP_028814247.1|  phosphohistidine phosphatase                     69.3    4e-10    
ref|WP_018407534.1|  phosphohistidine phosphatase                     69.3    4e-10    
ref|WP_026171733.1|  MULTISPECIES: phosphohistidine phosphatase       69.3    4e-10    
ref|WP_013460532.1|  phosphohistidine phosphatase SixA                69.3    4e-10    
ref|WP_027042103.1|  histidine phosphatase                            69.3    4e-10    
ref|WP_037607234.1|  phosphohistidine phosphatase                     69.3    4e-10    
ref|WP_010468867.1|  phosphohistidine phosphatase                     69.3    4e-10    
ref|WP_006143345.1|  phosphohistidine phosphatase                     69.3    4e-10    
ref|WP_031173823.1|  phosphohistidine phosphatase                     69.3    5e-10    
ref|WP_026249938.1|  phosphohistidine phosphatase                     68.9    5e-10    
ref|WP_037905853.1|  phosphohistidine phosphatase                     69.3    5e-10    
ref|WP_034424272.1|  hypothetical protein                             69.3    5e-10    
ref|WP_030040104.1|  phosphohistidine phosphatase                     68.9    5e-10    
ref|WP_025658126.1|  phosphoglycerate mutase                          69.3    5e-10    
gb|KHQ53162.1|  Phosphoglycerate mutase                               68.9    5e-10    
ref|WP_030408700.1|  phosphohistidine phosphatase                     68.9    5e-10    
ref|WP_018855832.1|  phosphoglycerate mutase                          68.9    5e-10    
ref|WP_018148063.1|  hypothetical protein                             68.9    5e-10    
ref|WP_015933393.1|  phosphoglycerate mutase                          68.9    5e-10    
ref|WP_030795695.1|  phosphohistidine phosphatase                     68.9    5e-10    
ref|WP_008623505.1|  putative phosphohistidine phosphatase, SixA      68.9    5e-10    
ref|WP_030549062.1|  phosphohistidine phosphatase                     69.3    5e-10    
ref|WP_030684235.1|  phosphohistidine phosphatase                     68.9    5e-10    
ref|WP_024846958.1|  histidine phosphatase                            68.9    5e-10    
ref|WP_026468842.1|  phosphohistidine phosphatase                     68.9    5e-10    
ref|WP_007528263.1|  phosphoglycerate mutase                          68.9    5e-10    
ref|WP_028064015.1|  hypothetical protein                             68.9    5e-10    
ref|WP_012335859.1|  MULTISPECIES: phosphoglycerate mutase            68.9    5e-10    
gb|KDS85368.1|  phosphohistidine phosphatase                          68.9    6e-10    
ref|WP_037911170.1|  phosphoglycerate mutase                          68.6    6e-10    
ref|WP_025048060.1|  phosphoglycerate mutase                          68.6    6e-10    
emb|CDM59632.1|  putative phosphohistidine phosphatase                68.9    6e-10    
ref|WP_018541212.1|  phosphohistidine phosphatase                     68.9    6e-10    
ref|WP_028737797.1|  hypothetical protein                             68.6    6e-10    
ref|WP_039523444.1|  phosphoglycerate mutase                          68.6    6e-10    
ref|WP_030790957.1|  phosphohistidine phosphatase                     68.6    6e-10    
ref|WP_030300582.1|  phosphohistidine phosphatase                     68.6    6e-10    
ref|WP_036290432.1|  phosphohistidine phosphatase                     68.9    7e-10    
ref|WP_009187900.1|  phosphohistidine phosphatase                     68.6    7e-10    
ref|WP_031099920.1|  phosphohistidine phosphatase                     68.6    7e-10    
ref|WP_027758240.1|  phosphohistidine phosphatase                     68.6    7e-10    
gb|EDY45437.1|  phosphohistidine phosphatase SixA                     68.6    7e-10    
ref|WP_024315329.1|  phosphoglycerate mutase                          68.6    7e-10    
ref|WP_018560579.1|  phosphohistidine phosphatase                     68.6    7e-10    
ref|WP_037116826.1|  phosphoglycerate mutase                          68.6    7e-10    
ref|WP_033286416.1|  phosphohistidine phosphatase                     68.9    7e-10    
ref|WP_027144490.1|  histidine phosphatase                            68.6    7e-10    
ref|WP_024879400.1|  phosphohistidine phosphatase                     68.6    7e-10    
ref|WP_030568213.1|  phosphohistidine phosphatase                     68.6    7e-10    
ref|WP_037937941.1|  phosphohistidine phosphatase                     68.6    7e-10    
ref|WP_026598132.1|  phosphohistidine phosphatase                     68.6    7e-10    
ref|WP_033249955.1|  MULTISPECIES: phosphohistidine phosphatase       68.6    8e-10    
ref|WP_017297443.1|  hypothetical protein                             68.2    8e-10    
ref|WP_014746833.1|  putative phosphohistidine phosphatase, SixA      68.6    8e-10    
ref|WP_014045144.1|  MULTISPECIES: phosphohistidine phosphatase       68.6    8e-10    
ref|WP_037870527.1|  phosphohistidine phosphatase                     68.6    8e-10    
ref|WP_031072428.1|  phosphohistidine phosphatase                     68.6    8e-10    
ref|WP_013004678.1|  phosphohistidine phosphatase                     68.6    8e-10    
ref|WP_030264752.1|  phosphohistidine phosphatase                     68.2    8e-10    
ref|WP_022523751.1|  putative phosphohistidine phosphatase, SixA      71.2    9e-10    
ref|WP_006606414.1|  phosphohistidine phosphatase                     68.2    9e-10    
ref|WP_013215471.1|  phosphohistidine phosphatase                     68.2    9e-10    
ref|WP_031175534.1|  MULTISPECIES: phosphohistidine phosphatase       68.2    9e-10    
ref|WP_026237559.1|  phosphohistidine phosphatase                     68.2    9e-10    
ref|WP_030266622.1|  phosphohistidine phosphatase                     68.2    9e-10    
ref|WP_026191237.1|  phosphohistidine phosphatase                     68.2    9e-10    
ref|WP_029385816.1|  phosphohistidine phosphatase                     68.2    9e-10    
ref|WP_027053235.1|  histidine phosphatase                            68.2    9e-10    
ref|WP_026955441.1|  hypothetical protein                             68.2    9e-10    
ref|WP_016468102.1|  MULTISPECIES: hypothetical protein               68.2    9e-10    
ref|WP_028419385.1|  phosphohistidine phosphatase                     68.2    1e-09    
ref|WP_037668246.1|  phosphohistidine phosphatase                     68.2    1e-09    
ref|WP_028803283.1|  phosphohistidine phosphatase                     68.2    1e-09    
ref|WP_030753390.1|  phosphohistidine phosphatase                     68.2    1e-09    
ref|WP_020666358.1|  hypothetical protein                             67.8    1e-09    
ref|WP_030675895.1|  phosphohistidine phosphatase                     68.2    1e-09    
ref|WP_019067399.1|  phosphohistidine phosphatase                     68.2    1e-09    
ref|WP_037623740.1|  phosphohistidine phosphatase                     68.2    1e-09    
ref|WP_031142677.1|  phosphohistidine phosphatase                     68.2    1e-09    
ref|WP_019766552.1|  phosphohistidine phosphatase                     68.2    1e-09    
ref|WP_026209749.1|  phosphohistidine phosphatase                     68.2    1e-09    
ref|WP_026241515.1|  phosphohistidine phosphatase                     68.2    1e-09    
ref|WP_030985793.1|  phosphohistidine phosphatase                     68.2    1e-09    
ref|WP_030283129.1|  phosphohistidine phosphatase                     68.2    1e-09    
ref|WP_030908882.1|  phosphohistidine phosphatase                     68.2    1e-09    
ref|WP_027058851.1|  histidine phosphatase                            67.8    1e-09    
ref|WP_019545511.1|  hypothetical protein                             67.8    1e-09    
ref|WP_035714210.1|  phosphoglycerate mutase                          67.8    1e-09    
ref|WP_026047456.1|  phosphohistidine phosphatase                     67.8    1e-09    
ref|WP_012855122.1|  putative phosphohistidine phosphatase SixA       67.8    1e-09    
ref|WP_037743592.1|  phosphohistidine phosphatase                     67.8    1e-09    
ref|WP_014157020.1|  MULTISPECIES: phosphohistidine phosphatase       67.8    1e-09    
ref|WP_030411673.1|  MULTISPECIES: phosphohistidine phosphatase       67.8    1e-09    
ref|WP_013864768.1|  hypothetical protein                             67.8    1e-09    
ref|WP_009185342.1|  phosphoglycerate mutase                          67.8    1e-09    
ref|WP_029005201.1|  phosphoglycerate mutase                          67.8    1e-09    
ref|WP_026969464.1|  phosphoglycerate mutase                          67.8    1e-09    
ref|WP_020527447.1|  hypothetical protein                             67.8    1e-09    
ref|WP_012318114.1|  MULTISPECIES: phosphoglycerate mutase            67.8    1e-09    
ref|WP_030248863.1|  MULTISPECIES: phosphohistidine phosphatase       67.8    1e-09    
ref|WP_010355636.1|  phosphohistidine phosphatase                     67.8    1e-09    
ref|WP_011425045.1|  phosphohistidine phosphatase                     67.8    1e-09    
ref|WP_027029127.1|  histidine phosphatase                            67.4    1e-09    
ref|WP_028968887.1|  hypothetical protein                             67.4    1e-09    
ref|WP_007006495.1|  phosphohistidine phosphatase                     67.8    1e-09    
ref|WP_008232601.1|  phosphoglycerate mutase                          67.8    2e-09    
ref|WP_033177238.1|  phosphohistidine phosphatase                     67.4    2e-09    
ref|WP_014671867.1|  phosphohistidine phosphatase                     67.4    2e-09    
ref|WP_003083736.1|  phosphohistidine phosphatase                     67.4    2e-09    
ref|WP_020130395.1|  phosphohistidine phosphatase                     67.4    2e-09    
ref|WP_030642671.1|  MULTISPECIES: phosphohistidine phosphatase       67.4    2e-09    
ref|WP_031023958.1|  phosphohistidine phosphatase                     67.4    2e-09    
ref|WP_015661437.1|  phosphoglycerate mutase                          67.4    2e-09    
ref|WP_037277337.1|  hypothetical protein                             67.4    2e-09    
ref|WP_030901177.1|  phosphohistidine phosphatase                     67.4    2e-09    
gb|ERM02650.1|  phosphohistidine phosphatase                          67.4    2e-09    
ref|WP_017238522.1|  phosphohistidine phosphatase                     67.4    2e-09    
ref|WP_037209346.1|  phosphoglycerate mutase                          67.4    2e-09    
ref|WP_019964539.1|  hypothetical protein                             67.4    2e-09    
ref|WP_014797559.1|  phosphohistidine phosphatase SixA                67.4    2e-09    
ref|WP_028094111.1|  phosphoglycerate mutase                          67.4    2e-09    
ref|WP_031086156.1|  phosphohistidine phosphatase                     67.4    2e-09    
ref|WP_029029185.1|  phosphoglycerate mutase                          67.4    2e-09    
ref|WP_029914393.1|  hypothetical protein                             67.0    2e-09    
ref|WP_028435516.1|  phosphohistidine phosphatase                     67.4    2e-09    
ref|WP_006466859.1|  phosphohistidine phosphatase                     67.4    2e-09    
ref|WP_031352513.1|  phosphohistidine phosphatase                     67.0    2e-09    
ref|WP_014286476.1|  phosphohistidine phosphatase                     67.4    2e-09    
ref|WP_006470501.1|  putative phosphohistidine phosphatase SixA       67.0    2e-09    
ref|WP_037418022.1|  phosphoglycerate mutase                          67.4    2e-09    
ref|WP_031232032.1|  phosphohistidine phosphatase                     67.0    2e-09    
ref|WP_028302073.1|  phosphoglycerate mutase                          67.0    2e-09    



>ref|XP_009802383.1| PREDICTED: uncharacterized protein LOC104247928 [Nicotiana sylvestris]
Length=237

 Score =   317 bits (811),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 177/208 (85%), Gaps = 4/208 (2%)
 Frame = +3

Query  396   AAAASMVIDTGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLS  575
             + A S+VID  ++Q  Q S   +TP + S     RRLILLRHA SSW++RS+RDHDRPLS
Sbjct  34    SGATSLVID-DTIQ-GQTSTSMETPTTQSVT--ARRLILLRHAKSSWDNRSIRDHDRPLS  89

Query  576   KSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSV  755
             ++GQL A +VS +L +LGWIP LIL SDA+RTRETLKIMQEQV AFLEAEVHF+SSFYSV
Sbjct  90    RAGQLDAIKVSQKLLELGWIPKLILSSDALRTRETLKIMQEQVQAFLEAEVHFISSFYSV  149

Query  756   AAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEAT  935
             AAMDGQTAEHLRQAICKYS+D+I TVMCMGHNRGWEEAASMFSG  +ELKTCNAALLEAT
Sbjct  150   AAMDGQTAEHLRQAICKYSRDEIFTVMCMGHNRGWEEAASMFSGVTVELKTCNAALLEAT  209

Query  936   GKSWEETFSLAGLGGWELQGIVKPDIDV  1019
             GKSWEE FSLAG GGW+LQG+VKPDI V
Sbjct  210   GKSWEEAFSLAGPGGWKLQGLVKPDIAV  237



>ref|XP_009620527.1| PREDICTED: uncharacterized protein LOC104112346 [Nicotiana tomentosiformis]
Length=237

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 176/208 (85%), Gaps = 4/208 (2%)
 Frame = +3

Query  396   AAAASMVIDTGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLS  575
             + A S+VID  ++Q  Q S   +TP + S     RRLILLRHA SSW++RS+RDHDRPLS
Sbjct  34    SGATSLVID-DTIQ-GQTSTSMETPTTQSVT--ARRLILLRHAKSSWDNRSIRDHDRPLS  89

Query  576   KSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSV  755
             ++GQL A +VS +L +LGWIP LIL SDA+RTRETLKIMQEQV AFLEAEVHF+SSFYSV
Sbjct  90    RAGQLDAIKVSQKLLELGWIPKLILSSDAMRTRETLKIMQEQVQAFLEAEVHFISSFYSV  149

Query  756   AAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEAT  935
             AAMDGQTAEHLRQAICKYS+D+I TVMCMGHNRGWEEAASMFSG  +ELKTCNAALLEAT
Sbjct  150   AAMDGQTAEHLRQAICKYSRDEIFTVMCMGHNRGWEEAASMFSGVTVELKTCNAALLEAT  209

Query  936   GKSWEETFSLAGLGGWELQGIVKPDIDV  1019
             GKSWEE FSLAG GGW+LQG+VKPD  V
Sbjct  210   GKSWEEAFSLAGPGGWKLQGLVKPDTAV  237



>ref|XP_011086305.1| PREDICTED: uncharacterized protein LOC105168078 [Sesamum indicum]
Length=228

 Score =   309 bits (791),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/207 (72%), Positives = 169/207 (82%), Gaps = 9/207 (4%)
 Frame = +3

Query  390   AIAAAASMVIDTGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRP  569
             +++   S+VI+T          E Q  A    + + RRLILLRHA SSWE+RSLRDHDRP
Sbjct  30    SVSTRNSLVIETA---------EDQASAETPRESVARRLILLRHAKSSWENRSLRDHDRP  80

Query  570   LSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFY  749
             LSKSG+  A ++S +L QLGWIP LIL SDA RTRETLKIMQEQV  FLEAEVHF+SSFY
Sbjct  81    LSKSGRADAVKLSQKLEQLGWIPQLILSSDAQRTRETLKIMQEQVRGFLEAEVHFISSFY  140

Query  750   SVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLE  929
             S+AAMDGQTAEHL+QAICKYS+D+ILT+MCMGHNRGWEEAASMFSG  IELKTCNAALLE
Sbjct  141   SIAAMDGQTAEHLQQAICKYSRDEILTIMCMGHNRGWEEAASMFSGVSIELKTCNAALLE  200

Query  930   ATGKSWEETFSLAGLGGWELQGIVKPD  1010
             ATGKSWEE FSLAG GGW+L GIVKPD
Sbjct  201   ATGKSWEEAFSLAGFGGWKLYGIVKPD  227



>ref|XP_006373548.1| hypothetical protein POPTR_0016s00290g [Populus trichocarpa]
 gb|ERP51345.1| hypothetical protein POPTR_0016s00290g [Populus trichocarpa]
Length=258

 Score =   309 bits (792),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 169/200 (85%), Gaps = 2/200 (1%)
 Frame = +3

Query  408   SMVIDTGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQ  587
             S+VI+  S  +   +  T T     +Q + RRLILLRHA SSW+DRSLRDHDRPLSKSG+
Sbjct  55    SLVIEETSTTMSDTN--TDTDIETDSQSVSRRLILLRHAKSSWDDRSLRDHDRPLSKSGE  112

Query  588   LAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMD  767
             L AA VS +L QL WIP LIL SDA+RT+ETL+IMQ+QVP FL+AEVHF+SSFYSVAAMD
Sbjct  113   LDAAEVSQKLLQLDWIPQLILSSDALRTKETLRIMQQQVPDFLDAEVHFISSFYSVAAMD  172

Query  768   GQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSW  947
             GQTA+HL+QAIC YS+D ILTVMCMGHNRGWEEAASMFSGA IELKTCNAALLEATGKSW
Sbjct  173   GQTADHLQQAICNYSRDGILTVMCMGHNRGWEEAASMFSGASIELKTCNAALLEATGKSW  232

Query  948   EETFSLAGLGGWELQGIVKP  1007
             EE F+ AGLGGW+LQGIVKP
Sbjct  233   EEAFASAGLGGWKLQGIVKP  252



>ref|XP_002264671.3| PREDICTED: uncharacterized protein LOC100247110 [Vitis vinifera]
Length=249

 Score =   307 bits (786),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/185 (78%), Positives = 162/185 (88%), Gaps = 0/185 (0%)
 Frame = +3

Query  456   ETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWI  635
             E Q      ++ + RRLILLRHA SSW DRSLRDHDRPLSK+G+  A  +SH+L QLGWI
Sbjct  62    EDQVDGEARSESVARRLILLRHAKSSWTDRSLRDHDRPLSKAGRADAINISHKLQQLGWI  121

Query  636   PGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSK  815
             P LILCSDA+RTRETLKIMQEQV  F EAEVHF+SSFYS+AAMDGQTAEHL+QAICK+S+
Sbjct  122   PELILCSDAMRTRETLKIMQEQVRGFSEAEVHFISSFYSIAAMDGQTAEHLQQAICKFSR  181

Query  816   DDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             D+ILTVMCMGHNRGWEEAASMFSGA IELKTCNAALLEATGKSWEE F+LAGLGGW+L G
Sbjct  182   DEILTVMCMGHNRGWEEAASMFSGASIELKTCNAALLEATGKSWEEAFNLAGLGGWKLHG  241

Query  996   IVKPD  1010
             IVKP+
Sbjct  242   IVKPN  246



>ref|XP_006350226.1| PREDICTED: uncharacterized protein LOC102589126 [Solanum tuberosum]
Length=246

 Score =   305 bits (782),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 172/203 (85%), Gaps = 1/203 (0%)
 Frame = +3

Query  411   MVIDTGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQL  590
             +VI+T   Q QQ S  T+TP +  +    RRLILLRHA SSWE+RS+RDHDRPLS+SGQL
Sbjct  45    LVIETNQDQ-QQISTSTETPTTTLSSVAARRLILLRHAKSSWENRSIRDHDRPLSRSGQL  103

Query  591   AAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDG  770
              A +VS  L +LGWIP LIL SDA+RT+ETLKIMQEQV AFLEAEVHF+SSFYSVAAMDG
Sbjct  104   DAIKVSQNLLKLGWIPQLILSSDALRTQETLKIMQEQVQAFLEAEVHFISSFYSVAAMDG  163

Query  771   QTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWE  950
             QT EHLRQAICKYS+D+ILTVMCMGHNRGWEEAAS+ SG  +ELKTCNAALLEATGKSWE
Sbjct  164   QTTEHLRQAICKYSRDEILTVMCMGHNRGWEEAASVLSGVTVELKTCNAALLEATGKSWE  223

Query  951   ETFSLAGLGGWELQGIVKPDIDV  1019
             E FSLAG GGW+LQG+VKPD  V
Sbjct  224   EAFSLAGPGGWKLQGLVKPDTVV  246



>ref|XP_004236635.1| PREDICTED: uncharacterized protein LOC101251174 [Solanum lycopersicum]
Length=246

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 171/203 (84%), Gaps = 1/203 (0%)
 Frame = +3

Query  411   MVIDTGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQL  590
             +VI+T   Q QQ S  TQTP +  +    RRLILLRHA SSWE+RS+RDHDRPLS+SGQL
Sbjct  45    LVIETNQDQ-QQISTSTQTPTTTLSSVAARRLILLRHAKSSWENRSIRDHDRPLSRSGQL  103

Query  591   AAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDG  770
              A +VS  L +LGWIP LIL SDA+RTRETLKIMQEQV AFLEAEVHF+SSFYSVAAMDG
Sbjct  104   DAIKVSQNLLKLGWIPQLILSSDALRTRETLKIMQEQVQAFLEAEVHFISSFYSVAAMDG  163

Query  771   QTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWE  950
             QTAEHLRQAIC YS+D+I TVMCMGHNRGWEEAAS+ SGA +ELKTCN ALLEATGKSWE
Sbjct  164   QTAEHLRQAICNYSRDEISTVMCMGHNRGWEEAASVLSGATVELKTCNGALLEATGKSWE  223

Query  951   ETFSLAGLGGWELQGIVKPDIDV  1019
             E FSLAG GGW+LQG+VKPD  V
Sbjct  224   EAFSLAGPGGWKLQGLVKPDTAV  246



>ref|XP_011040082.1| PREDICTED: uncharacterized protein LOC105136437 isoform X1 [Populus 
euphratica]
Length=258

 Score =   305 bits (781),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/200 (74%), Positives = 168/200 (84%), Gaps = 2/200 (1%)
 Frame = +3

Query  408   SMVIDTGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQ  587
             S+VI+  S  +   +  T T     +Q + RRLILLRHA SSW+DRSLRDHDRPLSKSG+
Sbjct  55    SLVIEETSTTMSDTN--TDTDIETDSQAVSRRLILLRHAKSSWDDRSLRDHDRPLSKSGE  112

Query  588   LAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMD  767
             L AA VS +L QL WIP LIL SDA+RT+ETL+IMQ+QVP FL+AEVHF+SSFYSVAAMD
Sbjct  113   LDAAEVSQKLLQLDWIPQLILSSDALRTKETLRIMQQQVPDFLDAEVHFISSFYSVAAMD  172

Query  768   GQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSW  947
             GQTA+HL+QAIC YS D ILTVMCMGHNRGWEEAASMFSGA IELKTCNAALLEATGKSW
Sbjct  173   GQTADHLQQAICNYSWDGILTVMCMGHNRGWEEAASMFSGASIELKTCNAALLEATGKSW  232

Query  948   EETFSLAGLGGWELQGIVKP  1007
             EE F+ AGLGGW+LQG+VKP
Sbjct  233   EEAFASAGLGGWKLQGVVKP  252



>ref|XP_008224669.1| PREDICTED: uncharacterized protein LOC103324393 [Prunus mume]
Length=242

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 170/201 (85%), Gaps = 7/201 (3%)
 Frame = +3

Query  405   ASMVIDTGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSG  584
             +S+VI+T  V+ +  S   QTP      ++ RRLILLRHA+SSWED SL+DHDRPLS++G
Sbjct  45    SSLVIET--VEGKAVSDSEQTPP-----YVARRLILLRHANSSWEDPSLKDHDRPLSETG  97

Query  585   QLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAM  764
             Q  A +VSH+L QLGWIP LIL S+AVRTRETL IMQ+QV  FLEAEVH++SSFYS+AAM
Sbjct  98    QADAVKVSHKLQQLGWIPQLILSSNAVRTRETLTIMQQQVRGFLEAEVHYISSFYSIAAM  157

Query  765   DGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKS  944
             DGQTAEHL+  IC YS+DDILTVMCMGHNRGWEEAASMF+GA IELKTCNAALLE TGKS
Sbjct  158   DGQTAEHLQHVICNYSRDDILTVMCMGHNRGWEEAASMFTGASIELKTCNAALLETTGKS  217

Query  945   WEETFSLAGLGGWELQGIVKP  1007
             W+E F+LAGLGGW+LQGIVKP
Sbjct  218   WDEAFALAGLGGWKLQGIVKP  238



>ref|XP_010052520.1| PREDICTED: uncharacterized protein LOC104441195 isoform X1 [Eucalyptus 
grandis]
Length=239

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 146/200 (73%), Positives = 172/200 (86%), Gaps = 2/200 (1%)
 Frame = +3

Query  408   SMVIDTGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQ  587
             S+ ++T   +   A+ +    +S+SA   PRRLILLRHA SSW DRSLRDHDRPLSK+GQ
Sbjct  40    SVAVETAEGRAASAAEDEAPSSSESAA--PRRLILLRHAESSWSDRSLRDHDRPLSKTGQ  97

Query  588   LAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMD  767
               A +++ +L QLGWIP LIL SDAVRTRETL+IMQE+V +FLEA+VHF+SSFYS+AAMD
Sbjct  98    DDAVKIARKLHQLGWIPELILLSDAVRTRETLQIMQERVESFLEAKVHFISSFYSIAAMD  157

Query  768   GQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSW  947
             GQTAEHL+ AICKYS+D+ILTVMCMGHNRGWEEAASMF+GA IELKTCNAALLEATG+SW
Sbjct  158   GQTAEHLQNAICKYSRDEILTVMCMGHNRGWEEAASMFTGASIELKTCNAALLEATGRSW  217

Query  948   EETFSLAGLGGWELQGIVKP  1007
             EE F+LAGLGGW+LQGIVKP
Sbjct  218   EEAFALAGLGGWKLQGIVKP  237



>gb|KDP29022.1| hypothetical protein JCGZ_16411 [Jatropha curcas]
Length=248

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = +3

Query  480   SAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSD  659
             S++ + RRLILLRHA SSW++  LRDHDRPLSK G+  AA+VS +L QLGWIP LIL S+
Sbjct  67    SSKLVARRLILLRHAESSWDNPLLRDHDRPLSKGGKADAAKVSQKLQQLGWIPQLILSSN  126

Query  660   AVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMC  839
             A RTRETLK+MQEQVP F++AEVHF+ SFYS+AA+DGQTAEHL+QAIC+YS+D+ILTVMC
Sbjct  127   ATRTRETLKVMQEQVPGFVDAEVHFIPSFYSIAALDGQTAEHLQQAICRYSRDEILTVMC  186

Query  840   MGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             MGHNRGWEEAASMF+GAP+ELKTCNAALLEATGKSWEE F LAG+GGW+LQGIVKP
Sbjct  187   MGHNRGWEEAASMFTGAPVELKTCNAALLEATGKSWEEAFVLAGIGGWKLQGIVKP  242



>ref|XP_010250907.1| PREDICTED: uncharacterized protein LOC104593002 isoform X1 [Nelumbo 
nucifera]
Length=246

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 137/174 (79%), Positives = 157/174 (90%), Gaps = 0/174 (0%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRLILLRHA SSW+DRSLRDHDRPLSKSG   A  VS++L QLGW+P LIL SDA RTRE
Sbjct  65    RRLILLRHAKSSWDDRSLRDHDRPLSKSGHADAISVSYKLQQLGWVPELILSSDATRTRE  124

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
             TL+IMQEQV  FLEAEVHF+SSFYS+AAMDGQTAEHL++AIC+YS+D+ILTVMCMGHNRG
Sbjct  125   TLRIMQEQVRGFLEAEVHFISSFYSIAAMDGQTAEHLQKAICEYSRDEILTVMCMGHNRG  184

Query  858   WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPDIDV  1019
             WEEAAS+FSG  +ELKTCNAALLEATGKSW+E FS+AGLGGW+L GIVKP+ ++
Sbjct  185   WEEAASVFSGTSVELKTCNAALLEATGKSWDEAFSVAGLGGWKLHGIVKPNTNL  238



>gb|EYU33816.1| hypothetical protein MIMGU_mgv1a013095mg [Erythranthe guttata]
Length=230

 Score =   296 bits (759),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 169/209 (81%), Gaps = 9/209 (4%)
 Frame = +3

Query  393   IAAAASMVIDTGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPL  572
             ++  +S+ I+T      QAS ET        +   RRLILLRHA SSWE+RS++DHDRPL
Sbjct  31    VSVRSSLAIETAE---DQASSET------PPEPFNRRLILLRHAKSSWENRSVKDHDRPL  81

Query  573   SKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYS  752
             SKSG+  A ++S +L +LGWIP LIL SDA RTRETLKIMQE V AFLEAEVHF+SSFYS
Sbjct  82    SKSGRDDAIKLSKKLEKLGWIPQLILSSDAQRTRETLKIMQEHVRAFLEAEVHFISSFYS  141

Query  753   VAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEA  932
             +AAMDGQTAEHL+QAI KYS D+I T+MCMGHN+GWEEAASMFSGA IELKTCNAALLEA
Sbjct  142   IAAMDGQTAEHLQQAIRKYSSDEIFTIMCMGHNKGWEEAASMFSGASIELKTCNAALLEA  201

Query  933   TGKSWEETFSLAGLGGWELQGIVKPDIDV  1019
             TGKSWEE FSLAG GGW+L G+VKPD D+
Sbjct  202   TGKSWEEAFSLAGFGGWKLNGVVKPDTDL  230



>ref|XP_011005785.1| PREDICTED: uncharacterized protein LOC105111959 isoform X1 [Populus 
euphratica]
Length=335

 Score =   297 bits (760),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRLILLRHA SSW+DRSLRDHDRPLSKSG+L AA+VS +L  LGWIP LIL SDA+RT+E
Sbjct  160   RRLILLRHAKSSWDDRSLRDHDRPLSKSGELDAAKVSQKLQHLGWIPQLILSSDALRTKE  219

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
             TLKIMQ+QVP FL+AEVHF+SSFYS+AAMDGQTA+HL+QAIC YS+DDILTVMCMGHN+G
Sbjct  220   TLKIMQQQVPDFLDAEVHFISSFYSIAAMDGQTADHLQQAICNYSRDDILTVMCMGHNKG  279

Query  858   WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             WEEAASMFSGA +EL TCNAALLEA GKSW E F+ AGLGGW+LQ IVKP
Sbjct  280   WEEAASMFSGASVELNTCNAALLEAAGKSWAEAFASAGLGGWKLQDIVKP  329



>ref|XP_011005786.1| PREDICTED: uncharacterized protein LOC105111959 isoform X2 [Populus 
euphratica]
Length=322

 Score =   296 bits (758),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRLILLRHA SSW+DRSLRDHDRPLSKSG+L AA+VS +L  LGWIP LIL SDA+RT+E
Sbjct  147   RRLILLRHAKSSWDDRSLRDHDRPLSKSGELDAAKVSQKLQHLGWIPQLILSSDALRTKE  206

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
             TLKIMQ+QVP FL+AEVHF+SSFYS+AAMDGQTA+HL+QAIC YS+DDILTVMCMGHN+G
Sbjct  207   TLKIMQQQVPDFLDAEVHFISSFYSIAAMDGQTADHLQQAICNYSRDDILTVMCMGHNKG  266

Query  858   WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             WEEAASMFSGA +EL TCNAALLEA GKSW E F+ AGLGGW+LQ IVKP
Sbjct  267   WEEAASMFSGASVELNTCNAALLEAAGKSWAEAFASAGLGGWKLQDIVKP  316



>ref|NP_001238160.1| uncharacterized protein LOC100305626 [Glycine max]
 gb|ACU13408.1| unknown [Glycine max]
Length=223

 Score =   292 bits (747),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/193 (72%), Positives = 161/193 (83%), Gaps = 1/193 (1%)
 Frame = +3

Query  429   SVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVS  608
             S+ +Q+   +   P SDS   + RRLILLRHA SSW++RSLRDHDRPLSKSG+  A RVS
Sbjct  30    SLLVQKQDTQLGEPLSDSVS-VSRRLILLRHAKSSWDNRSLRDHDRPLSKSGKEDAVRVS  88

Query  609   HELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHL  788
               L QLGWIP LIL SDA RT+ETLKIMQEQV   +EAEVHF+SSFYS+AAMDGQTAEHL
Sbjct  89    RRLQQLGWIPELILSSDAARTKETLKIMQEQVQELVEAEVHFVSSFYSIAAMDGQTAEHL  148

Query  789   RQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLA  968
             ++ IC+YS+D+ILT+MCMGHNRGWEEAASMFSGA +ELKTCNAALLE  GKSW+E F+ A
Sbjct  149   QKIICRYSRDEILTIMCMGHNRGWEEAASMFSGATVELKTCNAALLETAGKSWDEAFATA  208

Query  969   GLGGWELQGIVKP  1007
             G GGW+LQGI+KP
Sbjct  209   GFGGWKLQGIIKP  221



>ref|XP_007147554.1| hypothetical protein PHAVU_006G134500g [Phaseolus vulgaris]
 gb|ESW19548.1| hypothetical protein PHAVU_006G134500g [Phaseolus vulgaris]
Length=232

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 155/180 (86%), Gaps = 1/180 (1%)
 Frame = +3

Query  468   PASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLI  647
             P SDS   + RRLILLRHA SSW +RSLRDHDRPLSKSG+  A RVS +L +LGWIP LI
Sbjct  52    PFSDSVS-VSRRLILLRHAKSSWANRSLRDHDRPLSKSGKEDAVRVSRKLQELGWIPELI  110

Query  648   LCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDIL  827
             L SDA RT+ETLKIMQEQV   +EAEVHF+SSFYS+AAMDGQTAEHL++ IC+YSKD+IL
Sbjct  111   LSSDAARTKETLKIMQEQVQELVEAEVHFVSSFYSIAAMDGQTAEHLQKIICRYSKDEIL  170

Query  828   TVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             TVMCMGHNRGWEEAASMFSGA +ELKTCNAALLE  GKSW+E F+ AG GGW+LQGIVKP
Sbjct  171   TVMCMGHNRGWEEAASMFSGASVELKTCNAALLETAGKSWDEAFATAGFGGWKLQGIVKP  230



>ref|XP_006467252.1| PREDICTED: uncharacterized protein LOC102630087 isoform X3 [Citrus 
sinensis]
Length=239

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 160/195 (82%), Gaps = 0/195 (0%)
 Frame = +3

Query  423   TGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAAR  602
             +G +  Q    ET    +   Q + RRLILLRHA SSWE  SLRDHDRPLSK+GQ  A +
Sbjct  41    SGRLASQSLVIETNVTGTAEDQSVARRLILLRHAKSSWEFPSLRDHDRPLSKAGQDDAIK  100

Query  603   VSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAE  782
             VS  L QLGWIP LIL SDAVRTR+TL+IMQ+ V  FLEAEVHF+SSFYSVAAMDGQTAE
Sbjct  101   VSQRLQQLGWIPQLILSSDAVRTRQTLEIMQQHVQGFLEAEVHFISSFYSVAAMDGQTAE  160

Query  783   HLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFS  962
             HL++AICKYS+D+ILTVMCMGHNRGWEEAASMF+GA IELKTCNAALLE TGKSWEE F+
Sbjct  161   HLQKAICKYSRDEILTVMCMGHNRGWEEAASMFTGAFIELKTCNAALLETTGKSWEEAFT  220

Query  963   LAGLGGWELQGIVKP  1007
              AGLGGW+LQGIV P
Sbjct  221   AAGLGGWKLQGIVTP  235



>ref|XP_004293433.1| PREDICTED: uncharacterized protein LOC101310200 [Fragaria vesca 
subsp. vesca]
Length=242

 Score =   291 bits (744),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 167/201 (83%), Gaps = 7/201 (3%)
 Frame = +3

Query  405   ASMVIDTGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSG  584
             +S++I+T  V+ Q A+   Q P+S     + RRLILLRHA SSWED SL+DHDRPLS+ G
Sbjct  48    SSLLIET--VEGQVAADSEQAPSS-----VARRLILLRHAKSSWEDPSLKDHDRPLSEKG  100

Query  585   QLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAM  764
             Q  A  +SH+L QLGW+P LIL S+A+RTRETL+IMQ+QV  FLEAEVH+ SSFYS+AAM
Sbjct  101   QADAVEISHKLQQLGWVPQLILSSNALRTRETLRIMQQQVKGFLEAEVHYFSSFYSIAAM  160

Query  765   DGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKS  944
             DGQTAEHL++ IC YS+DDILTVMCMGHNRGWEEAASM +GA IELKTCNAALLE TGKS
Sbjct  161   DGQTAEHLQRIICNYSRDDILTVMCMGHNRGWEEAASMLTGASIELKTCNAALLETTGKS  220

Query  945   WEETFSLAGLGGWELQGIVKP  1007
             W+E F+LAG GGW+LQGIVKP
Sbjct  221   WDEAFALAGHGGWKLQGIVKP  241



>gb|EPS67529.1| hypothetical protein M569_07243, partial [Genlisea aurea]
Length=181

 Score =   288 bits (738),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = +3

Query  492   LPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRT  671
             + RRLILLRHA SSWE RSL+DHDRPLSKSG+  A ++S +L +LGWIP LIL SDA R+
Sbjct  9     VSRRLILLRHARSSWEQRSLKDHDRPLSKSGKADAVKLSQKLERLGWIPELILSSDAERS  68

Query  672   RETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
             +ETL+IMQEQV AF++AEVHF+SSFYS+AAMDGQTAEHL++ ICKYS + ILTVMCMGHN
Sbjct  69    KETLRIMQEQVRAFVKAEVHFISSFYSIAAMDGQTAEHLQRMICKYSTNQILTVMCMGHN  128

Query  852   RGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPD  1010
             +GWEEAASMFSGA IELKTCNAALLEATG+SWEE FS+AG GGW LQGIVKPD
Sbjct  129   KGWEEAASMFSGASIELKTCNAALLEATGRSWEEAFSMAGYGGWRLQGIVKPD  181



>ref|XP_006449957.1| hypothetical protein CICLE_v10016151mg [Citrus clementina]
 gb|ESR63197.1| hypothetical protein CICLE_v10016151mg [Citrus clementina]
Length=288

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 143/195 (73%), Positives = 160/195 (82%), Gaps = 0/195 (0%)
 Frame = +3

Query  423   TGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAAR  602
             +G +  Q    ET    +   Q + RRLILLRHA SSWE  SLRDHDRPLSK+GQ  A +
Sbjct  90    SGRLSSQSLVIETNVTGTAEDQSVARRLILLRHAKSSWEFPSLRDHDRPLSKAGQDDAIK  149

Query  603   VSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAE  782
             VS  L QLGWIP LIL SDAVRTR+TL+IMQ+ V  FLEAEVHF+SSFYSVAAMDGQTAE
Sbjct  150   VSRRLQQLGWIPQLILSSDAVRTRQTLEIMQQHVQGFLEAEVHFISSFYSVAAMDGQTAE  209

Query  783   HLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFS  962
             HL++AICKYS+D+ILTVMCMGHNRGWEEAASMF+GA IELKTCNAALLE TGKSWEE F+
Sbjct  210   HLQKAICKYSRDEILTVMCMGHNRGWEEAASMFTGAFIELKTCNAALLETTGKSWEEAFT  269

Query  963   LAGLGGWELQGIVKP  1007
              AGLGGW+LQGIV P
Sbjct  270   AAGLGGWKLQGIVTP  284



>ref|XP_003535014.1| PREDICTED: uncharacterized protein LOC100789290 [Glycine max]
Length=230

 Score =   289 bits (740),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRLILLRHA SSW++RSLRDHDRPLSKSG+  A RVS  L QLGWIP LIL SDA RT+E
Sbjct  59    RRLILLRHAKSSWDNRSLRDHDRPLSKSGKEDAVRVSRRLQQLGWIPELILSSDAARTKE  118

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
             TLKIMQEQV   +EAEVHF+SSFYS+AAMDGQTAEHL++ ICKYS+D+ILT+MCMGHNRG
Sbjct  119   TLKIMQEQVQELVEAEVHFVSSFYSIAAMDGQTAEHLQKIICKYSRDEILTIMCMGHNRG  178

Query  858   WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             WEEAASMFSGA +ELKTCNAALLE+ GKSW+E F+ AG GGW+LQGI+KP
Sbjct  179   WEEAASMFSGASVELKTCNAALLESAGKSWDEAFATAGFGGWKLQGIIKP  228



>ref|XP_009374810.1| PREDICTED: uncharacterized protein LOC103963698 [Pyrus x bretschneideri]
Length=248

 Score =   287 bits (735),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 155/182 (85%), Gaps = 4/182 (2%)
 Frame = +3

Query  474   SDSAQFLP----RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPG  641
             SDS Q  P    RRLILLRHA+SSW D SL+DHDRPLS+ GQ  A +VS +L +LGWIP 
Sbjct  64    SDSEQTPPPSVARRLILLRHANSSWVDPSLKDHDRPLSERGQADAVKVSLKLQELGWIPQ  123

Query  642   LILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDD  821
             LIL S+AVRTRETL IMQ+QV  FLEAEVH++SSFYS+AAMDGQTAEHL+  IC YS+DD
Sbjct  124   LILSSNAVRTRETLTIMQQQVRGFLEAEVHYISSFYSIAAMDGQTAEHLQHIICNYSRDD  183

Query  822   ILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIV  1001
             ILTVMCMGHNRGWEEAASMF+GA IELKTCNAALLE TGKSW+E F+LAG GGW+LQGIV
Sbjct  184   ILTVMCMGHNRGWEEAASMFTGASIELKTCNAALLETTGKSWDEAFTLAGFGGWKLQGIV  243

Query  1002  KP  1007
             KP
Sbjct  244   KP  245



>emb|CDP04563.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   286 bits (733),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/196 (71%), Positives = 163/196 (83%), Gaps = 4/196 (2%)
 Frame = +3

Query  423   TGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAAR  602
             TGSV ++  +P  Q   S+S   + RRLILLRHA SSWE+RSLRDHDRPL+K+G+  A +
Sbjct  45    TGSVVVE-TTPSQQETYSNS---VVRRLILLRHADSSWENRSLRDHDRPLTKNGREDAIK  100

Query  603   VSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAE  782
             VS +L  LGWIP LIL SD+ RTRETL IM+++V  FLEAEVHFLSSFYSVAAMDGQTAE
Sbjct  101   VSQKLQLLGWIPELILSSDSRRTRETLNIMRKEVRGFLEAEVHFLSSFYSVAAMDGQTAE  160

Query  783   HLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFS  962
             HLRQAI +YS D+ILTVMCMGHN+GWEEAAS FSG  +ELKTCNAALLEA GK+WEE F+
Sbjct  161   HLRQAISEYSTDEILTVMCMGHNKGWEEAASTFSGVSVELKTCNAALLEAAGKTWEEAFA  220

Query  963   LAGLGGWELQGIVKPD  1010
             LAG+GGW+L GIVKPD
Sbjct  221   LAGIGGWKLHGIVKPD  236



>ref|XP_004486399.1| PREDICTED: uncharacterized protein LOC101505808 isoform X2 [Cicer 
arietinum]
Length=227

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 158/193 (82%), Gaps = 3/193 (2%)
 Frame = +3

Query  429   SVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVS  608
             S+ +Q+   + + P SDS   + RRLILLRHA SSWE  SLRDHDRPLSKSG+  A +VS
Sbjct  36    SILIQKQDSKLKDPLSDS---VYRRLILLRHADSSWEHPSLRDHDRPLSKSGKEDAVKVS  92

Query  609   HELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHL  788
              ++ QLGWIP LIL SDA RT+ETLKIMQEQV   LEAEVHF+SSFYS+AAMDGQTAEHL
Sbjct  93    LKIQQLGWIPELILSSDAARTKETLKIMQEQVKELLEAEVHFVSSFYSIAAMDGQTAEHL  152

Query  789   RQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLA  968
             +  IC+YS+D+ILTVMCMGHN+GWEEAASMF GA +ELKTCNAALLE  GKSW E F+ A
Sbjct  153   QNVICRYSRDEILTVMCMGHNKGWEEAASMFCGASVELKTCNAALLETAGKSWNEAFATA  212

Query  969   GLGGWELQGIVKP  1007
             G GGW+LQGI+KP
Sbjct  213   GFGGWKLQGILKP  225



>gb|KHG13569.1| Uncharacterized protein F383_16990 [Gossypium arboreum]
Length=231

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/183 (70%), Positives = 156/183 (85%), Gaps = 0/183 (0%)
 Frame = +3

Query  471   ASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLIL  650
             A+  AQ   RRLILLRHA SSW+  SLRDHDRPLSK+G++ A  VS +L ++GWIP LIL
Sbjct  49    AASEAQPASRRLILLRHAKSSWQHPSLRDHDRPLSKTGRIDAVTVSRKLERMGWIPQLIL  108

Query  651   CSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILT  830
             CSDA+RTRETL IMQE+   FLEAEVHF+SS+YS+AAMDGQTAEHL++ IC+YS+D++ T
Sbjct  109   CSDALRTRETLNIMQEEARGFLEAEVHFISSYYSIAAMDGQTAEHLQRTICQYSRDELFT  168

Query  831   VMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPD  1010
             +MCMGHNRGWEEAASMF+GA +ELKTCNAALLEA GKSWEE F++AG GGW+LQGIV P 
Sbjct  169   IMCMGHNRGWEEAASMFTGASVELKTCNAALLEAPGKSWEEAFAVAGYGGWKLQGIVTPS  228

Query  1011  IDV  1019
              ++
Sbjct  229   SNL  231



>ref|XP_007026442.1| Phosphoglycerate mutase family protein [Theobroma cacao]
 gb|EOY29064.1| Phosphoglycerate mutase family protein [Theobroma cacao]
Length=361

 Score =   286 bits (731),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/183 (74%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = +3

Query  471   ASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLIL  650
             A+  AQ + RRLILLRHA SSW+  +LRDHDRPLSK+G+  AA VS +L  +GWIP LIL
Sbjct  179   AASEAQPVSRRLILLRHAKSSWQHTALRDHDRPLSKTGRADAALVSKKLQHMGWIPQLIL  238

Query  651   CSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILT  830
              SDA+RTR TL IMQEQV  FLEAEVHF+SSFYS+AAMDGQTAEHL++ IC+YS+D+ILT
Sbjct  239   SSDALRTRATLNIMQEQVRGFLEAEVHFISSFYSIAAMDGQTAEHLQRTICQYSRDEILT  298

Query  831   VMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPD  1010
             +MCMGHNRGWEEAASMF+GA IELKTCNAALLEATGKSWEE FS+AG GGW+LQGIV P 
Sbjct  299   IMCMGHNRGWEEAASMFTGASIELKTCNAALLEATGKSWEEAFSVAGFGGWKLQGIVTPS  358

Query  1011  IDV  1019
              ++
Sbjct  359   SNL  361



>ref|XP_004134818.1| PREDICTED: uncharacterized protein LOC101211960 [Cucumis sativus]
 ref|XP_004163398.1| PREDICTED: uncharacterized protein LOC101223568 [Cucumis sativus]
 gb|KGN49008.1| hypothetical protein Csa_6G510260 [Cucumis sativus]
Length=233

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 164/199 (82%), Gaps = 1/199 (1%)
 Frame = +3

Query  417   IDTGSVQLQQASPETQTP-ASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLA  593
             I   S  +Q A  E  T  A+  ++ + RRLILLRHA SS +  S+RDHDRPLSK G++ 
Sbjct  32    IQWSSAVIQTAESEVATEEAASQSESVARRLILLRHARSSRQKLSVRDHDRPLSKDGKVD  91

Query  594   AARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQ  773
             A +++H+L +L WIP LIL SDA RTRETLK+MQEQV  FLEAEVHF+SSFYS+AAMDGQ
Sbjct  92    AIKIAHKLQELSWIPELILSSDAKRTRETLKLMQEQVSGFLEAEVHFISSFYSIAAMDGQ  151

Query  774   TAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEE  953
             TA+HL+Q IC YS+++I+TVMCMGHN+GWEEAASMFSG+ I+LKTCNAALLEA+GKSW+E
Sbjct  152   TADHLQQVICNYSRNEIVTVMCMGHNKGWEEAASMFSGSSIKLKTCNAALLEASGKSWDE  211

Query  954   TFSLAGLGGWELQGIVKPD  1010
              F+LAGLGGW+L GIVKP+
Sbjct  212   AFALAGLGGWKLHGIVKPN  230



>ref|XP_003594381.1| hypothetical protein MTR_2g028000 [Medicago truncatula]
 gb|AES64632.1| histidine phosphatase family (branch 1) protein [Medicago truncatula]
 gb|AFK39417.1| unknown [Medicago truncatula]
Length=226

 Score =   280 bits (716),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 157/193 (81%), Gaps = 3/193 (2%)
 Frame = +3

Query  429   SVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVS  608
             S+ + +     + P SDS   + RRLILLRHA SSWE  SLRDHDRPLSKSG+  A +VS
Sbjct  35    SILIPKQDTRLKEPFSDS---ISRRLILLRHAESSWEHPSLRDHDRPLSKSGKEDAVKVS  91

Query  609   HELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHL  788
              +L QLGWIP LIL SDA RT+ETLKIMQEQV   L+AEVHF+SSFYS+AAMDGQTA+HL
Sbjct  92    LKLQQLGWIPELILSSDAARTKETLKIMQEQVQELLDAEVHFVSSFYSIAAMDGQTADHL  151

Query  789   RQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLA  968
             ++ ICKYS+D++LTVMCMGHNRGWEEAASMF GA +ELKTCNAALLE+ GKSW E F  A
Sbjct  152   QKVICKYSRDEMLTVMCMGHNRGWEEAASMFCGASVELKTCNAALLESAGKSWNEAFVAA  211

Query  969   GLGGWELQGIVKP  1007
             G GGW+LQGI+KP
Sbjct  212   GFGGWKLQGILKP  224



>gb|KHN40754.1| hypothetical protein glysoja_015121 [Glycine soja]
Length=264

 Score =   281 bits (720),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/166 (78%), Positives = 147/166 (89%), Gaps = 0/166 (0%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            RRLILLRHA SSW++RSLRDHDRPLSKSG+  A RVS  L QLGWIP LIL SDA RT+E
Sbjct  59   RRLILLRHAKSSWDNRSLRDHDRPLSKSGKEDAVRVSRRLQQLGWIPELILSSDAARTKE  118

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            TLKIMQEQV   +EAEVHF+SSFYS+AAMDGQTAEHL++ ICKYS+D+ILT+MCMGHNRG
Sbjct  119  TLKIMQEQVQELVEAEVHFVSSFYSIAAMDGQTAEHLQKIICKYSRDEILTIMCMGHNRG  178

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
            WEEAASMFSGA +ELKTCNAALLE+ GKSW+E F+ AG GGW+LQG
Sbjct  179  WEEAASMFSGASVELKTCNAALLESAGKSWDEAFATAGFGGWKLQG  224



>ref|XP_010695924.1| PREDICTED: uncharacterized protein LOC104908506 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=239

 Score =   280 bits (716),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = +3

Query  480   SAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSD  659
             S++ + RRLILLRHA S+W + SLRDH+RPLSK+G+  AA VS++L +LGW+P LILCSD
Sbjct  54    SSESVTRRLILLRHAESTWSNHSLRDHERPLSKAGRADAADVSYKLQRLGWVPELILCSD  113

Query  660   AVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMC  839
             A RTRETL +MQE+   FL+A VHF  SFYSVAAMDGQTAEHL+Q ICK+S DDILTVMC
Sbjct  114   AARTRETLSVMQERCTGFLQAAVHFFPSFYSVAAMDGQTAEHLQQMICKFSSDDILTVMC  173

Query  840   MGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPD  1010
             MGHN+GWEEAASMF+G+ IELKTCNAALLEATGKSWEE F  AGLGGW+LQG+VKP+
Sbjct  174   MGHNKGWEEAASMFTGSVIELKTCNAALLEATGKSWEEAFESAGLGGWKLQGLVKPN  230



>emb|CBI35724.3| unnamed protein product [Vitis vinifera]
Length=234

 Score =   278 bits (710),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 149/173 (86%), Gaps = 0/173 (0%)
 Frame = +3

Query  456  ETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWI  635
            E Q      ++ + RRLILLRHA SSW DRSLRDHDRPLSK+G+  A  +SH+L QLGWI
Sbjct  62   EDQVDGEARSESVARRLILLRHAKSSWTDRSLRDHDRPLSKAGRADAINISHKLQQLGWI  121

Query  636  PGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSK  815
            P LILCSDA+RTRETLKIMQEQV  F EAEVHF+SSFYS+AAMDGQTAEHL+QAICK+S+
Sbjct  122  PELILCSDAMRTRETLKIMQEQVRGFSEAEVHFISSFYSIAAMDGQTAEHLQQAICKFSR  181

Query  816  DDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGL  974
            D+ILTVMCMGHNRGWEEAASMFSGA IELKTCNAALLEATGKSWEE  +L+ L
Sbjct  182  DEILTVMCMGHNRGWEEAASMFSGASIELKTCNAALLEATGKSWEEVGNLSFL  234



>ref|XP_006857591.1| hypothetical protein AMTR_s00061p00089940 [Amborella trichopoda]
 gb|ERN19058.1| hypothetical protein AMTR_s00061p00089940 [Amborella trichopoda]
Length=241

 Score =   278 bits (710),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 157/181 (87%), Gaps = 3/181 (2%)
 Frame = +3

Query  474   SDSAQFLP--RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLI  647
             +DSA+  P  RRL+LLRHA SSW+DR+LRDHDRPLSK+G++ A  +SH+L ++GW+P LI
Sbjct  57    NDSAKEEPVTRRLVLLRHAKSSWKDRTLRDHDRPLSKAGRVDAMNISHKLHRMGWVPELI  116

Query  648   LCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDIL  827
             L SDA+RTRETL+IMQE V  FLEAEV F++SFYS+AAMDGQTAEHL++ IC+ S+D+IL
Sbjct  117   LSSDAIRTRETLQIMQEHVQGFLEAEVRFVASFYSIAAMDGQTAEHLQEVICEISRDEIL  176

Query  828   TVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             T+MCMGHNRGWEEAASM SG PIELKTCNAALLEA+G+SWEE FS  GLGGW L G+VKP
Sbjct  177   TIMCMGHNRGWEEAASMLSGTPIELKTCNAALLEASGRSWEEAFS-TGLGGWRLLGVVKP  235

Query  1008  D  1010
             D
Sbjct  236   D  236



>ref|XP_002525240.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37206.1| conserved hypothetical protein [Ricinus communis]
Length=262

 Score =   278 bits (712),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = +3

Query  477   DSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCS  656
             +S+  + RRLILLRHA SSW++ SLRDHDRPLS +G+  AA V+ +L QL WIP LIL S
Sbjct  82    NSSNSVGRRLILLRHAKSSWDNSSLRDHDRPLSPAGRADAANVTLKLQQLDWIPQLILSS  141

Query  657   DAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVM  836
             DA RTRETL +MQ+QVP+FL+A+V+F+SSFYS+AAMDGQTAEHL+Q ICKYS DDI TVM
Sbjct  142   DATRTRETLGLMQQQVPSFLDAQVYFISSFYSIAAMDGQTAEHLQQVICKYSTDDIHTVM  201

Query  837   CMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             CMGHNRGWEEAAS+F+GA +ELKTCNAALL+ATGKSWEE F+LAG GGW+L GIVKP
Sbjct  202   CMGHNRGWEEAASVFTGASVELKTCNAALLKATGKSWEEAFALAGHGGWKLLGIVKP  258



>ref|XP_008440939.1| PREDICTED: uncharacterized protein LOC103485205 [Cucumis melo]
Length=233

 Score =   277 bits (709),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 161/195 (83%), Gaps = 1/195 (1%)
 Frame = +3

Query  429   SVQLQQASPETQTP-ASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARV  605
             S  +Q A  E  T  A+  ++ + RRLILLRHA SS +  SLRDHDRPLSK G++ A ++
Sbjct  36    SAVIQTAESEVATEEAASQSESVARRLILLRHARSSRQKLSLRDHDRPLSKDGKVDAIKI  95

Query  606   SHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEH  785
             +H+L +L WIP LIL SDA RTRETLK+MQEQV  F EAEVHF+SSFYS+AAMDGQTA+H
Sbjct  96    AHKLQELSWIPELILSSDAKRTRETLKLMQEQVSGFSEAEVHFVSSFYSIAAMDGQTADH  155

Query  786   LRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSL  965
             L+Q IC YS+++I+TVMCMGHN+GWEEAASMFSG+ I+LKTCNAALLEA+GKSW E F+L
Sbjct  156   LQQVICDYSRNEIVTVMCMGHNKGWEEAASMFSGSSIKLKTCNAALLEASGKSWNEAFAL  215

Query  966   AGLGGWELQGIVKPD  1010
             AGLGGW+L GIVKP+
Sbjct  216   AGLGGWKLHGIVKPN  230



>ref|XP_010539948.1| PREDICTED: uncharacterized protein LOC104813862 [Tarenaya hassleriana]
Length=227

 Score =   269 bits (688),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = +3

Query  492   LPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRT  671
             +PRRLILLRHAHSSW+D SLRDH+RPLSK+G+  AA+VS  + +LGW+P LIL SDA RT
Sbjct  50    MPRRLILLRHAHSSWDDSSLRDHERPLSKAGRADAAKVSQIICRLGWVPQLILSSDAART  109

Query  672   RETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
             RETL+IMQ+QV   +E EVHF+ SFYS+AAMDGQTAEH+++ +C++S D+I TVMCMGHN
Sbjct  110   RETLRIMQDQVGLLMEVEVHFIPSFYSIAAMDGQTAEHIQRTVCRFSTDEITTVMCMGHN  169

Query  852   RGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPDIDV  1019
             +GWEEAAS  +GAP++L+TCNAALL+A+GKSWEE F LAG GGWEL G+  PD ++
Sbjct  170   KGWEEAASFLAGAPVKLETCNAALLQASGKSWEEAFDLAGPGGWELHGVATPDSNI  225



>ref|XP_010515666.1| PREDICTED: uncharacterized protein LOC104791467 [Camelina sativa]
Length=215

 Score =   269 bits (687),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 128/198 (65%), Positives = 154/198 (78%), Gaps = 4/198 (2%)
 Frame = +3

Query  429   SVQLQQASPETQTPASDSAQF----LPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAA  596
             S+  + ++P +  P   +  F    + RRLILLRHAHSSW+D SLRDHDRPLSK+GQ+ A
Sbjct  13    SIPNRSSNPCSTAPPRATTDFAATPISRRLILLRHAHSSWDDVSLRDHDRPLSKAGQVDA  72

Query  597   ARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQT  776
             A+V+  L  LGW+P LIL SDA RTRETLK MQ QV  F+EA VHF+ SFYS+AAMDGQT
Sbjct  73    AKVAQILSSLGWLPQLILSSDATRTRETLKSMQAQVDEFMEANVHFIPSFYSIAAMDGQT  132

Query  777   AEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEET  956
             AEHL Q I KYS  DI TVMCMGHN+GWEEAASM SGA ++LKTCNAALL+A G SW+E 
Sbjct  133   AEHLHQIISKYSTPDITTVMCMGHNKGWEEAASMLSGASVKLKTCNAALLQAFGDSWDEA  192

Query  957   FSLAGLGGWELQGIVKPD  1010
             F+L+G GGW+L+G+V PD
Sbjct  193   FALSGTGGWKLEGVVAPD  210



>ref|XP_007212002.1| hypothetical protein PRUPE_ppa011110mg [Prunus persica]
 gb|EMJ13201.1| hypothetical protein PRUPE_ppa011110mg [Prunus persica]
Length=223

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 153/183 (84%), Gaps = 7/183 (4%)
 Frame = +3

Query  405  ASMVIDTGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSG  584
            +S+VI+T  V+ +  S   +TP      ++ RRLILLRHA+SSWED SL+DHDRPLS++G
Sbjct  36   SSLVIET--VEGKAVSDSERTPP-----YVARRLILLRHANSSWEDPSLKDHDRPLSETG  88

Query  585  QLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAM  764
            Q  A +VSH+L QLGWIP LIL S+AVRTRETL IMQ+QV  FLEAEVH++SSFYS+AAM
Sbjct  89   QADAVKVSHKLQQLGWIPQLILSSNAVRTRETLTIMQQQVRGFLEAEVHYISSFYSIAAM  148

Query  765  DGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKS  944
            DGQTAEHL+  IC YS+DDILTVMCMGHNRGWEEAASMF+GA IELKTCNAALLE TGKS
Sbjct  149  DGQTAEHLQHVICNYSRDDILTVMCMGHNRGWEEAASMFTGASIELKTCNAALLETTGKS  208

Query  945  WEE  953
            W+E
Sbjct  209  WDE  211



>ref|XP_010426820.1| PREDICTED: uncharacterized protein LOC104711768 [Camelina sativa]
Length=215

 Score =   267 bits (682),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 145/176 (82%), Gaps = 0/176 (0%)
 Frame = +3

Query  492   LPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRT  671
             + RRLILLRHAHSSW+D SLRDHDRPLSK+GQ+ AA+V+  L  LGW+P LIL SDA RT
Sbjct  38    ISRRLILLRHAHSSWDDLSLRDHDRPLSKTGQVDAAKVAQILSSLGWLPQLILSSDATRT  97

Query  672   RETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
             RETLK MQ QV  F+EA VHF+ SFYS+AAMDGQTAEHL Q I KYS  DI TVMCMGHN
Sbjct  98    RETLKSMQAQVDEFMEANVHFIPSFYSIAAMDGQTAEHLHQIISKYSTPDITTVMCMGHN  157

Query  852   RGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPDIDV  1019
             +GWEEAASM SGA ++LKTCNAALL+A G SW+E F+L+G GGW+L+G+V PD  +
Sbjct  158   KGWEEAASMLSGASVKLKTCNAALLQAFGDSWDEAFALSGPGGWKLEGVVAPDSSI  213



>ref|XP_010503942.1| PREDICTED: uncharacterized protein LOC104781058 [Camelina sativa]
Length=215

 Score =   266 bits (681),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  492   LPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRT  671
             + RRLILLRHAHSSW+D SLRDHDRPLSK+GQ+ AA+V+  L  LGW+P LIL SDA RT
Sbjct  38    ISRRLILLRHAHSSWDDISLRDHDRPLSKTGQVDAAKVAQILSSLGWLPQLILSSDATRT  97

Query  672   RETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
             RETLK MQ QV  F+EA VHF+ SFYS+AAMDGQTAEHL Q I KYS  DI TVMCMGHN
Sbjct  98    RETLKSMQAQVDEFMEANVHFVPSFYSIAAMDGQTAEHLHQIISKYSTPDITTVMCMGHN  157

Query  852   RGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPD  1010
             +GWEEAASM SGA ++LKTCNAALL+A G SW+E F+L+G GGW+L+G+V PD
Sbjct  158   KGWEEAASMLSGASVKLKTCNAALLQAFGDSWDEAFALSGPGGWKLEGVVAPD  210



>ref|XP_006292491.1| hypothetical protein CARUB_v10018721mg [Capsella rubella]
 gb|EOA25389.1| hypothetical protein CARUB_v10018721mg [Capsella rubella]
Length=218

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/174 (71%), Positives = 142/174 (82%), Gaps = 0/174 (0%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRLILLRHAHSSW+D SLRDHDRPLSK+GQ  AA+V+  L  LGW+P LIL SDA RTRE
Sbjct  43    RRLILLRHAHSSWDDSSLRDHDRPLSKTGQADAAKVAQILSTLGWLPQLILSSDATRTRE  102

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
             TLK MQ QV  F+EA VHF+ SFYS+AAMDGQTAEH+ Q I KYS  DI TVMCMGHN+G
Sbjct  103   TLKSMQAQVDEFMEANVHFIPSFYSIAAMDGQTAEHIHQIISKYSTPDITTVMCMGHNKG  162

Query  858   WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPDIDV  1019
             WEEAASM SGA ++LKTCNAALL+A G SWEE F L+G GGW+L+G+V PD  +
Sbjct  163   WEEAASMLSGASVKLKTCNAALLQAFGDSWEEAFVLSGPGGWKLEGVVAPDSSI  216



>ref|XP_006467250.1| PREDICTED: uncharacterized protein LOC102630087 isoform X1 [Citrus 
sinensis]
Length=244

 Score =   265 bits (678),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = +3

Query  423  TGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAAR  602
            +G +  Q    ET    +   Q + RRLILLRHA SSWE  SLRDHDRPLSK+GQ  A +
Sbjct  41   SGRLASQSLVIETNVTGTAEDQSVARRLILLRHAKSSWEFPSLRDHDRPLSKAGQDDAIK  100

Query  603  VSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAE  782
            VS  L QLGWIP LIL SDAVRTR+TL+IMQ+ V  FLEAEVHF+SSFYSVAAMDGQTAE
Sbjct  101  VSQRLQQLGWIPQLILSSDAVRTRQTLEIMQQHVQGFLEAEVHFISSFYSVAAMDGQTAE  160

Query  783  HLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFS  962
            HL++AICKYS+D+ILTVMCMGHNRGWEEAASMF+GA IELKTCNAALLE TGKSWEE  +
Sbjct  161  HLQKAICKYSRDEILTVMCMGHNRGWEEAASMFTGAFIELKTCNAALLETTGKSWEENLA  220

Query  963  LA  968
            ++
Sbjct  221  VS  222



>ref|NP_566959.1| phosphoglycerate mutase family protein [Arabidopsis thaliana]
 gb|AAK62623.1| AT3g52150/F4F15_260 [Arabidopsis thaliana]
 gb|AAN38695.1| At3g52150/F4F15_260 [Arabidopsis thaliana]
 gb|AEE78905.1| phosphoglycerate mutase family protein [Arabidopsis thaliana]
Length=218

 Score =   264 bits (675),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +3

Query  492   LPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRT  671
             + RRLILLRHAHSSW+D SLRDHDRPLSK+G+  AA+V+  L  LGW+P LIL SDA RT
Sbjct  41    ISRRLILLRHAHSSWDDLSLRDHDRPLSKTGEADAAKVAQILSSLGWLPQLILSSDATRT  100

Query  672   RETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
             RETLK MQ QV  F+EA VHF+ SFYS+AAMDGQTAEHL+  I KYS  DI T+MCMGHN
Sbjct  101   RETLKSMQAQVDGFMEANVHFIPSFYSIAAMDGQTAEHLQNIISKYSTPDISTIMCMGHN  160

Query  852   RGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPDIDV  1019
             +GWEEAASM SGA I+LKTCNAALL+A G SWEE F+L+G GGW+L+G+V PD  +
Sbjct  161   KGWEEAASMLSGASIKLKTCNAALLQAFGNSWEEAFALSGPGGWKLEGLVAPDSSI  216



>ref|XP_006467251.1| PREDICTED: uncharacterized protein LOC102630087 isoform X2 [Citrus 
sinensis]
Length=241

 Score =   265 bits (676),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +3

Query  423  TGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAAR  602
            +G +  Q    ET    +   Q + RRLILLRHA SSWE  SLRDHDRPLSK+GQ  A +
Sbjct  41   SGRLASQSLVIETNVTGTAEDQSVARRLILLRHAKSSWEFPSLRDHDRPLSKAGQDDAIK  100

Query  603  VSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAE  782
            VS  L QLGWIP LIL SDAVRTR+TL+IMQ+ V  FLEAEVHF+SSFYSVAAMDGQTAE
Sbjct  101  VSQRLQQLGWIPQLILSSDAVRTRQTLEIMQQHVQGFLEAEVHFISSFYSVAAMDGQTAE  160

Query  783  HLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEET  956
            HL++AICKYS+D+ILTVMCMGHNRGWEEAASMF+GA IELKTCNAALLE TGKSWEET
Sbjct  161  HLQKAICKYSRDEILTVMCMGHNRGWEEAASMFTGAFIELKTCNAALLETTGKSWEET  218



>gb|KDO78606.1| hypothetical protein CISIN_1g0263792mg [Citrus sinensis]
Length=220

 Score =   264 bits (674),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 145/178 (81%), Gaps = 0/178 (0%)
 Frame = +3

Query  423  TGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAAR  602
            +G +  Q    ET    +   Q + RRLILLRHA SSWE  SLRDHDRPLSK+GQ  A +
Sbjct  41   SGRLASQSLVIETNVTGTAEDQSVARRLILLRHAKSSWEFPSLRDHDRPLSKAGQDDAIK  100

Query  603  VSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAE  782
            VS  L QLGWIP LIL SDAVRTR+TL+IMQ+ V  FLEAEVHF+SSFYSVAAMDGQTAE
Sbjct  101  VSQRLQQLGWIPQLILSSDAVRTRQTLEIMQQHVQGFLEAEVHFISSFYSVAAMDGQTAE  160

Query  783  HLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEET  956
            HL++AICKYS+D+ILTVMCMGHNRGWEEAASMF+GA IELKTCNAALLE TGKSWEE 
Sbjct  161  HLQKAICKYSRDEILTVMCMGHNRGWEEAASMFTGAFIELKTCNAALLETTGKSWEEV  218



>gb|KDO78607.1| hypothetical protein CISIN_1g0263792mg, partial [Citrus sinensis]
Length=217

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 145/177 (82%), Gaps = 0/177 (0%)
 Frame = +3

Query  423  TGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAAR  602
            +G +  Q    ET    +   Q + RRLILLRHA SSWE  SLRDHDRPLSK+GQ  A +
Sbjct  41   SGRLASQSLVIETNVTGTAEDQSVARRLILLRHAKSSWEFPSLRDHDRPLSKAGQDDAIK  100

Query  603  VSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAE  782
            VS  L QLGWIP LIL SDAVRTR+TL+IMQ+ V  FLEAEVHF+SSFYSVAAMDGQTAE
Sbjct  101  VSQRLQQLGWIPQLILSSDAVRTRQTLEIMQQHVQGFLEAEVHFISSFYSVAAMDGQTAE  160

Query  783  HLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEE  953
            HL++AICKYS+D+ILTVMCMGHNRGWEEAASMF+GA IELKTCNAALLE TGKSWEE
Sbjct  161  HLQKAICKYSRDEILTVMCMGHNRGWEEAASMFTGAFIELKTCNAALLETTGKSWEE  217



>tpg|DAA39827.1| TPA: hypothetical protein ZEAMMB73_861648 [Zea mays]
Length=253

 Score =   264 bits (675),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRLILLRH  S+   RS RDHDRPLSK+G+  A  VS++L Q+GWIP LILCSDA+RT+E
Sbjct  84    RRLILLRHGESTAGGRSTRDHDRPLSKAGRADAISVSNKLQQMGWIPELILCSDAMRTKE  143

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
             TLKI+QE V    EA VHF+ SFYS+AAMDGQTAEHL++AIC+YS D+ILTVMCMGHN+G
Sbjct  144   TLKILQEHVQGLSEAVVHFIPSFYSIAAMDGQTAEHLQKAICEYSSDEILTVMCMGHNKG  203

Query  858   WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             WEEAASMFSG  + L+TCNAALLEA GKSW E FS+AGLGGW+L GIVKP
Sbjct  204   WEEAASMFSGDSVALETCNAALLEAAGKSWVEAFSVAGLGGWKLHGIVKP  253



>ref|XP_002462122.1| hypothetical protein SORBIDRAFT_02g019520 [Sorghum bicolor]
 gb|EER98643.1| hypothetical protein SORBIDRAFT_02g019520 [Sorghum bicolor]
Length=242

 Score =   263 bits (671),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRLILLRH  S+   RS RDHDRPLSK+G+  A  VS++L Q+GWIP LILCSDA+RT+E
Sbjct  73    RRLILLRHGESTARGRSTRDHDRPLSKAGRADAISVSNKLQQMGWIPELILCSDAMRTKE  132

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
             TLKI+Q+ V    EA VHF+ SFYS+AAMDGQTAEHL++AIC+YS D+ILTVMCMGHN+G
Sbjct  133   TLKILQDHVQGLSEAVVHFIPSFYSIAAMDGQTAEHLQKAICEYSSDEILTVMCMGHNKG  192

Query  858   WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             WEEAASMFSG  + L+TCNAALLEA GKSW E FSLAGLGGW+L GIVKP
Sbjct  193   WEEAASMFSGDSVVLETCNAALLEAAGKSWVEAFSLAGLGGWKLHGIVKP  242



>ref|NP_001143028.1| uncharacterized protein LOC100275495 [Zea mays]
 gb|ACG28424.1| hypothetical protein [Zea mays]
Length=240

 Score =   262 bits (670),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRLILLRH  S+   RS RDHDRPLSK+G+  A  VS++L Q+GWIP LILCSDA+RT+E
Sbjct  71    RRLILLRHGESTAGGRSTRDHDRPLSKAGRADAISVSNKLQQMGWIPELILCSDAMRTKE  130

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
             TLKI+QE V    EA VHF+ SFYS+AAMDGQTAEHL++AIC+YS D+ILTVMCMGHN+G
Sbjct  131   TLKILQEHVQGLSEAVVHFIPSFYSIAAMDGQTAEHLQKAICEYSSDEILTVMCMGHNKG  190

Query  858   WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             WEEAASMFSG  + L+TCNAALLEA GKSW E FS+AGLGGW+L GIVKP
Sbjct  191   WEEAASMFSGDSVALETCNAALLEAAGKSWVEAFSVAGLGGWKLHGIVKP  240



>ref|XP_002876128.1| hypothetical protein ARALYDRAFT_348313 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52387.1| hypothetical protein ARALYDRAFT_348313 [Arabidopsis lyrata subsp. 
lyrata]
Length=467

 Score =   270 bits (690),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 144/176 (82%), Gaps = 0/176 (0%)
 Frame = +3

Query  492   LPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRT  671
             + RRLILLRHAHSSW+D SLRDHDRPLSK+GQ  AA+V+  L  LGW+P LIL SDA RT
Sbjct  290   ISRRLILLRHAHSSWDDLSLRDHDRPLSKTGQADAAKVAQILSSLGWLPQLILSSDATRT  349

Query  672   RETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
             RETLK MQ QV  F+EA VHF+ SFYS+AAMDGQTAEHL+  I KYS  DI T+MCMGHN
Sbjct  350   RETLKSMQAQVDEFMEANVHFIPSFYSIAAMDGQTAEHLQNIISKYSTPDISTIMCMGHN  409

Query  852   RGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPDIDV  1019
             +GWEEAASM SGA ++LKTCNAALL+A G SWEE F+L+G GGW+L+G+V PD  +
Sbjct  410   KGWEEAASMLSGASVKLKTCNAALLQAFGNSWEEAFALSGPGGWKLEGLVAPDSSI  465



>ref|XP_006661201.1| PREDICTED: uncharacterized protein LOC102719616, partial [Oryza 
brachyantha]
Length=180

 Score =   259 bits (663),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RR+ILLRH  S+   R  RDHDRPLSK+G+ AA  VS++L Q+GWIP L+LCSDA RT+E
Sbjct  11    RRVILLRHGESAAGGRLTRDHDRPLSKAGRSAAISVSNKLQQMGWIPELVLCSDATRTKE  70

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
             TLKI+QE V    EA VHF+ SFYS+AAMDGQTAEHL++AIC+YS D+ILTVMCMGHN+G
Sbjct  71    TLKILQEHVKGLSEAIVHFIPSFYSIAAMDGQTAEHLQKAICEYSSDEILTVMCMGHNKG  130

Query  858   WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             WEEAASMFSG  + LKTCNAALLEA GKSW E FSLAGLGGW+L GIVKP
Sbjct  131   WEEAASMFSGDSVVLKTCNAALLEAEGKSWVEAFSLAGLGGWKLHGIVKP  180



>ref|XP_006403836.1| hypothetical protein EUTSA_v10010705mg [Eutrema salsugineum]
 gb|ESQ45289.1| hypothetical protein EUTSA_v10010705mg [Eutrema salsugineum]
Length=219

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 144/177 (81%), Gaps = 0/177 (0%)
 Frame = +3

Query  489   FLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVR  668
              + RRLILLRHAHSSWE  SLRDHDRPL+K+GQ  AA+V+  L  LGW+P LIL SDA R
Sbjct  41    LISRRLILLRHAHSSWEHLSLRDHDRPLTKAGQADAAKVAQILSTLGWLPQLILSSDATR  100

Query  669   TRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGH  848
             TRETLK MQ QV  F+EA V+F+ SFYS+AAMDGQTA+HL+Q I KYS  DI T+MCMGH
Sbjct  101   TRETLKSMQAQVDGFMEANVNFVPSFYSIAAMDGQTADHLQQIITKYSTPDITTIMCMGH  160

Query  849   NRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPDIDV  1019
             N+GWEEAASM SGA ++LKTCNAALL+A G SWEE F+LAG GGW+L+G+V PD  +
Sbjct  161   NKGWEEAASMLSGASVKLKTCNAALLQAFGNSWEEAFALAGPGGWKLEGVVAPDSSI  217



>dbj|BAJ92725.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=239

 Score =   261 bits (666),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 156/207 (75%), Gaps = 3/207 (1%)
 Frame = +3

Query  390   AIAAAASMVIDTGSVQLQQASPETQTPASDSAQFLPRR-LILLRHAHSSWEDRSLRDHDR  566
             A A A S+ + T  V    A+ E  +  SDSA   PRR LILLRH  S+  +R  RDHDR
Sbjct  35    AAAVARSVSVSTTVVDAPAAAAEPGS--SDSASATPRRRLILLRHGDSAVGERFTRDHDR  92

Query  567   PLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSF  746
             PLSKSG+  A  VS +  ++GWIP LILCSDA RT+ETL+IMQE V    ++ VHF+ SF
Sbjct  93    PLSKSGRADAISVSDKFHKMGWIPELILCSDATRTKETLQIMQEHVQGLSQSLVHFIPSF  152

Query  747   YSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALL  926
             YS+AAMDGQTAEHL++AIC+YS D+ILTVMCMGHN+GWEEAASMFSG  + LKTCNAALL
Sbjct  153   YSIAAMDGQTAEHLQKAICEYSTDEILTVMCMGHNKGWEEAASMFSGDSVVLKTCNAALL  212

Query  927   EATGKSWEETFSLAGLGGWELQGIVKP  1007
             EA GKSW E FS AGLGGW+L GIVKP
Sbjct  213   EAAGKSWIEAFSQAGLGGWKLHGIVKP  239



>gb|EEC84268.1| hypothetical protein OsI_30728 [Oryza sativa Indica Group]
Length=248

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 146/179 (82%), Gaps = 2/179 (1%)
 Frame = +3

Query  477   DSAQFLP--RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLIL  650
             D+A   P  RRLILLRH  S+   R  RDHDRPLSK+G+ AA  VS++L Q+GWIP L+L
Sbjct  70    DAAPAAPSRRRLILLRHGESAAGGRLTRDHDRPLSKAGRAAAISVSNKLQQMGWIPELVL  129

Query  651   CSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILT  830
             CSDA RT+ETLKI+Q+ V    EA VHF+ SFYS+AAMDGQTAEHL++AIC+YS D+ILT
Sbjct  130   CSDATRTKETLKILQDHVKGLSEAIVHFIPSFYSIAAMDGQTAEHLQKAICQYSSDEILT  189

Query  831   VMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             VMCMGHN+GWEEAASMFSG  + LKTCNAALLEA GKSW E FSLAGLGGW+L GIVKP
Sbjct  190   VMCMGHNKGWEEAASMFSGDSVVLKTCNAALLEAEGKSWVEAFSLAGLGGWKLHGIVKP  248



>ref|XP_004956482.1| PREDICTED: uncharacterized protein LOC101780209 [Setaria italica]
Length=237

 Score =   260 bits (664),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 142/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRLILLRH  S+   R  RDHDRPLSK+G+  A  VS++L Q+GWIP LILCSDA+RT+E
Sbjct  68    RRLILLRHGESAAGGRFTRDHDRPLSKAGRADAISVSNKLQQMGWIPELILCSDAMRTKE  127

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
             TLKI+QE V    +A VHF+ SFYS+AAMDGQTAEHL++AIC+YS D+ILTVMCMGHN+G
Sbjct  128   TLKILQEHVQGLSQAVVHFIPSFYSIAAMDGQTAEHLQKAICEYSSDEILTVMCMGHNKG  187

Query  858   WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             WEEAASMFSG  + LKTCNAALLEA GKSW E FSLAGLGGW+L GIVKP
Sbjct  188   WEEAASMFSGDSVVLKTCNAALLEAAGKSWVEAFSLAGLGGWKLHGIVKP  237



>ref|XP_004486398.1| PREDICTED: uncharacterized protein LOC101505808 isoform X1 [Cicer 
arietinum]
Length=237

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 142/178 (80%), Gaps = 3/178 (2%)
 Frame = +3

Query  426  GSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARV  605
             S+ +Q+   + + P SDS     RRLILLRHA SSWE  SLRDHDRPLSKSG+  A +V
Sbjct  35   SSILIQKQDSKLKDPLSDSVY---RRLILLRHADSSWEHPSLRDHDRPLSKSGKEDAVKV  91

Query  606  SHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEH  785
            S ++ QLGWIP LIL SDA RT+ETLKIMQEQV   LEAEVHF+SSFYS+AAMDGQTAEH
Sbjct  92   SLKIQQLGWIPELILSSDAARTKETLKIMQEQVKELLEAEVHFVSSFYSIAAMDGQTAEH  151

Query  786  LRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETF  959
            L+  IC+YS+D+ILTVMCMGHN+GWEEAASMF GA +ELKTCNAALLE  GKSW E  
Sbjct  152  LQNVICRYSRDEILTVMCMGHNKGWEEAASMFCGASVELKTCNAALLETAGKSWNEVL  209



>ref|XP_010910101.1| PREDICTED: uncharacterized protein LOC105036058 isoform X2 [Elaeis 
guineensis]
Length=230

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = +3

Query  519   HAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQE  698
             HA S+  DR  +DHDRPLSK+G+  A  VS++L Q+GWIP LIL S+A RT+ETL+IMQE
Sbjct  64    HAESALGDRFTKDHDRPLSKAGRADAISVSYKLQQMGWIPELILSSNATRTKETLQIMQE  123

Query  699   QVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASM  878
                 F EAEV+F+ SFYSVAAMDGQTAEHL++A+C+YS+D+ILTVMCMGHNRGWEEAASM
Sbjct  124   HAQGFSEAEVYFIPSFYSVAAMDGQTAEHLQKAVCEYSRDEILTVMCMGHNRGWEEAASM  183

Query  879   FSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPD  1010
             FSGA +ELKTCNAALLEATGKSW+E F+LAGLGGW+L G+VKPD
Sbjct  184   FSGATVELKTCNAALLEATGKSWDEAFTLAGLGGWKLCGVVKPD  227



>emb|CDX90616.1| BnaA03g41650D [Brassica napus]
Length=219

 Score =   256 bits (654),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 124/197 (63%), Positives = 148/197 (75%), Gaps = 1/197 (1%)
 Frame = +3

Query  423   TGSVQLQQASPETQTPASDS-AQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAA  599
             T +     A P   T  + S +  + RRLILLRHAHSSW+  SL+DHDRPL+K+G   AA
Sbjct  18    TTTTSCSTAPPRASTELTASPSSLISRRLILLRHAHSSWDHLSLKDHDRPLTKTGHADAA  77

Query  600   RVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTA  779
             +V+  L  LGW+P LIL SDA RT+ETLK MQ QV  F+EA VHF+ SFYS+AAMDGQTA
Sbjct  78    KVAQILSSLGWLPQLILSSDATRTKETLKSMQAQVDGFMEANVHFIPSFYSIAAMDGQTA  137

Query  780   EHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETF  959
             +HL+  I KYS  DI TVMCMGHN+GWEEAASM SGA ++LKTCNAALL A G SW++ F
Sbjct  138   DHLQHIISKYSSPDITTVMCMGHNKGWEEAASMLSGASVKLKTCNAALLLAFGNSWDDAF  197

Query  960   SLAGLGGWELQGIVKPD  1010
             SLAG GGW+L+GIV PD
Sbjct  198   SLAGPGGWKLEGIVAPD  214



>ref|XP_009136660.1| PREDICTED: uncharacterized protein LOC103860747 isoform X1 [Brassica 
rapa]
Length=219

 Score =   256 bits (654),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 123/197 (62%), Positives = 149/197 (76%), Gaps = 1/197 (1%)
 Frame = +3

Query  423   TGSVQLQQASPETQTPASDS-AQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAA  599
             T +     A P   T  + S +  + RRLILLRHAHSSW+  SL+DHDRPL+K+GQ  AA
Sbjct  18    TTTTSCSTAPPRASTELTASPSSLISRRLILLRHAHSSWDHLSLKDHDRPLTKTGQADAA  77

Query  600   RVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTA  779
             +V+  L  LGW+P LIL SDA RT+ETLK MQ QV  F+EA VHF+ SFYS+AAMDGQTA
Sbjct  78    KVAQILSSLGWLPQLILSSDATRTKETLKSMQAQVDGFMEANVHFIPSFYSIAAMDGQTA  137

Query  780   EHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETF  959
             +HL+  I KYS  DI TVMCMGHN+GWEEAASM SGA ++LKTCNAALL A G SW++ F
Sbjct  138   DHLQHIISKYSSPDITTVMCMGHNKGWEEAASMLSGASVKLKTCNAALLLAFGNSWDDAF  197

Query  960   SLAGLGGWELQGIVKPD  1010
             ++AG GGW+L+GIV PD
Sbjct  198   AMAGPGGWKLEGIVAPD  214



>emb|CDY29066.1| BnaC07g32720D [Brassica napus]
Length=218

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 146/184 (79%), Gaps = 4/184 (2%)
 Frame = +3

Query  459   TQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIP  638
             T +P+S     + RRLILLRHAHSSW+  SL+DHDRPL+K+GQ  AA+V+  L  LGW+P
Sbjct  34    TASPSS----LISRRLILLRHAHSSWDHLSLKDHDRPLTKTGQADAAKVAQILSSLGWLP  89

Query  639   GLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKD  818
              LIL SDA RT+ETLK MQ QV  F+EA VHF+ SFYS+AAMDGQTA+HL+  I KYS  
Sbjct  90    QLILSSDATRTKETLKSMQAQVDGFMEANVHFIPSFYSIAAMDGQTADHLQHIISKYSSP  149

Query  819   DILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGI  998
             DI TVMCMGHN+GWEEAASM SGA ++LKTCNAALL A G SW++ F++AG GGW+L+GI
Sbjct  150   DITTVMCMGHNKGWEEAASMLSGASVKLKTCNAALLLAFGNSWDDAFAMAGPGGWKLEGI  209

Query  999   VKPD  1010
             V PD
Sbjct  210   VAPD  213



>tpg|DAA60894.1| TPA: hypothetical protein ZEAMMB73_766231 [Zea mays]
Length=240

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 152/198 (77%), Gaps = 1/198 (1%)
 Frame = +3

Query  414   VIDTGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLA  593
             V+ + SV L   + E     + SA    RRLILLRH  S+   R  RDHDRPLSK+G+  
Sbjct  44    VVRSVSVDLLAVAGEPAVAGAPSATPC-RRLILLRHGDSATGGRFTRDHDRPLSKAGRAD  102

Query  594   AARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQ  773
             A  VS++L Q+GW+P LILCSDA+RT+ETLKI+QE V    EA VHF+ SFYS+AAMDGQ
Sbjct  103   AISVSNKLQQMGWVPELILCSDAMRTKETLKILQEHVHGLSEAVVHFIPSFYSIAAMDGQ  162

Query  774   TAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEE  953
             TAEHL++AIC+YS D+ILTVMCMGHN+GWEEAASMFSG  + L+TCNAALLEA GKSW E
Sbjct  163   TAEHLQKAICEYSSDEILTVMCMGHNKGWEEAASMFSGDSVLLETCNAALLEAAGKSWVE  222

Query  954   TFSLAGLGGWELQGIVKP  1007
              F +AGLGGW+L GIVKP
Sbjct  223   AFFVAGLGGWKLHGIVKP  240



>ref|XP_010910100.1| PREDICTED: uncharacterized protein LOC105036058 isoform X1 [Elaeis 
guineensis]
Length=232

 Score =   254 bits (648),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = +3

Query  519   HAHSSWEDR--SLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIM  692
             HA S+  DR    RDHDRPLSK+G+  A  VS++L Q+GWIP LIL S+A RT+ETL+IM
Sbjct  64    HAESALGDRFTKGRDHDRPLSKAGRADAISVSYKLQQMGWIPELILSSNATRTKETLQIM  123

Query  693   QEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAA  872
             QE    F EAEV+F+ SFYSVAAMDGQTAEHL++A+C+YS+D+ILTVMCMGHNRGWEEAA
Sbjct  124   QEHAQGFSEAEVYFIPSFYSVAAMDGQTAEHLQKAVCEYSRDEILTVMCMGHNRGWEEAA  183

Query  873   SMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPD  1010
             SMFSGA +ELKTCNAALLEATGKSW+E F+LAGLGGW+L G+VKPD
Sbjct  184   SMFSGATVELKTCNAALLEATGKSWDEAFTLAGLGGWKLCGVVKPD  229



>ref|XP_009415442.1| PREDICTED: uncharacterized protein LOC103996278 [Musa acuminata 
subsp. malaccensis]
Length=238

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 153/193 (79%), Gaps = 0/193 (0%)
 Frame = +3

Query  429   SVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVS  608
             S+ +  A PE +  AS +     RRLILLRHA S   DR  +DHDRP+SK G+  A  +S
Sbjct  46    SISVSTADPEVRDEASTAPLTRRRRLILLRHADSRIGDRFTKDHDRPISKVGRKDAISIS  105

Query  609   HELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHL  788
              +L QLGWIP L+L SD+ RT+ETL+IMQE    F EAEV+F+ SFYS+AAMDGQTAEHL
Sbjct  106   SKLQQLGWIPELVLSSDSTRTKETLQIMQEHAQGFSEAEVYFVPSFYSIAAMDGQTAEHL  165

Query  789   RQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLA  968
             ++AIC+YS+D+ILTVMCMGHNRGWEEAASM SGA +ELKTCNAALLEATG SW+E F+LA
Sbjct  166   QKAICEYSRDEILTVMCMGHNRGWEEAASMLSGATVELKTCNAALLEATGNSWDEAFTLA  225

Query  969   GLGGWELQGIVKP  1007
             GLGGW+L G+VKP
Sbjct  226   GLGGWKLHGVVKP  238



>ref|XP_003577942.1| PREDICTED: uncharacterized protein LOC100833936 [Brachypodium 
distachyon]
Length=246

 Score =   251 bits (642),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 142/180 (79%), Gaps = 1/180 (1%)
 Frame = +3

Query  471   ASDSAQFLPRR-LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLI  647
             +SDSA   PRR LILLRH  S+   R   DHDRPLSK+G+  A  VS +L Q+GWIP LI
Sbjct  67    SSDSASVTPRRRLILLRHGDSAVGGRFTTDHDRPLSKAGRADAISVSDKLQQMGWIPELI  126

Query  648   LCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDIL  827
             LCSD+ RT+ETL+I+QE V    EA VHF+ SFYS+AAMDGQTAEHL++AIC+YS D+IL
Sbjct  127   LCSDSTRTKETLQILQEHVEGLSEAIVHFIPSFYSIAAMDGQTAEHLQKAICEYSSDEIL  186

Query  828   TVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             TVMCMGHN+GWEEAASMFSG  + L+TCNAALLEA G SW E FS AGLGGW L GIVKP
Sbjct  187   TVMCMGHNKGWEEAASMFSGDSVLLQTCNAALLEAAGNSWVEAFSQAGLGGWTLHGIVKP  246



>ref|NP_001145550.1| uncharacterized protein LOC100279002 [Zea mays]
 gb|ACG48409.1| hypothetical protein [Zea mays]
Length=240

 Score =   251 bits (640),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/198 (63%), Positives = 149/198 (75%), Gaps = 1/198 (1%)
 Frame = +3

Query  414   VIDTGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLA  593
             V+ + SV L   + E     + SA    RRLILLRH  S+   R  RDHDRPLSK+G+  
Sbjct  44    VVRSVSVDLLAVAGEPAVAGAPSATPC-RRLILLRHGDSATGGRFTRDHDRPLSKAGRAD  102

Query  594   AARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQ  773
             A  VS++L Q+GW+P LILCSDA+RT+ETLKI+QE V    EA VHF+ SFYS+AAMDGQ
Sbjct  103   AISVSNKLQQMGWVPELILCSDAMRTKETLKILQEHVHGLSEAVVHFIPSFYSIAAMDGQ  162

Query  774   TAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEE  953
             TAEHL++AIC+YS D+ILTVMCMGHN+GWEE A MF G  + L+TCNAALLEA GKSW E
Sbjct  163   TAEHLQKAICEYSSDEILTVMCMGHNKGWEEXAXMFXGDSVLLETCNAALLEAAGKSWVE  222

Query  954   TFSLAGLGGWELQGIVKP  1007
              F +AGLGGW+L GIVKP
Sbjct  223   AFFVAGLGGWKLHGIVKP  240



>gb|KFK34469.1| hypothetical protein AALP_AA5G149300 [Arabis alpina]
Length=214

 Score =   248 bits (633),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 140/180 (78%), Gaps = 6/180 (3%)
 Frame = +3

Query  471   ASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLIL  650
             A+  +  + RRLILLRHA       SLRDHDRPL+K+GQ  AA+V+  L  LGWIP LIL
Sbjct  36    AASPSPLISRRLILLRHA------VSLRDHDRPLTKTGQADAAKVAQILSTLGWIPQLIL  89

Query  651   CSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILT  830
              SDA RTRETLK MQ QV  FLEA VH + SFYS+AAMDGQTA+HL+Q + KYS  DI T
Sbjct  90    SSDATRTRETLKSMQAQVDGFLEANVHLIPSFYSIAAMDGQTAQHLQQIVSKYSTPDITT  149

Query  831   VMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPD  1010
             VMCMGHN+GWEEAASM SGA ++LKTCNAALL+A G SWEE F+LAG GGW+L+G+V PD
Sbjct  150   VMCMGHNKGWEEAASMLSGASVKLKTCNAALLQAFGNSWEEAFALAGPGGWKLEGVVAPD  209



>ref|XP_008782960.1| PREDICTED: uncharacterized protein LOC103702350 isoform X2 [Phoenix 
dactylifera]
Length=230

 Score =   248 bits (632),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  522   AHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQ  701
             A S+  DR  +DH RPLSK G+  A  VS++L Q+GWIP LIL S+A RT+ETL+IMQE 
Sbjct  65    AESALGDRFTKDHGRPLSKLGRTDAISVSYKLQQMGWIPELILSSNATRTKETLQIMQEH  124

Query  702   VPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMF  881
                F EAEV+F+ SFYSVAAMDGQTAEHL++AIC+YS+D+ILTVMCMGHNRGWEEAASMF
Sbjct  125   AQGFSEAEVYFIPSFYSVAAMDGQTAEHLQKAICEYSRDEILTVMCMGHNRGWEEAASMF  184

Query  882   SGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPD  1010
             SGA +ELKT NAALLEATGKSW+E F+LAGLGGW+L G+VKPD
Sbjct  185   SGATVELKTSNAALLEATGKSWDEAFTLAGLGGWKLCGVVKPD  227



>ref|XP_001772111.1| predicted protein [Physcomitrella patens]
 gb|EDQ63055.1| predicted protein [Physcomitrella patens]
Length=172

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 137/171 (80%), Gaps = 0/171 (0%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRLILLRHA SSW DRSL+DH RPLS  G+LAAA ++ +L +  W+PGLILCSD+ RTRE
Sbjct  1     RRLILLRHAKSSWADRSLKDHKRPLSNKGRLAAANIASKLEKHSWVPGLILCSDSQRTRE  60

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
             TL IMQ +  A  +A+V FL SFYSVAAMDGQTA+H+++ + KY+ DDI T+MCMGHNRG
Sbjct  61    TLHIMQGRYSALADADVRFLGSFYSVAAMDGQTAQHIQENVLKYAGDDITTIMCMGHNRG  120

Query  858   WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPD  1010
             WEEAAS F G  +ELKT NAALLEA G SW+E F  AG+GGW+L GI+KPD
Sbjct  121   WEEAASQFCGVAVELKTANAALLEAPGISWKEAFEKAGMGGWKLVGIMKPD  171



>ref|XP_010096514.1| hypothetical protein L484_017966 [Morus notabilis]
 gb|EXB64634.1| hypothetical protein L484_017966 [Morus notabilis]
Length=671

 Score =   260 bits (664),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 150/185 (81%), Gaps = 3/185 (2%)
 Frame = +3

Query  405  ASMVIDT--GSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSK  578
            +S+VI+T  G  +    S ET+ P S     + RRLILLRHA SSW DRSLRDHDRPLSK
Sbjct  39   SSLVIETSVGDNKGDAISEETEAP-SPPIDSISRRLILLRHAKSSWRDRSLRDHDRPLSK  97

Query  579  SGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVA  758
            +GQ  A +V+H+L +LGWIP LIL SDA+RT+ETLKIMQEQV  FLEAEV F+SSFYS+A
Sbjct  98   TGQADAIKVAHKLQELGWIPQLILSSDALRTKETLKIMQEQVQGFLEAEVRFISSFYSIA  157

Query  759  AMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATG  938
            AMDGQTAEHL+  +C+ S D+I+TVMCMGHNRGWEEAASMF+GA +ELKTCNAALLE +G
Sbjct  158  AMDGQTAEHLQDVVCRCSGDEIVTVMCMGHNRGWEEAASMFTGASVELKTCNAALLETSG  217

Query  939  KSWEE  953
            KSW E
Sbjct  218  KSWTE  222



>gb|EEE69361.1| hypothetical protein OsJ_28695 [Oryza sativa Japonica Group]
Length=153

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 131/153 (86%), Gaps = 0/153 (0%)
 Frame = +3

Query  549   LRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEV  728
             + DHDRPLSK+G+ AA  VS++L Q+GWIP L+LCSDA RT+ETLKI+Q+ V    EA V
Sbjct  1     MSDHDRPLSKAGRAAAISVSNKLQQMGWIPELVLCSDATRTKETLKILQDHVKGLSEAIV  60

Query  729   HFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKT  908
             HF+ SFYS+AAMDGQTAEHL++AIC+YS D+ILTVMCMGHN+GWEEAASMFSG  + LKT
Sbjct  61    HFIPSFYSIAAMDGQTAEHLQKAICQYSSDEILTVMCMGHNKGWEEAASMFSGDSVVLKT  120

Query  909   CNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             CNAALLEA GKSW E FSLAGLGGW+L GIVKP
Sbjct  121   CNAALLEAEGKSWVEAFSLAGLGGWKLHGIVKP  153



>ref|XP_008782959.1| PREDICTED: uncharacterized protein LOC103702350 isoform X1 [Phoenix 
dactylifera]
Length=232

 Score =   244 bits (623),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = +3

Query  552   RDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVH  731
             RDH RPLSK G+  A  VS++L Q+GWIP LIL S+A RT+ETL+IMQE    F EAEV+
Sbjct  77    RDHGRPLSKLGRTDAISVSYKLQQMGWIPELILSSNATRTKETLQIMQEHAQGFSEAEVY  136

Query  732   FLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTC  911
             F+ SFYSVAAMDGQTAEHL++AIC+YS+D+ILTVMCMGHNRGWEEAASMFSGA +ELKT 
Sbjct  137   FIPSFYSVAAMDGQTAEHLQKAICEYSRDEILTVMCMGHNRGWEEAASMFSGATVELKTS  196

Query  912   NAALLEATGKSWEETFSLAGLGGWELQGIVKPD  1010
             NAALLEATGKSW+E F+LAGLGGW+L G+VKPD
Sbjct  197   NAALLEATGKSWDEAFTLAGLGGWKLCGVVKPD  229



>emb|CAB41335.1| putative protein [Arabidopsis thaliana]
Length=546

 Score =   253 bits (647),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 143/202 (71%), Gaps = 29/202 (14%)
 Frame = +3

Query  492   LPRRLILLRHAHSSWEDRSLR-----------------------------DHDRPLSKSG  584
             + RRLILLRHAHSSW+D SLR                             DHDRPLSK+G
Sbjct  340   ISRRLILLRHAHSSWDDLSLRGTLILLFLAQNRKIKSLMSLFLSVCVLTIDHDRPLSKTG  399

Query  585   QLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAM  764
             +  AA+V+  L  LGW+P LIL SDA RTRETLK MQ QV  F+EA VHF+ SFYS+AAM
Sbjct  400   EADAAKVAQILSSLGWLPQLILSSDATRTRETLKSMQAQVDGFMEANVHFIPSFYSIAAM  459

Query  765   DGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKS  944
             DGQTAEHL+  I KYS  DI T+MCMGHN+GWEEAASM SGA I+LKTCNAALL+A G S
Sbjct  460   DGQTAEHLQNIISKYSTPDISTIMCMGHNKGWEEAASMLSGASIKLKTCNAALLQAFGNS  519

Query  945   WEETFSLAGLGGWELQGIVKPD  1010
             WEE F+L+G GGW+L+G+V PD
Sbjct  520   WEEAFALSGPGGWKLEGLVAPD  541



>ref|XP_002974533.1| hypothetical protein SELMODRAFT_58546, partial [Selaginella moellendorffii]
 gb|EFJ24053.1| hypothetical protein SELMODRAFT_58546, partial [Selaginella moellendorffii]
Length=170

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRLILLRHAHSSW +RSL+DH+RPLS  G+  AA ++ +L +LGW+P L+LCSD+ RTRE
Sbjct  1     RRLILLRHAHSSWANRSLKDHERPLSGRGRQQAASIAAKLRELGWLPELVLCSDSTRTRE  60

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
             TL+I++      L+ E HFL+++YSVAAMDG TA+H+R+ ICK++KDDI TV+CMGHNRG
Sbjct  61    TLEIIKRHTVELLQVETHFLTTYYSVAAMDGHTAQHIRETICKFAKDDIATVLCMGHNRG  120

Query  858   WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             WEEAAS+  G P+ELKT NAALLEA G SW+ETF+ AG GGW+L+ I++P
Sbjct  121   WEEAASILCGRPLELKTSNAALLEAHGCSWQETFASAGAGGWKLREILQP  170



>ref|XP_002963230.1| hypothetical protein SELMODRAFT_68511, partial [Selaginella moellendorffii]
 gb|EFJ35101.1| hypothetical protein SELMODRAFT_68511, partial [Selaginella moellendorffii]
Length=170

 Score =   239 bits (610),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 140/170 (82%), Gaps = 0/170 (0%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRLILLRHAHSSW +RSL+DH+RPLS  G+  AA ++ +L +LGW+P L+LCSD+ RTRE
Sbjct  1     RRLILLRHAHSSWANRSLKDHERPLSGRGRQQAASIAAKLRELGWLPELVLCSDSTRTRE  60

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
             TL+I++      L+ E HFL+++YSVAAMDG TA+H+R+ ICK++KDDI T++CMGHNRG
Sbjct  61    TLEIIKRHTVELLQVETHFLTTYYSVAAMDGHTAQHIRETICKFAKDDIATILCMGHNRG  120

Query  858   WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             WEEAAS+  G P+ELKT NAALLEA G SW+ETF+ AG GGW+L+ I++P
Sbjct  121   WEEAASILCGRPLELKTSNAALLEAHGCSWQETFASAGAGGWKLREILQP  170



>gb|EMS56896.1| hypothetical protein TRIUR3_04060 [Triticum urartu]
Length=153

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = +3

Query  549   LRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEV  728
             + DHDRPLSK+G+  A  VS +  Q+GWIP LILCSDA RT+ETL+IMQE V    +A V
Sbjct  1     MTDHDRPLSKAGRADAISVSDKFHQMGWIPELILCSDATRTKETLQIMQEHVQGLSQALV  60

Query  729   HFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKT  908
             HF+ SFYS+AAMDGQTAEHL++AIC+YS D+ILTVMCMGHN+GWEEAASMFSG  + LKT
Sbjct  61    HFIPSFYSIAAMDGQTAEHLQKAICEYSTDEILTVMCMGHNKGWEEAASMFSGDSVVLKT  120

Query  909   CNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             CNAALLEA GKSW E FS AGLGGW+L GIVKP
Sbjct  121   CNAALLEAAGKSWVEAFSQAGLGGWKLHGIVKP  153



>gb|EMT07728.1| hypothetical protein F775_14266 [Aegilops tauschii]
Length=205

 Score =   234 bits (598),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 138/176 (78%), Gaps = 4/176 (2%)
 Frame = +3

Query  483   AQFLP-RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSD  659
             A FLP RR+ L R     W   ++ DHDRPLSK+G+  A  VS +  Q+GWIP LILCSD
Sbjct  33    AAFLPWRRVDLSRGL--KW-GSTVDDHDRPLSKAGRADAISVSDKFHQMGWIPELILCSD  89

Query  660   AVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMC  839
             A RT+ETL+IMQE V    +A VHF+ SFYS+AAMDGQTAEHL++AIC+YS D+ILTVMC
Sbjct  90    ATRTKETLQIMQEHVQGLSQALVHFIPSFYSIAAMDGQTAEHLQKAICEYSTDEILTVMC  149

Query  840   MGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             MGHN+GWEEAASMFSG  + LKTCNAALLEA GKSW E FS AGLGGW+L GIVKP
Sbjct  150   MGHNKGWEEAASMFSGDSVVLKTCNAALLEAAGKSWIEAFSQAGLGGWKLHGIVKP  205



>gb|AAZ06218.1| hypothetical protein TQR14A11.4 [Oryza sativa Indica Group]
 gb|AAZ06248.1| hypothetical protein TQR14A11.4 [Oryza sativa Indica Group]
Length=274

 Score =   234 bits (596),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 140/183 (77%), Gaps = 4/183 (2%)
 Frame = +3

Query  477   DSAQFLP--RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLIL  650
             D+A   P  RRLILLRH  S+   R  RDHDRPLSK+G+ AA  VS++L Q+GWIP L+L
Sbjct  70    DAAPAAPSRRRLILLRHGESAAGGRLTRDHDRPLSKAGRAAAISVSNKLQQMGWIPELVL  129

Query  651   CSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILT  830
             CSDA RT+ETLKI+Q+ V    EA VHF+ SFYS+AAMDGQTAEHL++AIC+YS D+ILT
Sbjct  130   CSDATRTKETLKILQDHVKGLSEAIVHFIPSFYSIAAMDGQTAEHLQKAICQYSSDEILT  189

Query  831   VMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEE--TFSLAGLGGWELQGIVK  1004
             VMCMGHN+GWEEAASMFSG  + LKTCNAALLEA GKSW E        L G+ L+ +++
Sbjct  190   VMCMGHNKGWEEAASMFSGDSVVLKTCNAALLEAEGKSWVELNLIPFYYLMGYILRAVIE  249

Query  1005  PDI  1013
             P +
Sbjct  250   PPL  252



>ref|XP_009136661.1| PREDICTED: uncharacterized protein LOC103860747 isoform X2 [Brassica 
rapa]
Length=208

 Score =   226 bits (576),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 135/188 (72%), Gaps = 1/188 (1%)
 Frame = +3

Query  423  TGSVQLQQASPETQTPASDS-AQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAA  599
            T +     A P   T  + S +  + RRLILLRHAHSSW+  SL+DHDRPL+K+GQ  AA
Sbjct  18   TTTTSCSTAPPRASTELTASPSSLISRRLILLRHAHSSWDHLSLKDHDRPLTKTGQADAA  77

Query  600  RVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTA  779
            +V+  L  LGW+P LIL SDA RT+ETLK MQ QV  F+EA VHF+ SFYS+AAMDGQTA
Sbjct  78   KVAQILSSLGWLPQLILSSDATRTKETLKSMQAQVDGFMEANVHFIPSFYSIAAMDGQTA  137

Query  780  EHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETF  959
            +HL+  I KYS  DI TVMCMGHN+GWEEAASM SGA ++LKTCNAALL A G SW++  
Sbjct  138  DHLQHIISKYSSPDITTVMCMGHNKGWEEAASMLSGASVKLKTCNAALLLAFGNSWDDVC  197

Query  960  SLAGLGGW  983
               G   W
Sbjct  198  FCYGWTWW  205



>ref|NP_001175750.1| Os09g0287300 [Oryza sativa Japonica Group]
 dbj|BAH94478.1| Os09g0287300 [Oryza sativa Japonica Group]
Length=251

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/153 (69%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = +3

Query  504  LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETL  683
            LILLRH  S+   R  RDHDRPLSK+G+ AA  VS++L Q+GWIP L+LCSDA RT+ETL
Sbjct  85   LILLRHGESAAGGRLTRDHDRPLSKAGRAAAISVSNKLQQMGWIPELVLCSDATRTKETL  144

Query  684  KIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWE  863
            KI+Q+ V    EA VHF+ SFYS+AAMDGQTAEHL++AIC+YS D+ILTVMCMGHN+GWE
Sbjct  145  KILQDHVKGLSEAIVHFIPSFYSIAAMDGQTAEHLQKAICQYSSDEILTVMCMGHNKGWE  204

Query  864  EAASMFSGAPIELKTCNAALLEATGKSWEETFS  962
            EAASMFSG  + LKTCNAALLEA GKSW E   
Sbjct  205  EAASMFSGDSVVLKTCNAALLEAEGKSWVEVVG  237



>ref|XP_008782962.1| PREDICTED: uncharacterized protein LOC103702350 isoform X3 [Phoenix 
dactylifera]
Length=217

 Score =   213 bits (542),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = +3

Query  522  AHSSWEDR--SLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQ  695
            A S+  DR    RDH RPLSK G+  A  VS++L Q+GWIP LIL S+A RT+ETL+IMQ
Sbjct  65   AESALGDRFTKGRDHGRPLSKLGRTDAISVSYKLQQMGWIPELILSSNATRTKETLQIMQ  124

Query  696  EQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAAS  875
            E    F EAEV+F+ SFYSVAAMDGQTAEHL++AIC+YS+D+ILTVMCMGHNRGWEEAAS
Sbjct  125  EHAQGFSEAEVYFIPSFYSVAAMDGQTAEHLQKAICEYSRDEILTVMCMGHNRGWEEAAS  184

Query  876  MFSGAPIELKTCNAALLEATGKSWEE  953
            MFSGA +ELKT NAALLEATGKSW+E
Sbjct  185  MFSGATVELKTSNAALLEATGKSWDE  210



>ref|NP_001169062.1| uncharacterized protein LOC100382903 [Zea mays]
 gb|ACN31559.1| unknown [Zea mays]
Length=128

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +3

Query  624   LGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAIC  803
             +GW+P LILCSDA+RT+ETLKI+QE V    EA VHF+ SFYS+AAMDGQTAEHL++AIC
Sbjct  1     MGWVPELILCSDAMRTKETLKILQEHVHGLSEAVVHFIPSFYSIAAMDGQTAEHLQKAIC  60

Query  804   KYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGW  983
             +YS D+ILTVMCMGHN+GWEEAASMFSG  + L+TCNAALLEA GKSW E F +AGLGGW
Sbjct  61    EYSSDEILTVMCMGHNKGWEEAASMFSGDSVLLETCNAALLEAAGKSWVEAFFVAGLGGW  120

Query  984   ELQGIVKP  1007
             +L GIVKP
Sbjct  121   KLHGIVKP  128



>gb|AFK39549.1| unknown [Lotus japonicus]
Length=194

 Score =   208 bits (529),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 120/151 (79%), Gaps = 3/151 (2%)
 Frame = +3

Query  408  SMVIDTGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQ  587
            S  +   S+ +Q+   +   P SDS   + RRLILLRHA SSW + SLRDHDRPLSKSG+
Sbjct  25   SQFLAKSSLLIQKQDTQVADPFSDS---VSRRLILLRHAQSSWGNPSLRDHDRPLSKSGK  81

Query  588  LAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMD  767
              A +VS +L QLGWIP LILCSDA RT+ETLKIMQE+V   LEAEVHF+SSFYS+AAMD
Sbjct  82   EDAMKVSSKLQQLGWIPELILCSDATRTKETLKIMQEEVQELLEAEVHFVSSFYSIAAMD  141

Query  768  GQTAEHLRQAICKYSKDDILTVMCMGHNRGW  860
            GQTA+HL++ ICKYS+DDILT+MCMGHNRGW
Sbjct  142  GQTADHLQKIICKYSRDDILTIMCMGHNRGW  172



>gb|KHN14393.1| hypothetical protein glysoja_012431 [Glycine soja]
Length=108

 Score =   187 bits (474),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +3

Query  690   MQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEA  869
             MQEQV   +EAEVHF+SSFYS+AAMDGQTAEHL++ IC+YS+D+ILT+MCMGHNRGWEEA
Sbjct  1     MQEQVQELVEAEVHFVSSFYSIAAMDGQTAEHLQKIICRYSRDEILTIMCMGHNRGWEEA  60

Query  870   ASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             ASMFSGA +ELKTCNAALLE  GKSW+E F+ AG GGW+LQGI+KP
Sbjct  61    ASMFSGATVELKTCNAALLETAGKSWDEAFATAGFGGWKLQGIIKP  106



>ref|XP_010250908.1| PREDICTED: uncharacterized protein LOC104593002 isoform X2 [Nelumbo 
nucifera]
Length=200

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/115 (77%), Positives = 102/115 (89%), Gaps = 0/115 (0%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            RRLILLRHA SSW+DRSLRDHDRPLSKSG   A  VS++L QLGW+P LIL SDA RTRE
Sbjct  65   RRLILLRHAKSSWDDRSLRDHDRPLSKSGHADAISVSYKLQQLGWVPELILSSDATRTRE  124

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCM  842
            TL+IMQEQV  FLEAEVHF+SSFYS+AAMDGQTAEHL++AIC+YS+D+ILTV+ +
Sbjct  125  TLRIMQEQVRGFLEAEVHFISSFYSIAAMDGQTAEHLQKAICEYSRDEILTVIVV  179



>ref|XP_003594382.1| hypothetical protein MTR_2g028000 [Medicago truncatula]
 gb|AES64633.1| histidine phosphatase family (branch 1) protein [Medicago truncatula]
Length=167

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 114/148 (77%), Gaps = 10/148 (7%)
 Frame = +3

Query  393  IAAAASMVIDTGSVQLQQASPETQTPASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPL  572
            + A +S++I     +L++       P SDS   + RRLILLRHA SSWE  SLRDHDRPL
Sbjct  30   LRAKSSILIPKQDTRLKE-------PFSDS---ISRRLILLRHAESSWEHPSLRDHDRPL  79

Query  573  SKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYS  752
            SKSG+  A +VS +L QLGWIP LIL SDA RT+ETLKIMQEQV   L+AEVHF+SSFYS
Sbjct  80   SKSGKEDAVKVSLKLQQLGWIPELILSSDAARTKETLKIMQEQVQELLDAEVHFVSSFYS  139

Query  753  VAAMDGQTAEHLRQAICKYSKDDILTVM  836
            +AAMDGQTA+HL++ ICKYS+D++LTVM
Sbjct  140  IAAMDGQTADHLQKVICKYSRDEMLTVM  167



>ref|XP_010695925.1| PREDICTED: uncharacterized protein LOC104908506 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=194

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 98/118 (83%), Gaps = 0/118 (0%)
 Frame = +3

Query  480  SAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSD  659
            S++ + RRLILLRHA S+W + SLRDH+RPLSK+G+  AA VS++L +LGW+P LILCSD
Sbjct  54   SSESVTRRLILLRHAESTWSNHSLRDHERPLSKAGRADAADVSYKLQRLGWVPELILCSD  113

Query  660  AVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTV  833
            A RTRETL +MQE+   FL+A VHF  SFYSVAAMDGQTAEHL+Q ICK+S DDILT+
Sbjct  114  AARTRETLSVMQERCTGFLQAAVHFFPSFYSVAAMDGQTAEHLQQMICKFSSDDILTI  171



>ref|XP_008667644.1| PREDICTED: uncharacterized protein LOC100275495 isoform X1 [Zea 
mays]
Length=203

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 93/113 (82%), Gaps = 0/113 (0%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            RRLILLRH  S+   RS RDHDRPLSK+G+  A  VS++L Q+GWIP LILCSDA+RT+E
Sbjct  84   RRLILLRHGESTAGGRSTRDHDRPLSKAGRADAISVSNKLQQMGWIPELILCSDAMRTKE  143

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVM  836
            TLKI+QE V    EA VHF+ SFYS+AAMDGQTAEHL++AIC+YS D+ILTV+
Sbjct  144  TLKILQEHVQGLSEAVVHFIPSFYSIAAMDGQTAEHLQKAICEYSSDEILTVI  196



>ref|XP_011040084.1| PREDICTED: uncharacterized protein LOC105136437 isoform X2 [Populus 
euphratica]
Length=190

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 73/86 (85%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  750   SVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLE  929
             S+ AMDGQTA+HL+QAIC YS D ILTVMCMGHNRGWEEAASMFSGA IELKTCNAALLE
Sbjct  99    SLRAMDGQTADHLQQAICNYSWDGILTVMCMGHNRGWEEAASMFSGASIELKTCNAALLE  158

Query  930   ATGKSWEETFSLAGLGGWELQGIVKP  1007
             ATGKSWEE F+ AGLGGW+LQG+VKP
Sbjct  159   ATGKSWEEAFASAGLGGWKLQGVVKP  184



>ref|XP_005649041.1| phosphoglycerate mutase-like protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24497.1| phosphoglycerate mutase-like protein [Coccomyxa subellipsoidea 
C-169]
Length=188

 Score =   151 bits (382),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 118/187 (63%), Gaps = 5/187 (3%)
 Frame = +3

Query  468   PASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLI  647
             PA  + +   +RLI++RHA S    +++RDHDRP++++G+  A  V+ +L + GW+P LI
Sbjct  2     PAFLAKKHPGKRLIMMRHADSEERLQNVRDHDRPITEAGRACAMEVAQKLAERGWLPDLI  61

Query  648   LCSDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAI---CKYSKD  818
             + SD+ RTR+TL  M   V AF EA  HF  S Y+VAA+DGQ  +HL+  +    K +  
Sbjct  62    MSSDSSRTRQTLSTMAAAVAAFGEAVTHFRGSLYTVAALDGQLRQHLQGLVVEEVKKTGG  121

Query  819   DILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGI  998
             D+  V+C+GHN+G EEAAS  +G  I L+T NAALLE    SWEE  +L     W L  +
Sbjct  122   DVACVLCLGHNKGMEEAASSLTGKTIRLETANAALLERAAASWEE--ALCDEPSWTLVEL  179

Query  999   VKPDIDV  1019
             ++PD  V
Sbjct  180   LQPDTCV  186



>ref|XP_005847613.1| hypothetical protein CHLNCDRAFT_23381, partial [Chlorella variabilis]
 gb|EFN55511.1| hypothetical protein CHLNCDRAFT_23381, partial [Chlorella variabilis]
Length=172

 Score =   146 bits (369),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 104/170 (61%), Gaps = 2/170 (1%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRL+L+RHA S      +RDHDR ++  G      V  +L   GW+P +++CS+A RTR+
Sbjct  2     RRLVLMRHADSEAASVRVRDHDREITVQGAQETLEVGEQLRAAGWLPEVVICSNAQRTRQ  61

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
             TL ++Q+ +P   EA+ HFL S Y+ AA+DGQT  HL + +   +       +C+GHN+G
Sbjct  62    TLDVLQKVMPELGEADQHFLGSLYTTAALDGQTRGHLSELVAAEAASSHSCCLCLGHNKG  121

Query  858   WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             WEEAAS F+G  + L   +AALLEA G SW E  +LA    W L  ++ P
Sbjct  122   WEEAASSFAGETVRLGNAHAALLEAQGASWAE--ALAEGTRWRLVQVLTP  169



>ref|XP_002508212.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69470.1| predicted protein [Micromonas sp. RCC299]
Length=268

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 113/180 (63%), Gaps = 13/180 (7%)
 Frame = +3

Query  495   PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWI-PGLILCSDAVRT  671
             P R+I+LRH+ S  +D  LRDHDRPL+  G+ AAA++  EL   GW  P L+LCS + R+
Sbjct  66    PFRMIVLRHSDSCTQDADLRDHDRPLTSWGRTAAAKLCSELVAKGWAEPDLVLCSASTRS  125

Query  672   RETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAIC-----KYSKDD-ILTV  833
             RETL  M        +AE HF+ S Y+ AAMDG TA+HLR+ +      +  +D+ + TV
Sbjct  126   RETLGEMVRTHAPLGKAETHFMGSLYAFAAMDGLTADHLRETVAGLVEREGGRDNRVRTV  185

Query  834   MCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGK---SWEETFSLAGLGGWELQGIVK  1004
             M +GHN+GWEEAA+ F+G  ++L+  NAALLE  G+   +W E F+      W L G+ K
Sbjct  186   MVIGHNKGWEEAATDFAGQTVKLRVANAALLEFAGEGAGTWAEAFN---QNAWRLTGVAK  242



>ref|XP_002950070.1| hypothetical protein VOLCADRAFT_80941 [Volvox carteri f. nagariensis]
 gb|EFJ48738.1| hypothetical protein VOLCADRAFT_80941 [Volvox carteri f. nagariensis]
Length=220

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 113/174 (65%), Gaps = 6/174 (3%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRLILLRHA S  ++  +RDHDR +S++G+  A++V+  L   GW P L+L S++ RT++
Sbjct  51    RRLILLRHADSD-QNSGVRDHDRQISETGRKQASQVAQLLKSKGWTPDLVLASNSKRTKQ  109

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILT--VMCMGHN  851
             TL  M E +    + + H+  S Y+VAA+DGQT EH+ + + +   DD+    VMC+GHN
Sbjct  110   TLDEMCEVMDELGDVDAHYYGSLYTVAALDGQTREHIMECLLEVV-DDVRNKVVMCVGHN  168

Query  852   RGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKPDI  1013
             +GWEEAAS FSG  ++LKT +AALL+    SW+E   L     W+L  ++ P +
Sbjct  169   KGWEEAASQFSGTAVKLKTASAALLQCYSASWKEV--LQDSVQWQLVEVLVPAV  220



>ref|XP_001702495.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP06274.1| predicted protein [Chlamydomonas reinhardtii]
Length=156

 Score =   138 bits (348),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 105/159 (66%), Gaps = 6/159 (4%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            +R+ILLRHA S  +   +RDHDRP+S  G+  AA+V+  L + GW P L+L S++ RT++
Sbjct  1    KRIILLRHAESK-DIEGMRDHDRPVSDQGRQQAAQVAKMLKERGWTPDLVLASNSKRTKQ  59

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQA---ICKYSKDDILTVMCMGH  848
            TL  M E +    + + H+  S Y+VAA+DGQT +H+ +    +C  +++ +  +MC+GH
Sbjct  60   TLDEMAEVMHELADVDAHYYGSLYTVAALDGQTRDHIVECLLEVCDDARNRV--IMCVGH  117

Query  849  NRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSL  965
            N+GWEEAAS  +G  ++L+T +AALL+    SW++   L
Sbjct  118  NKGWEEAASQLAGQAVKLRTASAALLQCYAPSWKDVLKL  156



>ref|XP_003055847.1| phosphohistidine phosphatase [Micromonas pusilla CCMP1545]
 gb|EEH59223.1| phosphohistidine phosphatase [Micromonas pusilla CCMP1545]
Length=352

 Score =   136 bits (342),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 109/195 (56%), Gaps = 25/195 (13%)
 Frame = +3

Query  495   PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHEL------WQLGW-IPGLILC  653
             P R+I+LRH+ S  ED SL+DHDRPL+  G+  A  ++  L          W  P L+LC
Sbjct  68    PLRMIVLRHSDSCTEDASLKDHDRPLTSRGRALANGLAKALAASDDGGDGAWGAPDLVLC  127

Query  654   SDAVRTRETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSK------  815
             S + R+RETL+ +        +A  HFL S Y  AAMDG TA HL++ I K S+      
Sbjct  128   SASTRSRETLEELVRAHAPIGDATTHFLGSLYHFAAMDGVTAAHLKETIVKTSEAAAAEK  187

Query  816   -------DDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEAT---GKSWEETFSL  965
                      + TVMC+GHN+GWEEAAS F+G P++L   NAALLE     G+ W + F  
Sbjct  188   KKNGGGGGGVKTVMCIGHNKGWEEAASEFAGEPVKLNVANAALLEYVGDGGEDWAKVFDG  247

Query  966   A-GLGGW-ELQGIVK  1004
             A G GG  E  G ++
Sbjct  248   ARGAGGLGEKSGAIR  262



>dbj|BAD29673.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD29173.1| hypothetical protein [Oryza sativa Japonica Group]
Length=225

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 3/87 (3%)
 Frame = +3

Query  753   VAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEA  932
             +  MDGQTAEHL++AIC+YS D+ILTVMCMGHN+GWEEAASMFSG  + LKTCNAALLEA
Sbjct  115   LPPMDGQTAEHLQKAICQYSSDEILTVMCMGHNKGWEEAASMFSGDSVVLKTCNAALLEA  174

Query  933   TGKSWEETFSLAGLGGWELQGIVKPDI  1013
              GKSW E   L    G+ L+ +++P +
Sbjct  175   EGKSWVE---LNLTAGYILRAVIEPPL  198



>ref|XP_010052521.1| PREDICTED: uncharacterized protein LOC104441195 isoform X2 [Eucalyptus 
grandis]
 gb|KCW76591.1| hypothetical protein EUGRSUZ_D00973 [Eucalyptus grandis]
Length=179

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +3

Query  819   DILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGI  998
             +++ + CMGHNRGWEEAASMF+GA IELKTCNAALLEATG+SWEE F+LAGLGGW+LQGI
Sbjct  115   ELILLRCMGHNRGWEEAASMFTGASIELKTCNAALLEATGRSWEEAFALAGLGGWKLQGI  174

Query  999   VKP  1007
             VKP
Sbjct  175   VKP  177



>ref|XP_001416839.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95132.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=193

 Score =   112 bits (279),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 66/190 (35%), Positives = 101/190 (53%), Gaps = 25/190 (13%)
 Frame = +3

Query  510   LLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKI  689
             +LRH+ SS  D   +D DRPL++ G+  A  V+  +   GW P L LCS++ R++ETL+I
Sbjct  1     MLRHSASSGADGETKDADRPLTREGRALAKSVATRVDDAGWTPDLTLCSNSRRSKETLEI  60

Query  690   MQEQV-PAF-LEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSK----------------  815
             M+++V  AF  +  V +L S Y  A++DG   +HL + + K +                 
Sbjct  61    MRDEVNEAFGTKGRVMYLGSLYHYASLDGVMRQHLSECVVKQTTAGDGADGEEGDVVECE  120

Query  816   --DDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLE---ATGKSWEETFSLAGLGG  980
                D  T+M +GHN+G EEAAS + G  + L+   AALLE     G +W    ++A  G 
Sbjct  121   IVTDARTIMAVGHNKGMEEAASEYCGRDVRLQVATAALLERARGEGDTW--ASAMADAGS  178

Query  981   WELQGIVKPD  1010
             W L  +  P+
Sbjct  179   WTLVAVATPE  188



>ref|WP_002653005.1| hypothetical protein [Blastopirellula marina]
 gb|EAQ77798.1| hypothetical protein DSM3645_25552 [Blastopirellula marina DSM 
3645]
Length=170

 Score = 97.1 bits (240),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 60/173 (35%), Positives = 91/173 (53%), Gaps = 19/173 (11%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRLIL+RHA SSW++ S  DH+RPL++ G+ AA  V+ EL + GW P +++ S+A RT E
Sbjct  10    RRLILMRHAKSSWKEGS-SDHERPLNERGRAAAPLVAAELQKRGWTPEMVVASNARRTVE  68

Query  678   TLKIMQEQ---VPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGH  848
             T + M+E     P  +     +LS +  + +   Q         C+       + + +GH
Sbjct  69    TWERMRENFSPTPQIVLDSSLYLSGYSELVSAAAQLP-----GFCQ-------SALFLGH  116

Query  849   NRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
             N GWE AAS  SG  +E+ T  A L      +W+  F     G W+   I++P
Sbjct  117   NPGWEMAASQLSGESLEMATGMAVLFTVEAATWQSAFL---NGDWKFVSIIRP  166



>emb|CEF96980.1| Histidine phosphatase superfamily, clade-1 [Ostreococcus tauri]
Length=194

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 60/186 (32%), Positives = 89/186 (48%), Gaps = 20/186 (11%)
 Frame = +3

Query  510   LLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKI  689
             +LRH  +   + + +D DR L++ G+  A   +    + GWIP + LCS + R+RETL++
Sbjct  1     MLRHGEAMMSNANEKDADRALTRDGRARARETARAASERGWIPDVTLCSASRRSRETLEV  60

Query  690   MQEQVPAF-LEAEVHFLSSFYSVAAMDGQTAEHLRQAICK---------------YSKDD  821
             M E   AF       +L S Y  A++DGQ   HL + + +                   D
Sbjct  61    MGEADAAFGAVGRTMYLGSLYHFASLDGQYRTHLAECVAREIGILAACPPEEAACAKVPD  120

Query  822   ILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEA---TGKSWEETFSLAGLGGWELQ  992
               T+M +GHN+G EEAA+   G  + L    AALLE       +W +  S  G G W L 
Sbjct  121   ARTIMAVGHNKGMEEAATELCGEEVRLLPATAALLEREVDADATWADVLS-EGKGKWTLV  179

Query  993   GIVKPD  1010
              +  PD
Sbjct  180   AVATPD  185



>ref|XP_003077964.1| Ubiquitin fusion-degradation protein (ISS) [Ostreococcus tauri]
Length=476

 Score = 98.6 bits (244),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 62/188 (33%), Positives = 91/188 (48%), Gaps = 20/188 (11%)
 Frame = +3

Query  504   LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETL  683
             LI+LRH  +   + + +D DR L++ G+  A   +    + GWIP + LCS + R+RETL
Sbjct  281   LIMLRHGEAMMSNANEKDADRALTRDGRARARETARAASERGWIPDVTLCSASRRSRETL  340

Query  684   KIMQEQVPAF-LEAEVHFLSSFYSVAAMDGQTAEHLRQAICKY---------------SK  815
             ++M E   AF       +L S Y  A++DGQ   HL + + +                  
Sbjct  341   EVMGEADAAFGAVGRTMYLGSLYHFASLDGQYRTHLAECVAREIGILAACPPEEAACAKV  400

Query  816   DDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEA---TGKSWEETFSLAGLGGWE  986
              D  T+M +GHN+G EEAA+   G  + L    AALLE       +W +  S  G G W 
Sbjct  401   PDARTIMAVGHNKGMEEAATELCGEEVRLLPATAALLEREVDADATWADVLS-EGKGKWT  459

Query  987   LQGIVKPD  1010
             L  +  PD
Sbjct  460   LVAVATPD  467



>ref|XP_001418728.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO97021.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=295

 Score = 95.9 bits (237),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 79/152 (52%), Gaps = 10/152 (7%)
 Frame = +3

Query  513  LRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIM  692
            LRHA S W D +L D  RPL+  G+  A R +  L +  W P LIL SDA R  ETL+ M
Sbjct  1    LRHAKSDWSDDTLPDKRRPLAAKGRRRAMRCATRLDERAWTPDLILTSDATRCLETLEAM  60

Query  693  QEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQA--ICKYSKDDI-------LTVMCMG  845
             + V AF  A V  +  FY     D       + A  I K    ++        TVMC+G
Sbjct  61   GDAVEAFRTAPVILVPDFYDKTHGDEGDVSQAKSAKVIGKRVGVEVGLGTMQPRTVMCVG  120

Query  846  HNRGWEEAASMFSG-APIELKTCNAALLEATG  938
            HN G+E AA  F G A +ELKT +AALL A G
Sbjct  121  HNFGFELAARSFCGSANVELKTAHAALLTARG  152



>ref|WP_027152623.1| histidine phosphatase [Mesorhizobium sp. WSM2561]
Length=171

 Score = 91.7 bits (226),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 87/166 (52%), Gaps = 18/166 (11%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D  L D DRPLS  G  AA  V  EL   GW+P L L S A+R+R+
Sbjct  2    KQLLLLRHAKSSWDDPDLIDFDRPLSGRGLKAAPLVGRELASQGWLPDLALVSPALRSRD  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++PA  +    F+ + Y  +A D      +RQA    S     +++ +GHN G
Sbjct  62   TWRLVSAELPA--KTPAKFVQALYEASAAD--VLAKVRQANAATS-----SLLVLGHNPG  112

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             EE A   +GA       +AA L    K  EE F  A L  +   G
Sbjct  113  LEEFARRLAGA-----GSDAAAL----KKLEEKFPTAALARFVFDG  149



>ref|WP_029354299.1| histidine phosphatase [Mesorhizobium ciceri]
Length=174

 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 87/166 (52%), Gaps = 18/166 (11%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D  L D DRPLS  G  AA     EL + GW+P L L S A+R+R+
Sbjct  5    KQLLLLRHAKSSWDDPDLIDFDRPLSGRGVKAAPLAGRELARQGWLPDLALVSPALRSRD  64

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++PA  +    F+ + Y  +A D      +RQA    S     +++ +GHN G
Sbjct  65   TWRLVSAELPA--KTPAKFVQALYEASAAD--VLAKVRQANAATS-----SLLVLGHNPG  115

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             EE A   +GA       +AA L    K  EE F  A L  +   G
Sbjct  116  LEEFARRLAGA-----GSDAAAL----KKLEEKFPTAALARFVFDG  152



>ref|WP_022704911.1| phosphoglycerate mutase [Pseudorhodobacter ferrugineus]
Length=168

 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 75/135 (56%), Gaps = 12/135 (9%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            +RLIL RHA SSW+D    DHDRPL++ G+LAAA +   L   G++P  +LCSDA+RTR 
Sbjct  3    KRLILTRHAKSSWDDPLTPDHDRPLNERGKLAAADLGQWLASRGYVPAQVLCSDAIRTRS  62

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T   M   +P     ++    + Y       Q    +  A+ +++  D  TVM +GHN G
Sbjct  63   TFSGMAPALPG--SPQLDLKPALY-------QAGPDVMLAVLRHATAD--TVMMIGHNPG  111

Query  858  WEEAAS-MFSGAPIE  899
              E A+ + + AP+ 
Sbjct  112  ISEFATRLVTRAPVN  126



>ref|WP_023800649.1| histidine phosphatase [Mesorhizobium sp. L48C026A00]
 gb|ESZ17850.1| histidine phosphatase [Mesorhizobium sp. L48C026A00]
Length=171

 Score = 89.0 bits (219),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 87/166 (52%), Gaps = 18/166 (11%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L++LRHA SSW+D  L D DRPLS  G  AA  V  EL   GW+P L L S A+R+R+
Sbjct  2    KQLLVLRHAKSSWDDPDLIDFDRPLSGRGLKAAPLVGRELASQGWLPDLALVSPALRSRD  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++PA  +A   F+ + Y  +A D      +RQA         ++++ +GHN  
Sbjct  62   TWRLVSAELPA--KAPAKFVQALYEASAAD--VLAKVRQANAA-----TISLLVLGHNPD  112

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             EE A   +GA       +AA L    K  EE F  A L  +   G
Sbjct  113  LEEFARRLAGA-----GSDAAAL----KKLEEKFPTAALARFVFDG  149



>ref|XP_003080392.1| FOG: RRM domain (ISS) [Ostreococcus tauri]
 emb|CAL54559.1| Histidine phosphatase superfamily, clade-1 [Ostreococcus tauri]
Length=342

 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/156 (38%), Positives = 82/156 (53%), Gaps = 12/156 (8%)
 Frame = +3

Query  501  RLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRET  680
            RLILLRH  S W D +L D +RPL   G+  A      +  +GW P L++ SDA+R  ET
Sbjct  47   RLILLRHGKSDWSDGTLTDKERPLKGRGRKRAKLAGEFIRIMGWSPDLVITSDAMRCLET  106

Query  681  LKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHL-----RQAICKYSKDDI-LTVMCM  842
            +    E V   ++A V + +  Y V   D  + E       R+ + +  KDD   TVMC+
Sbjct  107  V----ECVDVSVDARVVYSTELYDVCHGDDVSGERSAEVIGRKVMREVDKDDPERTVMCV  162

Query  843  GHNRGWEEAASMFSGA--PIELKTCNAALLEATGKS  944
            GHN G+E AA +       + LKT +AALL A G+ 
Sbjct  163  GHNFGFELAARVLGTGTEDLTLKTAHAALLTANGRG  198



>ref|WP_023719766.1| histidine phosphatase [Mesorhizobium sp. LSHC420B00]
 gb|ESX75473.1| histidine phosphatase [Mesorhizobium sp. LSHC420B00]
Length=171

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 89/164 (54%), Gaps = 18/164 (11%)
 Frame = +3

Query  504  LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETL  683
            L+LLRHA SSW+D  L D DRPLS  G+ AA  V  EL + GW+P L L S A+RTR+T 
Sbjct  4    LLLLRHAKSSWDDPGLIDFDRPLSGRGRKAAPLVGRELTRRGWLPELALVSPALRTRDTW  63

Query  684  KIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWE  863
            +++  ++PA ++A+  F  + Y  AA D      +RQ      K +  T++ +GHN G E
Sbjct  64   RLVSAELPAKVQAK--FAQALYEAAAAD--ILAKVRQV-----KAETGTLLVLGHNPGLE  114

Query  864  EAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
            E A   +GA  +         EA  K   E F  A L  +++ G
Sbjct  115  EFARGLAGAGSD---------EAALKKLAEKFPTAALARFDVDG  149



>ref|WP_035026020.1| MULTISPECIES: histidine phosphatase [Proteobacteria]
 gb|EXL08770.1| histidine phosphatase [Aquamicrobium defluvii]
 gb|EZQ15137.1| histidine phosphatase [Pseudomonas bauzanensis]
Length=171

 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 71/130 (55%), Gaps = 9/130 (7%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            RRL LLRHA S+W+D +L D +RPL+  G+ AA  +  E+ + GW+P L + S AVRTRE
Sbjct  2    RRLFLLRHAKSAWDDPALSDFERPLAPRGKKAAPLMGREMTRRGWLPDLAVVSSAVRTRE  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T ++    +PA      HF  + Y  A        H+   I     D++  ++ +GHN G
Sbjct  62   TWELAGALLPA--PCRTHFTEAIYEAAPW------HILAEINSV-PDEVGNLLVVGHNPG  112

Query  858  WEEAASMFSG  887
             E  A M +G
Sbjct  113  LELLARMLAG  122



>ref|WP_021693329.1| phosphoglycerate mutase family protein [Loktanella cinnabarina]
 dbj|GAD55223.1| phosphoglycerate mutase family protein [Loktanella cinnabarina 
LL-001]
Length=164

 Score = 84.7 bits (208),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/155 (35%), Positives = 74/155 (48%), Gaps = 17/155 (11%)
 Frame = +3

Query  501  RLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRET  680
            +L+L+RHA S W D   RDH RPL+  G+  A R+   L Q G  P L+LCSDA RTRET
Sbjct  4    KLVLIRHAKSDWGDAGQRDHARPLAARGRRDAPRMGAWLAQGGHAPDLVLCSDATRTRET  63

Query  681  LKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGW  860
            + +MQ + P     E+ F  + Y+            RQ +         +V  + HN G 
Sbjct  64   IALMQPEWPG--PTEIRFDPTLYAAPP---------RQLLSALKDVSTRSVALVAHNPGI  112

Query  861  EEAASMFSG-AP-----IELKTCNAALLEATGKSW  947
               A+  +G AP      +  TC   +LE  G  W
Sbjct  113  GRLAAELAGEAPDHARFADYPTCAVTVLEFEGADW  147



>ref|WP_006201545.1| histidine phosphatase [Mesorhizobium amorphae]
 gb|EHH12204.1| putative phosphohistidine phosphatase SixA [Mesorhizobium amorphae 
CCNWGS0123]
Length=174

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 85/166 (51%), Gaps = 18/166 (11%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R+L++LRHA SSW+D  L D DRPL   G   A  +  EL + GW+P L L S A+RTR+
Sbjct  5    RQLLVLRHAKSSWDDPKLADIDRPLGPRGLKTAPLMGRELARRGWLPDLALVSSALRTRD  64

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++P  + A+  F  + Y   A D      +RQA  K       +++ +GHN G
Sbjct  65   TWRLVSAELPKKVPAD--FALALYEATAAD--ILAKVRQAKPKAG-----SLLVLGHNPG  115

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             EE A   +G        + +  EA  K  EE F  A L  ++  G
Sbjct  116  LEEFARRLAG--------DGSDAEAL-KKLEEKFPTAALARFDFDG  152



>ref|WP_023705321.1| MULTISPECIES: histidine phosphatase [Mesorhizobium]
 gb|ESX17558.1| histidine phosphatase [Mesorhizobium sp. LSJC255A00]
 gb|ESX25177.1| histidine phosphatase [Mesorhizobium sp. LSHC440B00]
 gb|ESX36395.1| histidine phosphatase [Mesorhizobium sp. LSHC432A00]
 gb|ESX38213.1| histidine phosphatase [Mesorhizobium sp. LSHC440A00]
 gb|ESX74530.1| histidine phosphatase [Mesorhizobium sp. LSHC414A00]
 gb|ESY16567.1| histidine phosphatase [Mesorhizobium sp. LNJC395A00]
 gb|ESY29286.1| histidine phosphatase [Mesorhizobium sp. LNJC391B00]
 gb|ESY43429.1| histidine phosphatase [Mesorhizobium sp. LNJC384A00]
 gb|ESY54193.1| histidine phosphatase [Mesorhizobium sp. LNJC374B00]
 gb|ESY59333.1| histidine phosphatase [Mesorhizobium sp. LNJC372A00]
 gb|ESZ47617.1| histidine phosphatase [Mesorhizobium sp. L103C565B0]
 gb|ESZ57266.1| histidine phosphatase [Mesorhizobium sp. L103C131B0]
 gb|ESZ60526.1| histidine phosphatase [Mesorhizobium sp. L103C120A0]
Length=174

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 84/167 (50%), Gaps = 18/167 (11%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PR+L+LLRHA SSW+D +L D DRPL   G   A  +  EL +  W+P L L S A+RTR
Sbjct  4    PRQLLLLRHAKSSWDDPALADFDRPLGPRGLKTAPLMGRELARRSWLPDLALVSPALRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET +++  ++ A     V F  + +   A  G     L+QA+   S      ++ +GHN 
Sbjct  64   ETWRLVSAELSA--SVTVEFAEALFEATA--GDILAELQQAVASAS-----CLLVLGHNP  114

Query  855  GWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
            G E+ A   +G     ++  AAL     +  EE F    L  + + G
Sbjct  115  GLEDFARRLAGP----RSGVAAL-----RKLEEKFPTGALARFVIDG  152



>ref|WP_028098226.1| hypothetical protein [Dongia sp. URHE0060]
Length=171

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/179 (32%), Positives = 90/179 (50%), Gaps = 26/179 (15%)
 Frame = +3

Query  504   LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETL  683
             LIL+RHA S+W+D   +D DRPLS  G+ AA+R+   L   G+ P ++LCS A RTR+TL
Sbjct  4     LILMRHAKSAWDDPHQKDIDRPLSTRGRKAASRMGEWLAGEGYRPDVVLCSPARRTRDTL  63

Query  684   KIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDD--ILTVMCMGHNRG  857
             ++++  +P    A V F+++ Y  A          R+ + +  K    + TVM +GHN G
Sbjct  64    ELLRPHLPK--SAIVEFVAALYMAAP---------REMLTEVGKVPAAVQTVMLLGHNPG  112

Query  858   WEEAASMFSGAPIE---------LKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
                 A + +G+  E           T   A+L      W E    +G+    L+  ++P
Sbjct  113   MASLAGLLAGSGDEKALGAMHGKFPTAAIAMLGFNIAKWSEVVPESGI----LRAFMRP  167



>ref|WP_008836009.1| histidine phosphatase [Mesorhizobium alhagi]
 gb|EHK57070.1| hypothetical protein MAXJ12_11892 [Mesorhizobium alhagi CCNWXJ12-2]
Length=171

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/166 (34%), Positives = 82/166 (49%), Gaps = 18/166 (11%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            +RL+LLRHA SSW+D +L D DRPL+  G+ AA  +  EL    W+P L L S A R+RE
Sbjct  2    KRLLLLRHAKSSWDDPALADFDRPLAPRGRKAAPLMGRELAARDWLPQLALVSPAARSRE  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++   +P  + A+  F    Y        T E +   I +  K  I T++ +GHN G
Sbjct  62   TWELVAAALPGSVSAD--FPDLLYDA------TPEDVLSEIRRTPK-AIKTLLVLGHNPG  112

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             E+ A   +GA  E K           +   E F  A L  ++  G
Sbjct  113  LEDLAKRLAGANSEKKAL---------QQLREKFPTAALARFDFDG  149



>ref|WP_019857367.1| MULTISPECIES: histidine phosphatase [Mesorhizobium]
Length=169

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 86/168 (51%), Gaps = 22/168 (13%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D +L D DRPL++ G  AA  +  EL    W+P L+L S A+RTR+
Sbjct  2    KQLLLLRHAKSSWDDPALDDVDRPLAERGLKAAKLIGRELAARDWLPDLVLVSSALRTRD  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILT--VMCMGHN  851
            T +++  ++PA+   +V F  + Y  +A D          + +  K D  +  +  +GHN
Sbjct  62   TWRLIAAELPAY--PKVVFAEALYETSAAD---------ILSQIRKVDPSSGCLAVVGHN  110

Query  852  RGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             G E+ A   +G+  E K           K  EE F  A +  +   G
Sbjct  111  PGLEDLAKQLAGSGSEAK---------AHKRLEEKFPTAAIARFVFDG  149



>gb|AID29199.1| phosphoglycerate mutase family protein [Mesorhizobium huakuii 
7653R]
Length=170

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 55/168 (33%), Positives = 86/168 (51%), Gaps = 22/168 (13%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D +L D DRPL++ G  AA  +  EL    W+P L+L S A+RTR+
Sbjct  3    KQLLLLRHAKSSWDDPALDDVDRPLAERGLKAAKLIGRELAARDWLPDLVLVSSALRTRD  62

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILT--VMCMGHN  851
            T +++  ++PA+   +V F  + Y  +A D          + +  K D  +  +  +GHN
Sbjct  63   TWRLIAAELPAY--PKVVFAEALYETSAAD---------ILSQIRKVDPSSGCLAVVGHN  111

Query  852  RGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             G E+ A   +G+  E K           K  EE F  A +  +   G
Sbjct  112  PGLEDLAKQLAGSGSEAK---------AHKRLEEKFPTAAIARFVFDG  150



>ref|WP_023677652.1| histidine phosphatase [Mesorhizobium sp. LSJC280B00]
 gb|ESW82994.1| histidine phosphatase [Mesorhizobium sp. LSJC280B00]
Length=171

 Score = 83.6 bits (205),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 86/166 (52%), Gaps = 18/166 (11%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D  L D DRPLS  G  AA  V  EL + GW+P L L S A+RTR+
Sbjct  2    KQLLLLRHAKSSWDDPDLIDFDRPLSARGLKAAPLVGRELARRGWLPELALVSPALRTRD  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++PA ++A+    S+     A        +RQ      K    T++ +GHN G
Sbjct  62   TWRLVSAELPAKVQAK----SAQALYEAAAADILAKVRQV-----KAGTGTLLVLGHNPG  112

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             EE A   +GA  +         EA  K   E +  A L  +++ G
Sbjct  113  LEEFARGLAGAGSD---------EAALKKLAEKYPTAALARFDVDG  149



>ref|WP_027026284.1| histidine phosphatase [Mesorhizobium sp. URHA0056]
Length=171

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 71/130 (55%), Gaps = 9/130 (7%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R+L+LLRHA SSW+D +L D DRPL   G   A  V  EL   GW+P L L S A+RTR+
Sbjct  4    RQLLLLRHAKSSWDDPNLADFDRPLGPRGLKTAPLVGRELAARGWLPELALLSPALRTRD  63

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++PA     V F  + Y  +A D      +RQ     +   I  ++ +GHN G
Sbjct  64   TWRLVTAELPA--HPAVAFNEALYGASAAD--ILSQIRQ-----TDPSIGCLVVVGHNPG  114

Query  858  WEEAASMFSG  887
             E+ A   +G
Sbjct  115  LEDLARQLAG  124



>ref|WP_008695654.1| phosphohistidine phosphatase, SixA [Rhodopirellula maiorica]
 gb|EMI20588.1| phosphohistidine phosphatase, SixA [Rhodopirellula maiorica SM1]
Length=146

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 72/136 (53%), Gaps = 9/136 (7%)
 Frame = +3

Query  501  RLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRET  680
            RLIL+RHA S W D  L DHDRPL+K G+  A +++  L ++  +P ++LCS AVRTRET
Sbjct  14   RLILMRHAKSDWSDGGLSDHDRPLNKRGKRDAPQMAEWLREIDCLPNVVLCSSAVRTRET  73

Query  681  LKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGW  860
            L+ MQ    +  +  V +  S Y        + E +   I      D  TVM + HN G 
Sbjct  74   LERMQSSFGS--DVVVSYSESLYLA------SPETISNVIAS-DHCDASTVMVLAHNPGM  124

Query  861  EEAASMFSGAPIELKT  908
                S  +G  +++ T
Sbjct  125  AYLVSQLAGQMVDMPT  140



>ref|WP_013554060.1| phosphohistidine phosphatase, sixa [Nitratifractor salsuginis]
 ref|YP_004168118.1| phosphohistidine phosphatase, sixa [Nitratifractor salsuginis 
DSM 16511]
 gb|ADV46369.1| putative phosphohistidine phosphatase, SixA [Nitratifractor salsuginis 
DSM 16511]
Length=167

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 83/154 (54%), Gaps = 11/154 (7%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++LIL+RHA SSW++  L D +RPL+K G+ AA  +   L + G IP LIL SDA R R 
Sbjct  3    KKLILMRHAKSSWKE-PLPDQERPLNKRGKRAAKMIGKTLAEKGIIPDLILSSDAKRARA  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T K    +V   L+ E   L    ++ A D +  E LR+   + ++D I T+M + HN G
Sbjct  62   TAK----RVLKALDKEKIDLQLDPALYAADAR--EILRE--IEKTEDKIQTLMVVAHNPG  113

Query  858  WEEAASMFSGAPIE--LKTCNAALLEATGKSWEE  953
              E A M SG      L T    +LE  G SW E
Sbjct  114  ISELAVMLSGEDAFSWLPTAAVVVLEIDGDSWRE  147



>ref|WP_034843649.1| hypothetical protein [Inquilinus limosus]
 gb|KGM32356.1| hypothetical protein P409_21850 [Inquilinus limosus MP06]
Length=171

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 68/121 (56%), Gaps = 9/121 (7%)
 Frame = +3

Query  504  LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETL  683
            LILLRHA S WED  L DHDRPL+  G+ AA R+S  L   G +P L+LCS A R R+TL
Sbjct  4    LILLRHAKSDWEDPELADHDRPLAARGRDAAPRMSAWLKAHGPMPDLVLCSTATRARQTL  63

Query  684  KIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWE  863
             ++ E + A  E E  F    Y +A   G  A  LRQA      D   TVM +GHN   E
Sbjct  64   ALVLEALGA--EPETRFDRGLY-LAGGAGVLA-RLRQA-----PDAAATVMVVGHNPDLE  114

Query  864  E  866
            +
Sbjct  115  Q  115



>ref|WP_023695552.1| MULTISPECIES: histidine phosphatase [Mesorhizobium]
 gb|ESX13959.1| histidine phosphatase [Mesorhizobium sp. LSJC265A00]
 gb|ESY05758.1| histidine phosphatase [Mesorhizobium sp. LNJC399B00]
Length=174

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 56/167 (34%), Positives = 84/167 (50%), Gaps = 18/167 (11%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PR+L+LLRHA SSW+D ++ D DRPL   G   A  +  EL +  W+P L L S A+RTR
Sbjct  4    PRQLLLLRHAKSSWDDPAVADFDRPLGPRGLKTAPLMGRELARRSWLPDLALVSPALRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET +++  ++ A     V F  + +   A  G     L+QA+   S      ++ +GHN 
Sbjct  64   ETWRLVSAELSA--SVTVEFAEALFEATA--GDILAELQQAVASAS-----CLLVLGHNP  114

Query  855  GWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
            G E+ A   +G     ++  AAL     +  EE F    L  + + G
Sbjct  115  GLEDFARRLAGP----RSGVAAL-----RKLEEKFPTGALARFVIDG  152



>ref|WP_038291376.1| hypothetical protein, partial [Zooshikella ganghwensis]
Length=153

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/166 (32%), Positives = 79/166 (48%), Gaps = 23/166 (14%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            + LILLRHA SSW+D +L D DRPL+K G+  A ++   L  +GW+P  I+ S A R R 
Sbjct  2    KELILLRHAKSSWKDSTLEDFDRPLNKRGKTIAPQMGQLLADVGWVPQYIIASPAKRCRA  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQA-------ICKYSKDDILTVM  836
            T K+               L  ++ + + + Q  E + +A       +     D I ++M
Sbjct  62   TTKL---------------LLPYFKIKSKNVQWEEMIYEAPTSALYTVISEVPDKISSLM  106

Query  837  CMGHNRGWEEAASMFSGA-PIELKTCNAALLEATGKSWEETFSLAG  971
             +GHN G E  A+    A P  L TC A  ++     W +    AG
Sbjct  107  VIGHNPGLEMLATELDSAFPGHLTTCAAVCIDLPISHWRDIGPDAG  152



>ref|WP_023761928.1| histidine phosphatase [Mesorhizobium sp. LNHC252B00]
 gb|ESY66578.1| histidine phosphatase [Mesorhizobium sp. LNHC252B00]
Length=169

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 84/166 (51%), Gaps = 18/166 (11%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D +L D DRPL+  G  AA  +  EL    W+P L L S A+RTR+
Sbjct  2    KQLLLLRHAKSSWDDPALDDFDRPLTDRGLKAAHLMGRELAARDWLPELALVSPALRTRD  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++PA    +V F  + Y  +A D      +RQ           +++ +GHN G
Sbjct  62   TWRLVAAELPA--HPKVAFAKALYDASAAD--ILSQIRQVDPSDG-----SLLVVGHNPG  112

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             E+ A+  +G   E K           K  EE F  A L  +  +G
Sbjct  113  LEDLANQLAGPGSEAK---------ARKKLEEKFPTAALVRFVFEG  149



>ref|WP_018698842.1| hypothetical protein [Amorphus coralli]
Length=171

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 64/183 (35%), Positives = 92/183 (50%), Gaps = 23/183 (13%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRLILLRHA SSW+D +  D DRPL++ G+  A  ++  +     +P  ILCS A RTRE
Sbjct  2     RRLILLRHAKSSWDDPTQADFDRPLNRRGRRVAPIMARYMAAHDLVPDRILCSTAQRTRE  61

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
             TL  +  +V   L  ++  +   Y  +    +TA  +  AI +    D  TV+ +GHN G
Sbjct  62    TLAALLPEVRGPL--DIRLIDEIYEAS----ETA--IIDAIRRLGG-DARTVLVIGHNPG  112

Query  858   WEEAASMFSGA---------PIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP-  1007
              EE A    G+           E  T   A+++    +WE   +LA  GG  L   V+P 
Sbjct  113   MEECAETLVGSTGDGLAEAFATEFPTATVAVIDFEIDAWE---ALAPDGG-HLSAFVRPK  168

Query  1008  DID  1016
             D+D
Sbjct  169   DLD  171



>ref|WP_021130500.1| hypothetical protein [Phaeospirillum fulvum]
 gb|EPY03554.1| hypothetical protein K678_00545 [Phaeospirillum fulvum MGU-K5]
Length=177

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 61/164 (37%), Positives = 80/164 (49%), Gaps = 11/164 (7%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R+L LLRHA SSW+D  L D DRPLS+ G+ AAARV+  + +   +P L L S A RTRE
Sbjct  2    RKLFLLRHAKSSWDDPVLTDFDRPLSRRGREAAARVAGFVKRYDLVPDLALVSTARRTRE  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T + + + +P        F  S Y+    D      LRQ   +       TV+ +GHN G
Sbjct  62   TWEALAQVMPTI---PASFEPSLYAAGQTD--LFRRLRQLDAETD-----TVILVGHNPG  111

Query  858  WEEAASMFSGAPIELKTCN-AALLEATGKSWEETFSLAGLGGWE  986
             E  A    G   E +  +  A    TG   E T  +AG  G E
Sbjct  112  LERLADFLGGGQGEPEALDRIARKYPTGSLAELTLDIAGWEGLE  155



>ref|WP_018066493.1| hypothetical protein [Martelella mediterranea]
Length=171

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/157 (34%), Positives = 76/157 (48%), Gaps = 17/157 (11%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            P R+ LLRHA + W + ++RD+DRPLSK G   AA ++  + Q G++PGLIL S A+R R
Sbjct  8    PDRIYLLRHAQAVWPEPTMRDYDRPLSKRGVDDAAELAERMKQSGYVPGLILSSSAMRCR  67

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            +T       +      E  F+  FY  A +         +A+ + +  D  TV+  GHN 
Sbjct  68   QTADAAYRTL--GRAPECRFVDDFYQAAPVT------YLEALAENA--DAKTVLICGHNP  117

Query  855  GWEEAASMFSGA-------PIELKTCNAALLEATGKS  944
            G EE   M  G        P    T   A+L+  G  
Sbjct  118  GIEETLLMLVGPEAFNRACPYGFPTAGMAVLDHAGDG  154



>ref|WP_023701884.1| histidine phosphatase [Mesorhizobium sp. LSJC264A00]
 gb|ESX20516.1| histidine phosphatase [Mesorhizobium sp. LSJC264A00]
Length=179

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 71/131 (54%), Gaps = 9/131 (7%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PR+L+LLRHA SSW+D +L D DRPL   G   A  +  EL +  W+P L L S A+RTR
Sbjct  4    PRQLLLLRHAKSSWDDPALADFDRPLGPRGLKTAPLMGRELARRSWLPDLALVSPALRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET +++  ++ A     V F  + +   A  G     ++QA+   S      ++ +GHN 
Sbjct  64   ETWRLVSAELSA--SVTVEFAEALFEATA--GDILAEVQQAVASAS-----CLLVLGHNP  114

Query  855  GWEEAASMFSG  887
            G E+ A   +G
Sbjct  115  GLEDFARRLAG  125



>ref|WP_023693925.1| MULTISPECIES: histidine phosphatase [Mesorhizobium]
 gb|ESW99169.1| histidine phosphatase [Mesorhizobium sp. LSJC268A00]
 gb|ESY25372.1| histidine phosphatase [Mesorhizobium sp. LNJC394B00]
 gb|ESZ12760.1| histidine phosphatase [Mesorhizobium sp. L2C085B000]
 gb|ESZ38066.1| histidine phosphatase [Mesorhizobium sp. L2C066B000]
 gb|ESZ71476.1| histidine phosphatase [Mesorhizobium sp. L103C119B0]
Length=174

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 71/131 (54%), Gaps = 9/131 (7%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PR+L+LLRHA SSW+D +L D DRPL   G   A  +  EL +  W+P L L S A+RTR
Sbjct  4    PRQLLLLRHAKSSWDDPALADFDRPLGPRGLKTAPLMGRELARRSWLPDLALVSPALRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET +++  ++ A     V F  + +   A  G     ++QA+   S      ++ +GHN 
Sbjct  64   ETWRLVSAELSA--SVTVEFAEALFEATA--GDILAEVQQAVASAS-----CLLVLGHNP  114

Query  855  GWEEAASMFSG  887
            G E+ A   +G
Sbjct  115  GLEDFARRLAG  125



>ref|WP_007669979.1| hypothetical protein [alpha proteobacterium BAL199]
 gb|EDP66269.1| hypothetical protein BAL199_25019 [alpha proteobacterium BAL199]
Length=171

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 71/128 (55%), Gaps = 9/128 (7%)
 Frame = +3

Query  504  LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETL  683
            L LLRHA SSW+D  +RDHDRPLS  G+ AA  ++  L Q G  P L+LCS A RT +TL
Sbjct  4    LHLLRHAKSSWDDLGIRDHDRPLSDRGERAAVAMAAYLRQEGITPDLVLCSTARRTVDTL  63

Query  684  KIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWE  863
              ++  +P  +  ++      Y V       +E L   +   S D++  +M +GHN G E
Sbjct  64   AALRSALPKAVRTKI--TRDLYEVG------SEALLDRLRGVS-DEVGVLMVVGHNPGLE  114

Query  864  EAASMFSG  887
            + A+  +G
Sbjct  115  DLATRLAG  122



>gb|AIF15848.1| phosphohistidine phosphatase (sixA) [uncultured marine group 
II/III euryarchaeote KM3_71_G06]
Length=169

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 82/172 (48%), Gaps = 27/172 (16%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             RRLI++RHA S  +  ++ DHDRPL+  GQ  A R++  L +  W+P LIL S A RT E
Sbjct  20    RRLIVMRHADSGHDYPNMSDHDRPLNARGQRDAPRMADALSEGNWLPQLILVSSATRTLE  79

Query  678   TLKIMQEQVPAFLEAEVHFLSSFY--SVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
             TL+ M    P   +A +      Y   ++ M  Q  + L             T M +GHN
Sbjct  80    TLEGMS---PHMDDARIDVRPEIYHAGISTMLTQLEDMLGDG----------TTMILGHN  126

Query  852   RGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
              G E   +  +G   E+ T  AALL  T              GW ++G+++P
Sbjct  127   PGSENLINHLTGEWHEMPTAAAALLVKTSD------------GWIVEGVLRP  166



>emb|CDX22081.1| putative phosphohistidine phosphatase SixA [Mesorhizobium plurifarium]
Length=171

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 81/161 (50%), Gaps = 20/161 (12%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R+L++LRHA SSW+D  L D DRPL+  G   A  +  EL + GW+P L L S  +RTR+
Sbjct  4    RQLLILRHAKSSWDDPKLDDFDRPLAPRGLKTAPLMGRELARRGWLPDLALVSPTLRTRD  63

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++ +++P  ++AE  F    Y  A         +RQA           ++ +GHN G
Sbjct  64   TWRLVAQELPKHVQAE--FAEELYEAAP--ATILARVRQAKAT-------NLLVIGHNPG  112

Query  858  WEEAASMFSGA--------PIELKTCNAALLEAT-GKSWEE  953
             ++     +GA         IE K   AAL   T G+ W +
Sbjct  113  LQQFGLRLAGAGSDESVFKKIEAKFPTAALARFTLGEDWAD  153



>ref|WP_023715099.1| MULTISPECIES: histidine phosphatase [Mesorhizobium]
 gb|ESX59701.1| histidine phosphatase [Mesorhizobium sp. LSHC422A00]
 gb|ESY45634.1| histidine phosphatase [Mesorhizobium sp. LNJC380A00]
Length=174

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 83/166 (50%), Gaps = 18/166 (11%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R+L+LLRHA SSW+D +L D DRPL   G   A  +  EL +  W+P L L S A+RTRE
Sbjct  5    RQLLLLRHAKSSWDDPALADFDRPLGPRGLKTAPLMGRELARRSWLPDLALVSPALRTRE  64

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++ A     V F  + +   A  G     ++QA+          ++ +GHN G
Sbjct  65   TWRLVSAELSA--SVTVEFAEALFEATA--GDILAEVQQAVASAG-----CLLVLGHNPG  115

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             E+ A  F+G     ++  AAL     +  EE F    L  + + G
Sbjct  116  LEDFARRFAGP----RSGVAAL-----RKLEEKFPTGALARFVIDG  152



>ref|WP_027048842.1| histidine phosphatase [Mesorhizobium sp. URHB0007]
Length=174

 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 70/131 (53%), Gaps = 9/131 (7%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PR+L+LLRHA SSW+D +L D DRPL   G   A  +  EL +  W+P L L S A+RTR
Sbjct  4    PRQLLLLRHAKSSWDDPALADFDRPLGPRGLKTAPLMGRELARRSWLPDLALVSPALRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET ++   ++ A     V F  + +   A  G     ++QA+   S      ++ +GHN 
Sbjct  64   ETWRLGSAELSA--SVTVEFAEALFEATA--GDILAEVQQAVASAS-----CLLVLGHNP  114

Query  855  GWEEAASMFSG  887
            G E+ A   +G
Sbjct  115  GLEDFARRLAG  125



>ref|WP_037331881.1| histidine phosphatase [Saccharopolyspora rectivirgula]
 gb|KEI45727.1| histidine phosphatase [Saccharopolyspora rectivirgula]
Length=162

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 81/165 (49%), Gaps = 20/165 (12%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGL--ILCSDAVRT  671
            RRL+L+RHA S+W +    D  RPL+  G   A RV    W    +PG+  +LCS A RT
Sbjct  6    RRLVLIRHAKSAWPE-GTDDFHRPLADRGLADAPRVGK--WLRKNLPGIEVVLCSPARRT  62

Query  672  RETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
            RET ++   +VPA     V F    Y  +A D      L  AI        LT + +GHN
Sbjct  63   RETWQLAGAEVPA--SPTVQFDERIYQGSADD------LLSAIRGLPSTS-LTAVLVGHN  113

Query  852  RGWEEAASMFSGAPIELKTCNAALL------EATGKSWEETFSLA  968
             G EE  S+ +G P ELKT + A+L       A GK W    + A
Sbjct  114  PGLEELLSLLTGEPAELKTGSIAVLATSAAWSAAGKQWANVDTFA  158



>ref|WP_006331885.1| putative enzyme [Mesorhizobium sp. STM 4661]
 emb|CCV12871.1| putative enzyme [Mesorhizobium sp. STM 4661]
Length=169

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 71/131 (54%), Gaps = 11/131 (8%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D  L D DRPL+  G   A  +  EL + GW+P L L S A+RTR+
Sbjct  2    KQLLLLRHAKSSWDDPKLADFDRPLAPRGLKTAPLIGRELARRGWLPELALVSPALRTRD  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++P  L AE  F  + Y   A        +RQA          +++ +GHN G
Sbjct  62   TWRLVSAELPKHLPAE--FAETLYEATA--ATVLARVRQAKAT-------SLLVVGHNPG  110

Query  858  WEEAASMFSGA  890
             +  A   +GA
Sbjct  111  LQHFALRLAGA  121



>ref|WP_023664575.1| phosphoglycerate mutase [Rhodobacter sp. CACIA14H1]
 gb|ESW61666.1| phosphoglycerate mutase [Rhodobacter sp. CACIA14H1]
Length=167

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 69/126 (55%), Gaps = 11/126 (9%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            +RLIL RHA SSW+D    DHDRPL+  G+ AAA +   L   G++P  +LCSDA+RTR+
Sbjct  2    KRLILTRHAKSSWDDPLTPDHDRPLNDRGKAAAADLGQWLGSRGYVPDEVLCSDALRTRK  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T   +   +P     E+    + Y            +  A+ +++K +  TVM +GHN G
Sbjct  62   TWSGIAPALPGTPVLELK--PALY-------HAGPDVMLAVLRHAKGN--TVMMIGHNPG  110

Query  858  WEEAAS  875
              E AS
Sbjct  111  IAEFAS  116



>ref|WP_026940892.1| hypothetical protein [Hellea balneolensis]
Length=164

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 64/128 (50%), Gaps = 9/128 (7%)
 Frame = +3

Query  504  LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETL  683
            L+L+RHA SSW D SL DH RPL+K GQ AA  V   L   G+ P +I  SDA RTRET 
Sbjct  5    LLLMRHAKSSWSDGSLSDHQRPLNKRGQKAAEAVGLALTARGYAPDIIWSSDAARTRETA  64

Query  684  KIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWE  863
              +   +P      V++ S+FY        T       IC    +    +M +GHN GW 
Sbjct  65   MRLIRAIPG--AQTVNYDSNFYHAGVETVLT-------ICGKQIEPEGKLMLLGHNPGWA  115

Query  864  EAASMFSG  887
                 F+G
Sbjct  116  ALHEYFTG  123



>ref|WP_038144665.1| phosphoglycerate mutase [Thioclava sp. 13D2W-2]
 gb|KFE35553.1| phosphohistidine phosphatase [Thioclava sp. 13D2W-2]
Length=172

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 74/158 (47%), Gaps = 16/158 (10%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            RRLIL RHA SSWED ++ D DRPL+  G+LAA  +   L   G  P  +LCS A RTRE
Sbjct  7    RRLILTRHAKSSWEDPAMEDRDRPLNTRGRLAATELGDFLASRGLEPEEVLCSSARRTRE  66

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T + ++  V      E+ F+   Y   A      + LR A          TVM +GHN G
Sbjct  67   TWERIEGAV-IETRPEIRFVDRLYH--ASPDVMLDVLRSATAP-------TVMMLGHNPG  116

Query  858  WEEAASMFSGAPI------ELKTCNAALLEATGKSWEE  953
              E A M     I         TC   +++   + W E
Sbjct  117  ISEFARMLPARTIHDPDFRRFPTCATLIVDFQTEDWTE  154



>emb|CDX41095.1| putative phosphohistidine phosphatase SixA [Mesorhizobium sp. 
SOD10]
Length=171

 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 80/166 (48%), Gaps = 20/166 (12%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R+L++LRHA SSW+D  L D DRPL+  G   A  +  EL + GW+P L L S A+RTR+
Sbjct  4    RQLLILRHAKSSWDDPKLEDFDRPLAPRGLKTAPLMGRELSRRGWLPDLALVSPALRTRD  63

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++ +++P   +AE  F    Y  A         +RQA           ++ +GHN G
Sbjct  64   TWRLVAQELPKHAQAE--FAEELYEAAP--AAILARVRQARAT-------NLLVIGHNPG  112

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             +  A   +GA       N    E   K  E  F  A L  + L G
Sbjct  113  LQHFALRLAGA-----GSN----EGAFKKIEAKFPTAALARFTLDG  149



>ref|WP_023670280.1| histidine phosphatase [Mesorhizobium sp. LSJC285A00]
 gb|ESW80800.1| histidine phosphatase [Mesorhizobium sp. LSJC285A00]
Length=171

 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 83/166 (50%), Gaps = 18/166 (11%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D +L D DRPL   G   A  +  EL +  W+P L L S A+RTRE
Sbjct  2    KQLLLLRHAKSSWDDPALADFDRPLGPRGLKTAPLMGRELARRSWLPDLALVSPALRTRE  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++ A     V F  + +   A  G     L+QA+   S      ++ +GHN G
Sbjct  62   TWRLVSAELSA--SVTVEFADALFEATA--GDILAELQQAVASAS-----CLLVLGHNPG  112

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             E+ A   +G     ++  AAL     +  EE F    L  + + G
Sbjct  113  LEDFARRLAGP----RSGVAAL-----RKLEEKFPTGALARFVIDG  149



>ref|WP_032929615.1| histidine phosphatase [Mesorhizobium loti]
 gb|ETA72286.1| phosphohistidine phosphatase SixA [Mesorhizobium loti R7A]
Length=169

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 84/168 (50%), Gaps = 22/168 (13%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D +L D DRPL++ G  AA  +  EL    W+P  +L S A+RTR+
Sbjct  2    KQLLLLRHAKSSWDDPALDDFDRPLAQRGLKAAKLMGRELAARDWLPDQVLVSSALRTRD  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILT--VMCMGHN  851
            T +++  ++PA     V F  + Y  +A D          + +  K D  +  ++ +GHN
Sbjct  62   TWRLVAAELPA--HPRVVFAEALYEASAAD---------ILSQIRKVDPSSGCLVVVGHN  110

Query  852  RGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             G E+ A   +G+  E K           K  EE F  A +  +   G
Sbjct  111  PGLEDLAKQLAGSGSEAKAY---------KRLEEKFPTAAIARFVFDG  149



>ref|WP_013652259.1| phosphohistidine phosphatase, SixA [Polymorphum gilvum]
 ref|YP_004303242.1| phosphohistidine phosphatase, SixA [Polymorphum gilvum SL003B-26A1]
 gb|ADZ69942.1| Phosphohistidine Phosphatase, SixA [Polymorphum gilvum SL003B-26A1]
Length=187

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 69/124 (56%), Gaps = 9/124 (7%)
 Frame = +3

Query  501  RLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRET  680
            RL+LLRHA S W D SL D DRPL++ G  +AAR+S  L   G  P  ILCS A+RTR+T
Sbjct  18   RLLLLRHAKSDWADASLADFDRPLNERGDQSAARMSAYLKAEGLYPDRILCSTALRTRQT  77

Query  681  LKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGW  860
            L  +  ++    +AEV  + + Y    +D     H+R         ++ T+M +GHN   
Sbjct  78   LARLLPEL--HRDAEVSLMRALYDDGELD--YIPHIRS-----RGGNVRTLMVIGHNPAT  128

Query  861  EEAA  872
            E+ A
Sbjct  129  EDTA  132



>emb|CDX41094.1| putative phosphohistidine phosphatase SixA [Mesorhizobium plurifarium]
 emb|CDX61667.1| putative phosphohistidine phosphatase SixA [Mesorhizobium plurifarium]
Length=171

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/154 (34%), Positives = 77/154 (50%), Gaps = 19/154 (12%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R+L++LRHA SSW+D  L D DRPL+  G   A  +  EL + GW+P L L S  +RTR+
Sbjct  4    RQLLILRHAKSSWDDPKLDDFDRPLAPRGLKTAPLMGRELARRGWLPDLALVSPTLRTRD  63

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++ +++P  ++AE  F    Y  A         +RQA           ++ +GHN G
Sbjct  64   TWRLVAQELPKHVQAE--FAEELYEAAP--ATILARVRQAKAT-------NLLVIGHNPG  112

Query  858  WEEAASMFSGA--------PIELKTCNAALLEAT  935
             ++     +GA         IE K   AAL   T
Sbjct  113  LQQFGLRLAGAGSDESVFKKIEAKFPTAALARFT  146



>gb|KGM47470.1| phosphoglycerate mutase [Oceanicola sp. 22II-S11g]
Length=164

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 69/132 (52%), Gaps = 15/132 (11%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            +RL+L+RHA SSW+D +L DH RPL+  G+ AA  +   L  L   P +ILCSDAVRT+E
Sbjct  3    KRLVLMRHAKSSWDDLNLEDHARPLNARGRKAARAIGAWLTSLDIAPDMILCSDAVRTQE  62

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T + ++   P  +  +++  S    +  + G   +               TVM +GHN G
Sbjct  63   THQRLKMDGPVHMRPDLYLASLDRILTVLQGAEGD---------------TVMLIGHNPG  107

Query  858  WEEAASMFSGAP  893
              E A+    +P
Sbjct  108  IGEFANRLVMSP  119



>ref|WP_023733901.1| histidine phosphatase [Mesorhizobium sp. LNJC403B00]
 gb|ESX92008.1| histidine phosphatase [Mesorhizobium sp. LNJC403B00]
Length=171

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 83/166 (50%), Gaps = 18/166 (11%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D ++ D DRPL   G   A  +  EL +  W+P L L S A+RTRE
Sbjct  2    KQLLLLRHAKSSWDDPAVADFDRPLGPRGLKTAPLMGRELARRSWLPDLALVSPALRTRE  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++ A     V F  + +   A  G     L+QA+   S      ++ +GHN G
Sbjct  62   TWRLVSAELSA--SVTVEFAEALFEATA--GDILAELQQAVASAS-----CLLVLGHNPG  112

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             E+ A   +G     ++  AAL     +  EE F    L  + + G
Sbjct  113  LEDFARRLAGP----RSGVAAL-----RKLEEKFPTGALARFVIDG  149



>ref|WP_025425166.1| hypothetical protein [Ensifer adhaerens]
Length=178

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/163 (33%), Positives = 79/163 (48%), Gaps = 19/163 (12%)
 Frame = +3

Query  501  RLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRET  680
            RL+LLRHA S+W D  + DHDRPL + G+ AA  +  ++ + G IPGL + S A R RET
Sbjct  11   RLMLLRHAKSAWPD-GVPDHDRPLGERGRKAAPLIGADMKRKGLIPGLAIVSTARRARET  69

Query  681  LKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGW  860
              ++++ +P  +          Y V A           A  +    DI  ++ +GHN G 
Sbjct  70   WALVRDNLPPPI--PTRETRDIYEVGA-------PAILATIRAVDPDIRNLLVVGHNPGM  120

Query  861  EEAASMFSGAPIE---------LKTCNAALLEATGKSWEETFS  962
            EE A + +G+  +           T   A+L   G SWE+  S
Sbjct  121  EELAHLLAGSGRQEALARMREKFPTAALAVLAFDGSSWEDLAS  163



>ref|WP_028031685.1| phosphoglycerate mutase [Gemmobacter nectariphilus]
Length=169

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 66/124 (53%), Gaps = 11/124 (9%)
 Frame = +3

Query  501  RLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRET  680
            RLIL RHA SSW+D ++ DHDRPL+  G  AA  V   L   G +PG +LCSDA RTRET
Sbjct  5    RLILTRHAKSSWDDPTMADHDRPLNPRGIRAAGLVGGWLASRGDVPGEVLCSDATRTRET  64

Query  681  LKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGW  860
             + +   +P   EA +   S+ Y            +  A+ + +   +  VM +GHN G 
Sbjct  65   WERIAPHLPGAPEATLK--SALY-------HAGPDVMLAVLRGATAPV--VMMLGHNPGI  113

Query  861  EEAA  872
             E A
Sbjct  114  AEFA  117



>ref|WP_036479506.1| hypothetical protein [Nitratireductor basaltis]
 gb|KFB09518.1| hypothetical protein EL18_00534 [Nitratireductor basaltis]
Length=176

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 70/127 (55%), Gaps = 10/127 (8%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R L LLRHA SSW+D +L DHDRPLS  G+ AA  +   + + G  P  +L S A RTR 
Sbjct  2    RELYLLRHAKSSWDDPALADHDRPLSGRGERAAPLMGRYMAEQGLFPDHVLVSPARRTRR  61

Query  678  TLKIMQEQV-PAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            T K++  ++   + EAE H     Y+ +A   +    LRQ       DD+  V+ +GHN 
Sbjct  62   TWKLLASELGQGYSEAEFH--DDIYNASA--DRLLTLLRQV-----PDDVARVLLVGHNP  112

Query  855  GWEEAAS  875
            G E+ AS
Sbjct  113  GLEDLAS  119



>emb|CDO60157.1| Phosphohistidine phosphatase SixA [Candidatus Phaeomarinobacter 
ectocarpi]
Length=177

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 70/124 (56%), Gaps = 13/124 (10%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            +RL+LLRHA S W D  L DH R L+  G+ AA R+   + + G +P LI+CS A RTRE
Sbjct  2    KRLLLLRHAKSDWSDEDLDDHARTLNARGRAAATRMGQYIKENGLVPQLIVCSTATRTRE  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQ----TAEHLRQAICKYSKDDILTVMCMG  845
            TL+++Q+++    EA+V F    Y   AM  Q      EHL+QA  +        V+ + 
Sbjct  62   TLELLQQEMGT--EAKVCFDRGMY--LAMPEQMLDVALEHLQQAETEPD-----CVLILA  112

Query  846  HNRG  857
            HN G
Sbjct  113  HNPG  116



>emb|CDX19495.1| putative phosphohistidine phosphatase SixA [Mesorhizobium sp. 
ORS3324]
Length=171

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 88/178 (49%), Gaps = 22/178 (12%)
 Frame = +3

Query  498   RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
             R+L++LRHA SS +D  L D DRPL+  G   A  +  EL + GW+P L L S A+RTR+
Sbjct  4     RQLLILRHAKSSRDDPKLEDFDRPLAPRGLKTAPLMGRELSRRGWLPDLALVSPALRTRD  63

Query  678   TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
             T +++ +++P  + AE  F    Y  A         +RQA  K S+     ++ +GHN G
Sbjct  64    TWRLVAQELPKHVPAE--FAEELYEAAP--AAILARVRQA--KASR-----LIVIGHNPG  112

Query  858   WEEAASMFSGA--------PIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVKP  1007
              +      +GA         IE K   AAL   T K   E ++    GG  L   V+P
Sbjct  113   LQNFVLKLAGAGSDAGVFTKIEAKFPTAALARLTVK---EDWANLDFGGARLTHCVRP  167



>ref|WP_008032635.1| phosphoglycerate mutase [Rhodobacter sp. SW2]
 gb|EEW23934.1| putative phosphohistidine phosphatase, SixA [Rhodobacter sp. 
SW2]
Length=168

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 74/135 (55%), Gaps = 12/135 (9%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            +RLIL RHA S+W+D    DHDRPL++ G+ AAA +   L   G++P  +LCSDA+RTR 
Sbjct  3    KRLILTRHAKSNWDDPLTPDHDRPLNERGKAAAADLGDWLASRGYVPEKVLCSDALRTRA  62

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T   +   +P  +   V    + Y  +A        +  A+ +++  D  TVM +GHN G
Sbjct  63   TWSGIAPALPGTV--TVQLKPALYHASA-------DVMLAVLRHATVD--TVMMIGHNPG  111

Query  858  WEE-AASMFSGAPIE  899
              E A  + + API 
Sbjct  112  IAEFAHRLVAHAPIN  126



>ref|WP_013947227.1| MULTISPECIES: phosphohistidine phosphatase [Hyphomicrobium]
 ref|YP_004675394.1| phosphohistidine phosphatase, SixA [Hyphomicrobium sp. MC1]
 emb|CCB64820.1| putative phosphohistidine phosphatase, SixA [Hyphomicrobium sp. 
MC1]
Length=170

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/165 (33%), Positives = 77/165 (47%), Gaps = 19/165 (12%)
 Frame = +3

Query  504  LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETL  683
            L LLRHA SSW+   + D DRPL+  G++AA  +   L +L + P LILCS A RTRETL
Sbjct  4    LALLRHAKSSWDATDIDDFDRPLNDRGRMAAPLMGAALKELNFAPELILCSSAKRTRETL  63

Query  684  KIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWE  863
             ++    P+  +AEV F    Y        T++    +  K     I  V+ +GHN G  
Sbjct  64   ALI---TPSVKDAEVTFDDQLY-------LTSQETLYSRLKAVPAGIKRVLMIGHNPGMH  113

Query  864  EAASMFSGA---------PIELKTCNAALLEATGKSWEETFSLAG  971
              A   +G            +  TC  A+      SW++    +G
Sbjct  114  GLALFLTGTGDAKSISRLEDKFPTCALAVFSFEQTSWQDLLPASG  158



>ref|WP_023689061.1| histidine phosphatase [Mesorhizobium sp. LSJC269B00]
 gb|ESW85946.1| histidine phosphatase [Mesorhizobium sp. LSJC269B00]
Length=168

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/164 (33%), Positives = 81/164 (49%), Gaps = 18/164 (11%)
 Frame = +3

Query  504  LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETL  683
            ++LLRHA SSW+D +L D DRPL   G   A  +  EL +  W+P L L S A+RTRET 
Sbjct  1    MLLLRHAKSSWDDPALADFDRPLGPRGLKTAPLMGRELARRSWLPDLALVSPALRTRETW  60

Query  684  KIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWE  863
            +++  ++ A     V F  + +   A  G     L+QA+   S      ++ +GHN G E
Sbjct  61   RLVSAELSA--SVTVEFAEALFEATA--GDILAELQQAVASAS-----CLLVLGHNPGLE  111

Query  864  EAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
            + A   +G     ++  AAL     +  EE F    L  + + G
Sbjct  112  DFARRLAGP----RSGVAAL-----RKLEEKFPTGALARFVIDG  146



>ref|WP_014774177.1| phosphoglycerate mutase [Belliella baltica]
 ref|YP_006408998.1| phosphohistidine phosphatase SixA [Belliella baltica DSM 15883]
 gb|AFL86243.1| phosphohistidine phosphatase SixA [Belliella baltica DSM 15883]
Length=163

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 45/152 (30%), Positives = 73/152 (48%), Gaps = 8/152 (5%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++LI++RHA SSW+D  L DH RPL++ G   + R+   L +   +P  ++ SDA R + 
Sbjct  2    KKLIIIRHAKSSWDDPYLEDHQRPLAQRGLRDSPRMGQRLKRRNIVPDKMISSDAARAKA  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T  I+ EQ+  F +  + F    Y        T+ +L   + K + DDI  +   GH  G
Sbjct  62   TALIIAEQL-HFPKENIEFTRKLY-------HTSAYLILDLIKKTGDDIDALFIFGHIPG  113

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEE  953
            + +  ++  G    L TC          SW +
Sbjct  114  FNDLINLLGGKIDNLPTCGQYAFTFDTDSWSQ  145



>ref|WP_008875035.1| putative phosphohistidine phosphatase, SixA [Mesorhizobium metallidurans]
 emb|CCV06099.1| putative phosphohistidine phosphatase, SixA [Mesorhizobium metallidurans 
STM 2683]
Length=171

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 69/130 (53%), Gaps = 11/130 (8%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R+L+LLRHA SSW+D  L D DRPL   G   A  +  +L + GW+P L L S A+RTR+
Sbjct  4    RQLLLLRHAKSSWDDPKLADFDRPLGPRGLKTAPLIGRKLARRGWLPDLALVSPALRTRD  63

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++P  + AE  F  + Y   A        +RQA          +++ +GHN G
Sbjct  64   TWRLVSAELPRHVPAE--FAETLYEATA--ATILARVRQAKAT-------SLLVVGHNPG  112

Query  858  WEEAASMFSG  887
             +  A   +G
Sbjct  113  LQHFALRLAG  122



>ref|WP_023805638.1| histidine phosphatase [Mesorhizobium sp. L2C089B000]
 gb|ESZ06047.1| histidine phosphatase [Mesorhizobium sp. L2C089B000]
Length=171

 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 70/130 (54%), Gaps = 9/130 (7%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D +L D DRPL   G   A  +  EL +  W+P L L S A+RTRE
Sbjct  2    KQLLLLRHAKSSWDDPALADFDRPLGPRGLKTAPLMGRELARRSWLPDLALVSPALRTRE  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++ A     V F  + +   A  G     ++QA+   S      ++ +GHN G
Sbjct  62   TWRLVSAELSA--SVTVEFAEALFEATA--GDILAEVQQAVASAS-----CLLVLGHNPG  112

Query  858  WEEAASMFSG  887
             E+ A   +G
Sbjct  113  LEDFARRLAG  122



>ref|WP_028287795.1| phosphoglycerate mutase [Oceanicola nanhaiensis]
Length=165

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 65/132 (49%), Gaps = 15/132 (11%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            RRLIL+RHA SSW D    DH+RPL++ GQ +A  + H L + G++P  ILCS A RTRE
Sbjct  3    RRLILIRHAKSSWADPGQDDHERPLNRRGQRSAVAIGHWLREKGFLPDRILCSSAARTRE  62

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T  ++       L+ E   L + Y  +             + +       TV  +GHN G
Sbjct  63   TCALLA------LDPEPVILPALYHASP---------ETLLAELQAAGGGTVAVIGHNPG  107

Query  858  WEEAASMFSGAP  893
                A M   AP
Sbjct  108  IGTFAEMILSAP  119



>ref|WP_027034569.1| histidine phosphatase [Mesorhizobium loti]
Length=169

 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 84/168 (50%), Gaps = 22/168 (13%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D +L D DRPL++ G  AA  +  EL    W+P L L S A+RT +
Sbjct  2    KQLLLLRHAKSSWDDPALDDFDRPLAERGLKAARLMGRELAVRDWLPDLALVSPALRTSD  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMD--GQTAEHLRQAICKYSKDDILTVMCMGHN  851
            T +++  ++P  +   + F  + Y  +A D  G+  +    + C         ++ +GHN
Sbjct  62   TWRLVAAELP--VHPRIAFAQALYDASAADILGRIRKADPSSNC---------LLMVGHN  110

Query  852  RGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             G E+ A   +    E+K         + K  EE F  A L  +  +G
Sbjct  111  PGLEDLAKQLAAPTSEVK---------SRKRLEEKFPTAALARFVFEG  149



>ref|WP_018427151.1| hypothetical protein [Hoeflea sp. 108]
Length=175

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 81/164 (49%), Gaps = 17/164 (10%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R+L+LLRHA SSW+D  L D DRPLS  G+ AA  +  E+ + GW P L L S A+RT +
Sbjct  5    RQLLLLRHAKSSWDDPKLVDFDRPLSSRGESAAPLMGAEIARRGWRPDLALVSPAIRTLQ  64

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T ++  E  P  L     F    Y  +A D   AE       + +   +  ++ +GHN G
Sbjct  65   TWQLASEGWPRPLP-PADFPQGLYEASA-DAVLAE------AQTAPASVRCLLIVGHNPG  116

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWEL  989
             E+ A   +G P    T          +S  E FS AGL  +E+
Sbjct  117  LEDFARELAG-PGSDSTAM--------RSMAEKFSTAGLARFEI  151



>ref|WP_009718986.1| phosphohistidine phosphatase [Streptomyces himastatinicus]
 gb|EFL27186.1| putative phosphohistidine phosphatase SixA [Streptomyces himastatinicus 
ATCC 53653]
Length=175

 Score = 77.8 bits (190),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 69/132 (52%), Gaps = 11/132 (8%)
 Frame = +3

Query  492  LPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRT  671
            +PRR+++LRHA + W +  + DH+RPL++ G+  A      L + G +P L LCS AVRT
Sbjct  8    VPRRIVILRHAKADWPE--VADHERPLAERGRKDAPLAGRRLTEAGLVPELTLCSTAVRT  65

Query  672  RETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
            RET K++  ++P           + Y     D    E +  A+   + DDI  ++ +GHN
Sbjct  66   RETWKLVVHELP-------QRPKTVYEERLYDASLGELI--AVLNETSDDITDLLVVGHN  116

Query  852  RGWEEAASMFSG  887
             G    A   +G
Sbjct  117  PGVHALADALAG  128



>ref|WP_009094483.1| phosphohistidine phosphatase, SixA [Rhodopirellula sp. SWK7]
 gb|EMI46326.1| phosphohistidine phosphatase, SixA [Rhodopirellula sp. SWK7]
Length=173

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 47/157 (30%), Positives = 75/157 (48%), Gaps = 11/157 (7%)
 Frame = +3

Query  513  LRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLKIM  692
            +RHA S W    + DHDRPL+  G   A  ++  + + G++P  ILCS A RT++T  +M
Sbjct  1    MRHAKSDWSGEDVADHDRPLNSRGVRDAPVMARWIAETGFVPNYILCSSAKRTQQTAALM  60

Query  693  QE-------QVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
            +          P  +     +L+S  ++     QT E + +   +  ++   TV+ +GHN
Sbjct  61   ESYWKHTNVPTPRLVIEPPLYLASAKTIL----QTVERVSRIADEDGENFPRTVLILGHN  116

Query  852  RGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFS  962
             G   AASM +G PI L T    +   +   W E   
Sbjct  117  PGISHAASMLAGHPIGLPTAAMVVYRCSTTDWSEALG  153



>ref|WP_010915248.1| histidine phosphatase [Mesorhizobium loti]
 ref|NP_108161.1| hypothetical protein mll7959 [Mesorhizobium loti MAFF303099]
 dbj|BAB53622.1| mll7959 [Mesorhizobium loti MAFF303099]
Length=171

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/168 (32%), Positives = 83/168 (49%), Gaps = 22/168 (13%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D +L D DRPL++ G  AA  +  EL    W+P  +L S A+RTR+
Sbjct  4    KQLLLLRHAKSSWDDPALDDFDRPLAQRGLKAAKLMGRELAARDWLPDQVLVSSALRTRD  63

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILT--VMCMGHN  851
            T +++  ++PA     V F  + Y  +A D          + +  K D  +  ++ +GHN
Sbjct  64   TWRLVAAELPA--HPRVVFAEALYEASAAD---------ILSQIRKVDPSSGCLVVVGHN  112

Query  852  RGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
               E+ A   +G+  E K           K  EE F  A +  +   G
Sbjct  113  PSLEDLAKQLAGSGSEAKAY---------KRLEEKFPTAAIARFVFDG  151



>ref|XP_007509263.1| unknown protein [Bathycoccus prasinos]
 emb|CCO19720.1| unknown protein [Bathycoccus prasinos]
Length=294

 Score = 78.6 bits (192),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 67/196 (34%), Positives = 95/196 (48%), Gaps = 39/196 (20%)
 Frame = +3

Query  471  ASDSAQFLPRRLILLRHAHSSWEDRSL----RDHDRPLSKSGQLAAARVSHELWQL---G  629
            +S SA F   RLIL+RH+ ++ ED       RD DRPL++ G   A ++S  L  +    
Sbjct  67   SSKSASF---RLILMRHSEAAEEDEEKKKYRRDIDRPLTERGITYAKKLSENLKTICGEE  123

Query  630  WIPGLILCSDAVRTRETLKIMQEQVPAF-------------LEAEVHFLSSFYSVAAMDG  770
            W+P  I+CS A RTRETL  M + VP                   V +L S Y  A MDG
Sbjct  124  WMPTRIVCSSARRTRETLMAM-DLVPTMSIFNDKVSSSSSSNNNTVVYLGSIYHYAGMDG  182

Query  771  QTAEHLRQAICKYSK-------DDILTVMCMGHNRGWEEAASMFSG-APIELKTCNAALL  926
                H++Q I   S+       D++  V+ +GHNRG EEA   F+G   +E+   + A L
Sbjct  183  VFGSHVKQLIIGESETFEGEQTDEV--VLIVGHNRGLEEAVREFTGETNVEMNVASLACL  240

Query  927  E-----ATGKSWEETF  959
                   T ++WE+  
Sbjct  241  RKRKEAKTRETWEQAL  256



>ref|WP_017928051.1| hypothetical protein [Loktanella hongkongensis]
 gb|EYD73440.1| phosphoglycerate mutase family protein [Loktanella hongkongensis 
DSM 17492]
Length=164

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 74/155 (48%), Gaps = 17/155 (11%)
 Frame = +3

Query  501  RLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRET  680
            +L+L+RHA S W D   RDH RPL+  G+  A R++  L + G +P L+LCSDA RTRET
Sbjct  4    KLVLIRHAKSDWGDSGQRDHARPLAARGRRDAPRMAAWLAEGGHVPELVLCSDATRTRET  63

Query  681  LKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGW  860
            + +MQ   P      +      Y+           LRQA+      D  +V  + HN G 
Sbjct  64   IDLMQAAWPT--PPAIRHEPMLYAA------PPRQLRQAL---HGADARSVALVAHNPGI  112

Query  861  EE-AASMFSGAPI-----ELKTCNAALLEATGKSW  947
               AA +   AP      +  TC   +LE   + W
Sbjct  113  GRLAAELAESAPAHPRFHDYPTCAVTVLEFDARDW  147



>ref|WP_019598003.1| hypothetical protein [Rhodonellum psychrophilum]
 gb|ERM83161.1| hypothetical protein P872_17600 [Rhodonellum psychrophilum GCM71 
= DSM 17998]
Length=162

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 49/152 (32%), Positives = 76/152 (50%), Gaps = 8/152 (5%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+++RHA SSWE   L DH RPL++ G   A +++  L +   IP  +L SDA R + 
Sbjct  2    KKLVIIRHAKSSWESPYLDDHSRPLAERGLRDAPKMAKRLKKKDIIPDAMLSSDAERAKN  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T  I  E +  F +A++HF S  +         A+ +   I K +++ + T+   GHN G
Sbjct  62   TALITAE-ILDFPKAKIHFTSRLFH------SLADTIFDEI-KKTENKVQTLFLFGHNPG  113

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEE  953
              +    F G    L TC    L     SW+E
Sbjct  114  LNDLIEKFGGKIDNLPTCGQFGLTFDVNSWKE  145



>ref|WP_023727316.1| histidine phosphatase [Mesorhizobium sp. LSHC412B00]
 gb|ESX84470.1| histidine phosphatase [Mesorhizobium sp. LSHC412B00]
Length=171

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 82/166 (49%), Gaps = 18/166 (11%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D +L D DRPL   G   A  +  EL +  W P L L S A+RTRE
Sbjct  2    KQLLLLRHAKSSWDDPALADFDRPLGPRGLKTAPMMGRELARRSWQPDLALVSPALRTRE  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++ A     V F  + +   A  G     ++QA+   S      ++ +GHN G
Sbjct  62   TWRLVSAELSA--SVTVEFAEALFEATA--GDILAEVQQAVASAS-----CLLVLGHNPG  112

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             E+ A   +G     ++  AAL     +  EE F    L  + + G
Sbjct  113  LEDFARRLAGP----RSGVAAL-----RKLEEKFPTGALARFVIDG  149



>ref|WP_028794780.1| hypothetical protein [Thalassobaculum salexigens]
Length=162

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 74/145 (51%), Gaps = 12/145 (8%)
 Frame = +3

Query  504  LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETL  683
            L L+RHA S W D    DHDRPL+  G+ AAA ++    Q G  P  +LCS A RTR+TL
Sbjct  4    LHLMRHAKSDW-DGGEADHDRPLAPRGERAAAAMAVYCRQQGIAPDFVLCSSARRTRDTL  62

Query  684  KIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWE  863
            +I++  +P  +  E       Y  +A   Q    L+    +         + +GHN G E
Sbjct  63   EILRAGLPEGVPVET--TRDIYMASA--AQLVTRLKSIPVRTR-----VALVIGHNPGME  113

Query  864  EAASMFSGAPIELK--TCNAALLEA  932
            +A  + +GA + +K  TC  A LEA
Sbjct  114  DAVGLLTGAGVGVKFPTCALATLEA  138



>ref|WP_023834748.1| histidine phosphatase [Mesorhizobium sp. L103C105A0]
 gb|ESZ74315.1| histidine phosphatase [Mesorhizobium sp. L103C105A0]
Length=171

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 69/130 (53%), Gaps = 9/130 (7%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D +L D DRPL   G   A  +  EL +  W+P L L S A+RTRE
Sbjct  2    KQLLLLRHAKSSWDDPALADFDRPLGPRGLKTAPLMGRELARRSWLPDLALVSPALRTRE  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++ A     V F  + +   A  G     ++QA+          ++ +GHN G
Sbjct  62   TWRLVSAELSA--SVTVEFAEALFEATA--GDILAEVQQAVASAG-----CLLVLGHNPG  112

Query  858  WEEAASMFSG  887
             E+ A   +G
Sbjct  113  LEDFARRLAG  122



>gb|ETW12431.1| phosphogylcerate mutase-like protein [Roseivivax sp. 22II-s10s]
Length=165

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 74/133 (56%), Gaps = 15/133 (11%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            RRLI++RHA S W  R L DH RPL++ G+ +A  +   + +    P  +LCS AVRTRE
Sbjct  3    RRLIVMRHAKSDWS-RGLSDHARPLNERGRRSADALGTWMRETAHAPDQVLCSSAVRTRE  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            TL  +     A  EA V F  + Y +A  DG     LR  + +++K     VM +GHN G
Sbjct  62   TLDRL-----ALPEAAVRFEEALY-LAEADGV----LR--VLRHAKGQ--CVMVLGHNPG  107

Query  858  WEEAASMFSGAPI  896
             +E A+   GAPI
Sbjct  108  LQEFAARIVGAPI  120



>ref|WP_027037917.1| histidine phosphatase [Mesorhizobium ciceri]
Length=169

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 71/130 (55%), Gaps = 9/130 (7%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R+L+L+RHA SSW+   L D DRPL++ G  AA  +  EL    W+P L L S A+RTRE
Sbjct  2    RQLLLIRHAKSSWDVPDLDDFDRPLAERGSKAARLMGRELAARRWLPDLALVSAALRTRE  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++P  ++  + F+ + Y  +A D     H+ Q           +++ +GHN G
Sbjct  62   TWRLVAAELP--VQPGIAFVKALYDASAAD--ILSHIGQTDASSG-----SLLVIGHNPG  112

Query  858  WEEAASMFSG  887
             E  A   +G
Sbjct  113  LEHLARQLAG  122



>ref|WP_009563118.1| Phosphoglycerate mutase family protein [Rhodobacter sp. AKP1]
 gb|EKX58138.1| Phosphoglycerate mutase family protein [Rhodobacter sp. AKP1]
Length=168

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 69/125 (55%), Gaps = 11/125 (9%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            +RLIL+RHA S+W+D  L DHDRPL+  G+ AA  +   L   G++PG +LCSDA+RTR 
Sbjct  3    KRLILIRHAKSAWDDPLLPDHDRPLNPRGEGAARDLGQWLASRGYLPGEVLCSDALRTRA  62

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T + +   +P   E  +    + Y   A        +  A+ +++  D  TV  +GHN G
Sbjct  63   TWEGIAPFLPDAPEPTLK--PALYHAGA-------DVMLAVLRHATAD--TVCLLGHNPG  111

Query  858  WEEAA  872
              E A
Sbjct  112  IAEFA  116



>dbj|GAK58981.1| phosphoglycerate mutase [bacterium UASB270]
Length=169

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 77/159 (48%), Gaps = 9/159 (6%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            +R+ LLRHA SSW+D SL D +RPL+K G+  A  +   L     +P LI+ S A R   
Sbjct  2    KRVYLLRHAKSSWQDSSLEDFERPLNKRGKQDAPEMGQRLRSQHVLPDLIISSPAKRAVA  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T KI  E++  + + ++ + ++ Y       QT  H  +       ++I  VM  GHN G
Sbjct  62   TAKIFAEEI-GYPKKQIVYEAAIYEADTARLQTLLHGLE-------NNIQQVMLCGHNPG  113

Query  858  WEEAASMFSGAPIE-LKTCNAALLEATGKSWEETFSLAG  971
                A   SG  I+ + TC    ++    +W+E     G
Sbjct  114  LTMLAEYLSGTLIDNIPTCGIVCVDFAVDTWQEIGERKG  152



>ref|WP_024505066.1| histidine phosphatase [Mesorhizobium ciceri]
Length=170

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 76/132 (58%), Gaps = 13/132 (10%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R+L+LLRHA SSW+D  L D DRPL++ G  AA  +  EL   GW+P L+L S A+RTRE
Sbjct  2    RQLLLLRHAKSSWDDPDLDDFDRPLAERGSKAARLMGRELAARGWLPDLVLVSTALRTRE  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDIL--TVMCMGHN  851
            T +++  ++P  ++  V FL + Y  +A D          + +  + D    +++ +GHN
Sbjct  62   TWRLVAAELP--VQPRVAFLKALYDASAAD---------ILSQIGQTDASSGSLLAIGHN  110

Query  852  RGWEEAASMFSG  887
             G E+ A   +G
Sbjct  111  PGLEQLARKLAG  122



>ref|WP_002721435.1| phosphoglycerate mutase [Rhodobacter sphaeroides]
 gb|EGJ22571.1| phosphohistidine phosphatase, SixA [Rhodobacter sphaeroides WS8N]
Length=168

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 68/127 (54%), Gaps = 15/127 (12%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            +RLIL+RHA S+W+D  L DHDRPL+  G+ AA  +   L   G++PG +LCSDA+RTR 
Sbjct  3    KRLILIRHAKSAWDDPLLPDHDRPLNPRGEGAARDLGQWLASRGYVPGEVLCSDALRTRA  62

Query  678  TLKIMQEQVPAFLE--AEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
            T     E +  FL    E     + Y   A        +  A+ +++  D  TV  +GHN
Sbjct  63   T----WEGIAPFLSDAPEPTLKPALYHAGA-------DVMLAVLRHATAD--TVCLLGHN  109

Query  852  RGWEEAA  872
             G  E A
Sbjct  110  PGIAEFA  116



>ref|WP_023731098.1| histidine phosphatase [Mesorhizobium sp. LNJC405B00]
 gb|ESX92370.1| histidine phosphatase [Mesorhizobium sp. LNJC405B00]
Length=171

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 69/130 (53%), Gaps = 9/130 (7%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D +L D DRPL   G   A  +  EL +  W P L L S A+RTRE
Sbjct  2    KQLLLLRHAKSSWDDPALADFDRPLGPRGLKTAPLMGRELARRSWQPDLALVSPALRTRE  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++ A     V F  + +   A  G     ++QA+   S      ++ +GHN G
Sbjct  62   TWRLVSAELSA--SVTVEFAEALFEATA--GDILAEVQQAVASAS-----CLLVLGHNPG  112

Query  858  WEEAASMFSG  887
             E+ A   +G
Sbjct  113  LEDFARRLAG  122



>ref|WP_011338695.1| phosphoglycerate mutase [Rhodobacter sphaeroides]
 ref|YP_354155.1| phosphohistidine phosphatase SixA [Rhodobacter sphaeroides 2.4.1]
 ref|YP_002526825.1| phosphohistidine phosphatase, SixA [Rhodobacter sphaeroides KD131]
 gb|ABA80254.1| phosphohistidine phosphatase SixA [Rhodobacter sphaeroides 2.4.1]
 gb|ACM02324.1| phosphohistidine phosphatase, SixA [Rhodobacter sphaeroides KD131]
Length=168

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 68/127 (54%), Gaps = 15/127 (12%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            +RLIL+RHA S+W+D  L DHDRPL+  G+ AA  +   L   G++PG +LCSDA+RTR 
Sbjct  3    KRLILIRHAKSAWDDPLLPDHDRPLNPRGEGAARDLGQWLASRGYVPGEVLCSDALRTRA  62

Query  678  TLKIMQEQVPAFLE--AEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
            T     E +  FL    E     + Y   A        +  A+ +++  D  TV  +GHN
Sbjct  63   T----WEGIAPFLSDAPEPTLKPALYHAGA-------DVMLAVLRHATAD--TVCLLGHN  109

Query  852  RGWEEAA  872
             G  E A
Sbjct  110  PGIAEFA  116



>ref|WP_011841849.1| phosphoglycerate mutase [Rhodobacter sphaeroides]
 ref|YP_001044605.1| putative phosphohistidine phosphatase, SixA [Rhodobacter sphaeroides 
ATCC 17029]
 gb|ABN77833.1| putative phosphohistidine phosphatase, SixA [Rhodobacter sphaeroides 
ATCC 17029]
Length=168

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 68/127 (54%), Gaps = 15/127 (12%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            +RLIL+RHA S+W+D  L DHDRPL+  G+ AA  +   L   G++PG +LCSDA+RTR 
Sbjct  3    KRLILIRHAKSAWDDPLLPDHDRPLNPRGEGAARDLGQWLASRGYVPGEVLCSDALRTRA  62

Query  678  TLKIMQEQVPAFLE--AEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
            T     E +  FL    E     + Y   A        +  A+ +++  D  TV  +GHN
Sbjct  63   T----WEGIAPFLSDAPEPTLKPALYHAGA-------DVMLAVLRHATAD--TVCLLGHN  109

Query  852  RGWEEAA  872
             G  E A
Sbjct  110  PGIAEFA  116



>ref|WP_002693842.1| phosphoglycerate mutase family domain protein [Microscilla marina]
 gb|EAY31280.1| phosphoglycerate mutase family domain protein [Microscilla marina 
ATCC 23134]
Length=168

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 78/153 (51%), Gaps = 11/153 (7%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            + L LLRHA SSW+D SL D +RPL+K G+  A  ++ +  + G +P LIL S +VRTR 
Sbjct  2    KTLTLLRHAKSSWKDLSLPDFERPLNKRGKRDAPFMAQKFKEKGDMPHLILSSPSVRTRL  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T+    + +P   E  V F    Y   A   QT   LR  + +   D + +++ +GHN G
Sbjct  62   TVAAFAKVLP---ETAVEFDQRIYEAHA---QTL--LR--LIRQQSDKVTSLVLVGHNPG  111

Query  858  WEEAASMFSGAPIE-LKTCNAALLEATGKSWEE  953
              +  + F+  PI+ + T            W++
Sbjct  112  LTDLTNYFAPRPIDNVPTTGVVQFNFVTTQWQQ  144



>ref|WP_016556668.1| hypothetical protein [Rhizobium grahamii]
 gb|EPE95888.1| hypothetical protein RGCCGE502_23600 [Rhizobium grahamii CCGE 
502]
Length=178

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/171 (33%), Positives = 88/171 (51%), Gaps = 25/171 (15%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            RRL+LLRHA S+W + ++ DHDRPL+  G+ AA  + H L     IP L+L S A RT+E
Sbjct  10   RRLLLLRHAKSAWPE-NVPDHDRPLAGRGEKAAPLMGHYLAHEKLIPDLVLVSSARRTQE  68

Query  678  TLKIMQEQVPAFL---EAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGH  848
            T  ++ +++P+ +   +AE  + +S   +A            A+ +     + T+M +GH
Sbjct  69   TWGLLAKKLPSSIAKRDAEDLYEASAAKIA------------AVVQTIDPKVRTLMLIGH  116

Query  849  NRGWEEAASMFSG-------APIELKTCNAAL--LEATGKSWEETFSLAGL  974
            N G+++ A    G       A I  K   AAL  +E     WE+    +GL
Sbjct  117  NPGFQDLADGLIGEGDPEACARIREKFPTAALAVIEFDADRWEDLRPRSGL  167



>ref|WP_015597990.1| phosphohistidine phosphatase SixA [Hyphomicrobium denitrificans]
 ref|YP_007914458.1| phosphohistidine phosphatase SixA [Hyphomicrobium denitrificans 
1NES1]
 gb|AGK57959.1| phosphohistidine phosphatase SixA [Hyphomicrobium denitrificans 
1NES1]
Length=184

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 85/179 (47%), Gaps = 25/179 (14%)
 Frame = +3

Query  504   LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETL  683
             L LLRHA SSWE   L D DRPL+  G+ AA  +   L    ++P +ILCS A RTRETL
Sbjct  16    LALLRHAKSSWEASHLDDFDRPLNARGRAAAPIMGETLRSFPFVPEIILCSPAKRTRETL  75

Query  684   KIMQEQVPAFLEAEVH--FLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
              +++   P+F     H  F    Y  +A      E LR  +   +K    TV+ +GHN G
Sbjct  76    HLIE---PSFGHPHGHVLFEDQLYLTSA--DTLLERLRH-VSATAK----TVLMIGHNPG  125

Query  858   WEEAASMFSG-------APIELKTCNAAL--LEATGKSWEETFSLAGLGGWELQGIVKP  1007
               E A M +G       + +E K   AAL  L     +W +     G     L+G + P
Sbjct  126   LHELALMLTGRGDAKSISRLEDKFPTAALAILTFPETAWRDV----GPSSGRLEGFITP  180



>ref|WP_023711895.1| MULTISPECIES: histidine phosphatase [Mesorhizobium]
 gb|ESX46540.1| histidine phosphatase [Mesorhizobium sp. LSHC426A00]
 gb|ESX54375.1| histidine phosphatase [Mesorhizobium sp. LSHC424B00]
 gb|ESX72174.1| histidine phosphatase [Mesorhizobium sp. LSHC416B00]
Length=171

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 69/130 (53%), Gaps = 9/130 (7%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D +L D DRPL   G   A  +  EL +  W+P L L S A+RTRE
Sbjct  2    KQLLLLRHAKSSWDDPALADFDRPLGPRGLKTAPLMGRELARRSWLPDLALVSPALRTRE  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++ A     V F  + +   A  G     ++QA+          ++ +GHN G
Sbjct  62   TWRLVSAELSA--SVTVEFAEALFEGTA--GDILAEVQQAVASAG-----CLLVLGHNPG  112

Query  858  WEEAASMFSG  887
             E+ A   +G
Sbjct  113  LEDFARRLAG  122



>gb|AHK42717.1| putative phosphohistidine phosphatase protein [Ensifer adhaerens 
OV14]
Length=166

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/161 (32%), Positives = 77/161 (48%), Gaps = 19/161 (12%)
 Frame = +3

Query  507  ILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETLK  686
            +LLRHA S+W D  + DHDRPL + G+ AA  +  ++ + G IPGL + S A R RET  
Sbjct  1    MLLRHAKSAWPD-GVPDHDRPLGERGRKAAPLIGADMKRKGLIPGLAIVSTARRARETWA  59

Query  687  IMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWEE  866
            ++++ +P  +          Y V A           A  +    DI  ++ +GHN G EE
Sbjct  60   LVRDNLPPPI--PTRETRDIYEVGA-------PAILATIRAVDPDIRNLLVVGHNPGMEE  110

Query  867  AASMFSGAPIE---------LKTCNAALLEATGKSWEETFS  962
             A + +G+  +           T   A+L   G SWE+  S
Sbjct  111  LAHLLAGSGRQEALARMREKFPTAALAVLAFDGSSWEDLAS  151



>ref|WP_027057563.1| histidine phosphatase [Mesorhizobium loti]
Length=169

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 82/168 (49%), Gaps = 22/168 (13%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L+LLRHA SSW+D +L D DRPL++ G  AA  +  EL    W+P L L S A+RT +
Sbjct  2    KQLLLLRHAKSSWDDPALDDFDRPLAERGLKAARLMGQELAARDWLPDLALVSPALRTSD  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMD--GQTAEHLRQAICKYSKDDILTVMCMGHN  851
            T +++  ++P  +   + F  + Y  +A D  G+  +    + C         ++ +GHN
Sbjct  62   TWRLVAAELP--VHPRIAFAQALYDASAADILGRIRKADPSSNC---------LLMVGHN  110

Query  852  RGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             G E+ A   +    E+K           K  EE F  A +     +G
Sbjct  111  PGLEDLAKQLASPTSEVK---------ARKRLEEKFPTAAVARLVFEG  149



>ref|WP_031148959.1| phosphohistidine phosphatase [Streptomyces erythrochromogenes]
Length=173

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 68/131 (52%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR+ LLRHA + W D S  DHDRPL++ G+  A  V  +L + G +  L LCS A RTR
Sbjct  6    PRRIALLRHAKADWPDVS--DHDRPLAERGRKDAPAVGLKLAETGIVFDLALCSTAARTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  +++P       H   + Y     D    E +  A+   + D++  ++ +GHN 
Sbjct  64   ETWKLAVQEMP-------HRPKTHYEERIYDASPGELI--ALLNETSDEVSDLLVIGHNP  114

Query  855  GWEEAASMFSG  887
            G    A   +G
Sbjct  115  GMHALADALAG  125



>ref|WP_037930673.1| phosphohistidine phosphatase [Streptomyces sp. PCS3-D2]
 gb|EYU65343.1| phosphohistidine phosphatase [Streptomyces sp. PCS3-D2]
Length=173

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 68/131 (52%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR+ LLRHA + W D S  DHDRPL++ G+  A  V  +L + G +  L LCS A RTR
Sbjct  6    PRRIALLRHAKADWPDVS--DHDRPLAERGRKDAPAVGLKLAETGIVFDLALCSTAARTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  +++P       H   + Y     D    E +  A+   + D++  ++ +GHN 
Sbjct  64   ETWKLAVQEMP-------HRPKTHYEERIYDASPGELI--ALLNETSDEVSDLLVIGHNP  114

Query  855  GWEEAASMFSG  887
            G    A   +G
Sbjct  115  GMHALADALAG  125



>ref|WP_011121948.1| phosphohistidine phosphatase [Rhodopirellula baltica]
 ref|NP_868471.1| phosphohistidine phosphatase [Rhodopirellula baltica SH 1]
 emb|CAD75835.1| conserved hypothetical protein-putative phosphohistidine phosphatase 
[Rhodopirellula baltica SH 1]
Length=201

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 80/166 (48%), Gaps = 9/166 (5%)
 Frame = +3

Query  468  PASDSAQFLPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLI  647
            P++D  Q    RLIL+RHA S W D  L DH+RPL+  G+  A R++  +   G  P  +
Sbjct  22   PSADPTQM---RLILMRHAKSDWADARLSDHERPLNARGRRDAPRIAGWMQDNGCQPDFL  78

Query  648  LCSDAVRTRETLKIMQEQ----VPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSK  815
            L SD+ RTRET   +  +    VP +   ++ +L+S  ++  M   T + L       S 
Sbjct  79   LSSDSKRTRETAAFLNSRWDSTVPTYFSLDL-YLASASAIFQMIRSTKQWLADE-NGTSI  136

Query  816  DDILTVMCMGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEE  953
                T++ +GHN G   AAS   G      T   A+ E    SW +
Sbjct  137  STPETLLVLGHNPGISAAASELLGHSCGFPTAGLAVFECEVSSWSD  182



>ref|WP_030962206.1| phosphohistidine phosphatase [Streptomyces sp. NRRL S-378]
Length=173

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 68/131 (52%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR+ LLRHA + W D S  DHDRPL++ G+  A  V  +L + G +  L LCS A RTR
Sbjct  6    PRRIALLRHAKADWPDVS--DHDRPLAERGRKDAPAVGLKLAETGIVFDLALCSTAARTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  +++P       H   + Y     D    E +  A+   + D++  ++ +GHN 
Sbjct  64   ETWKLAVQEMP-------HRPKTHYEERIYDASPGELI--ALLNETSDEVSDLLVIGHNP  114

Query  855  GWEEAASMFSG  887
            G    A   +G
Sbjct  115  GMHALADALAG  125



>gb|AHF00632.1| histidine phosphatase [Thioalkalimicrobium aerophilum AL3]
Length=177

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 64/123 (52%), Gaps = 11/123 (9%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R+L+L RHA S W D SL DHDRPL+  G  AA R+++ L     IP  +LCS AVRT++
Sbjct  7    RQLLLWRHAKSDWSDSSLADHDRPLATRGVKAAQRMANWLLSEKLIPEQVLCSSAVRTKQ  66

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            TL+ +    P        F S  Y   A   Q       AI      DI  +M +GHN G
Sbjct  67   TLEFLTRLQP----IPTTFDSQLYH--AEPDQIL-----AIISKVNPDIKRLMLVGHNPG  115

Query  858  WEE  866
            +E+
Sbjct  116  YEQ  118



>ref|WP_037165030.1| MULTISPECIES: hypothetical protein [Rhizobium]
Length=167

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 73/128 (57%), Gaps = 10/128 (8%)
 Frame = +3

Query  504  LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETL  683
            ++LLRHA S+W +  + D +RPL++ G+ AA  + + + +   IPGL L SDA RT+ET 
Sbjct  1    MLLLRHAKSAWPE-GVPDQERPLAERGEKAAPAMGNHMAREHLIPGLALVSDARRTQETW  59

Query  684  KIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWE  863
            K+++ ++P  +EA V    + Y  +A   Q  E LR+           TV+ +GHN G +
Sbjct  60   KLVKSRLPGAVEARV--TPALYDASA--AQMLEVLRKTDANTD-----TVLMIGHNPGLQ  110

Query  864  EAASMFSG  887
            E A M  G
Sbjct  111  ELALMLVG  118



>ref|WP_030318327.1| phosphohistidine phosphatase [Streptomyces sp. NRRL B-3229]
Length=172

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 11/132 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++L RHA + W    + DH+RPL+  G+  AA     L   G   GL LCS A RTR
Sbjct  6    PRRIVLFRHAKADWP--QVTDHERPLADRGRKDAAEAGRRLTDSGIPFGLALCSTATRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  ++ P       H   + Y     +    E +  A+   + DD+   + +GHN 
Sbjct  64   ETWKLAVQEFP-------HRPKTVYEERIYEASPGELI--AVLNETPDDVQNAVLIGHNP  114

Query  855  GWEEAASMFSGA  890
            G +  A + +GA
Sbjct  115  GVQGLADILAGA  126



>ref|WP_019012850.1| hypothetical protein [Elioraea tepidiphila]
Length=177

 Score = 74.7 bits (182),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 71/130 (55%), Gaps = 10/130 (8%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R+L+LLRHA SSW+D SL DHDRPL+  G+  AA +  E+  LG  P ++L S A RT+E
Sbjct  2    RQLLLLRHAKSSWDDPSLPDHDRPLNARGRADAAAMGSEMRGLGLAPDIVLVSSARRTQE  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            TL +++   P      +  L + Y   A   +    L  A+ + ++    +V+ +GHN G
Sbjct  62   TLALIE---PFDDSPVIDTLEALYLAPA---RKLLDLLHAVPETAR----SVLVIGHNPG  111

Query  858  WEEAASMFSG  887
                A   +G
Sbjct  112  LHNLALALAG  121



>ref|WP_019979086.1| hypothetical protein [Verrucomicrobia bacterium SCGC AAA300-O17]
Length=171

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 72/153 (47%), Gaps = 9/153 (6%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            + L+L+RHA SSWED  L DH+RPL+  G+  A R++  L +LG  P  ++ S A R   
Sbjct  2    KTLLLIRHAKSSWEDSRLDDHERPLNHRGKDNAPRMAARLQELGIKPDALISSTARRAAS  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T ++  + +  F   ++ F +  Y  +         + Q I    +D   TV+  GHN G
Sbjct  62   TAQVFADHL-DFPRDKILFDADLYLASV-------GILQKIIGKIEDSFQTVLIFGHNPG  113

Query  858  WEEAASMFSGAPI-ELKTCNAALLEATGKSWEE  953
                 S   G PI  L TC    L     +W E
Sbjct  114  LTLLVSQVWGLPIGNLPTCGIVSLNFESFTWAE  146



>ref|WP_011909808.1| phosphoglycerate mutase [Rhodobacter sphaeroides]
 ref|YP_001169054.1| putative phosphohistidine phosphatase SixA [Rhodobacter sphaeroides 
ATCC 17025]
 gb|ABP71749.1| putative phosphohistidine phosphatase, SixA [Rhodobacter sphaeroides 
ATCC 17025]
Length=168

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 68/125 (54%), Gaps = 11/125 (9%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            +RLIL+RHA S+W+D  + DHDRPL+  G+ AA  +   L   G++PG +LCSDA+RTR 
Sbjct  3    KRLILIRHAKSAWDDPLIPDHDRPLNPRGEGAARDLGQWLASRGYLPGEVLCSDALRTRA  62

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T   +   +P+   A    L      A  D      +  A+ +++  D  TV  +GHN G
Sbjct  63   TWDGIAPFLPS---APAPVLKPALYHAGSD------VMLAVLRHATAD--TVCILGHNPG  111

Query  858  WEEAA  872
              E A
Sbjct  112  IAEFA  116



>ref|WP_037111099.1| hypothetical protein [Rhizobium sp. MGL06]
Length=167

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 75/128 (59%), Gaps = 10/128 (8%)
 Frame = +3

Query  504  LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETL  683
            ++LLRHA S+W +  + DH+RPL++ G+ AA  + + + +   IPGL L SDA RT+ET 
Sbjct  1    MLLLRHAKSAWPE-GVPDHERPLAERGEKAARAMGNHMAREHLIPGLALVSDARRTQETW  59

Query  684  KIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWE  863
            ++++ ++P  +EA V       + A  D   A+ L   + + +  +  TV+ +GHN G +
Sbjct  60   ELVKSRLPCAVEARV-------TPALYDASAAQMLE--VLRKTDANTDTVLMIGHNPGLQ  110

Query  864  EAASMFSG  887
            E A M  G
Sbjct  111  ELALMLVG  118



>ref|WP_030386470.1| phosphohistidine phosphatase [Streptomyces sp. NRRL S-241]
Length=173

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 68/131 (52%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR+ LLRHA + W + S  DHDRPL++ G+  A  V  +L + G +  L LCS A RTR
Sbjct  6    PRRIALLRHAKADWPEVS--DHDRPLAERGRKDAPAVGLKLAETGIVFDLALCSTAARTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  +++P       H   + Y     D    E +  A+   + D++  ++ +GHN 
Sbjct  64   ETWKLAVQEMP-------HRPKTHYEERLYDASLGELI--ALLNETSDEVSDLLVIGHNP  114

Query  855  GWEEAASMFSG  887
            G    A   SG
Sbjct  115  GMHALADALSG  125



>ref|WP_030012236.1| MULTISPECIES: phosphohistidine phosphatase [Streptomyces]
Length=173

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 68/131 (52%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR+ LLRHA + W + S  DHDRPL++ G+  A  V  +L + G +  L LCS A RTR
Sbjct  6    PRRIALLRHAKADWPEVS--DHDRPLAERGRKDAPAVGLKLAETGIVFDLALCSTAARTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  +++P       H   + Y     D    E +  A+   + D++  ++ +GHN 
Sbjct  64   ETWKLAVQEMP-------HRPKTHYEERLYDASLGELI--ALLNETSDEVSDLLVIGHNP  114

Query  855  GWEEAASMFSG  887
            G    A   SG
Sbjct  115  GMHALADALSG  125



>ref|WP_030849757.1| phosphohistidine phosphatase [Streptomyces sp. NRRL F-4474]
Length=173

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR+ LLRHA + W D S  DHDRPL++ G+  A  V  +L + G +  L LCS A RTR
Sbjct  6    PRRIALLRHAKADWPDVS--DHDRPLAERGRKDAPAVGLKLAETGIVFDLALCSTAARTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  +++P       H   + Y     D    E +  A+     D++  ++ +GHN 
Sbjct  64   ETWKLAVQEMP-------HRPKTHYEERIYDASPGELI--ALLNEVSDEVRDLLVIGHNP  114

Query  855  GWEEAASMFSG  887
            G    A   +G
Sbjct  115  GMHALADALAG  125



>ref|WP_030720119.1| phosphohistidine phosphatase [Streptomyces sp. NRRL S-237]
Length=173

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 68/131 (52%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR+ LLRHA + W + S  DHDRPL++ G+  A  V  +L + G +  L LCS A RTR
Sbjct  6    PRRIALLRHAKADWPEVS--DHDRPLAERGRKDAPAVGLKLAETGIVFDLALCSTAARTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  +++P       H   + Y     D    E +  A+   + D++  ++ +GHN 
Sbjct  64   ETWKLAVQEMP-------HRPKTHYEERLYDASLGELI--ALLNETSDEVSDLLVIGHNP  114

Query  855  GWEEAASMFSG  887
            G    A   SG
Sbjct  115  GMHALADALSG  125



>ref|WP_022708247.1| phosphoglycerate mutase [Paracoccus zeaxanthinifaciens]
Length=172

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 52/135 (39%), Positives = 72/135 (53%), Gaps = 11/135 (8%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            RRLIL RHA S+W+D +L DHDRPL++ G+ +A  +   +   G+ P  +LCS A RTR+
Sbjct  7    RRLILTRHAKSAWDDPTLDDHDRPLNERGRRSARALGDWMASRGYEPEEVLCSTATRTRQ  66

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T  ++    P  +   + F  S Y  A  D   A  LR A          TVM +GHN G
Sbjct  67   TWDVVS-GAPLEVRPVMRFEKSLYH-AGPDRMLAV-LRSATQP-------TVMMIGHNPG  116

Query  858  WEEAASMFSG-APIE  899
              E A+M    AP++
Sbjct  117  ISEFAAMLPARAPLD  131



>ref|WP_023779708.1| histidine phosphatase [Mesorhizobium sp. LNHC221B00]
 gb|ESY77151.1| histidine phosphatase [Mesorhizobium sp. LNHC221B00]
Length=170

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 56/166 (34%), Positives = 79/166 (48%), Gaps = 18/166 (11%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R+L+LLRHA SS +D  L D +RPL++ G   A  +  EL    W+P L L S A+RTR+
Sbjct  2    RQLLLLRHAKSSRDDPGLDDFNRPLAERGLKTAPLIGRELAAHAWLPDLALVSPALRTRD  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++P      +H   S ++ A  D   A+ L Q       D  L V   GHN G
Sbjct  62   TWRLVAAELP------MH-PRSVFAEALYDASAADILSQIRLADPSDGCLLV--AGHNPG  112

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             E+ A   +G+  E K           K  EE F  A L  +   G
Sbjct  113  LEDLAKQLAGSGSEAK---------ARKRLEEKFPTAALARFVFDG  149



>ref|WP_023000684.1| MULTISPECIES: phosphohistidine phosphatase [Labrenzia]
 gb|ERP93854.1| phosphohistidine phosphatase [Labrenzia sp. C1B10]
 gb|ERS05321.1| phosphohistidine phosphatase [Labrenzia sp. C1B70]
Length=174

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 66/130 (51%), Gaps = 11/130 (8%)
 Frame = +3

Query  501  RLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRET  680
            RL+L RHA S W D +L D DRPL+  G+ A+ +++  + + G  P  ILCS A RTRET
Sbjct  2    RLLLFRHAKSDWGDANLADIDRPLNSRGKTASVKMARYMKEQGLQPNQILCSTAQRTRET  61

Query  681  LKIMQEQVPAFL-EAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            L  +   +P    E ++H +S  Y       Q +E     + +        +M +GHN  
Sbjct  62   LARL---LPTLTQETQIHLVSDLY-------QQSEDDYVGLIRRYGGRAQNLMVIGHNPA  111

Query  858  WEEAASMFSG  887
             E+ A   SG
Sbjct  112  TEDTALSLSG  121



>ref|WP_031010384.1| phosphohistidine phosphatase [Streptomyces sp. NRRL WC-3773]
Length=172

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 65/131 (50%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++LLRHA + W   S  DH+RPL++ G+  A    H L   G  P L LCS A RTR
Sbjct  6    PRRIVLLRHAKADWSQES--DHERPLAERGRKDAPVAGHWLAGAGITPDLTLCSTAARTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K++  ++P           + Y     +    E +  A+   + DD+  +M +GHN 
Sbjct  64   ETWKLVVSELP-------QRPKTVYDERLYEASLGELI--ALLNETSDDVTDLMLVGHNP  114

Query  855  GWEEAASMFSG  887
            G    A   +G
Sbjct  115  GMHALADALAG  125



>ref|WP_038076948.1| phosphoglycerate mutase [Thioclava pacifica]
 gb|KEO52770.1| phosphoglycerate mutase [Thioclava pacifica DSM 10166]
Length=172

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 74/166 (45%), Gaps = 22/166 (13%)
 Frame = +3

Query  501  RLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRET  680
            RLIL RHA SSW+D  + D DRPL+  G+ AA  +   L   G  P  +LCS A RTRET
Sbjct  8    RLILTRHAKSSWDDPLMEDRDRPLNARGRAAALELGDFLASRGLEPEEVLCSSAQRTRET  67

Query  681  LKIMQEQVPAFL---EAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
                 +QV A +     EV ++ S Y  A       E + Q +   S     TVM +GHN
Sbjct  68   W----DQVAAAVIETRPEVSYVESLYHAA------PEMMLQVLRTASAP---TVMMLGHN  114

Query  852  RGWEEAASMFSGAPI------ELKTCNAALLEATGKSWEETFSLAG  971
             G  E A      PI         TC   +++     W E     G
Sbjct  115  PGIAEFAHQLPARPIHDPDFRRFPTCATLIVDFQIADWSEVMPGQG  160



>ref|WP_013896232.1| histidine phosphatase [Mesorhizobium opportunistum]
 ref|YP_004613683.1| putative phosphohistidine phosphatase SixA [Mesorhizobium opportunistum 
WSM2075]
 gb|AEH89589.1| putative phosphohistidine phosphatase, SixA [Mesorhizobium opportunistum 
WSM2075]
Length=170

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 80/166 (48%), Gaps = 18/166 (11%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R+L++LRHA SS +D  L D DRPL++ G   A  +  EL    W+P L L S A+RTR+
Sbjct  2    RQLLVLRHAKSSRDDPKLADFDRPLAERGLKTAPLIGRELAARDWVPDLALVSPALRTRD  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++  ++P      +H   S ++ A  D   A+ L Q       +  L V  +GHN G
Sbjct  62   TWRLVAAELP------MH-PRSVFAEALYDASAADILSQIRLADPSNGCLLV--VGHNPG  112

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQG  995
             E+ A   +G+  E K           K  EE F  A L     +G
Sbjct  113  LEDLAKQLAGSGSEAK---------ARKRLEEKFPTAALARLVFEG  149



>emb|CDX25893.1| putative phosphohistidine phosphatase SixA [Mesorhizobium sp. 
ORS3359]
Length=171

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/161 (34%), Positives = 82/161 (51%), Gaps = 20/161 (12%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            ++L++LRHA SSW+D +L D DRPL+  G   A+ +  EL + GW+P L L S A+R R+
Sbjct  4    KQLLILRHAKSSWDDPALADFDRPLAPRGLKTASLMGRELARRGWLPDLALVSPALRARD  63

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++ +++     A+  F    Y  AA D   A  +RQA           +M +GHN G
Sbjct  64   TWRLVAQELSGHTPAQ--FADELYEAAA-DAILA-RVRQAKAT-------NLMVIGHNPG  112

Query  858  WEEAASMFSGA--------PIELKTCNAALLEAT-GKSWEE  953
             ++     +GA         IE K   AAL   T  + W +
Sbjct  113  LQQFVLRLAGAGSDESVFKKIEAKFPTAALARFTLDRDWAD  153



>ref|WP_018499986.1| phosphohistidine phosphatase [Frankia sp. BCU110501]
Length=183

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/159 (35%), Positives = 71/159 (45%), Gaps = 24/159 (15%)
 Frame = +3

Query  501  RLILLRHAHSSW-EDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            RL+LLRHA S W  D  +RD DRPLS  G+   A V+  L   G  P L+LCS AVRTRE
Sbjct  6    RLLLLRHAKSDWTSDPEVRDQDRPLSPKGRRGIALVADHLAASGLEPDLVLCSSAVRTRE  65

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T++ +   +P   +  V      Y   A D         A  +   D + TV+ +GHN G
Sbjct  66   TVEHLANALPG--DVPVLVEDRLYLAEAND-------LLARLREIDDGVPTVLMVGHNPG  116

Query  858  WEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGL  974
                          L T    LL  + +    TF  A L
Sbjct  117  --------------LHTLTVGLLAPSERHRVPTFPTAAL  141



>ref|WP_007332250.1| phosphohistidine phosphatase [Rhodopirellula baltica]
 gb|EKK02177.1| phosphohistidine phosphatase, SixA [Rhodopirellula baltica SH28]
 gb|ELP32252.1| phosphohistidine phosphatase, SixA [Rhodopirellula baltica SWK14]
Length=173

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/155 (33%), Positives = 75/155 (48%), Gaps = 6/155 (4%)
 Frame = +3

Query  501  RLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRET  680
            RLIL+RHA S W D  L DH+RPL+  G+  A R++  +   G  P  +L SD+ RTRET
Sbjct  2    RLILMRHAKSDWADARLSDHERPLNARGRRDAPRIAGWMQDNGCQPDFLLSSDSKRTRET  61

Query  681  LKIMQEQ----VPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGH  848
               +  +    VP +   ++ +L+S  ++  M   T + L       S     T++ +GH
Sbjct  62   AAFLNSRWDSPVPTYFSLDL-YLASASAIFQMIRSTGQWLADE-NGTSISTPETLLVLGH  119

Query  849  NRGWEEAASMFSGAPIELKTCNAALLEATGKSWEE  953
            N G   AAS   G      T   A+ E    SW +
Sbjct  120  NPGISAAASELLGHSCGFPTAGLAVFECEVSSWSD  154



>ref|WP_023529149.1| hypothetical protein [Streptomycetaceae bacterium MP113-05]
 gb|EST37792.1| hypothetical protein N566_11140 [Streptomycetaceae bacterium 
MP113-05]
Length=172

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/171 (31%), Positives = 78/171 (46%), Gaps = 20/171 (12%)
 Frame = +3

Query  492   LPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRT  671
             +PR ++LLRHA + W D  + DHDRPL+  G+  A      L   G  P L LCS A RT
Sbjct  5     VPRSIVLLRHAKADWPD--VADHDRPLADRGRTDAPLAGGWLAGHGIAPQLTLCSTAART  62

Query  672   RETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
             RET K++  Q+P           + Y     +    E +  A+   + DD   ++ +GHN
Sbjct  63    RETWKLVAHQLP-------ERPRTVYEERLYEASPGEII--AVLNETSDDTRDLLVVGHN  113

Query  852   RGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWELQGIVK  1004
              G +  A + +G+  E         +A G+  E  F  A L      G+ K
Sbjct  114   PGMQALAELLAGSADE---------DAAGRMREHGFPTAALAVVRFTGLWK  155



>ref|WP_024707039.1| hypothetical protein [Martelella sp. AD-3]
Length=172

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 84/183 (46%), Gaps = 30/183 (16%)
 Frame = +3

Query  495   PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
             P R+ L RHA + W + ++RD +RPLSK G   AA ++  +   G++P +IL S A+R R
Sbjct  8     PERIYLFRHAQAVWPEPTMRDFERPLSKRGVDDAAEIARRMKAAGYVPEVILSSSAMRCR  67

Query  675   ETLKIMQ---EQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMG  845
             +T        +++P+       F+  FY  A +         +AI  ++  D  +V+  G
Sbjct  68    QTADAAYRALDRIPS-----CRFIDDFYQAAPVT------YIEAISDHA--DRQSVLICG  114

Query  846   HNRGWEEAASMFSG-------APIELKTCNAALLEATGKSWEETFSLAGLGG--WELQGI  998
             HN G EE   M  G        P    T   A+L+  G   E     AG G   W++   
Sbjct  115   HNPGIEETLLMLVGYEAFNATCPYGFPTAGIAVLDHAGAQQE-----AGDGAPEWKVTAF  169

Query  999   VKP  1007
             + P
Sbjct  170   LAP  172



>ref|WP_034090529.1| phosphohistidine phosphatase [Streptacidiphilus albus]
Length=179

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 67/130 (52%), Gaps = 11/130 (8%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            RR+I+LRHA + W   S+ DH+RPL+  G+  A      L   G +P L+LCS A RTRE
Sbjct  10   RRIIVLRHAKADWP--SVADHERPLADRGRRDAPAAGRWLAGTGIVPDLVLCSTAARTRE  67

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T K+   ++P        +    Y  A   GQ  E L++       +D+ TV+ +GHN G
Sbjct  68   TWKLFAHELPT--RPRTVYEERLYEAAP--GQLIEVLQEV-----PEDVATVLLVGHNPG  118

Query  858  WEEAASMFSG  887
             +    + +G
Sbjct  119  VQGLTEVLAG  128



>ref|WP_030858418.1| phosphohistidine phosphatase [Streptomyces sp. NRRL S-37]
Length=172

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 66/132 (50%), Gaps = 11/132 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++L RHA + W   S  DH+RPL++ G++ AA    +L   G    L LCS AVRTR
Sbjct  6    PRRIVLFRHAKADWPPVS--DHERPLAERGRMDAAVAGRKLADTGIAFDLALCSTAVRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+   + P           + Y     D    E +  A+   + DD   V+ +GHN 
Sbjct  64   ETWKLAVHEFP-------ERPKTVYEERIYDASPGELI--ALLNETPDDAQNVLLVGHNP  114

Query  855  GWEEAASMFSGA  890
            G +  A + +GA
Sbjct  115  GVQGLADILAGA  126



>ref|WP_030404484.1| phosphohistidine phosphatase [Streptomyces sp. NRRL F-5555]
Length=172

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 65/132 (49%), Gaps = 11/132 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++L RHA + W   S  DH+RPL+  G++ AA     L   G      LCS +VRTR
Sbjct  6    PRRIVLFRHAKADWPQVS--DHERPLADRGRMEAAEAGRRLADTGVPFDQALCSTSVRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  ++ P       H   + Y     +    E +  A+   + DD+  V+ +GHN 
Sbjct  64   ETWKLAVQEFP-------HRPKTVYEERIYEASPGELI--AVLNETPDDLRNVLVIGHNP  114

Query  855  GWEEAASMFSGA  890
            G E    + +G+
Sbjct  115  GMEALTEILAGS  126



>ref|WP_003977013.1| MULTISPECIES: phosphohistidine phosphatase [Streptomyces]
 ref|NP_626078.1| hypothetical protein SCO1809 [Streptomyces coelicolor A3(2)]
 emb|CAB50877.1| conserved hypothetical protein [Streptomyces coelicolor A3(2)]
 gb|EFD70101.1| phosphohistidine phosphatase [Streptomyces lividans TK24]
 gb|AIJ16641.1| hypothetical protein SLIV_28675 [Streptomyces lividans TK24]
Length=172

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 64/132 (48%), Gaps = 11/132 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++L RHA + W    + DH+RPL+  G++ AA     L   G      LCS + RTR
Sbjct  6    PRRIVLFRHAKADWP--QVTDHERPLADRGRMDAAEAGRRLADTGVPIDQALCSTSARTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  ++ P       H   + Y     D    E +  A+   + DD+  V+ +GHN 
Sbjct  64   ETWKLAVQEFP-------HRPKTVYEERIYDASPGELI--AVLNETPDDLRNVLVIGHNP  114

Query  855  GWEEAASMFSGA  890
            G E    + +G+
Sbjct  115  GMEALTEILAGS  126



>ref|WP_023406531.1| hypothetical protein [uncultured Desulfofustis sp. PB-SRB1]
 gb|ESQ12063.1| hypothetical protein N839_02400 [uncultured Desulfofustis sp. 
PB-SRB1]
Length=164

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/152 (33%), Positives = 73/152 (48%), Gaps = 9/152 (6%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R L L+RHA SSW D  L+D DRPL+K G   A  +   L + G  P L+L S AVR R 
Sbjct  2    RHLYLIRHAKSSWRDPHLQDIDRPLNKRGIRDAPMMGERLRKAGICPDLMLVSPAVRARA  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T   +   +  + ++ V  +   YS  AM+G        ++     D + +V  +GHN G
Sbjct  62   TADAIAGAI-GYHQSLVVIVEDLYSF-AMEGIV------SVLHGVDDTVQSVALVGHNHG  113

Query  858  WEEAASMFSGAPI-ELKTCNAALLEATGKSWE  950
               AA  F+GA +  + TC    ++     W 
Sbjct  114  MTSAAEWFTGASLGNVPTCGIVAIDTMVDQWR  145



>ref|WP_031047691.1| phosphohistidine phosphatase [Streptomyces sp. NRRL F-5650]
Length=172

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 65/132 (49%), Gaps = 11/132 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++L RHA + W   S  DH+RPL+  G++ AA     L   G      LCS +VRTR
Sbjct  6    PRRIVLFRHAKADWPQVS--DHERPLADRGRMEAAEAGRRLADTGVPFDQALCSTSVRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  ++ P       H   + Y     +    E +  A+   + DD+  V+ +GHN 
Sbjct  64   ETWKLAVQEFP-------HRPKTVYEERIYEASPGELI--AVLNETPDDLRNVLVIGHNP  114

Query  855  GWEEAASMFSGA  890
            G E    + +G+
Sbjct  115  GMEALTEILAGS  126



>ref|WP_031087111.1| MULTISPECIES: phosphohistidine phosphatase [Streptomyces]
Length=172

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 65/132 (49%), Gaps = 11/132 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++L RHA + W   S  DH+RPL+  G++ AA     L   G      LCS +VRTR
Sbjct  6    PRRIVLFRHAKADWPQVS--DHERPLADRGRMEAAEAGRRLADTGVPFDQALCSTSVRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  ++ P       H   + Y     +    E +  A+   + DD+  V+ +GHN 
Sbjct  64   ETWKLAVQEFP-------HRPKTVYEERIYEASPGELI--AVLNETPDDLRNVLVIGHNP  114

Query  855  GWEEAASMFSGA  890
            G E    + +G+
Sbjct  115  GMEALTEILAGS  126



>ref|WP_020462465.1| phosphohistidine phosphatase [Frankia sp. EAN1pec]
 ref|YP_001509254.1| putative phosphohistidine phosphatase SixA [Frankia sp. EAN1pec]
 gb|ABW14348.1| putative phosphohistidine phosphatase, SixA [Frankia sp. EAN1pec]
Length=183

 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 64/120 (53%), Gaps = 10/120 (8%)
 Frame = +3

Query  501  RLILLRHAHSSW-EDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            RL+LLRHA S W  D  +RD DRPLS+ G+   A V+  L   G  P L+LCS AVRTRE
Sbjct  6    RLLLLRHAKSDWTSDPEVRDQDRPLSQKGRRGIALVADYLAASGLEPDLVLCSSAVRTRE  65

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T++ + + +P+  +  V      Y   A D         A  +   D + TV+ +GHN G
Sbjct  66   TVEHLADALPS--DVPVLVEDRLYLAEAND-------LLARLREIDDGVPTVLLVGHNPG  116



>ref|WP_030184897.1| phosphohistidine phosphatase [Streptomyces violaceorubidus]
Length=172

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 65/132 (49%), Gaps = 11/132 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++L RHA + W    + DH+RPL+  G++ AA     L   G      LCS +VRTR
Sbjct  6    PRRIVLFRHAKADWP--QVTDHERPLADRGRMDAAEAGRRLADTGLPFDQALCSTSVRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  ++ P       H   + Y     +    E +  A+   + DD+  V+ +GHN 
Sbjct  64   ETWKLAVQEFP-------HRPKTVYEERIYEASPGELI--AVLNETPDDLRNVLVIGHNP  114

Query  855  GWEEAASMFSGA  890
            G E    + +G+
Sbjct  115  GMEALTEILAGS  126



>ref|WP_030378935.1| MULTISPECIES: phosphohistidine phosphatase [Streptomyces]
Length=172

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 65/131 (50%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++LLRHA + W    + DH+RPL+  G+  A      L   G    L LCS + RTR
Sbjct  6    PRRIVLLRHAKADWP--PVADHERPLADRGRKDAPVAGRRLADSGIAFDLALCSTSTRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+   ++P       H   + Y     D    E +  A+   + DD+  ++ +GHN 
Sbjct  64   ETWKLAVHELP-------HRPKTVYEERVYDASPGELI--AVLNETPDDVRNLVLIGHNP  114

Query  855  GWEEAASMFSG  887
            G + AA + SG
Sbjct  115  GVQGAAEVLSG  125



>ref|WP_002731087.1| Phosphoglycerate mutase family protein [Phaeospirillum molischianum]
 emb|CCG43092.1| Phosphoglycerate mutase family protein [Phaeospirillum molischianum 
DSM 120]
Length=184

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 76/161 (47%), Gaps = 15/161 (9%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            R+L LLRHA SSW+D  L D DRPLS+ G  AA R++  + + G  P L L S A RTRE
Sbjct  9    RKLFLLRHAKSSWDDPVLADFDRPLSRRGHEAAVRLAAFVERYGLTPKLALVSTARRTRE  68

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T + +   +P        +    Y+    D      L Q + K     + +V+ +GHN G
Sbjct  69   TWEALARIMPT---VPASYEPGLYAAGQSD------LFQRLQKLDP-PLESVILVGHNPG  118

Query  858  WEEAASMFS---GAPIELKTCNAALLEATGKSWEETFSLAG  971
             E  A   S   G P+ L     A    TG   E T  +AG
Sbjct  119  LERLADFLSNRQGEPVALD--RMARKYPTGALAELTLDIAG  157



>ref|WP_026871934.1| hypothetical protein [Inquilinus limosus]
Length=171

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 61/127 (48%), Gaps = 9/127 (7%)
 Frame = +3

Query  504  LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETL  683
            LILLRHA S W D +L DHDRPL+  G+ AA R+   L   G  P LILCS A R R+TL
Sbjct  4    LILLRHAKSDWSDPTLADHDRPLAPRGRDAAPRMGAWLKAHGPAPDLILCSTAARARQTL  63

Query  684  KIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWE  863
             +  E        E  F    Y V          LRQA      DD   VM +GHN   E
Sbjct  64   ALALEA--LGAAPETRFNRGLYLVGGTG--VLARLRQA-----PDDAGAVMVVGHNPDLE  114

Query  864  EAASMFS  884
            + A   +
Sbjct  115  QLARRLA  121



>ref|WP_007328176.1| phosphohistidine phosphatase [Rhodopirellula baltica]
 gb|EGF25793.1| phosphohistidine phosphatase, SixA [Rhodopirellula baltica WH47]
Length=173

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 77/169 (46%), Gaps = 12/169 (7%)
 Frame = +3

Query  501  RLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRET  680
            RLIL+RHA S W D  L DH+RPL+  G+  A R++  +   G  P  +L SD+ RTRET
Sbjct  2    RLILMRHAKSDWADARLSDHERPLNARGRRDAPRIAGWMQDNGCQPDFLLSSDSKRTRET  61

Query  681  LKIMQEQ----VPAFLEAEVHFLSS---FYSVAAMDGQTAEHLRQAICKYSKDDILTVMC  839
               +  +    VP +   +++  S+   F  + + +   A+    +I         T++ 
Sbjct  62   ATFLNSRWDSPVPTYFSLDLYLASASAIFQMIRSTEQWLADENGTSISTPE-----TLLV  116

Query  840  MGHNRGWEEAASMFSGAPIELKTCNAALLEATGKSWEETFSLAGLGGWE  986
            +GHN G   AAS   G      T   A+ E    SW +         W+
Sbjct  117  LGHNPGISAAASELLGHSCGFPTAGLAVFECEVSSWSDELGPENCEVWK  165



>ref|WP_037493986.1| hypothetical protein [Sneathiella glossodoripedis]
Length=175

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 61/121 (50%), Gaps = 8/121 (7%)
 Frame = +3

Query  504  LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETL  683
            L L+RHA SSWED S  D DRPL+  G+ AA ++   L++    P L++CS A RTRETL
Sbjct  5    LTLMRHAKSSWEDYSQSDLDRPLAPRGKKAAPKMGQYLYENSLSPDLVICSPAQRTRETL  64

Query  684  KIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWE  863
              +Q   P  L   V +    YS     G         +     D++  +M +GHN   +
Sbjct  65   SRLQTAFPDPL--PVKYDKMVYSAGMGHGLI------PLLHNMSDELQHIMILGHNPAMQ  116

Query  864  E  866
            E
Sbjct  117  E  117



>ref|WP_030203079.1| phosphohistidine phosphatase [Streptomyces sp. NRRL S-87]
Length=172

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 67/131 (51%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++LLRHA + W D S  DH+RPL+  G+  A  V  +L + G    L LCS A RTR
Sbjct  6    PRRIVLLRHAKADWPDVS--DHERPLADRGRADAPAVGLKLAETGITFDLALCSTAARTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  +++P       H   + Y     +    E +  A+   + DD+  ++ +GHN 
Sbjct  64   ETWKLAVQELP-------HRPKTVYEERLYEASLGELI--ALVNETPDDVHDLLVIGHNP  114

Query  855  GWEEAASMFSG  887
            G    A   +G
Sbjct  115  GMHALADALAG  125



>gb|AIC17261.1| Phosphohistidine phosphatase SixA [Nitrososphaera viennensis 
EN76]
Length=164

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 48/152 (32%), Positives = 76/152 (50%), Gaps = 8/152 (5%)
 Frame = +3

Query  492  LPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRT  671
            + + L+LLRHA SSW++  L D DRPL+K G+  A R+   L + G +P  IL S AVR 
Sbjct  1    MAKMLLLLRHAKSSWKNPELADRDRPLNKRGKRDALRMGRLLDEEGLVPDAILSSTAVRA  60

Query  672  RETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
            ++T   + +    +    +  + S Y+         E+L   + +   DD   V+ +GHN
Sbjct  61   QDTAAAVAKSC-GYDRRRITHIESLYASGP-----EEYLN--VLRRLPDDPKVVLVVGHN  112

Query  852  RGWEEAASMFSGAPIELKTCNAALLEATGKSW  947
             G EE   + +G P  + T   A ++   K W
Sbjct  113  PGMEEYLEILTGQPEAMPTAALAFVKLPIKRW  144



>ref|WP_020152219.1| hypothetical protein [Verrucomicrobia bacterium SCGC AAA300-N18]
Length=171

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/153 (32%), Positives = 72/153 (47%), Gaps = 9/153 (6%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            + L+L+RHA SSWED  L DH+RPL+  G+  A R++  L +LG  P  ++ S A R   
Sbjct  2    KTLLLIRHAKSSWEDCRLDDHERPLNHRGKDNAPRMAARLQELGIKPDALISSTARRAAS  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T ++  + +  F   ++ F +  Y  +         + Q I    +D   TV+  GHN G
Sbjct  62   TAQVFADHL-DFPRDKILFDADLYLASV-------GILQKIIGKIEDSFQTVLIFGHNPG  113

Query  858  WEEAASMFSGAPI-ELKTCNAALLEATGKSWEE  953
                 S   G PI  L TC    L     +W E
Sbjct  114  LTLLVSQVWGLPIGNLPTCGIVSLNFESFTWAE  146



>ref|WP_014059744.1| phosphohistidine phosphatase [Streptomyces violaceusniger]
 ref|YP_004816547.1| phosphohistidine phosphatase SixA [Streptomyces violaceusniger 
Tu 4113]
 gb|AEM86267.1| putative phosphohistidine phosphatase, SixA [Streptomyces violaceusniger 
Tu 4113]
Length=172

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 67/132 (51%), Gaps = 11/132 (8%)
 Frame = +3

Query  492  LPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRT  671
            +PRR++LLRHA + W    + DH+RPL++ G+  A      + + G  P L LCS A+RT
Sbjct  5    VPRRIVLLRHAKADWP--QVADHERPLAERGRNDAPLAGRRIAEAGLTPELTLCSTALRT  62

Query  672  RETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
            RET K++  ++P       H   + Y     D    + +   +   + DD+  ++ +GHN
Sbjct  63   RETWKLVVHELP-------HRPKTVYEERLYDAPVGQLIE--VINETADDVTDLLVVGHN  113

Query  852  RGWEEAASMFSG  887
             G    A   +G
Sbjct  114  PGMHGLADALAG  125



>ref|WP_030612614.1| phosphohistidine phosphatase [Streptomyces fulvoviolaceus]
Length=172

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 65/132 (49%), Gaps = 11/132 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++L RHA + W    + DH+RPL+  G++ AA     L   G    L LCS A RTR
Sbjct  6    PRRIVLFRHAKADWP--QMTDHERPLADRGRMEAAEAGRRLADTGIPFDLALCSTATRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  ++ P       H   + Y     +    E +  A+   + DD   V+ +GHN 
Sbjct  64   ETWKLAVQEFP-------HRPKTLYEERIYEASPGELI--ALLNETPDDAQNVLLVGHNP  114

Query  855  GWEEAASMFSGA  890
            G +  A + +G+
Sbjct  115  GIQGLADILAGS  126



>ref|WP_030852315.1| phosphohistidine phosphatase [Streptomyces sp. NRRL S-475]
Length=172

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 66/132 (50%), Gaps = 11/132 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++L RHA + W    + DH+RPL+  G++ AA     L   G    L LCS AVRTR
Sbjct  6    PRRIVLFRHAKADWP--QVADHERPLADRGRMDAAEAGRRLTDTGIAFDLALCSTAVRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  ++ P           + Y     +    E +  A+   + DD+  V+ +GHN 
Sbjct  64   ETWKLAVQEFP-------QRPKTVYEERIYEASPGELI--ALLNETPDDVRNVLMIGHNP  114

Query  855  GWEEAASMFSGA  890
            G +  A + +G+
Sbjct  115  GIQGLAEVLAGS  126



>ref|WP_030841316.1| phosphohistidine phosphatase [Streptomyces hygroscopicus]
Length=172

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 69/132 (52%), Gaps = 11/132 (8%)
 Frame = +3

Query  492  LPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRT  671
            +PRR++LLRHA + W    + DH+RPL++ G+  A      + + G  P L LCS A+RT
Sbjct  5    VPRRIVLLRHAKADWP--QVADHERPLAERGRKDAPLAGRRIAEAGLTPELTLCSTALRT  62

Query  672  RETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
            RET K++  ++P     +  +    Y  +   GQ  E L +     + DDI  ++ +GHN
Sbjct  63   RETWKLVVHELPQ--RPKTVYEERLYDASV--GQLIEVLNE-----TSDDITDLLVVGHN  113

Query  852  RGWEEAASMFSG  887
             G    A   +G
Sbjct  114  PGMHGLADALAG  125



>ref|WP_031477237.1| phosphohistidine phosphatase [Streptomyces bicolor]
Length=172

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 65/131 (50%), Gaps = 11/131 (8%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            RR++L RHA + W    + DH+RPL++ G+L AA     L   G    L LCS AVRTRE
Sbjct  7    RRIVLFRHAKADWP--QVTDHERPLAERGRLDAAEAGRRLTDTGIPFDLALCSTAVRTRE  64

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T K+   + P       H   + Y     +    E +  A+   + DD   V+ +GHN G
Sbjct  65   TWKLAVHEFP-------HRPKTVYEERIYEASPGELI--AVLNETPDDAQNVLLIGHNPG  115

Query  858  WEEAASMFSGA  890
             +  A + SG+
Sbjct  116  VQGLAEILSGS  126



>ref|WP_030859136.1| phosphohistidine phosphatase [Streptomyces sp. NRRL F-2747]
Length=173

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++LLRHA + W + S  DHDRPL++ G+  A  V  +L + G    L LCS A RTR
Sbjct  6    PRRIVLLRHAKADWPEVS--DHDRPLAERGRKDAPAVGLKLAETGIAFDLALCSTATRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  +++P       H   + Y     D    E +  A+     D++  ++ +GHN 
Sbjct  64   ETWKLAVQEMP-------HRPRTSYEERLYDASPGELI--ALLNEVSDEVGNLLVIGHNP  114

Query  855  GWEEAASMFSG  887
            G    A   SG
Sbjct  115  GMHALADALSG  125



>ref|WP_012912471.1| phosphohistidine phosphatase [Pirellula staleyi]
 ref|YP_003372069.1| phosphohistidine phosphatase [Pirellula staleyi DSM 6068]
 gb|ADB18209.1| putative phosphohistidine phosphatase, SixA [Pirellula staleyi 
DSM 6068]
Length=166

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 72/150 (48%), Gaps = 9/150 (6%)
 Frame = +3

Query  504  LILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRETL  683
            L+LLRHA SSW+D  L DHDRPL+K G+  A R+   L     +P  +L S A R R T 
Sbjct  7    LLLLRHAKSSWKDNELDDHDRPLNKRGKRDAPRMGELLRDEQMVPDFMLTSSAKRARRTA  66

Query  684  KIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRGWE  863
            + +  Q   F   E    S  Y  + +D Q       A+     +   TV+ +GHN G E
Sbjct  67   EHVA-QACGF-RGETRITSELYE-SNIDRQI------AVISAVPEPAATVLLVGHNPGIE  117

Query  864  EAASMFSGAPIELKTCNAALLEATGKSWEE  953
            E  +  SG    + T   A +E   +SW +
Sbjct  118  ELLAAISGECPAITTAALAKIELPIESWRD  147



>ref|WP_010987869.1| phosphohistidine phosphatase [Streptomyces avermitilis]
 ref|NP_827645.1| hypothetical protein SAV_6469 [Streptomyces avermitilis MA-4680 
= NBRC 14893]
 dbj|BAC74180.1| hypothetical protein SAV_6469 [Streptomyces avermitilis MA-4680 
= NBRC 14893]
Length=172

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 66/132 (50%), Gaps = 11/132 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++L RHA + W   S  DH+RPL+  G+  AA    +L   G    L LCS A RTR
Sbjct  6    PRRIVLFRHAKADWPQVS--DHERPLADRGRTDAAVAGRKLADTGIPVDLALCSTATRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+   ++P       H   + Y     +    E +  A+   + DD+  V+ +GHN 
Sbjct  64   ETWKLAVHELP-------HRPKTVYEERLYEASPGEII--AVLNETPDDVQNVVLIGHNP  114

Query  855  GWEEAASMFSGA  890
            G +  A + +G+
Sbjct  115  GVQGLADILAGS  126



>emb|CCF21291.1| putative phosphohistidine phosphatase protein [Rhizobium sp.]
Length=182

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 71/130 (55%), Gaps = 10/130 (8%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            RRL+LLRHA S+W D ++ DH+RPL++ G+ AA  +   + +   IP L L SDA RTR+
Sbjct  14   RRLLLLRHAKSAWPD-AVADHERPLAERGEKAAPAMGDYMAREHLIPDLALVSDARRTRQ  72

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T +++Q ++PA  E      S  Y        +A  L   I     D   T++ +GHN G
Sbjct  73   TWELVQRRLPA--EVAARTTSDIYEA------SASRLLDTIHALG-DSAATLLLIGHNPG  123

Query  858  WEEAASMFSG  887
             ++ A M  G
Sbjct  124  LQDLALMLIG  133



>ref|WP_003989302.1| phosphohistidine phosphatase [Streptomyces viridochromogenes]
 gb|EFL31189.1| phosphohistidine phosphatase [Streptomyces viridochromogenes 
DSM 40736]
Length=172

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 65/132 (49%), Gaps = 11/132 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++L RHA + W    + DH+RPL+  G+  AA     L   G    L LCS AVRTR
Sbjct  6    PRRIVLFRHAKADWP--QVTDHERPLADRGRKDAAEAGRRLADTGVPFDLALCSTAVRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  ++ P       H   + Y     +    E +  A+   + DD   V+ +GHN 
Sbjct  64   ETWKLAVQEFP-------HRPKTVYEERIYEASPGELI--AVLNETPDDAQNVLLIGHNP  114

Query  855  GWEEAASMFSGA  890
            G +  A + +G+
Sbjct  115  GVQGLAEILAGS  126



>gb|KIF05526.1| phosphohistidine phosphatase [Streptomyces sp. RSD-27]
Length=173

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 66/131 (50%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR+ LLRHA + W    + DHDRPL+  G+  A     +L + G    L LCS AVRTR
Sbjct  6    PRRIALLRHAKADWP--QVADHDRPLADRGRRDAPAAGRKLAETGITFDLALCSTAVRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  +++P       +   + Y     D    E +  A+   + D++  ++ +GHN 
Sbjct  64   ETWKLAVQELP-------YRPRTVYEERVYDASPGELI--ALLNETPDEVADLLVIGHNP  114

Query  855  GWEEAASMFSG  887
            G    A + SG
Sbjct  115  GMHALAEILSG  125



>ref|WP_028431465.1| phosphohistidine phosphatase [Streptomyces sp. TAA204]
Length=175

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 67/133 (50%), Gaps = 11/133 (8%)
 Frame = +3

Query  492  LPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRT  671
            LPR ++L+RHA + W +  + DH+RPL+  G+  A  V   L   G  PGL LCS AVRT
Sbjct  5    LPRSIVLVRHAKADWPE--VADHERPLADRGRKDAPAVGEWLAAHGVDPGLTLCSTAVRT  62

Query  672  RETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
            RET K+    +P       H   + Y     +    E +  A+     +D+  ++ +GHN
Sbjct  63   RETWKLAVHHLP-------HRPRTVYEERLYEASPGEII--AVLNDVDEDVHDLLVVGHN  113

Query  852  RGWEEAASMFSGA  890
             G +  A   SGA
Sbjct  114  PGIQGVAEALSGA  126



>ref|WP_013501186.1| phosphohistidine phosphatase [Rhodopseudomonas palustris]
 ref|YP_004107767.1| putative phosphohistidine phosphatase SixA [Rhodopseudomonas 
palustris DX-1]
 gb|ADU43034.1| putative phosphohistidine phosphatase, SixA [Rhodopseudomonas 
palustris DX-1]
Length=176

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 71/141 (50%), Gaps = 13/141 (9%)
 Frame = +3

Query  498  RRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTRE  677
            RRLILLRHA +  +  S +DHDR L   G+  AA ++  L     +P  +L S A RTR+
Sbjct  2    RRLILLRHAKTERDAPSGKDHDRRLEDRGRSDAAEIATWLAAEHLVPDQVLISTATRTRQ  61

Query  678  TLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNRG  857
            T  ++ E  PA  E +V +L   YS       +A  L QAI + S   I  +M +GHN G
Sbjct  62   TWDVLSELFPASSEPQVEYLPELYSA------SASQLLQAIHEVSA-GINRLMLIGHNPG  114

Query  858  WEEAASMFSGAPIELKTCNAA  920
              E A   +       TCN A
Sbjct  115  LHELALALTC------TCNEA  129



>ref|WP_030829498.1| MULTISPECIES: phosphohistidine phosphatase [Streptomyces]
Length=173

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 67/131 (51%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR+ LLRHA + W + S  DHDRPL++ G+  A  V  +L + G    L LCS A RTR
Sbjct  6    PRRIALLRHAKADWPEVS--DHDRPLAERGRKDAPAVGLKLAETGIAFDLALCSTAARTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  +++P       H   + Y     D    E +  A+   + D++  ++ +GHN 
Sbjct  64   ETWKLAVQEMP-------HRPKTHYEERIYDASPGELI--ALLNETSDEVRDLLVIGHNP  114

Query  855  GWEEAASMFSG  887
            G    A   SG
Sbjct  115  GMHALADALSG  125



>ref|WP_004989920.1| MULTISPECIES: phosphohistidine phosphatase [Streptomyces]
 gb|EFE70333.1| phosphohistidine phosphatase SixA [Streptomyces ghanaensis ATCC 
14672]
Length=172

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 67/132 (51%), Gaps = 11/132 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++L RHA + W    + DH+RPL++ G++ AA    +L   G    L LCS AVRTR
Sbjct  6    PRRIVLFRHAKADWP--PVADHERPLAERGRMDAAVAGRKLADTGIAFDLALCSTAVRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+  ++ P           + Y     +    E +  A+   + DD   V+ +GHN 
Sbjct  64   ETWKLAVQEFP-------QRPKTVYEERIYEASPGELI--ALLNETPDDAQNVLLVGHNP  114

Query  855  GWEEAASMFSGA  890
            G +  A + +GA
Sbjct  115  GVQGLADILAGA  126



>ref|WP_006132618.1| MULTISPECIES: hypothetical protein [Streptomyces]
 gb|EMF28114.1| hypothetical protein H114_15112 [Streptomyces gancidicus BKS 
13-15]
Length=172

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 66/132 (50%), Gaps = 11/132 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++L RHA + W   S  DH+RPL++ G+L AA    +L   G    L LCS AVRTR
Sbjct  6    PRRIVLFRHAKADWPPVS--DHERPLAERGRLDAAAAGRKLADTGVAFDLALCSTAVRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+   + P           + Y     +    E +  A+   + DD   V+ +GHN 
Sbjct  64   ETWKLAVHEFP-------KRPKTVYEERIYEASPGELI--ALLNETPDDAQNVLLVGHNP  114

Query  855  GWEEAASMFSGA  890
            G +  A + +GA
Sbjct  115  GVQGLADILAGA  126



>ref|WP_011046282.1| phosphoglycerate mutase [Ruegeria pomeroyi]
 ref|YP_165785.1| phosphoglycerate mutase family protein [Ruegeria pomeroyi DSS-3]
 gb|AAV93840.1| phosphoglycerate mutase family protein [Ruegeria pomeroyi DSS-3]
Length=169

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 75/146 (51%), Gaps = 14/146 (10%)
 Frame = +3

Query  492  LPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRT  671
            + R LIL RHA S+W+D SL DH+RPL+K G+ +A  +   L + G++P  ++ SDAVRT
Sbjct  1    MTRILILTRHAKSAWDDISLGDHERPLNKRGRRSAQAIGAWLRKRGYLPDQVISSDAVRT  60

Query  672  RETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
            RET   M  ++      +  F  S Y   A       +LRQA  +        V+ +GHN
Sbjct  61   RETWTQMSAEM-GQAGGDPTFTRSLYLAPAQ--HILANLRQASGR-------VVLLLGHN  110

Query  852  RGWEEAASMFSGAPIELKTCNAALLE  929
             G  E    F+G  ++    +A   +
Sbjct  111  PGIAE----FAGQIVDEAPAHARFFD  132



>ref|WP_037963446.1| phosphohistidine phosphatase [Streptomyces sp. PRh5]
 gb|EXU62627.1| phosphohistidine phosphatase [Streptomyces sp. PRh5]
Length=172

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 67/132 (51%), Gaps = 11/132 (8%)
 Frame = +3

Query  492  LPRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRT  671
            +PRR++LLRHA + W    + DH+RPL++ G+  A      + + G  P L LCS A+RT
Sbjct  5    VPRRIVLLRHAKADWP--QVADHERPLAERGRNDAPLAGRRIAEAGLTPELTLCSTALRT  62

Query  672  RETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHN  851
            RET K++  ++P     +  +    Y      GQ  E     +   + DDI  ++ +GHN
Sbjct  63   RETWKLVVHELPQ--RPKTVYEERLYDAPV--GQLIE-----VINETSDDITDLLVVGHN  113

Query  852  RGWEEAASMFSG  887
             G    A   +G
Sbjct  114  PGMHGLADALAG  125



>ref|WP_030920180.1| MULTISPECIES: phosphohistidine phosphatase [Streptomyces]
Length=172

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 67/132 (51%), Gaps = 11/132 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++LLRHA + W   S  DH+RPL++ G+  A     +L   G +  L LCS AVRTR
Sbjct  6    PRRIVLLRHAKAEWSQDS--DHERPLAERGRKDAPVAGRKLVDSGIVIDLALCSTAVRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+   ++P       H   + Y     +    E +  A+   + DD+  ++ +GHN 
Sbjct  64   ETWKLAVHEMP-------HRPRTVYEERLYEASLGELI--ALLNETPDDVQNLLLIGHNP  114

Query  855  GWEEAASMFSGA  890
            G    A   +G+
Sbjct  115  GMHAVADALAGS  126



>ref|WP_026242760.1| MULTISPECIES: phosphohistidine phosphatase [Streptomyces]
Length=172

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 66/132 (50%), Gaps = 11/132 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++LLRHA + W   S  DH+RPL++ G++ A  V  +L   G    L LCS AVRTR
Sbjct  6    PRRIVLLRHAKAEWSQES--DHERPLAERGRMEAPMVGRKLADSGIAFDLALCSTAVRTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K+   ++P           + Y     +    E +  A+   + DD+  ++ +GHN 
Sbjct  64   ETWKLAVHEMP-------ERPRTVYEERLYEASLGELI--ALVNETPDDVADLLVIGHNP  114

Query  855  GWEEAASMFSGA  890
            G    A   SG 
Sbjct  115  GMHALADALSGG  126



>ref|WP_039637633.1| phosphohistidine phosphatase [Streptomyces sp. 769]
 gb|AJC59270.1| Phosphohistidine phosphatase SixA [Streptomyces sp. 769]
Length=172

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 65/131 (50%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++LLRHA + W D S  DH+RPL+  G+  A      L   G  P L LCS A RTR
Sbjct  6    PRRIVLLRHAKAEWSDES--DHERPLADRGRKDAPVAGRWLAGAGVTPELTLCSTAARTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K++  ++P       H   + Y     +    E +  AI   + D++  ++ +GHN 
Sbjct  64   ETWKLVVSELP-------HRPKTVYDERLYEASLGELI--AILNETSDEVSDLLVVGHNP  114

Query  855  GWEEAASMFSG  887
            G    A   +G
Sbjct  115  GVHALADALAG  125



>ref|WP_030653730.1| phosphohistidine phosphatase [Streptomyces rimosus]
Length=172

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 65/131 (50%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++LLRHA + W   S  DH+RPL++ G+  A    H L   G  P L LCS A RTR
Sbjct  6    PRRIVLLRHAKADWSQES--DHERPLAERGRKDAPAAGHWLAGAGITPDLTLCSTAARTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K++  ++P           + Y     +    E +  A+   + DD+  +M +GHN 
Sbjct  64   ETWKLVVGELP-------QRPRTVYEERLYEASLGELI--ALLNETSDDVSDLMLVGHNP  114

Query  855  GWEEAASMFSG  887
            G    A   +G
Sbjct  115  GMHALADALAG  125



>ref|WP_030596794.1| phosphohistidine phosphatase [Streptomyces rimosus]
Length=172

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 65/131 (50%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++LLRHA + W   S  DH+RPL++ G+  A    H L   G  P L LCS A RTR
Sbjct  6    PRRIVLLRHAKADWSQES--DHERPLAERGRKDAPAAGHWLAGAGITPDLTLCSTAARTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K++  ++P           + Y     +    E +  A+   + DD+  +M +GHN 
Sbjct  64   ETWKLVVGELP-------QRPRTVYEERLYEASLGELI--ALLNETSDDVDDLMLVGHNP  114

Query  855  GWEEAASMFSG  887
            G    A   +G
Sbjct  115  GMHALADALAG  125



>ref|WP_033033293.1| phosphohistidine phosphatase [Streptomyces rimosus]
Length=172

 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 65/131 (50%), Gaps = 11/131 (8%)
 Frame = +3

Query  495  PRRLILLRHAHSSWEDRSLRDHDRPLSKSGQLAAARVSHELWQLGWIPGLILCSDAVRTR  674
            PRR++LLRHA + W   S  DH+RPL++ G+  A    H L   G  P L LCS A RTR
Sbjct  6    PRRIVLLRHAKADWSQES--DHERPLAERGRKDAPAAGHWLAGAGITPDLTLCSTAARTR  63

Query  675  ETLKIMQEQVPAFLEAEVHFLSSFYSVAAMDGQTAEHLRQAICKYSKDDILTVMCMGHNR  854
            ET K++  ++P           + Y     +    E +  A+   + DD+  +M +GHN 
Sbjct  64   ETWKLVVGELP-------QRPRTVYEERLYEASLGELI--ALLNETSDDVSDLMLVGHNP  114

Query  855  GWEEAASMFSG  887
            G    A   +G
Sbjct  115  GMHALADALAG  125



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4696885476248