BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16674_g1_i1 len=498 path=[1749:0-497]

Length=498
                                                                      Score     E

ref|XP_006663942.1|  PREDICTED: isoflavone reductase homolog            102   9e-23   
ref|XP_009769427.1|  PREDICTED: isoflavone reductase homolog            100   2e-22   
ref|XP_009596481.1|  PREDICTED: isoflavone reductase homolog            100   2e-22   
ref|NP_001066531.1|  Os12g0265100                                       100   2e-22   Oryza sativa Japonica Group [Japonica rice]
emb|CDP11761.1|  unnamed protein product                                100   4e-22   
emb|CDP11762.1|  unnamed protein product                              99.8    6e-22   
ref|XP_004241766.1|  PREDICTED: isoflavone reductase homolog isof...  98.6    1e-21   
ref|XP_010322711.1|  PREDICTED: isoflavone reductase homolog isof...  98.6    1e-21   
ref|XP_006353700.1|  PREDICTED: isoflavone reductase homolog          98.6    2e-21   
gb|EAY97058.1|  hypothetical protein OsI_18980                        94.7    2e-21   Oryza sativa Indica Group [Indian rice]
emb|CBI37385.3|  unnamed protein product                              96.3    4e-21   
ref|XP_011028077.1|  PREDICTED: isoflavone reductase homolog          97.1    5e-21   
emb|CAN69630.1|  hypothetical protein VITISV_028545                   96.7    8e-21   Vitis vinifera
ref|NP_001268219.1|  uncharacterized protein LOC100253437             96.7    9e-21   
ref|XP_004963224.1|  PREDICTED: isoflavone reductase homolog          95.9    1e-20   
gb|EEE62835.1|  hypothetical protein OsJ_17638                        95.9    2e-20   Oryza sativa Japonica Group [Japonica rice]
gb|ABA96985.2|  Isoflavone reductase, putative, expressed             95.5    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006432628.1|  hypothetical protein CICLE_v10001913mg           95.1    3e-20   
ref|XP_007158198.1|  hypothetical protein PHAVU_002G132400g           95.1    3e-20   
ref|XP_010056197.1|  PREDICTED: isoflavone reductase homolog          94.4    5e-20   
ref|XP_010056196.1|  PREDICTED: isoflavone reductase homolog          94.4    5e-20   
ref|XP_007210609.1|  hypothetical protein PRUPE_ppa017446mg           94.0    7e-20   
gb|EEE62836.1|  hypothetical protein OsJ_17639                        89.0    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008238119.1|  PREDICTED: isoflavone reductase homolog          93.2    1e-19   
ref|XP_008238115.1|  PREDICTED: isoflavone reductase homolog          93.2    1e-19   
gb|KDP39738.1|  hypothetical protein JCGZ_02758                       92.8    1e-19   
ref|XP_003533456.1|  PREDICTED: isoflavone reductase homolog          92.8    2e-19   
ref|XP_008674386.1|  PREDICTED: isoflavone reductase homolog          92.8    2e-19   
ref|XP_007040783.1|  Pinoresinol reductase 1 isoform 2                91.7    2e-19   
ref|XP_008238117.1|  PREDICTED: isoflavone reductase homolog          92.4    2e-19   
ref|XP_004300158.1|  PREDICTED: isoflavone reductase homolog          92.4    3e-19   
ref|XP_008238116.1|  PREDICTED: isoflavone reductase homolog          92.0    3e-19   
ref|XP_002519850.1|  NAD dependent epimerase/dehydratase, putative    92.0    3e-19   Ricinus communis
ref|XP_010255703.1|  PREDICTED: isoflavone reductase homolog          92.0    3e-19   
gb|ABA96987.1|  Isoflavone reductase, putative, expressed             90.1    4e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EAY97063.1|  hypothetical protein OsI_18984                        91.7    4e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_007040782.1|  Isoflavone reductase isoform 1                   91.3    6e-19   
ref|XP_004512425.1|  PREDICTED: isoflavone reductase homolog          91.3    6e-19   
ref|XP_007210635.1|  hypothetical protein PRUPE_ppa019829mg           90.5    6e-19   
ref|XP_006432626.1|  hypothetical protein CICLE_v10001909mg           91.3    6e-19   
ref|XP_004509553.1|  PREDICTED: isoflavone reductase homolog          91.3    6e-19   
ref|XP_010255702.1|  PREDICTED: isoflavone reductase homolog          91.3    6e-19   
ref|XP_007210249.1|  hypothetical protein PRUPE_ppa014854mg           91.3    7e-19   
emb|CCH47227.1|  similar to isoflavone reductase homolog              90.9    7e-19   
sp|P52581.1|IFRH_LUPAL  RecName: Full=Isoflavone reductase homolog    90.9    7e-19   Lupinus albus
gb|ABA96984.2|  Isoflavone reductase, putative, expressed             90.9    8e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007211123.1|  hypothetical protein PRUPE_ppa025381mg           90.9    9e-19   
gb|KEH20306.1|  pinoresinol-lariciresinol reductase-like protein      90.5    1e-18   
gb|AFK37791.1|  unknown                                               90.1    1e-18   
ref|XP_007209381.1|  hypothetical protein PRUPE_ppa008976mg           90.1    2e-18   
dbj|BAK04741.1|  predicted protein                                    88.6    2e-18   
ref|XP_010255701.1|  PREDICTED: bifunctional pinoresinol-laricire...  89.7    2e-18   
ref|XP_006663943.1|  PREDICTED: isoflavone reductase homolog          89.7    2e-18   
ref|XP_007210810.1|  hypothetical protein PRUPE_ppa017018mg           88.2    7e-18   
gb|EYU23275.1|  hypothetical protein MIMGU_mgv1a010366mg              88.2    8e-18   
gb|KHG03747.1|  Isoflavone reductase                                  87.8    9e-18   
ref|XP_011092596.1|  PREDICTED: isoflavone reductase homolog          87.8    1e-17   
ref|NP_001241029.1|  uncharacterized protein LOC100786578             87.8    1e-17   
ref|XP_010110424.1|  hypothetical protein L484_022830                 87.4    1e-17   
ref|XP_006368316.1|  pinoresinol-lariciresinol reductase family p...  87.4    1e-17   
ref|XP_010056202.1|  PREDICTED: isoflavone reductase homolog isof...  87.4    1e-17   
gb|KGN58400.1|  hypothetical protein Csa_3G636980                     87.4    1e-17   
ref|XP_010056201.1|  PREDICTED: isoflavone reductase homolog isof...  87.4    1e-17   
ref|XP_004144466.1|  PREDICTED: isoflavone reductase homolog          87.4    1e-17   
ref|XP_006368315.1|  hypothetical protein POPTR_0001s01540g           87.0    2e-17   
ref|XP_007156276.1|  hypothetical protein PHAVU_003G272900g           87.0    2e-17   
ref|XP_004161007.1|  PREDICTED: isoflavone reductase homolog          87.4    2e-17   
ref|XP_010663923.1|  PREDICTED: isoflavone reductase homolog          86.7    2e-17   
ref|XP_002304366.1|  pinoresinol-lariciresinol reductase family p...  86.7    2e-17   Populus trichocarpa [western balsam poplar]
ref|XP_008778652.1|  PREDICTED: bifunctional pinoresinol-laricire...  86.7    3e-17   
gb|AFK44943.1|  unknown                                               82.0    3e-17   
emb|CBI32846.3|  unnamed protein product                              86.3    3e-17   
gb|AFK47302.1|  unknown                                               86.3    3e-17   
ref|XP_003612639.1|  Isoflavone reductase-like protein                86.3    3e-17   
ref|XP_002283648.1|  PREDICTED: bifunctional pinoresinol-laricire...  85.9    4e-17   Vitis vinifera
ref|XP_011018442.1|  PREDICTED: isoflavone reductase homolog          85.9    4e-17   
ref|XP_010942719.1|  PREDICTED: isoflavone reductase homolog          85.9    4e-17   
dbj|BAJ96723.1|  predicted protein                                    84.7    5e-17   
dbj|BAJ90896.1|  predicted protein                                    85.1    6e-17   
ref|XP_011018437.1|  PREDICTED: bifunctional pinoresinol-laricire...  85.5    6e-17   
ref|XP_007040784.1|  Pinoresinol-(+)-lariciresinol reductase          85.5    7e-17   
ref|XP_009335317.1|  PREDICTED: isoflavone reductase homolog isof...  85.1    7e-17   
gb|AFK46850.1|  unknown                                               85.1    8e-17   
dbj|BAF34845.1|  pinoresinol-lariciresinol reductase homolog          85.1    8e-17   Lotus japonicus
gb|AFK37287.1|  unknown                                               85.1    8e-17   
ref|XP_010677468.1|  PREDICTED: isoflavone reductase homolog          85.1    9e-17   
ref|XP_006854135.1|  hypothetical protein AMTR_s00048p00167820        85.1    9e-17   
emb|CBI37386.3|  unnamed protein product                              84.7    9e-17   
ref|XP_003612642.1|  Isoflavone reductase-like protein                84.7    1e-16   
dbj|BAF34846.1|  pinoresinol-lariciresinol reductase homolog          84.7    1e-16   Lotus japonicus
ref|XP_004301639.1|  PREDICTED: isoflavone reductase homolog          86.7    1e-16   
ref|XP_009596485.1|  PREDICTED: bifunctional pinoresinol-laricire...  84.7    1e-16   
ref|XP_006828173.1|  hypothetical protein AMTR_s00023p00119780        84.7    1e-16   
ref|XP_010664884.1|  PREDICTED: isoflavone reductase homolog          84.7    1e-16   
ref|XP_008460436.1|  PREDICTED: bifunctional pinoresinol-laricire...  84.3    2e-16   
emb|CDP21344.1|  unnamed protein product                              80.1    2e-16   
ref|XP_008777499.1|  PREDICTED: isoflavone reductase homolog          84.0    2e-16   
gb|EMT10361.1|  Isoflavone reductase-like protein                     82.4    3e-16   
ref|XP_010110425.1|  hypothetical protein L484_022831                 83.6    3e-16   
gb|EMT10362.1|  Isoflavone reductase-like protein                     81.6    4e-16   
emb|CAN76230.1|  hypothetical protein VITISV_040855                   83.2    4e-16   Vitis vinifera
ref|XP_011092597.1|  PREDICTED: bifunctional pinoresinol-laricire...  82.8    6e-16   
ref|XP_008390914.1|  PREDICTED: isoflavone reductase homolog isof...  82.4    9e-16   
ref|XP_003578726.1|  PREDICTED: isoflavone reductase homolog          81.3    2e-15   
emb|CAN73024.1|  hypothetical protein VITISV_041007                   80.9    3e-15   Vitis vinifera
gb|EMT00088.1|  Isoflavone reductase-like protein                     80.5    3e-15   
ref|XP_010110432.1|  hypothetical protein L484_022838                 80.5    3e-15   
ref|XP_006353718.1|  PREDICTED: bifunctional pinoresinol-laricire...  80.5    3e-15   
ref|XP_010056195.1|  PREDICTED: bifunctional pinoresinol-laricire...  80.1    5e-15   
sp|E6Y2X0.1|PILR2_LINUS  RecName: Full=Bifunctional pinoresinol-l...  79.7    8e-15   
ref|XP_004300160.1|  PREDICTED: isoflavone reductase homolog          79.3    1e-14   
ref|XP_002519851.1|  Isoflavone reductase, putative                   79.0    1e-14   Ricinus communis
dbj|BAI66418.1|  pinoresinol-lariciresinol reductase                  79.0    1e-14   Linum album
sp|Q4R0I0.1|PILR1_LINAL  RecName: Full=Bifunctional pinoresinol-l...  79.0    1e-14   Linum album
emb|CDP21412.1|  unnamed protein product                              77.4    1e-14   
gb|EMS64763.1|  hypothetical protein TRIUR3_12439                     77.4    2e-14   
ref|XP_007158197.1|  hypothetical protein PHAVU_002G132300g           78.2    2e-14   
gb|AHL21381.1|  pinoresinol-lariciresinol reductase                   77.0    5e-14   
ref|XP_008460437.1|  PREDICTED: isoflavone reductase homolog          76.6    7e-14   
sp|P93143.1|PILR1_FORIN  RecName: Full=Bifunctional pinoresinol-l...  76.6    9e-14   Forsythia x intermedia [cultivated forsythia]
sp|B5KRH5.1|PILR1_LINCY  RecName: Full=Bifunctional pinoresinol-l...  76.6    9e-14   Linum corymbulosum
gb|AEA42007.1|  pinoresinol-lariciresinol reductase                   76.6    1e-13   
ref|XP_010440554.1|  PREDICTED: pinoresinol reductase 2-like          74.7    2e-13   
ref|XP_002870365.1|  predicted protein                                75.9    2e-13   
ref|XP_004241768.1|  PREDICTED: bifunctional pinoresinol-laricire...  75.5    2e-13   
ref|XP_010518923.1|  PREDICTED: pinoresinol reductase 1               75.9    2e-13   
ref|XP_010440553.1|  PREDICTED: pinoresinol reductase 2-like isof...  75.5    3e-13   
ref|XP_010440550.1|  PREDICTED: pinoresinol reductase 2-like isof...  75.1    3e-13   
gb|ACD35472.1|  pinoresinol-lariciresinol reductase                   72.0    3e-13   Phyllanthus amarus [carry-me seed]
ref|XP_009335318.1|  PREDICTED: isoflavone reductase homolog isof...  74.7    3e-13   
ref|XP_004144407.1|  PREDICTED: isoflavone reductase homolog          74.7    4e-13   
ref|XP_004168032.1|  PREDICTED: LOW QUALITY PROTEIN: isoflavone r...  74.7    4e-13   
ref|XP_010435236.1|  PREDICTED: pinoresinol reductase 2               73.9    8e-13   
gb|AAF64185.1|AF242502_1  pinoresinol-lariciresinol reductase TH2     73.9    9e-13   Tsuga heterophylla
gb|AAF64184.1|AF242501_1  pinoresinol-lariciresinol reductase TH1     73.2    9e-13   Tsuga heterophylla
ref|XP_010540735.1|  PREDICTED: pinoresinol reductase 1-like          73.2    2e-12   
ref|XP_008390912.1|  PREDICTED: isoflavone reductase homolog          72.8    2e-12   
gb|AFK38057.1|  unknown                                               70.1    2e-12   
gb|ABY75535.2|  pinoresinol-lariciresinol reductase                   72.4    3e-12   Sinopodophyllum hexandrum [Himalayan mayapple]
gb|AFK36279.1|  unknown                                               72.4    3e-12   
gb|ACF71492.1|  pinoresinol-lariciresinol reductase                   72.4    3e-12   Sinopodophyllum hexandrum [Himalayan mayapple]
ref|XP_008390915.1|  PREDICTED: isoflavone reductase homolog isof...  71.6    4e-12   
ref|NP_174490.1|  pinoresinol reductase 1                             71.6    5e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305387.1|  hypothetical protein CARUB_v10009780mg           71.6    6e-12   
ref|XP_002893700.1|  hypothetical protein ARALYDRAFT_473393           71.6    6e-12   
gb|KHN11848.1|  Isoflavone reductase like                             71.6    7e-12   
gb|KFK36255.1|  hypothetical protein AALP_AA4G098500                  71.2    9e-12   
ref|XP_010540727.1|  PREDICTED: pinoresinol reductase 1-like          70.9    1e-11   
ref|XP_010653663.1|  PREDICTED: bifunctional pinoresinol-laricire...  68.2    1e-11   
gb|AAM64780.1|  pinoresinol-lariciresinol reductase, putative         70.5    1e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CDY29935.1|  BnaC05g29010D                                        69.3    2e-11   
gb|ABV02071.1|  Isoflavone reductase                                  70.5    2e-11   Fagopyrum cymosum
ref|XP_006285396.1|  hypothetical protein CARUB_v10006801mg           70.5    2e-11   
ref|XP_010450179.1|  PREDICTED: pinoresinol reductase 2-like          70.1    2e-11   
ref|NP_193102.1|  pinoresinol reductase 2                             70.1    2e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CDY59205.1|  BnaA09g53990D                                        68.9    2e-11   
ref|NP_001241204.1|  uncharacterized protein LOC100780465             69.7    2e-11   
ref|XP_010461029.1|  PREDICTED: pinoresinol reductase 1-like          70.1    3e-11   
emb|CDY22584.1|  BnaC05g24220D                                        70.1    3e-11   
ref|XP_006415251.1|  hypothetical protein EUTSA_v10008239mg           69.7    3e-11   
ref|XP_009145209.1|  PREDICTED: pinoresinol reductase 1               69.7    3e-11   
ref|XP_006305386.1|  hypothetical protein CARUB_v10009778mg           69.7    3e-11   
ref|XP_009114918.1|  PREDICTED: pinoresinol reductase 1-like          69.7    3e-11   
sp|A3R052.1|PILR1_LINPE  RecName: Full=Bifunctional pinoresinol-l...  68.2    1e-10   Linum perenne
sp|Q9LD13.1|PILR2_THUPL  RecName: Full=Bifunctional pinoresinol-l...  68.2    1e-10   Thuja plicata [giant arborvitae]
emb|CBI32845.3|  unnamed protein product                              67.8    2e-10   
ref|XP_010478629.1|  PREDICTED: pinoresinol reductase 1-like          67.4    2e-10   
sp|Q9LD12.1|PILR4_THUPL  RecName: Full=Bifunctional pinoresinol-l...  67.0    3e-10   Thuja plicata [giant arborvitae]
emb|CAN82074.1|  hypothetical protein VITISV_036539                   67.0    3e-10   Vitis vinifera
ref|XP_010664849.1|  PREDICTED: isoflavone reductase homolog          66.6    3e-10   
ref|XP_010499755.1|  PREDICTED: pinoresinol reductase 1               66.6    4e-10   
gb|KFK36256.1|  hypothetical protein AALP_AA4G098600                  66.2    4e-10   
ref|XP_010478630.1|  PREDICTED: pinoresinol reductase 1-like          66.2    5e-10   
ref|XP_006415253.1|  hypothetical protein EUTSA_v10009995mg           65.5    1e-09   
gb|ADM76443.1|  isoflavone reductase-like protein                     61.2    1e-09   
gb|ADM78154.1|  isoflavone reductase-like protein                     62.8    1e-09   
gb|ADM78126.1|  isoflavone reductase-like protein                     62.8    1e-09   
gb|AAF64179.1|AF242496_1  phenylcoumaran benzylic ether reductase...  65.1    1e-09   Tsuga heterophylla
gb|AAF64176.1|AF242493_1  phenylcoumaran benzylic ether reductase...  64.7    1e-09   Tsuga heterophylla
gb|EMT10363.1|  Isoflavone reductase-like protein                     65.5    2e-09   
sp|Q9LD00.1|PILR3_THUPL  RecName: Full=Bifunctional pinoresinol-l...  64.3    2e-09   Thuja plicata [giant arborvitae]
gb|ADM78136.1|  isoflavone reductase-like protein                     61.6    4e-09   
gb|ADM78148.1|  isoflavone reductase-like protein                     61.2    4e-09   
gb|ABK21730.1|  unknown                                               63.5    4e-09   Picea sitchensis
gb|ADM78142.1|  isoflavone reductase-like protein                     60.8    6e-09   
ref|XP_006414867.1|  hypothetical protein EUTSA_v10026944mg           62.8    8e-09   
gb|ADM78146.1|  isoflavone reductase-like protein                     60.5    8e-09   
gb|KFK44973.1|  hypothetical protein AALP_AA1G327300                  62.8    9e-09   
gb|ABK22612.1|  unknown                                               62.0    1e-08   Picea sitchensis
sp|Q9LD14.1|PILR1_THUPL  RecName: Full=Bifunctional pinoresinol-l...  61.6    2e-08   Thuja plicata [giant arborvitae]
emb|CCC55425.1|  phenylcoumaran benzylic ether reductase              61.6    2e-08   
gb|ADM78139.1|  isoflavone reductase-like protein                     58.9    3e-08   
sp|P0DKC8.1|PILR_LINUS  RecName: Full=Bifunctional pinoresinol-la...  60.5    6e-08   
gb|ABK23449.1|  unknown                                               60.1    7e-08   Picea sitchensis
gb|ABK23528.1|  unknown                                               59.7    9e-08   Picea sitchensis
gb|AAF64182.1|AF242499_1  phenylcoumaran benzylic ether reductase...  59.7    1e-07   Tsuga heterophylla
gb|ABR16287.1|  unknown                                               59.3    1e-07   Picea sitchensis
gb|AGG40646.1|  isoflavone reductase-like protein                     59.3    1e-07   
gb|ACN41153.1|  unknown                                               58.5    1e-07   Picea sitchensis
pdb|1QYC|A  Chain A, Crystal Structures Of Pinoresinol-Lariciresi...  58.5    2e-07   
gb|AAC32591.1|  phenylcoumaran benzylic ether reductase               58.5    2e-07   Pinus taeda
gb|ABK26927.1|  unknown                                               58.5    2e-07   Picea sitchensis
gb|ABK25478.1|  unknown                                               58.5    3e-07   Picea sitchensis
sp|Q4R0H9.1|PILR1_LINUS  RecName: Full=Bifunctional pinoresinol-l...  58.5    3e-07   Linum usitatissimum
gb|ABK23542.1|  unknown                                               57.4    5e-07   Picea sitchensis
gb|ABK21421.1|  unknown                                               57.4    6e-07   Picea sitchensis
gb|AAF64180.1|AF242497_1  phenylcoumaran benzylic ether reductase...  57.0    7e-07   Tsuga heterophylla
gb|AAF64181.1|AF242498_1  phenylcoumaran benzylic ether reductase...  57.0    7e-07   Tsuga heterophylla
gb|ABK24786.1|  unknown                                               57.0    8e-07   Picea sitchensis
gb|ABK24213.1|  unknown                                               57.0    8e-07   Picea sitchensis
gb|AAK27264.1|  isoflavone reductase-like protein CJP-6               53.5    1e-05   Cryptomeria japonica
gb|ABF39004.1|  phenylcoumaran benzylic ether reductase               52.8    2e-05   Pinus strobus
gb|ABR16114.1|  unknown                                               51.2    6e-05   Picea sitchensis
emb|CCC55424.1|  pinoresinol-lariciresinol reductase                  51.2    7e-05   
ref|XP_002978069.1|  hypothetical protein SELMODRAFT_233106           50.8    8e-05   
ref|XP_002966667.1|  hypothetical protein SELMODRAFT_230858           50.8    9e-05   
gb|AAF64177.1|AF242494_1  phenylcoumaran benzylic ether reductase...  50.8    1e-04   Tsuga heterophylla
gb|ADM79284.1|  isoflavone reductase-like protein                     48.9    2e-04   
gb|ADM79288.1|  isoflavone reductase-like protein                     48.9    2e-04   
gb|ADM79319.1|  isoflavone reductase-like protein                     48.1    3e-04   
gb|ADM79303.1|  isoflavone reductase-like protein                     47.8    3e-04   
ref|XP_002283921.2|  PREDICTED: LOW QUALITY PROTEIN: isoflavone r...  48.9    5e-04   Vitis vinifera
emb|CBI37669.3|  unnamed protein product                              48.5    5e-04   
ref|XP_010034732.1|  PREDICTED: isoflavone reductase-like protein     47.0    6e-04   
ref|XP_006423307.1|  hypothetical protein CICLE_v10028896mg           48.1    7e-04   
gb|AEX13522.1|  hypothetical protein UMN_7561_01                      45.4    7e-04   
gb|KDO42019.1|  hypothetical protein CISIN_1g021596mg                 48.1    8e-04   
ref|XP_007148735.1|  hypothetical protein PHAVU_005G010000g           48.1    8e-04   
gb|KDO42018.1|  hypothetical protein CISIN_1g021596mg                 48.1    9e-04   
ref|XP_006423306.1|  hypothetical protein CICLE_v10028896mg           47.8    0.001   
ref|XP_006469140.1|  PREDICTED: isoflavone reductase homolog isof...  47.8    0.001   
ref|XP_006469139.1|  PREDICTED: isoflavone reductase homolog isof...  47.8    0.001   



>ref|XP_006663942.1| PREDICTED: isoflavone reductase homolog [Oryza brachyantha]
Length=314

 Score =   102 bits (253),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMKD+++  +VG+  YYHIFYEGCLTNF+IG++G EA+QLYPEVHYTRMDEYLKRYL
Sbjct  256  LASMKDLDFAHQVGIGHYYHIFYEGCLTNFDIGENGAEATQLYPEVHYTRMDEYLKRYL  314



>ref|XP_009769427.1| PREDICTED: isoflavone reductase homolog [Nicotiana sylvestris]
Length=313

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L+SMK M+Y G+VGV  +YHIFYEGCLTNFEIG++ EEAS+LYPEV YTRMDEYLKRYL
Sbjct  254  LSSMKGMDYAGQVGVGHFYHIFYEGCLTNFEIGENAEEASELYPEVRYTRMDEYLKRYL  312



>ref|XP_009596481.1| PREDICTED: isoflavone reductase homolog [Nicotiana tomentosiformis]
Length=313

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L+SMK M+Y G+VGV  +YHIFYEGCLTNFEIG++ EEAS+LYPEV YTRMDEYLKRYL
Sbjct  254  LSSMKGMDYAGQVGVGHFYHIFYEGCLTNFEIGENAEEASKLYPEVRYTRMDEYLKRYL  312



>ref|NP_001066531.1| Os12g0265100 [Oryza sativa Japonica Group]
 gb|ABA97006.1| Isoflavone reductase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29550.1| Os12g0265100 [Oryza sativa Japonica Group]
 gb|EAY97059.1| hypothetical protein OsI_18981 [Oryza sativa Indica Group]
 gb|EAZ40429.1| hypothetical protein OsJ_24881 [Oryza sativa Japonica Group]
Length=314

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMKD+++  +VG+  YYHIFYEGCL NFEIGD+G EA+QLYPEV YTRMDEYLKRY+
Sbjct  256  LASMKDLDFASQVGIGHYYHIFYEGCLANFEIGDNGAEATQLYPEVQYTRMDEYLKRYI  314



>emb|CDP11761.1| unnamed protein product [Coffea canephora]
Length=355

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMKDM+Y G+VGV  +YH+FYEGCLTNFE G DGEEAS+LYPEV YTRM+ YLKRY+
Sbjct  297  LASMKDMDYAGQVGVGHFYHVFYEGCLTNFEAGKDGEEASELYPEVEYTRMESYLKRYV  355



>emb|CDP11762.1| unnamed protein product [Coffea canephora]
Length=312

 Score = 99.8 bits (247),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMKDM+Y G+VGV  +YH+FYEGCLTNFE G DGEEAS+LYPEV YTRM+ YLKRY+
Sbjct  254  LASMKDMDYAGQVGVGHFYHVFYEGCLTNFEAGKDGEEASELYPEVEYTRMESYLKRYV  312



>ref|XP_004241766.1| PREDICTED: isoflavone reductase homolog isoform X2 [Solanum lycopersicum]
Length=313

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L+SMK+M+Y G+VGV  +YHIFYEGCLTNFEIG + EEAS LYPEV YTRMDEYLKR+L
Sbjct  254  LSSMKEMDYAGQVGVGHFYHIFYEGCLTNFEIGQNAEEASALYPEVCYTRMDEYLKRFL  312



>ref|XP_010322711.1| PREDICTED: isoflavone reductase homolog isoform X1 [Solanum lycopersicum]
Length=314

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L+SMK+M+Y G+VGV  +YHIFYEGCLTNFEIG + EEAS LYPEV YTRMDEYLKR+L
Sbjct  255  LSSMKEMDYAGQVGVGHFYHIFYEGCLTNFEIGQNAEEASALYPEVCYTRMDEYLKRFL  313



>ref|XP_006353700.1| PREDICTED: isoflavone reductase homolog [Solanum tuberosum]
Length=313

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L+SMK+M+Y G+VGV  +YHIFYEGCLTNFEIG + EEAS LYPEV YTRMDEYLKR+L
Sbjct  254  LSSMKEMDYAGQVGVGHFYHIFYEGCLTNFEIGQNAEEASALYPEVCYTRMDEYLKRFL  312



>gb|EAY97058.1| hypothetical protein OsI_18980 [Oryza sativa Indica Group]
Length=126

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA MKDM++  +VG+  +YHIFYEGCLTNF+IGD+G EA+ LYPEV YTR+DE+LKRYL
Sbjct  68   LAPMKDMQFAFQVGITHFYHIFYEGCLTNFDIGDNGAEATILYPEVQYTRIDEFLKRYL  126



>emb|CBI37385.3| unnamed protein product [Vitis vinifera]
Length=218

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L SMK ++Y G+VGV  +YHI+YEGCLTNFEIG++GEEAS+LYPEV Y RMDEYLKRYL
Sbjct  160  LVSMKGLDYAGQVGVGHFYHIYYEGCLTNFEIGEEGEEASKLYPEVDYIRMDEYLKRYL  218



>ref|XP_011028077.1| PREDICTED: isoflavone reductase homolog [Populus euphratica]
Length=312

 Score = 97.1 bits (240),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMK M+YV + G+  +YHIFYEGCLTNFEIG+DGEEAS LYPEV YTRMDEYLK +L
Sbjct  254  LASMKGMDYVAQAGMGHFYHIFYEGCLTNFEIGEDGEEASDLYPEVKYTRMDEYLKIFL  312



>emb|CAN69630.1| hypothetical protein VITISV_028545 [Vitis vinifera]
Length=312

 Score = 96.7 bits (239),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L SMK ++Y G+VGV  +YHI+YEGCLTNFEIG++GEEAS+LYPEV Y RMDEYLKRYL
Sbjct  254  LVSMKGLDYAGQVGVGHFYHIYYEGCLTNFEIGEEGEEASKLYPEVDYIRMDEYLKRYL  312



>ref|NP_001268219.1| uncharacterized protein LOC100253437 [Vitis vinifera]
 tpe|CAI56330.1| TPA: isoflavone reductase-like protein 1 [Vitis vinifera]
Length=312

 Score = 96.7 bits (239),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L SMK ++Y G+VGV  +YHI+YEGCLTNFEIG++GEEAS+LYPEV Y RMDEYLKRYL
Sbjct  254  LVSMKGLDYAGQVGVGHFYHIYYEGCLTNFEIGEEGEEASKLYPEVDYIRMDEYLKRYL  312



>ref|XP_004963224.1| PREDICTED: isoflavone reductase homolog [Setaria italica]
Length=312

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMKDM+  G++ V  +YHIFYEGCLTNF+IG+DG EA+ LYPEV YTRMDEY+KRYL
Sbjct  254  LASMKDMDIGGQIAVGHFYHIFYEGCLTNFDIGEDGAEATLLYPEVEYTRMDEYMKRYL  312



>gb|EEE62835.1| hypothetical protein OsJ_17638 [Oryza sativa Japonica Group]
Length=314

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA MKDM++  +VG+  +YHIFYEGCLTNF+IGD+G EA+ LYPEV YTR+DE+LKRYL
Sbjct  256  LAPMKDMQFAFQVGITHFYHIFYEGCLTNFDIGDNGAEATILYPEVQYTRIDEFLKRYL  314



>gb|ABA96985.2| Isoflavone reductase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAH01141.1| unnamed protein product [Oryza sativa Japonica Group]
Length=314

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA MKDM++  +VG+  +YHIFYEGCLTNF+IGD+G EA+ LYPEV YTR+DE+LKRYL
Sbjct  256  LAPMKDMQFAFQVGITHFYHIFYEGCLTNFDIGDNGAEATILYPEVQYTRIDEFLKRYL  314



>ref|XP_006432628.1| hypothetical protein CICLE_v10001913mg [Citrus clementina]
 ref|XP_006471437.1| PREDICTED: isoflavone reductase homolog [Citrus sinensis]
 gb|ESR45868.1| hypothetical protein CICLE_v10001913mg [Citrus clementina]
Length=312

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+MK+M+Y G+VGV  ++HIFYEGCLTNFEIG+  EEAS+LYPEV YTRMD+YLK+YL
Sbjct  254  LATMKEMDYAGQVGVGHFHHIFYEGCLTNFEIGEGQEEASKLYPEVKYTRMDDYLKQYL  312



>ref|XP_007158198.1| hypothetical protein PHAVU_002G132400g [Phaseolus vulgaris]
 gb|ESW30192.1| hypothetical protein PHAVU_002G132400g [Phaseolus vulgaris]
Length=312

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMK ++Y G+VGV  +YH+FYEGCLTNFEIG+ GEEAS LYPEV+YTRMDEYL+ Y+
Sbjct  254  LASMKGLDYAGQVGVGHFYHVFYEGCLTNFEIGEGGEEASALYPEVNYTRMDEYLQVYV  312



>ref|XP_010056197.1| PREDICTED: isoflavone reductase homolog [Eucalyptus grandis]
 gb|KCW72809.1| hypothetical protein EUGRSUZ_E01253 [Eucalyptus grandis]
Length=312

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLK  330
            LASMK ++Y  +VGV  +YHIFYEGCLTNFEIG+D EEASQLYPEV YTRM+EYLK
Sbjct  254  LASMKGLDYAQQVGVGHFYHIFYEGCLTNFEIGEDAEEASQLYPEVQYTRMNEYLK  309



>ref|XP_010056196.1| PREDICTED: isoflavone reductase homolog [Eucalyptus grandis]
 gb|KCW72808.1| hypothetical protein EUGRSUZ_E01252 [Eucalyptus grandis]
Length=312

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            LASMK + Y  +VG+  +YHIFYEGCLTNFEI +DGEEASQLYPEV YTRMDEYLK Y
Sbjct  254  LASMKGLGYAAQVGMGHFYHIFYEGCLTNFEISEDGEEASQLYPEVQYTRMDEYLKIY  311



>ref|XP_007210609.1| hypothetical protein PRUPE_ppa017446mg [Prunus persica]
 gb|EMJ11808.1| hypothetical protein PRUPE_ppa017446mg [Prunus persica]
Length=312

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            LASMK M+Y G+VGV  +YHIFYEG LTNFEIG++GEEAS+LYPEV YTRM+EYLK Y
Sbjct  254  LASMKGMDYAGQVGVGHFYHIFYEGALTNFEIGNEGEEASKLYPEVKYTRMNEYLKIY  311



>gb|EEE62836.1| hypothetical protein OsJ_17639 [Oryza sativa Japonica Group]
Length=79

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMKD  +  +VGV  +YHIFYEGCLTNF+IGD G EA+ LYP+V YTR++E+LKRYL
Sbjct  21   LASMKDTNFAHQVGVTHFYHIFYEGCLTNFDIGDYGAEATLLYPDVQYTRINEFLKRYL  79



>ref|XP_008238119.1| PREDICTED: isoflavone reductase homolog [Prunus mume]
Length=312

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            LASMK M+Y G+VGV   YH+FYEG LTNFEIG++GEEAS+LYPEV YTRMDEYLK Y
Sbjct  254  LASMKGMDYAGQVGVGHLYHMFYEGALTNFEIGEEGEEASKLYPEVKYTRMDEYLKLY  311



>ref|XP_008238115.1| PREDICTED: isoflavone reductase homolog [Prunus mume]
Length=312

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            LASMK M+Y G+VGV  +YHIFYEG LTNFEIG +GEEAS+LYPEV YTRM+EYLK Y
Sbjct  254  LASMKGMDYAGQVGVGHFYHIFYEGALTNFEIGKEGEEASKLYPEVKYTRMNEYLKIY  311



>gb|KDP39738.1| hypothetical protein JCGZ_02758 [Jatropha curcas]
Length=312

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L SMKD +Y  KVG+  +YH FYEGCL NFEIG DGEEAS LYPEV YTRMDEYLK YL
Sbjct  254  LDSMKDADYEAKVGIGHFYHFFYEGCLANFEIGKDGEEASNLYPEVKYTRMDEYLKIYL  312



>ref|XP_003533456.1| PREDICTED: isoflavone reductase homolog [Glycine max]
Length=318

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            LAS+K ++Y  +VGV  +YHIFYEGCLTNFEIG+ GEEAS+LYPEV YTRMDEYLK Y
Sbjct  254  LASIKGLDYAAQVGVGHFYHIFYEGCLTNFEIGEGGEEASELYPEVKYTRMDEYLKVY  311



>ref|XP_008674386.1| PREDICTED: isoflavone reductase homolog [Zea mays]
 tpg|DAA55393.1| TPA: hypothetical protein ZEAMMB73_016252 [Zea mays]
Length=312

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMK  +   + GV  YYHIFYEGCLTNFEIGDDG +A+ LYPEV YTRMDEY+KRY+
Sbjct  254  LASMKGTDLANQAGVGHYYHIFYEGCLTNFEIGDDGADATLLYPEVQYTRMDEYMKRYV  312



>ref|XP_007040783.1| Pinoresinol reductase 1 isoform 2 [Theobroma cacao]
 gb|EOY25284.1| Pinoresinol reductase 1 isoform 2 [Theobroma cacao]
Length=221

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMK +++ G+VGV  +YHIFYEGCLTNFEIG+  EEAS+LYPEV YTRMD+YLK Y+
Sbjct  163  LASMKGLDFAGQVGVGHFYHIFYEGCLTNFEIGEGVEEASRLYPEVEYTRMDDYLKIYI  221



>ref|XP_008238117.1| PREDICTED: isoflavone reductase homolog [Prunus mume]
Length=309

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            LASMK M+Y G+VGV  +YH+FYEG LTNFEIG++GEEAS+LYPEV YTRM+EYLK Y
Sbjct  251  LASMKGMDYAGQVGVGHFYHMFYEGALTNFEIGEEGEEASKLYPEVKYTRMNEYLKIY  308



>ref|XP_004300158.1| PREDICTED: isoflavone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=318

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            L SMK M+Y G+VGV  +YHIFYEG LTNF+IG++GEEAS+LYPEV YTRMDEYLK Y
Sbjct  260  LVSMKGMDYAGQVGVGHFYHIFYEGSLTNFKIGEEGEEASKLYPEVKYTRMDEYLKVY  317



>ref|XP_008238116.1| PREDICTED: isoflavone reductase homolog [Prunus mume]
Length=309

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            LASMK M+Y G+VGV  +YH+FYEG LTNFEIG++GEEAS+LYPEV YTRM+EYLK Y
Sbjct  251  LASMKGMDYAGQVGVGHFYHMFYEGALTNFEIGEEGEEASKLYPEVKYTRMNEYLKIY  308



>ref|XP_002519850.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
 gb|EEF42454.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
Length=312

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA MKD ++  + G+  +YHIFYEGCLTNFEIG DG EAS LYPEV YTRMDEYLK Y+
Sbjct  254  LACMKDADHAARAGIGHFYHIFYEGCLTNFEIGKDGAEASNLYPEVEYTRMDEYLKAYI  312



>ref|XP_010255703.1| PREDICTED: isoflavone reductase homolog [Nelumbo nucifera]
Length=314

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 53/59 (90%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMKD++Y  +VGV  +Y IFYEGCLTNF+IG++ EEAS+LYPEV+YTRMDEYLKRY+
Sbjct  257  LASMKDLDYASQVGVGHFYQIFYEGCLTNFDIGEE-EEASKLYPEVNYTRMDEYLKRYV  314



>gb|ABA96987.1| Isoflavone reductase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EEE62839.1| hypothetical protein OsJ_17642 [Oryza sativa Japonica Group]
Length=174

 Score = 90.1 bits (222),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMKD ++  +VGV  +YHIFYEGCLTNF+IGD+G EA+ LYP+V YTR++E +KRYL
Sbjct  116  LASMKDTDFAHQVGVTHFYHIFYEGCLTNFDIGDNGAEATLLYPDVQYTRINEVIKRYL  174



>gb|EAY97063.1| hypothetical protein OsI_18984 [Oryza sativa Indica Group]
Length=314

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMKD ++  +VGV  +YHIFYEGCLTNF+IGD+G EA+ LYP+V YTR++E LKRYL
Sbjct  256  LASMKDTDFAHQVGVTHFYHIFYEGCLTNFDIGDNGAEATLLYPDVQYTRINEVLKRYL  314



>ref|XP_007040782.1| Isoflavone reductase isoform 1 [Theobroma cacao]
 gb|EOY25283.1| Isoflavone reductase isoform 1 [Theobroma cacao]
Length=312

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMK +++ G+VGV  +YHIFYEGCLTNFEIG+  EEAS+LYPEV YTRMD+YLK Y+
Sbjct  254  LASMKGLDFAGQVGVGHFYHIFYEGCLTNFEIGEGVEEASRLYPEVEYTRMDDYLKIYI  312



>ref|XP_004512425.1| PREDICTED: isoflavone reductase homolog [Cicer arietinum]
Length=311

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 53/59 (90%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L+S+KD+++ G+VG+  +YHIFYEGCLTNFEIG DGEEAS+LYPEV YTRMDE+LK Y+
Sbjct  254  LSSVKDLDFAGQVGMGHFYHIFYEGCLTNFEIG-DGEEASKLYPEVQYTRMDEFLKCYV  311



>ref|XP_007210635.1| hypothetical protein PRUPE_ppa019829mg [Prunus persica]
 gb|EMJ11834.1| hypothetical protein PRUPE_ppa019829mg [Prunus persica]
Length=221

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            LASMK M++ G+VGV  +YH+FYEG LTNFEIG++GEEAS+LYPEV YTRMDEYL  Y
Sbjct  163  LASMKGMDFAGRVGVGHFYHMFYEGALTNFEIGEEGEEASKLYPEVKYTRMDEYLILY  220



>ref|XP_006432626.1| hypothetical protein CICLE_v10001909mg [Citrus clementina]
 ref|XP_006471436.1| PREDICTED: bifunctional pinoresinol-lariciresinol reductase 2-like 
[Citrus sinensis]
 gb|ESR45866.1| hypothetical protein CICLE_v10001909mg [Citrus clementina]
 gb|KDO58832.1| hypothetical protein CISIN_1g021470mg [Citrus sinensis]
Length=312

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMK+  Y G+VG+  YYH+ YEGCLTNFEIG++G EASQLYPE+ YT ++EYL+RYL
Sbjct  254  LASMKEQNYAGQVGLTHYYHVCYEGCLTNFEIGNEGVEASQLYPEIKYTTVEEYLRRYL  312



>ref|XP_004509553.1| PREDICTED: isoflavone reductase homolog [Cicer arietinum]
Length=312

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L ++K ++Y  +VG+  +YHIFYEGCLTNFEIG+DGEEAS+LYPEV+YTRMDEYLK Y+
Sbjct  254  LTTLKGLDYKLQVGIGHFYHIFYEGCLTNFEIGEDGEEASKLYPEVNYTRMDEYLKIYV  312



>ref|XP_010255702.1| PREDICTED: isoflavone reductase homolog [Nelumbo nucifera]
Length=314

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 53/59 (90%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMKD++Y  +VGV  +YHIFYEGCLTNF+IG++ EEAS+LYPEV+YTR+ EYLKRYL
Sbjct  257  LASMKDLDYANQVGVGHFYHIFYEGCLTNFDIGEE-EEASKLYPEVNYTRVHEYLKRYL  314



>ref|XP_007210249.1| hypothetical protein PRUPE_ppa014854mg [Prunus persica]
 gb|EMJ11448.1| hypothetical protein PRUPE_ppa014854mg [Prunus persica]
Length=312

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMK M+Y G+VG   +YH+FYEG LTNFEIG++GEEAS+LYPEV YTRM+EYLK Y+
Sbjct  254  LASMKGMDYAGQVGAGHFYHMFYEGVLTNFEIGEEGEEASKLYPEVKYTRMNEYLKIYV  312



>emb|CCH47227.1| similar to isoflavone reductase homolog [Lupinus angustifolius]
Length=312

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L+++K +++  +VGV  +YHIFYEGCLTNFEIG++GEEAS+LYPEV+YTRMD+YLK Y+
Sbjct  254  LSTLKGLDFASQVGVGHFYHIFYEGCLTNFEIGENGEEASELYPEVNYTRMDQYLKVYV  312



>sp|P52581.1|IFRH_LUPAL RecName: Full=Isoflavone reductase homolog [Lupinus albus]
 gb|AAB67729.1| isoflavone reductase-like protein [Lupinus albus]
Length=312

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L+++K +++  +VGV  +YHIFYEGCLTNFEIG++GEEAS+LYPEV+YTRMD+YLK Y+
Sbjct  254  LSTLKGLDFASQVGVGHFYHIFYEGCLTNFEIGENGEEASELYPEVNYTRMDQYLKVYV  312



>gb|ABA96984.2| Isoflavone reductase, putative, expressed [Oryza sativa Japonica 
Group]
Length=315

 Score = 90.9 bits (224),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 51/60 (85%), Gaps = 1/60 (2%)
 Frame = -2

Query  497  LASMK-DMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA MK DM++  +VG+  +YHIFYEGCLTNF+IGD+G EA+ LYPEV YTR+DE+LKRYL
Sbjct  256  LAPMKADMQFAFQVGITHFYHIFYEGCLTNFDIGDNGAEATILYPEVQYTRIDEFLKRYL  315



>ref|XP_007211123.1| hypothetical protein PRUPE_ppa025381mg [Prunus persica]
 gb|EMJ12322.1| hypothetical protein PRUPE_ppa025381mg [Prunus persica]
Length=312

 Score = 90.9 bits (224),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            LASMK M++ G+VG   +YH+FYEG LTNFEIG++GEEAS+LYPEV YTRM+EYLK Y
Sbjct  254  LASMKGMDFAGQVGAGHFYHVFYEGALTNFEIGEEGEEASKLYPEVKYTRMNEYLKIY  311



>gb|KEH20306.1| pinoresinol-lariciresinol reductase-like protein [Medicago truncatula]
Length=312

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L ++K +EY  +V +  +YHIFYEGCLTNFEIG+DGEEAS+LYPEV+YTRMDEYLK Y+
Sbjct  254  LTTLKGLEYKLQVAIGHFYHIFYEGCLTNFEIGEDGEEASKLYPEVNYTRMDEYLKIYV  312



>gb|AFK37791.1| unknown [Medicago truncatula]
Length=312

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L ++K +EY  +V +  +YHIFYEGCLTNFEIG+DGEEAS+LYPEV+YTRMDEYLK Y+
Sbjct  254  LTTLKGLEYKLQVAIGHFYHIFYEGCLTNFEIGEDGEEASKLYPEVNYTRMDEYLKIYV  312



>ref|XP_007209381.1| hypothetical protein PRUPE_ppa008976mg [Prunus persica]
 gb|EMJ10580.1| hypothetical protein PRUPE_ppa008976mg [Prunus persica]
Length=312

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            LASMK M+Y G+VG   +YH+FYEG LTNFEIG++GEEAS+LYPEV YTRM+EY+K Y
Sbjct  254  LASMKGMDYAGQVGAGHFYHMFYEGALTNFEIGEEGEEASKLYPEVKYTRMNEYIKIY  311



>dbj|BAK04741.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=195

 Score = 88.6 bits (218),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 1/60 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDG-EEASQLYPEVHYTRMDEYLKRYL  321
            LASMK  +   +VG+  YYHIFYEGCLTNFEIG DG EEA+ LYPEV Y+RMDEY+KRYL
Sbjct  136  LASMKGTDLANQVGIGHYYHIFYEGCLTNFEIGHDGEEEATLLYPEVQYSRMDEYMKRYL  195



>ref|XP_010255701.1| PREDICTED: bifunctional pinoresinol-lariciresinol reductase-like 
[Nelumbo nucifera]
Length=312

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMK   Y  +VG+  YYH++++GCLTNFEIG +GEEAS+LYPEV YTR+DEYL+RYL
Sbjct  254  LASMKGQSYEEQVGLTHYYHVYFDGCLTNFEIGPEGEEASKLYPEVRYTRVDEYLRRYL  312



>ref|XP_006663943.1| PREDICTED: isoflavone reductase homolog [Oryza brachyantha]
Length=307

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LAS +  +Y+ +VGV  +YHI+YEGCLTNFEIG++G EA+ LYPEV YTRMDEYLKRYL
Sbjct  249  LASGEGTDYINQVGVGHFYHIYYEGCLTNFEIGENGAEATLLYPEVEYTRMDEYLKRYL  307



>ref|XP_007210810.1| hypothetical protein PRUPE_ppa017018mg [Prunus persica]
 gb|EMJ12009.1| hypothetical protein PRUPE_ppa017018mg [Prunus persica]
Length=312

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            LASMK M+Y  +VGV  +YH+FYEG LTNFE G++GEEAS+LYPEV YTRM+EYLK Y
Sbjct  254  LASMKGMDYASQVGVGHFYHMFYEGALTNFETGEEGEEASKLYPEVKYTRMNEYLKIY  311



>gb|EYU23275.1| hypothetical protein MIMGU_mgv1a010366mg [Erythranthe guttata]
Length=314

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+M+  ++V +VG+  +YHIF+EGCLTNFEIG+DGEEAS LYPEV YTRM +YL RYL
Sbjct  254  LANMEGADFVMQVGLGHFYHIFFEGCLTNFEIGEDGEEASTLYPEVEYTRMHDYLNRYL  312



>gb|KHG03747.1| Isoflavone reductase [Gossypium arboreum]
Length=312

 Score = 87.8 bits (216),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMK  +  G+VGV  +YHIFYEGCLTNFEIG+  EEAS+LYP+V YTRMD+Y+K Y+
Sbjct  254  LASMKGFDLAGQVGVGHFYHIFYEGCLTNFEIGEGSEEASKLYPQVEYTRMDDYMKIYV  312



>ref|XP_011092596.1| PREDICTED: isoflavone reductase homolog [Sesamum indicum]
Length=314

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA +K  ++  +VG+  +YHIFYEGCLTNFEIG++GEEAS+LYPEV YTRM EYL RYL
Sbjct  254  LALLKGADFAEQVGIGHFYHIFYEGCLTNFEIGENGEEASKLYPEVEYTRMHEYLNRYL  312



>ref|NP_001241029.1| uncharacterized protein LOC100786578 [Glycine max]
 gb|ACU20316.1| unknown [Glycine max]
 gb|KHN27235.1| Isoflavone reductase like [Glycine soja]
Length=312

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L ++K ++Y  +VG+  +YHIFYEGCL NFEIG++GEEAS+LYPEV+YTRMDEYLK Y+
Sbjct  254  LTTLKGLDYKLQVGIGHFYHIFYEGCLANFEIGEEGEEASKLYPEVNYTRMDEYLKIYV  312



>ref|XP_010110424.1| hypothetical protein L484_022830 [Morus notabilis]
 gb|EXC26256.1| hypothetical protein L484_022830 [Morus notabilis]
Length=314

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLK  330
            LASMKD++++ +VGV  +YHIFYEG +TNFEIG++GEEAS LYPEV YTRM+EY+K
Sbjct  255  LASMKDLDFIMQVGVSHFYHIFYEGFMTNFEIGEEGEEASDLYPEVKYTRMEEYMK  310



>ref|XP_006368316.1| pinoresinol-lariciresinol reductase family protein [Populus trichocarpa]
 gb|ERP64885.1| pinoresinol-lariciresinol reductase family protein [Populus trichocarpa]
Length=312

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMKD +Y  K G+  +YHI YEG LTNFEIG+DGEEAS LYPEV YTRMDEYL  ++
Sbjct  254  LASMKDKDYAAKAGMGHFYHICYEGSLTNFEIGEDGEEASNLYPEVKYTRMDEYLNIFV  312



>ref|XP_010056202.1| PREDICTED: isoflavone reductase homolog isoform X2 [Eucalyptus 
grandis]
Length=306

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLK  330
            LA MK ++Y  + GV  +YHI YEGCLTNFEIG+D EEASQLYPEV YTRM+EYLK
Sbjct  248  LAPMKGLDYAQQEGVGHFYHIMYEGCLTNFEIGEDAEEASQLYPEVQYTRMNEYLK  303



>gb|KGN58400.1| hypothetical protein Csa_3G636980 [Cucumis sativus]
Length=312

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+MKD +Y  +VG+  YYH+ YEGCL NFEIG DGEEA  LYPEV YT ++EY+KRYL
Sbjct  254  LANMKDQDYAAQVGLSHYYHVCYEGCLANFEIGKDGEEACNLYPEVDYTTVEEYMKRYL  312



>ref|XP_010056201.1| PREDICTED: isoflavone reductase homolog isoform X1 [Eucalyptus 
grandis]
 gb|KCW72810.1| hypothetical protein EUGRSUZ_E01255 [Eucalyptus grandis]
Length=312

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 46/56 (82%), Gaps = 0/56 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLK  330
            LA MK ++Y  + GV  +YHI YEGCLTNFEIG+D EEASQLYPEV YTRM+EYLK
Sbjct  254  LAPMKGLDYAQQEGVGHFYHIMYEGCLTNFEIGEDAEEASQLYPEVQYTRMNEYLK  309



>ref|XP_004144466.1| PREDICTED: isoflavone reductase homolog [Cucumis sativus]
Length=319

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+MKD +Y  +VG+  YYH+ YEGCL NFEIG DGEEA  LYPEV YT ++EY+KRYL
Sbjct  261  LANMKDQDYAAQVGLSHYYHVCYEGCLANFEIGKDGEEACNLYPEVDYTTVEEYMKRYL  319



>ref|XP_006368315.1| hypothetical protein POPTR_0001s01540g [Populus trichocarpa]
 gb|ERP64884.1| hypothetical protein POPTR_0001s01540g [Populus trichocarpa]
Length=313

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA M++ +Y  +VG+  YYH+ YEGCLTNFEIGD+GEEAS+LYPEV YT +++Y+KRYL
Sbjct  255  LACMREQDYAEQVGLTHYYHVCYEGCLTNFEIGDEGEEASELYPEVKYTTVEKYMKRYL  313



>ref|XP_007156276.1| hypothetical protein PHAVU_003G272900g [Phaseolus vulgaris]
 gb|ESW28270.1| hypothetical protein PHAVU_003G272900g [Phaseolus vulgaris]
Length=312

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L ++K ++Y  +VG+  +YHIFYEGCLTNFEIG++G EAS+LYPEV+YTRMDEYLK Y+
Sbjct  254  LTTLKGLDYKLQVGIGHFYHIFYEGCLTNFEIGEEGAEASKLYPEVNYTRMDEYLKIYV  312



>ref|XP_004161007.1| PREDICTED: isoflavone reductase homolog [Cucumis sativus]
Length=375

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+MKD +Y  +VG+  YYH+ YEGCL NFEIG DGEEA  LYPEV YT ++EY+KRYL
Sbjct  317  LANMKDQDYAAQVGLSHYYHVCYEGCLANFEIGKDGEEACNLYPEVDYTTVEEYMKRYL  375



>ref|XP_010663923.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera]
 emb|CBI35285.3| unnamed protein product [Vitis vinifera]
Length=312

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASM+  ++  +VGV  +YHI+YEGCLTNFEIGD+GEEA+ LYPEV+Y RMDEYLK Y+
Sbjct  254  LASMEGKDFTFQVGVGHFYHIYYEGCLTNFEIGDEGEEAATLYPEVNYKRMDEYLKLYV  312



>ref|XP_002304366.1| pinoresinol-lariciresinol reductase family protein [Populus trichocarpa]
 gb|EEE79345.1| pinoresinol-lariciresinol reductase family protein [Populus trichocarpa]
Length=309

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 48/59 (81%), Gaps = 3/59 (5%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMK M+YV + G+  +YHIFYEGCLTNFEI   GEEAS LYPEV YTRMDEYLK +L
Sbjct  254  LASMKGMDYVAQAGMGHFYHIFYEGCLTNFEI---GEEASDLYPEVKYTRMDEYLKIFL  309



>ref|XP_008778652.1| PREDICTED: bifunctional pinoresinol-lariciresinol reductase 2-like 
[Phoenix dactylifera]
Length=312

 Score = 86.7 bits (213),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L ++K  +Y  +VG+  YYH+ YEGCLTNFEIGD+GEEASQLYPEV YTR+ +YLK+Y+
Sbjct  254  LTNLKGQDYASQVGLGHYYHVLYEGCLTNFEIGDEGEEASQLYPEVTYTRVKDYLKQYV  312



>gb|AFK44943.1| unknown [Lotus japonicus]
Length=65

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L+S+K +++  +VGV  +YH+F+EGCLTNFEI + G EAS+LYPEV YTRMDEYL+ Y+
Sbjct  7    LSSLKGLDFASQVGVGHFYHVFHEGCLTNFEIAEHGVEASELYPEVKYTRMDEYLQPYV  65



>emb|CBI32846.3| unnamed protein product [Vitis vinifera]
Length=266

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+MK   Y  +VG+  YYH+ YEGCL NFEIGD+ EEASQLYPE++YT + EY+KRYL
Sbjct  208  LATMKTQNYAEQVGLTHYYHVCYEGCLANFEIGDEAEEASQLYPEINYTTVHEYMKRYL  266



>gb|AFK47302.1| unknown [Medicago truncatula]
Length=311

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            L+SMK ++   +VGV  +YHIFYEGCL NFEIG DGEEAS+LYPEV YTRMDE+LK Y
Sbjct  254  LSSMKGLDLASQVGVGHFYHIFYEGCLANFEIG-DGEEASKLYPEVQYTRMDEFLKLY  310



>ref|XP_003612639.1| Isoflavone reductase-like protein [Medicago truncatula]
 gb|ACJ84981.1| unknown [Medicago truncatula]
 gb|AES95597.1| pinoresinol-lariciresinol reductase-like protein [Medicago truncatula]
Length=311

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 1/58 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            L+SMK ++   +VGV  +YHIFYEGCL NFEIG DGEEAS+LYPEV YTRMDE+LK Y
Sbjct  254  LSSMKGLDLASQVGVGHFYHIFYEGCLANFEIG-DGEEASKLYPEVQYTRMDEFLKLY  310



>ref|XP_002283648.1| PREDICTED: bifunctional pinoresinol-lariciresinol reductase 2 
[Vitis vinifera]
Length=312

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+MK   Y  +VG+  YYH+ YEGCL NFEIGD+ EEASQLYPE++YT + EY+KRYL
Sbjct  254  LATMKTQNYAEQVGLTHYYHVCYEGCLANFEIGDEAEEASQLYPEINYTTVHEYMKRYL  312



>ref|XP_011018442.1| PREDICTED: isoflavone reductase homolog [Populus euphratica]
Length=312

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMK+ +Y  K G+  +YHI YEG LTNFEIG+DGEEAS LYPEV YTRMDEYL  ++
Sbjct  254  LASMKEKDYAAKAGMGHFYHISYEGSLTNFEIGEDGEEASNLYPEVKYTRMDEYLSIFV  312



>ref|XP_010942719.1| PREDICTED: isoflavone reductase homolog [Elaeis guineensis]
Length=312

 Score = 85.9 bits (211),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L ++K  +Y  +VG+  YYH+FYEGCLTNF+IGD+GEEASQLYPEV YTR+ +YLK+Y+
Sbjct  254  LTNIKGQDYASQVGLGHYYHVFYEGCLTNFKIGDEGEEASQLYPEVVYTRVKDYLKQYV  312



>dbj|BAJ96723.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=204

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASM+  +   ++ V  ++HIFYEGC TNF+IG+DGEEAS LYPEV YTRM+EY+KRYL
Sbjct  146  LASMEGTDITNQMAVGHFHHIFYEGCSTNFDIGEDGEEASLLYPEVQYTRMEEYMKRYL  204



>dbj|BAJ90896.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score = 85.1 bits (209),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASM+  +   ++ V  ++HIFYEGC TNF+IG+DGEEAS LYPEV YTRM+EY+KRYL
Sbjct  171  LASMEGTDITNQMAVGHFHHIFYEGCSTNFDIGEDGEEASLLYPEVQYTRMEEYMKRYL  229



>ref|XP_011018437.1| PREDICTED: bifunctional pinoresinol-lariciresinol reductase 2-like 
[Populus euphratica]
Length=330

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+M++ +Y  +VG+  YYH+ YEGCLTNFEIG +GEEAS+LYPEV YT +++Y+KRYL
Sbjct  272  LAAMREQDYAEQVGLTHYYHVCYEGCLTNFEIGGEGEEASELYPEVKYTTVEQYMKRYL  330



>ref|XP_007040784.1| Pinoresinol-(+)-lariciresinol reductase [Theobroma cacao]
 gb|EOY25285.1| Pinoresinol-(+)-lariciresinol reductase [Theobroma cacao]
Length=313

 Score = 85.5 bits (210),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L+SMK+  Y  +VG+  YYH+ YEGCL NFEIGD GEEAS+LYPEV YT  ++Y+KRYL
Sbjct  255  LSSMKEQNYAEQVGLTHYYHVCYEGCLANFEIGDGGEEASKLYPEVKYTSAEDYMKRYL  313



>ref|XP_009335317.1| PREDICTED: isoflavone reductase homolog isoform X1 [Pyrus x bretschneideri]
Length=313

 Score = 85.1 bits (209),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 49/59 (83%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDG-EEASQLYPEVHYTRMDEYLKRY  324
            LASMK M+Y G+VGV  +YHIFYEG LTNFEI  +G EEAS+LYPEV YTRMDEYLK Y
Sbjct  254  LASMKGMDYAGQVGVGHFYHIFYEGDLTNFEIEGEGVEEASKLYPEVKYTRMDEYLKLY  312



>gb|AFK46850.1| unknown [Lotus japonicus]
Length=312

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  +K ++Y  +V +  + HIFYEGC+TNFEIGDDGEEAS+LYPEV+YTRMDEYLK Y+
Sbjct  254  LTILKGLDYKLQVAMGHFLHIFYEGCITNFEIGDDGEEASKLYPEVNYTRMDEYLKIYV  312



>dbj|BAF34845.1| pinoresinol-lariciresinol reductase homolog [Lotus japonicus]
Length=312

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  +K ++Y  +V +  + HIFYEGC+TNFEIGDDGEEAS+LYPEV+YTRMDEYLK Y+
Sbjct  254  LTILKGLDYKLQVAMGHFLHIFYEGCITNFEIGDDGEEASKLYPEVNYTRMDEYLKIYV  312



>gb|AFK37287.1| unknown [Lotus japonicus]
Length=312

 Score = 85.1 bits (209),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  +K ++Y  +V +  + HIFYEGC+TNFEIGDDGEEAS+LYPEV+YTRMDEYLK Y+
Sbjct  254  LTILKGLDYKLQVAMGHFLHIFYEGCITNFEIGDDGEEASKLYPEVNYTRMDEYLKIYV  312



>ref|XP_010677468.1| PREDICTED: isoflavone reductase homolog [Beta vulgaris subsp. 
vulgaris]
Length=311

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA MKD E   +VG+  +YHIFYEGCLTNFE+ +D EEAS+LYPEV YTRM++YLKRYL
Sbjct  254  LAPMKDGEIAHQVGIGHFYHIFYEGCLTNFEVQED-EEASRLYPEVEYTRMNDYLKRYL  311



>ref|XP_006854135.1| hypothetical protein AMTR_s00048p00167820 [Amborella trichopoda]
 gb|ERN15602.1| hypothetical protein AMTR_s00048p00167820 [Amborella trichopoda]
Length=316

 Score = 85.1 bits (209),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L SMKD++ V ++G+  YY +FYEGCLTNFEIG  G EASQLYPEV+YTR+ +YLK+YL
Sbjct  258  LDSMKDVDIVQQIGLGHYYQVFYEGCLTNFEIGGQGVEASQLYPEVNYTRVRDYLKQYL  316



>emb|CBI37386.3| unnamed protein product [Vitis vinifera]
Length=265

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMK M+Y  +VGV  +YHI+YEGCLTNFEIG+ G EA++LYPEV+Y RMDEY+K Y+
Sbjct  208  LASMKGMDYASQVGVGHFYHIYYEGCLTNFEIGEGG-EATKLYPEVNYKRMDEYMKLYV  265



>ref|XP_003612642.1| Isoflavone reductase-like protein [Medicago truncatula]
 gb|ACJ84439.1| unknown [Medicago truncatula]
 gb|AES95600.1| pinoresinol-lariciresinol reductase-like protein [Medicago truncatula]
 gb|AFK33813.1| unknown [Medicago truncatula]
Length=311

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 49/58 (84%), Gaps = 1/58 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            L+SMK ++  G+V V  +YHIF+EGCLTNFE+ +DGEEAS+LYPEV YTRMDE+LK Y
Sbjct  254  LSSMKGLDLAGQVAVGHFYHIFFEGCLTNFEL-EDGEEASKLYPEVQYTRMDEFLKAY  310



>dbj|BAF34846.1| pinoresinol-lariciresinol reductase homolog [Lotus japonicus]
Length=313

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L+S+K +++  +VGV  +YH+FYEGCLTNFEI + G EAS+LYPEV YTRMDEYL+ Y+
Sbjct  255  LSSLKGLDFASQVGVGHFYHVFYEGCLTNFEIAEHGVEASELYPEVKYTRMDEYLQPYV  313



>ref|XP_004301639.1| PREDICTED: isoflavone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=514

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            LASM  MEY G+VG   + HIFYEG LTNFEIG++GEEAS+LYP+V YTR+DEYLK Y
Sbjct  456  LASMTGMEYAGQVGAGHFCHIFYEGSLTNFEIGEEGEEASKLYPKVKYTRIDEYLKIY  513



>ref|XP_009596485.1| PREDICTED: bifunctional pinoresinol-lariciresinol reductase 2-like 
[Nicotiana tomentosiformis]
Length=313

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA MK++EY  +VG+  YYH+ YEGCL NFEIG++GEEAS+LYPEV+YT   +Y+KRY+
Sbjct  255  LAPMKELEYAEQVGMCHYYHVCYEGCLVNFEIGEEGEEASKLYPEVNYTTAQDYMKRYV  313



>ref|XP_006828173.1| hypothetical protein AMTR_s00023p00119780 [Amborella trichopoda]
 gb|ERM95589.1| hypothetical protein AMTR_s00023p00119780 [Amborella trichopoda]
Length=312

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L SMKD+  V ++G+  YY +FYEGCLTNFEIG  G EASQLYPEV+YTR+ +YLK+YL
Sbjct  254  LNSMKDVNIVQQIGLGHYYQVFYEGCLTNFEIGGQGVEASQLYPEVNYTRVRDYLKQYL  312



>ref|XP_010664884.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera]
 emb|CAN62384.1| hypothetical protein VITISV_006481 [Vitis vinifera]
Length=311

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMK M+Y  +VGV  +YHI+YEGCLTNFEIG+ G EA++LYPEV+Y RMDEY+K Y+
Sbjct  254  LASMKGMDYASQVGVGHFYHIYYEGCLTNFEIGEGG-EATKLYPEVNYKRMDEYMKLYV  311



>ref|XP_008460436.1| PREDICTED: bifunctional pinoresinol-lariciresinol reductase 2-like 
[Cucumis melo]
Length=313

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+MK  +Y  +VG+  YYH+ YEGCL NFEIG DGEEA  LYPEV+YT ++EY+KRYL
Sbjct  255  LANMKGQDYAEQVGLSHYYHVCYEGCLANFEIGKDGEEACNLYPEVNYTTVEEYMKRYL  313



>emb|CDP21344.1| unnamed protein product, partial [Coffea canephora]
Length=75

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
             +S   ++Y  +VG+  YYH+ YEGCLTNFEIGD+GEEAS+LYPEV YT++++YLK+Y+
Sbjct  17   FSSGAGLDYAEQVGLTHYYHVCYEGCLTNFEIGDEGEEASKLYPEVKYTKIEDYLKQYV  75



>ref|XP_008777499.1| PREDICTED: isoflavone reductase homolog [Phoenix dactylifera]
Length=312

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA++K  +   + G+  +YHIFYEGCLTNFEIGD GEEASQLYPEV YTR+ +YLK+Y+
Sbjct  254  LANLKGQDLATQEGLAHFYHIFYEGCLTNFEIGDGGEEASQLYPEVTYTRVKDYLKQYV  312



>gb|EMT10361.1| Isoflavone reductase-like protein [Aegilops tauschii]
Length=190

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/60 (65%), Positives = 48/60 (80%), Gaps = 1/60 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDG-EEASQLYPEVHYTRMDEYLKRYL  321
            LAS+K  +   +VG+  YYH+FYEGCLTNF+IGD+  EEAS LYPE+ Y RMDEY+KRYL
Sbjct  131  LASIKGTDLANQVGIGHYYHLFYEGCLTNFDIGDNWEEEASLLYPEIQYIRMDEYMKRYL  190



>ref|XP_010110425.1| hypothetical protein L484_022831 [Morus notabilis]
 gb|EXC26257.1| hypothetical protein L484_022831 [Morus notabilis]
Length=315

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 51/60 (85%), Gaps = 2/60 (3%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEI-GDDG-EEASQLYPEVHYTRMDEYLKRY  324
            LASMKD+ Y  +VGV  +YH+FYEGCLTNF+I G++G EEAS+LYPEV YTRMD+YLK Y
Sbjct  255  LASMKDLGYAEQVGVGHFYHLFYEGCLTNFDIKGEEGAEEASKLYPEVQYTRMDQYLKIY  314



>gb|EMT10362.1| Isoflavone reductase-like protein [Aegilops tauschii]
Length=153

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 47/60 (78%), Gaps = 1/60 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDD-GEEASQLYPEVHYTRMDEYLKRYL  321
            LASMK  +   +VGV  +YHIFYEGCLTNF+I D+  EEAS LYP+V Y RMDEY+KRYL
Sbjct  94   LASMKGTDLTNQVGVGHFYHIFYEGCLTNFDIKDNEEEEASLLYPDVRYPRMDEYMKRYL  153



>emb|CAN76230.1| hypothetical protein VITISV_040855 [Vitis vinifera]
Length=298

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASM+  ++  +VGV  +YHI+YEGCLTNFEIG++GEE + LYPEV+Y RMDEYLK Y+
Sbjct  240  LASMEGKDFTFQVGVGHFYHIYYEGCLTNFEIGEEGEETATLYPEVNYKRMDEYLKLYV  298



>ref|XP_011092597.1| PREDICTED: bifunctional pinoresinol-lariciresinol reductase-like 
[Sesamum indicum]
Length=312

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASMK ++Y  +VG+  Y+ + YEGCLTNFEIG+DGEEAS LYP+V YT ++E+LK Y+
Sbjct  254  LASMKSLDYAQQVGLCHYHDVLYEGCLTNFEIGEDGEEASTLYPQVKYTTVEEFLKHYV  312



>ref|XP_008390914.1| PREDICTED: isoflavone reductase homolog isoform X1 [Malus domestica]
Length=313

 Score = 82.4 bits (202),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDG-EEASQLYPEVHYTRMDEYLKRY  324
            LASMK M+Y G+VGV  +YHIFYEG LTNFEI  +G EEAS+LY EV YTRMDEYLK Y
Sbjct  254  LASMKGMDYAGQVGVGHFYHIFYEGNLTNFEIEGEGVEEASKLYSEVKYTRMDEYLKLY  312



>ref|XP_003578726.1| PREDICTED: isoflavone reductase homolog [Brachypodium distachyon]
Length=307

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASM+  E   +  V  ++HIFYEGCLTNF+IGD  EEAS LYPEV YTRMDEY+K YL
Sbjct  249  LASMEGAELFHQEAVGHFHHIFYEGCLTNFDIGDGAEEASLLYPEVQYTRMDEYMKPYL  307



>emb|CAN73024.1| hypothetical protein VITISV_041007 [Vitis vinifera]
Length=312

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASM+  ++  +VGV   YHI+YEGCLTNFEIG++GE A+ LYPEV+Y RMDEYLK Y+
Sbjct  254  LASMEGKDFTFQVGVGHLYHIYYEGCLTNFEIGEEGEGAAALYPEVNYKRMDEYLKLYV  312



>gb|EMT00088.1| Isoflavone reductase-like protein [Aegilops tauschii]
Length=307

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASM+  +   ++ V  ++HIFYEGC TNF+IG+DGEEAS LYPEV  TRM++Y+KRYL
Sbjct  249  LASMEGTDITNQMAVGHFHHIFYEGCSTNFDIGEDGEEASLLYPEVRCTRMEDYMKRYL  307



>ref|XP_010110432.1| hypothetical protein L484_022838 [Morus notabilis]
 gb|EXC26264.1| hypothetical protein L484_022838 [Morus notabilis]
Length=312

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA++K+ +Y  ++G+  YYH+ +EGCL NFEIGDDG EA+QLYPEV Y  +++Y+KRYL
Sbjct  254  LATLKEQDYAQQIGLGHYYHVCFEGCLANFEIGDDGLEATQLYPEVKYISVEDYMKRYL  312



>ref|XP_006353718.1| PREDICTED: bifunctional pinoresinol-lariciresinol reductase 2-like 
[Solanum tuberosum]
Length=312

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  491  SMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
             MK++EY  +VG+  YYH+ YEGCL NFEIG++GEEAS LYPEV Y   ++Y+KRYL
Sbjct  256  PMKELEYAEQVGLCHYYHVCYEGCLANFEIGEEGEEASTLYPEVKYNTAEQYMKRYL  312



>ref|XP_010056195.1| PREDICTED: bifunctional pinoresinol-lariciresinol reductase 2-like 
[Eucalyptus grandis]
 gb|KCW72807.1| hypothetical protein EUGRSUZ_E01250 [Eucalyptus grandis]
Length=312

 Score = 80.1 bits (196),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA M++  Y  +VG+  YYH+ YEGCL NFEIG+DG EAS+LYP+V+Y  ++EYL+RYL
Sbjct  254  LAMMREQNYAEQVGLTHYYHVCYEGCLANFEIGEDGVEASELYPDVNYVTVEEYLRRYL  312



>sp|E6Y2X0.1|PILR2_LINUS RecName: Full=Bifunctional pinoresinol-lariciresinol reductase 
2; Short=PLR-Lu2; AltName: Full=(+)-lariciresinol reductase.; 
AltName: Full=(+)-pinoresinol reductase [Linum usitatissimum]
 gb|ABW24501.1| (+)-pinoresinol-(+)-lariciresinol reductase [Linum usitatissimum]
Length=330

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA MK+ +Y  +VG+  YYH+ YEGCLTNFEIGD+  EA++LYPEV YT + EY+KRY+
Sbjct  272  LAMMKEQDYAEQVGLTHYYHVCYEGCLTNFEIGDEAGEATKLYPEVGYTTVVEYMKRYV  330



>ref|XP_004300160.1| PREDICTED: isoflavone reductase homolog [Fragaria vesca subsp. 
vesca]
Length=316

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L SMKDM+Y  +VG   ++ ++YEGCLTNFEIG++ EEAS+LYPEV YTRM E+L  Y+
Sbjct  258  LVSMKDMDYANQVGAGHFHDMYYEGCLTNFEIGENEEEASKLYPEVKYTRMHEFLNIYV  316



>ref|XP_002519851.1| Isoflavone reductase, putative [Ricinus communis]
 gb|EEF42455.1| Isoflavone reductase, putative [Ricinus communis]
Length=313

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L S+K  +Y  +VG+  YYH+ YEGCL NFEIG++GEEA+ LYPEV YT ++EYL RYL
Sbjct  255  LESIKGQDYAEQVGLTHYYHVCYEGCLANFEIGEEGEEATGLYPEVKYTTVEEYLTRYL  313



>dbj|BAI66418.1| pinoresinol-lariciresinol reductase [Linum album]
Length=326

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 49/59 (83%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+M++  Y  +VG+  YYH+ YEGCL+NFE+ DD +EAS+LYP+VHYT ++EYLKRY+
Sbjct  269  LATMREQNYAEQVGLTHYYHVCYEGCLSNFEV-DDEQEASKLYPDVHYTTVEEYLKRYV  326



>sp|Q4R0I0.1|PILR1_LINAL RecName: Full=Bifunctional pinoresinol-lariciresinol reductase; 
Short=PLR-La1; AltName: Full=(+)-lariciresinol reductase.; 
AltName: Full=(+)-pinoresinol reductase [Linum album]
 emb|CAH60857.1| pinoresinol-lariciresinol reductase [Linum album]
Length=326

 Score = 79.0 bits (193),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 49/59 (83%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+M++  Y  +VG+  YYH+ YEGCL+NFE+ DD +EAS+LYP+VHYT ++EYLKRY+
Sbjct  269  LATMREQNYAEQVGLTHYYHVCYEGCLSNFEV-DDEQEASKLYPDVHYTTVEEYLKRYV  326



>emb|CDP21412.1| unnamed protein product [Coffea canephora]
Length=170

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -2

Query  494  ASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            AS+K M+Y  +V V   YH F EGCLT FE G DG+EAS+LYPEV  TR+D YLKRY+
Sbjct  113  ASVKGMDYAAQVVVCHVYHPFTEGCLTKFEAGKDGQEASELYPEVACTRIDSYLKRYV  170



>gb|EMS64763.1| hypothetical protein TRIUR3_12439 [Triticum urartu]
Length=189

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASM+  +   ++ V  ++HIFYEGC TNF+IG+DGEEAS LYPEV  T M++Y+KRYL
Sbjct  131  LASMEGTDITNQMAVGHFHHIFYEGCSTNFDIGEDGEEASLLYPEVRCTSMEDYMKRYL  189



>ref|XP_007158197.1| hypothetical protein PHAVU_002G132300g [Phaseolus vulgaris]
 gb|ESW30191.1| hypothetical protein PHAVU_002G132300g [Phaseolus vulgaris]
Length=312

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L+SM+   Y  +V V+ YYH+ +EGCLTNFEIG++G EA +LYPE+ YT ++EY+KRY+
Sbjct  254  LSSMEGQPYAHQVAVVHYYHVCFEGCLTNFEIGEEGVEACELYPEIKYTTVEEYMKRYV  312



>gb|AHL21381.1| pinoresinol-lariciresinol reductase, partial [Dysosma pleiantha]
Length=311

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA MK + +  + G+  YYH+ YEGCLTNFE+ +DGE+AS+LYPEV+YT++ EYLKRYL
Sbjct  254  LALMKGLSHGHQAGLTHYYHVSYEGCLTNFEV-EDGEDASKLYPEVNYTKVSEYLKRYL  311



>ref|XP_008460437.1| PREDICTED: isoflavone reductase homolog [Cucumis melo]
Length=309

 Score = 76.6 bits (187),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA++KD++   + G   +Y IF++GCLTNFEIG+  EEAS+L+PEV+YT MD+YLK +L
Sbjct  251  LANIKDLDEAQQAGAGHFYEIFFKGCLTNFEIGEAAEEASKLFPEVNYTTMDDYLKIFL  309



>sp|P93143.1|PILR1_FORIN RecName: Full=Bifunctional pinoresinol-lariciresinol reductase; 
Short=PLR-Fi1; Short=PLR3; AltName: Full=(+)-lariciresinol 
reductase; AltName: Full=(+)-pinoresinol reductase [Forsythia 
x intermedia]
 gb|AAC49608.1| (+)-pinoresinol/(+)-lariciresinol reductase [Forsythia x intermedia]
Length=312

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 50/59 (85%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LAS+K++EY  +VG+  Y+ + Y+GCLT+FEIGD+ EEAS+LYPEV YT ++EYLKRY+
Sbjct  255  LASVKELEYAQQVGLSHYHDVNYQGCLTSFEIGDE-EEASKLYPEVKYTSVEEYLKRYV  312



>sp|B5KRH5.1|PILR1_LINCY RecName: Full=Bifunctional pinoresinol-lariciresinol reductase; 
Short=PLR-Lc1; AltName: Full=(+)-lariciresinol reductase.; 
AltName: Full=(+)-pinoresinol reductase [Linum corymbulosum]
 gb|ABW86959.1| (+)-pinoresinol-(+)-lariciresinol reductase [Linum corymbulosum]
Length=315

 Score = 76.6 bits (187),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+MK+ +Y  +VG+  YYH+ YEGCLTNFE+  D +EAS+LYP+V YT ++EYLKRY+
Sbjct  258  LAAMKEQDYAEQVGLTHYYHVCYEGCLTNFEVEQD-QEASKLYPDVRYTTVEEYLKRYV  315



>gb|AEA42007.1| pinoresinol-lariciresinol reductase [Isatis tinctoria]
Length=317

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA ++D E   + G+  +YHIFYEGCLT+ E+GDD EEAS+LYP+V YTRMDEYLK +L
Sbjct  260  LADIEDKEIPHQAGLGHFYHIFYEGCLTDHEVGDD-EEASKLYPDVKYTRMDEYLKIFL  317



>ref|XP_010440554.1| PREDICTED: pinoresinol reductase 2-like [Camelina sativa]
Length=193

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA ++D E   + G+  +YHI+YEGCLT+ E+GDD EEAS+LYPEV YTRMDEYLK ++
Sbjct  136  LADIEDKEIAHQAGLGHFYHIYYEGCLTDHEVGDD-EEASKLYPEVKYTRMDEYLKIFV  193



>ref|XP_002870365.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46624.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=317

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA ++D E   + GV  +YHI+YEGCLT+ E+GDD EEAS+LYPEV YTRMDEYLK ++
Sbjct  260  LADIEDKEIPHQAGVGHFYHIYYEGCLTDHEVGDD-EEASKLYPEVKYTRMDEYLKIFV  317



>ref|XP_004241768.1| PREDICTED: bifunctional pinoresinol-lariciresinol reductase-like 
[Solanum lycopersicum]
Length=311

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA M++++Y  +VG+  YYH+ YEGCL NFEIG++ EEAS LYPEV YT  ++Y+KRYL
Sbjct  254  LAPMEELKYAEQVGLCHYYHVCYEGCLANFEIGEE-EEASTLYPEVKYTTAEQYMKRYL  311



>ref|XP_010518923.1| PREDICTED: pinoresinol reductase 1 [Tarenaya hassleriana]
Length=326

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA MK  +   + G+  +YHIFYEGCL N+E+GDD +EAS+LYP+V YTRMD+YL+ +L
Sbjct  269  LAGMKHSDKAQQAGIGHFYHIFYEGCLANYEVGDD-QEASKLYPDVKYTRMDDYLRMFL  326



>ref|XP_010440553.1| PREDICTED: pinoresinol reductase 2-like isoform X4 [Camelina 
sativa]
Length=317

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA ++D E   + G+  +YHI+YEGCLT+ E+GDD EEAS+LYPEV YTRMDEYLK ++
Sbjct  260  LADIEDKEIAHQAGLGHFYHIYYEGCLTDHEVGDD-EEASKLYPEVKYTRMDEYLKIFV  317



>ref|XP_010440550.1| PREDICTED: pinoresinol reductase 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010440551.1| PREDICTED: pinoresinol reductase 2-like isoform X2 [Camelina 
sativa]
 ref|XP_010440552.1| PREDICTED: pinoresinol reductase 2-like isoform X3 [Camelina 
sativa]
Length=317

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA ++D E   + G+  +YHI+YEGCLT+ E+GDD EEAS+LYPEV YTRMDEYLK ++
Sbjct  260  LADIEDKEIAHQAGLGHFYHIYYEGCLTDHEVGDD-EEASKLYPEVKYTRMDEYLKIFV  317



>gb|ACD35472.1| pinoresinol-lariciresinol reductase, partial [Phyllanthus amarus]
Length=97

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRM  345
            L SMK M+  G+ GV   YHI+YEGCLTNFEIG+DG EAS LYP+V YT M
Sbjct  47   LDSMKGMDIAGQAGVGHLYHIYYEGCLTNFEIGEDGVEASHLYPDVKYTTM  97



>ref|XP_009335318.1| PREDICTED: isoflavone reductase homolog isoform X2 [Pyrus x bretschneideri]
Length=308

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDG-EEASQLYPEVHYTRMDEYLKRY  324
            LASMK     G+VGV  +YHIFYEG LTNFEI  +G EEAS+LYPEV YTRMDEYLK Y
Sbjct  254  LASMK-----GQVGVGHFYHIFYEGDLTNFEIEGEGVEEASKLYPEVKYTRMDEYLKLY  307



>ref|XP_004144407.1| PREDICTED: isoflavone reductase homolog [Cucumis sativus]
Length=309

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA ++D++   + G   +Y IF+EGCLTNFEIG+  EEAS+L+PEV+YT MD+YLK +L
Sbjct  251  LAKIEDLDEAQQSGAGHFYDIFFEGCLTNFEIGEGAEEASKLFPEVNYTTMDDYLKIFL  309



>ref|XP_004168032.1| PREDICTED: LOW QUALITY PROTEIN: isoflavone reductase homolog 
[Cucumis sativus]
Length=309

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA ++D++   + G   +Y IF+EGCLTNFEIG+  EEAS+L+PEV+YT MD+YLK +L
Sbjct  251  LAKIEDLDEAQQSGAGHFYDIFFEGCLTNFEIGEGAEEASKLFPEVNYTTMDDYLKIFL  309



>ref|XP_010435236.1| PREDICTED: pinoresinol reductase 2 [Camelina sativa]
Length=317

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA ++D E   + G+  +YHI+YEGCLT+ E+GDD EEAS+LYP+V YTRMDEYLK ++
Sbjct  260  LADIEDKEIAHQAGLGHFYHIYYEGCLTDHEVGDD-EEASKLYPDVKYTRMDEYLKIFV  317



>gb|AAF64185.1|AF242502_1 pinoresinol-lariciresinol reductase TH2 [Tsuga heterophylla]
Length=309

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA ++D  Y  +VG+  +Y +FY G L NFEIG DG EA+ LYPEV YT MD YLKRYL
Sbjct  251  LAGIEDQPYEHQVGISHFYQMFYSGDLYNFEIGPDGREATMLYPEVQYTTMDSYLKRYL  309



>gb|AAF64184.1|AF242501_1 pinoresinol-lariciresinol reductase TH1 [Tsuga heterophylla]
Length=265

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA ++D  Y  +VG+  +Y +FY G L NFEIG DG EA+ LYPEV YT MD YLKRYL
Sbjct  207  LAGIEDQPYEHQVGISHFYQMFYSGDLYNFEIGPDGREATVLYPEVQYTTMDSYLKRYL  265



>ref|XP_010540735.1| PREDICTED: pinoresinol reductase 1-like [Tarenaya hassleriana]
Length=325

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 48/59 (81%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L++MK ME   + G+  +YHI+YEGCLT++E+G+D EEAS+LYP+V YTRMD YL+ +L
Sbjct  268  LSNMKYMEKAEQAGIGHFYHIYYEGCLTDYEVGED-EEASKLYPQVKYTRMDHYLRIFL  325



>ref|XP_008390912.1| PREDICTED: isoflavone reductase homolog [Malus domestica]
Length=313

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 47/59 (80%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNF-EIGDDGEEASQLYPEVHYTRMDEYLKRY  324
            LASMK M+Y G+VGV  +YHIFYEG LTNF   G+  EEAS+LYPEV YTRMDEYLK Y
Sbjct  254  LASMKGMDYAGQVGVGHFYHIFYEGDLTNFEVEGEGVEEASKLYPEVKYTRMDEYLKLY  312



>gb|AFK38057.1| unknown [Lotus japonicus]
Length=112

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L+S++   Y  +VG+I YYH+ +EGC TNFEIG++  EA +LYPE+ YT + +Y+KRY+
Sbjct  54   LSSLEGQAYAEQVGLIHYYHVCFEGCPTNFEIGEEEVEACELYPEIKYTTVHDYMKRYV  112



>gb|ABY75535.2| pinoresinol-lariciresinol reductase [Sinopodophyllum hexandrum]
Length=311

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA MK + +  + G+  YYH+ YEGCLTNFE+ +DG +AS+LYP+V+YT + EYLKRYL
Sbjct  254  LALMKGLSHGHQAGLTHYYHVSYEGCLTNFEV-EDGVDASKLYPQVNYTTVSEYLKRYL  311



>gb|AFK36279.1| unknown [Lotus japonicus]
Length=312

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L+S++   Y  +VG+I YYH+ +EGCLTNFEIG++  EA +LYPE+ YT + +Y+KRY+
Sbjct  254  LSSLEGQAYAEQVGLIHYYHVCFEGCLTNFEIGEEEVEACELYPEIKYTTVHDYMKRYV  312



>gb|ACF71492.1| pinoresinol-lariciresinol reductase [Sinopodophyllum hexandrum]
Length=311

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA MK + +  + G+  YYH+ YEGCLTNFE+ +DG +AS+LYP+V+YT + EYLKRYL
Sbjct  254  LALMKGLSHGHQAGLTHYYHVSYEGCLTNFEV-EDGVDASKLYPQVNYTTVSEYLKRYL  311



>ref|XP_008390915.1| PREDICTED: isoflavone reductase homolog isoform X2 [Malus domestica]
Length=308

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 45/59 (76%), Gaps = 6/59 (10%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDG-EEASQLYPEVHYTRMDEYLKRY  324
            LASMK     G+VGV  +YHIFYEG LTNFEI  +G EEAS+LY EV YTRMDEYLK Y
Sbjct  254  LASMK-----GQVGVGHFYHIFYEGNLTNFEIEGEGVEEASKLYSEVKYTRMDEYLKLY  307



>ref|NP_174490.1| pinoresinol reductase 1 [Arabidopsis thaliana]
 sp|Q9FVQ6.1|PILR1_ARATH RecName: Full=Pinoresinol reductase 1; Short=AtPrR1; AltName: 
Full=(+)-pinoresinol reductase; AltName: Full=(-)-pinoresinol 
reductase; AltName: Full=Pinoresinol-lariciresinol reductase 
1; Short=AtPLR1 [Arabidopsis thaliana]
 gb|AAG23447.1|AC084165_13 pinoresinol-lariciresinol reductase, putative [Arabidopsis thaliana]
 gb|AAL38690.1| putative pinoresinol-lariciresinol reductase [Arabidopsis thaliana]
 gb|AAM20170.1| putative pinoresinol-lariciresinol reductase [Arabidopsis thaliana]
 gb|AEE31436.1| pinoresinol reductase 1 [Arabidopsis thaliana]
Length=317

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+++ ME   + G+  +YHIFYEGCLT+ E+G+D EEAS LYP+V Y RMD+YL+ +L
Sbjct  260  LANIEQMEIPHQAGIGHFYHIFYEGCLTDHEVGED-EEASSLYPDVKYKRMDDYLRMFL  317



>ref|XP_006305387.1| hypothetical protein CARUB_v10009780mg [Capsella rubella]
 gb|EOA38285.1| hypothetical protein CARUB_v10009780mg [Capsella rubella]
Length=318

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+++ ME   + G+  +YHIFYEGCLT+ ++G+D EEAS LYPEV Y RMD+YL+ +L
Sbjct  261  LANIEQMEIPHQAGIGHFYHIFYEGCLTDHDVGED-EEASSLYPEVKYRRMDDYLRMFL  318



>ref|XP_002893700.1| hypothetical protein ARALYDRAFT_473393 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69959.1| hypothetical protein ARALYDRAFT_473393 [Arabidopsis lyrata subsp. 
lyrata]
Length=317

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+++ ME   + G+  +YHIFYEGCLT+ E+G+D EEAS LYP+V Y RMD+YL+ +L
Sbjct  260  LANIEQMEIPHQAGIGHFYHIFYEGCLTDHEVGED-EEASSLYPDVKYKRMDDYLRLFL  317



>gb|KHN11848.1| Isoflavone reductase like [Glycine soja]
Length=322

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPE  363
            LAS+K ++Y  +VGV  +YHIFYEGCLTNFEIG+ GEEAS+LYPE
Sbjct  254  LASIKGLDYAAQVGVGHFYHIFYEGCLTNFEIGEGGEEASELYPE  298



>gb|KFK36255.1| hypothetical protein AALP_AA4G098500 [Arabis alpina]
Length=321

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 45/57 (79%), Gaps = 1/57 (2%)
 Frame = -2

Query  491  SMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            + KD E + ++ +   YH+FYEGCLT+ E+GDD EEAS+LYP+V YTRMDEYLK +L
Sbjct  266  TKKDKEILQQIVLGHLYHLFYEGCLTDHEVGDD-EEASKLYPDVKYTRMDEYLKIFL  321



>ref|XP_010540727.1| PREDICTED: pinoresinol reductase 1-like [Tarenaya hassleriana]
Length=327

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = -2

Query  497  LASMKDMEYVG-KVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L++MK ++  G K G+ F +H+FYEGCLTNF +G+D EEAS LYP+V YTRM +YL+ +L
Sbjct  269  LSNMKHLDNKGQKAGIGFMFHLFYEGCLTNFHVGED-EEASSLYPDVKYTRMVDYLRMFL  327



>ref|XP_010653663.1| PREDICTED: bifunctional pinoresinol-lariciresinol reductase 2-like 
[Vitis vinifera]
Length=116

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLK  330
            L +MK   Y   VG    YH+FY+GC  NFEIGD  EEASQLYPE+ YT + E++K
Sbjct  54   LTNMKTQNYAVLVGSTHCYHVFYDGCHANFEIGDGAEEASQLYPEIKYTTVHEHMK  109



>gb|AAM64780.1| pinoresinol-lariciresinol reductase, putative [Arabidopsis thaliana]
Length=317

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA ++ ME   + G+  +YHIFYEGCLT+ E+G+D EEAS LYP+V Y RMD+YL+ +L
Sbjct  260  LAHIEQMEIPHQAGIGHFYHIFYEGCLTDHEVGED-EEASSLYPDVKYKRMDDYLRMFL  317



>emb|CDY29935.1| BnaC05g29010D [Brassica napus]
Length=229

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+++ ME   + G+  +YHIFYEGCLT+ ++G+D EEAS LYP+V Y RMD+YL+ +L
Sbjct  172  LANIEHMEIPHQAGIGHFYHIFYEGCLTDHKVGED-EEASSLYPDVKYRRMDDYLRMFL  229



>gb|ABV02071.1| Isoflavone reductase [Fagopyrum cymosum]
Length=313

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 2/60 (3%)
 Frame = -2

Query  497  LASMK-DMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  MK D++YV +V +   YHIF +GCLTNF++ +D EEAS+LYPEV+Y RMDE+LK Y+
Sbjct  253  LLDMKGDVDYVTQVIICRVYHIFIDGCLTNFKVAED-EEASKLYPEVNYKRMDEFLKIYI  311



>ref|XP_006285396.1| hypothetical protein CARUB_v10006801mg [Capsella rubella]
 gb|EOA18294.1| hypothetical protein CARUB_v10006801mg [Capsella rubella]
Length=322

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA ++D E   + G+  +YHI+YEGCLT+ E+GDD EEAS+LYP+V YTRM EYLK ++
Sbjct  265  LADIEDKEISHQAGLGHFYHIYYEGCLTDHEVGDD-EEASKLYPDVKYTRMHEYLKIFV  322



>ref|XP_010450179.1| PREDICTED: pinoresinol reductase 2-like [Camelina sativa]
Length=317

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA +++ E   + G+  +YHI+YEGCLT+ E+ DD EEAS+LYP+V YTRMDEYLK +L
Sbjct  260  LADIEEKEIAHQAGLGHFYHIYYEGCLTDHEVRDD-EEASKLYPDVKYTRMDEYLKIFL  317



>ref|NP_193102.1| pinoresinol reductase 2 [Arabidopsis thaliana]
 sp|Q9SVP6.1|PILR2_ARATH RecName: Full=Pinoresinol reductase 2; Short=AtPrR2; AltName: 
Full=(-)-pinoresinol reductase; AltName: Full=Pinoresinol-lariciresinol 
reductase 2; Short=AtPLR2 [Arabidopsis thaliana]
 emb|CAB36830.1| isoflavone reductase-like protein [Arabidopsis thaliana]
 emb|CAB78408.1| isoflavone reductase-like protein [Arabidopsis thaliana]
 gb|AAO22699.1| putative pinoresinol-lariciresinol reductase [Arabidopsis thaliana]
 gb|AAO42400.1| putative pinoresinol-lariciresinol reductase [Arabidopsis thaliana]
 gb|AEE83310.1| pinoresinol reductase 2 [Arabidopsis thaliana]
Length=317

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA ++D E   + G+  +YHI+YEGCLT+ E+GDD EEA++LYP+V Y RMDEYLK ++
Sbjct  260  LADIEDKEISHQAGLGHFYHIYYEGCLTDHEVGDD-EEATKLYPDVKYKRMDEYLKIFV  317



>emb|CDY59205.1| BnaA09g53990D, partial [Brassica napus]
Length=226

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L++++ ME   + G+  +YHIFYEGCLT+ E+G+D EEAS LYP+V Y RMD+YL+ +L
Sbjct  169  LSNIEHMEIPQQAGLGHFYHIFYEGCLTDHEVGED-EEASSLYPDVKYKRMDDYLRMFL  226



>ref|NP_001241204.1| uncharacterized protein LOC100780465 [Glycine max]
 gb|ACU21298.1| unknown [Glycine max]
 gb|KHN11847.1| Isoflavone reductase like [Glycine soja]
Length=312

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L+SM+   Y  +VG+  YYH+ +EGCLTNFEIG++G EA  LYP++ YT + +++KRY+
Sbjct  254  LSSMEGQPYEQQVGMGHYYHVCFEGCLTNFEIGEEGVEACGLYPQIKYTTVQDFMKRYV  312



>ref|XP_010461029.1| PREDICTED: pinoresinol reductase 1-like [Camelina sativa]
Length=336

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+++ ME   +  +  +YHIFYEGCLT+ E+G+D EEAS LYP+V Y RMD+YL+ YL
Sbjct  279  LANIEQMEISHQAAIGHFYHIFYEGCLTDHEVGED-EEASCLYPDVQYKRMDDYLRMYL  336



>emb|CDY22584.1| BnaC05g24220D [Brassica napus]
Length=345

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L++++ ME   + G+  +YHIFYEGCLT+ E+G+D EEAS LYP+V Y RMD+YL+ +L
Sbjct  260  LSNIEHMEIPQQAGIGHFYHIFYEGCLTDHEVGED-EEASSLYPDVKYKRMDDYLRMFL  317



>ref|XP_006415251.1| hypothetical protein EUTSA_v10008239mg [Eutrema salsugineum]
 gb|ESQ33604.1| hypothetical protein EUTSA_v10008239mg [Eutrema salsugineum]
Length=317

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L +++ ME   + G+  +YHIFYEGCLT+ E+G+D EEAS LYP+V Y RMD+YLK +L
Sbjct  260  LTNIEQMEIPHQAGIGHFYHIFYEGCLTDHEVGED-EEASCLYPDVKYKRMDDYLKMFL  317



>ref|XP_009145209.1| PREDICTED: pinoresinol reductase 1 [Brassica rapa]
 emb|CDY35543.1| BnaA05g16430D [Brassica napus]
Length=317

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+++ ME   + G+  +YHIFYEGCLT+ ++G+D EEAS LYP+V Y RMD+YL+ +L
Sbjct  260  LANIEHMEIPHQAGIGHFYHIFYEGCLTDHKVGED-EEASSLYPDVKYKRMDDYLRMFL  317



>ref|XP_006305386.1| hypothetical protein CARUB_v10009778mg [Capsella rubella]
 gb|EOA38284.1| hypothetical protein CARUB_v10009778mg [Capsella rubella]
Length=318

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+++ ME   + G+  +YHIFYEGCLT+ ++G+D EEAS LYPEV Y  MD+YL+ YL
Sbjct  261  LANIEQMEIPHQAGIGHFYHIFYEGCLTDHDVGED-EEASSLYPEVEYKSMDDYLRIYL  318



>ref|XP_009114918.1| PREDICTED: pinoresinol reductase 1-like [Brassica rapa]
Length=317

 Score = 69.7 bits (169),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 46/59 (78%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L++++ ME   + G+  +YHIFYEGCLT+ E+G+D EEAS LYP+V Y RMD+YL+ +L
Sbjct  260  LSNIEHMEIPQQAGLGHFYHIFYEGCLTDHEVGED-EEASSLYPDVKYKRMDDYLRMFL  317



>sp|A3R052.1|PILR1_LINPE RecName: Full=Bifunctional pinoresinol-lariciresinol reductase; 
Short=PLR-Lp1; AltName: Full=(+)-pinoresinol reductase; AltName: 
Full=(-)-lariciresinol reductase [Linum perenne]
 gb|ABM68630.1| pinoresinol-lariciresinol reductase [Linum perenne]
Length=314

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 43/61 (70%), Gaps = 2/61 (3%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDG--EEASQLYPEVHYTRMDEYLKRY  324
            LA M+      + G+  +YHIFYEGCLTNFEI  +   EEAS+LYPEV YTR+ +YLK Y
Sbjct  254  LALMEGTTVAEQAGIGHFYHIFYEGCLTNFEINAENGEEEASRLYPEVEYTRVHDYLKIY  313

Query  323  L  321
            L
Sbjct  314  L  314



>sp|Q9LD13.1|PILR2_THUPL RecName: Full=Bifunctional pinoresinol-lariciresinol reductase 
2; Short=PLR-Tp2; AltName: Full=(+)-lariciresinol reductase; 
AltName: Full=(+)-pinoresinol reductase; AltName: Full=(-)-pinoresinol 
reductase [Thuja plicata]
 gb|AAF63508.1|AF242504_1 pinoresinol-lariciresinol reductase [Thuja plicata]
Length=312

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA M+   Y  ++G+  +Y +FY G L NFEIG +G EASQLYPEV YT +D Y++RYL
Sbjct  254  LAGMEGQSYGEQIGISHFYQMFYRGDLYNFEIGPNGVEASQLYPEVKYTTVDSYMERYL  312



>emb|CBI32845.3| unnamed protein product [Vitis vinifera]
Length=331

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLK  330
            L +MK   Y   VG    YH+FY+GC  NFEIGD  EEASQLYPE+ YT + E++K
Sbjct  269  LTNMKTQNYAVLVGSTHCYHVFYDGCHANFEIGDGAEEASQLYPEIKYTTVHEHMK  324



>ref|XP_010478629.1| PREDICTED: pinoresinol reductase 1-like [Camelina sativa]
Length=318

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+++ ME   +  +  +YHIFYEGCLT+ E+G++ EEA  LYPEV Y RMD+YL+ YL
Sbjct  261  LANIEQMEIPQQAAIGHFYHIFYEGCLTDHEVGEE-EEAISLYPEVMYKRMDDYLRMYL  318



>sp|Q9LD12.1|PILR4_THUPL RecName: Full=Bifunctional pinoresinol-lariciresinol reductase; 
Short=PLR-TP4; AltName: Full=(+)-lariciresinol reductase; 
AltName: Full=(+)-pinoresinol reductase [Thuja plicata]
 gb|AAF63510.1|AF242506_1 pinoresinol-lariciresinol reductase [Thuja plicata]
Length=312

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA M+   Y  K+G+  +Y +FY+G L NFEIG +G EASQLYP V YT +D Y++RYL
Sbjct  254  LAGMEGQSYGEKIGISHFYQMFYKGDLYNFEIGPNGVEASQLYPGVKYTTVDSYMERYL  312



>emb|CAN82074.1| hypothetical protein VITISV_036539 [Vitis vinifera]
Length=312

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASM+  ++  +VGV  +YHI+YEGCLTNFEIG++GEEA+ LYPEV+Y RMDEYLK Y+
Sbjct  254  LASMEGKDFALQVGVAHFYHIYYEGCLTNFEIGEEGEEAATLYPEVNYKRMDEYLKLYV  312



>ref|XP_010664849.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera]
 ref|XP_010664853.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera]
 ref|XP_010664856.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera]
 ref|XP_010664858.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera]
 ref|XP_010664861.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera]
 ref|XP_010664866.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera]
 ref|XP_010664868.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera]
 ref|XP_010664871.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera]
 ref|XP_010664875.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera]
 ref|XP_010664879.1| PREDICTED: isoflavone reductase homolog [Vitis vinifera]
 emb|CBI37387.3| unnamed protein product [Vitis vinifera]
Length=312

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LASM+  ++  +VGV  +YHI+YEGCLTNFEIG++GEEA+ LYPEV+Y RMDEYLK Y+
Sbjct  254  LASMEGKDFALQVGVAHFYHIYYEGCLTNFEIGEEGEEAATLYPEVNYKRMDEYLKLYV  312



>ref|XP_010499755.1| PREDICTED: pinoresinol reductase 1 [Camelina sativa]
Length=318

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L +++ ME   + G+  +YHIFYEGCLT+ E+G+D EEAS LYP+V Y RM +YL+ +L
Sbjct  261  LTNIEQMEIPHQAGIGHFYHIFYEGCLTDHEVGED-EEASSLYPDVKYKRMVDYLRMFL  318



>gb|KFK36256.1| hypothetical protein AALP_AA4G098600 [Arabis alpina]
Length=299

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 37/42 (88%), Gaps = 1/42 (2%)
 Frame = -2

Query  446  YYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            +YHIFYEGCLT+ E+ DD +EAS+LYP+V YTRMDEYLK +L
Sbjct  259  FYHIFYEGCLTDHEVRDD-DEASKLYPDVKYTRMDEYLKMFL  299



>ref|XP_010478630.1| PREDICTED: pinoresinol reductase 1-like [Camelina sativa]
Length=318

 Score = 66.2 bits (160),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+++ ME   + G+  +YHIFYEGCLT+ E+G+D EEAS LYP+V Y RM +YL+ +L
Sbjct  261  LANIEQMEIPHQAGIGHFYHIFYEGCLTDHEVGED-EEASCLYPDVKYKRMFDYLRMFL  318



>ref|XP_006415253.1| hypothetical protein EUTSA_v10009995mg [Eutrema salsugineum]
 gb|ESQ33606.1| hypothetical protein EUTSA_v10009995mg [Eutrema salsugineum]
Length=317

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA+++ ME   +  +  +YHIFYEG LT+ ++G+D EEAS LYP+V Y RMDEYL+ +L
Sbjct  260  LANIEQMEPSHQAAIGNFYHIFYEGSLTDHDVGED-EEASTLYPDVKYKRMDEYLRMFL  317



>gb|ADM76443.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76444.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76445.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76446.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76447.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76448.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76449.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76450.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76451.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76452.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76453.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76454.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76455.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76456.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76457.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76458.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76459.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76460.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76461.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76462.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76463.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76464.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76465.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76466.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76467.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76468.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76469.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76470.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76471.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76472.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76473.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76474.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76475.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76476.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76477.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76478.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76479.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76480.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76481.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76482.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76483.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76484.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76485.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76486.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76487.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM76488.1| isoflavone reductase-like protein, partial [Picea sitchensis]
Length=61

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  + D  +   +G+   + IF +G  TNFEIG DG EA+QLYP+V YT +DEYL +++
Sbjct  3    LKLIADTPFPDNIGIAIGHSIFVKGDQTNFEIGPDGVEATQLYPDVKYTTVDEYLSKFV  61



>gb|ADM78154.1| isoflavone reductase-like protein, partial [Picea sitchensis]
Length=135

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  + +  + G +G+   + IF +G  TNFEIG DG EASQLYP+V YT +D+YL +++
Sbjct  77   LTLISETPFPGNIGIAIGHSIFVKGDQTNFEIGPDGVEASQLYPDVKYTTVDDYLNKFV  135



>gb|ADM78126.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78127.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78128.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78129.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78130.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78131.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78132.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78133.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78134.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78135.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78137.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78138.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78140.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78141.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78147.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78149.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78150.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78151.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78152.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78153.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78155.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78156.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78157.1| isoflavone reductase-like protein, partial [Picea sitchensis]
Length=135

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  + +  + G +G+   + IF +G  TNFEIG DG EASQLYP+V YT +D+YL +++
Sbjct  77   LTLISETPFPGNIGIAIGHSIFVKGDQTNFEIGPDGVEASQLYPDVKYTTVDDYLSKFV  135



>gb|AAF64179.1|AF242496_1 phenylcoumaran benzylic ether reductase homolog TH4 [Tsuga heterophylla]
Length=308

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  + D  +   +G+   + IF  G  TNFEIG DG EASQLYPEV YT +DEYL +++
Sbjct  250  LKLIADTPFPANIGIAIGHSIFVRGDQTNFEIGADGVEASQLYPEVQYTTVDEYLSKFV  308



>gb|AAF64176.1|AF242493_1 phenylcoumaran benzylic ether reductase homolog TH1 [Tsuga heterophylla]
Length=308

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  + D  +   +G+   + IF  G  TNFEIG DG EASQLYPEV YT +DEYL +++
Sbjct  250  LKLIADTPFPANIGIAIGHSIFVRGDQTNFEIGADGVEASQLYPEVQYTTVDEYLSKFV  308



>gb|EMT10363.1| Isoflavone reductase-like protein [Aegilops tauschii]
Length=446

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDG-EEASQLYPEVHYTRMDEYLKRYL  321
            LASM+  +   +VGV  Y+HIFYEGCLTNF IGDDG EE S LYP+    R   +L+R L
Sbjct  254  LASMEGTDLANQVGVGHYHHIFYEGCLTNFAIGDDGEEEGSLLYPK-RPRRDPRWLRRPL  312



>sp|Q9LD00.1|PILR3_THUPL RecName: Full=Bifunctional pinoresinol-lariciresinol reductase 
3; Short=PLR-TP3; AltName: Full=(-)-lariciresinol reductase; 
AltName: Full=(-)-pinoresinol reductase [Thuja plicata]
 gb|AAF63509.1|AF242505_1 pinoresinol-lariciresinol reductase [Thuja plicata]
 gb|AAF64183.1|AF242500_1 phenylcoumaran benzylic ether reductase homolog Tp1 [Thuja plicata]
Length=314

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L +MKD  YV K+     YH F +G L NFEIG +  E ++LYPEV YT MD Y++RYL
Sbjct  256  LLNMKDKSYVEKMARCHLYHFFIKGDLYNFEIGPNATEGTKLYPEVKYTTMDSYMERYL  314



>gb|ADM78136.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78144.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78145.1| isoflavone reductase-like protein, partial [Picea sitchensis]
Length=135

 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  + +  + G +G+   + IF +G  TNF+IG DG EASQLYP+V YT +D+YL +++
Sbjct  77   LTLISETPFPGNIGIAIGHSIFVKGDQTNFKIGPDGVEASQLYPDVKYTTVDDYLSKFV  135



>gb|ADM78148.1| isoflavone reductase-like protein, partial [Picea sitchensis]
Length=135

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  + +  + G +G+   + IF +G  TNF+IG DG EASQLYP+V YT +D+YL +++
Sbjct  77   LTLISETPFPGNIGIAIGHSIFVKGDQTNFKIGPDGVEASQLYPDVKYTTVDDYLSKFV  135



>gb|ABK21730.1| unknown [Picea sitchensis]
Length=308

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  + +  + G +G+   + IF +G  TNFEIG DG EASQLYP+V YT +D+YL +++
Sbjct  250  LTLISETPFPGNIGIAIGHSIFVKGDQTNFEIGPDGVEASQLYPDVKYTTVDDYLSKFV  308



>gb|ADM78142.1| isoflavone reductase-like protein, partial [Picea sitchensis]
 gb|ADM78143.1| isoflavone reductase-like protein, partial [Picea sitchensis]
Length=135

 Score = 60.8 bits (146),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  + +  +   +G+   + IF +G  TNFEIG DG EASQLYP+V YT +D+YL +++
Sbjct  77   LTLISETPFPANIGIAIGHSIFVKGDQTNFEIGPDGVEASQLYPDVKYTTVDDYLSKFV  135



>ref|XP_006414867.1| hypothetical protein EUTSA_v10026944mg [Eutrema salsugineum]
 gb|ESQ56320.1| hypothetical protein EUTSA_v10026944mg [Eutrema salsugineum]
Length=301

 Score = 62.8 bits (151),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = -2

Query  485  KDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            KD     + G+  +YHIFYEGCLT+ E+ DD +E S+LYP+V YTRMDE LK ++
Sbjct  248  KDKGIAHQAGLGHFYHIFYEGCLTDHEVRDD-DEVSRLYPDVKYTRMDESLKIFI  301



>gb|ADM78146.1| isoflavone reductase-like protein, partial [Picea sitchensis]
Length=135

 Score = 60.5 bits (145),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  + +  + G +G+   + IF +G  T+FEIG DG EASQLYP+V YT +D+YL +++
Sbjct  77   LTLIAETPFPGNIGIAIGHSIFVKGDQTSFEIGPDGVEASQLYPDVKYTTVDDYLSKFV  135



>gb|KFK44973.1| hypothetical protein AALP_AA1G327300 [Arabis alpina]
Length=317

 Score = 62.8 bits (151),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA++  +E   + G+  +YHIFYEG LT++ +G++ EEAS LYPEV Y RMD+YL+ +L
Sbjct  260  LANIDQLEIPHQAGIGHFYHIFYEGSLTDYHVGEE-EEASCLYPEVKYKRMDDYLRIFL  317



>gb|ABK22612.1| unknown [Picea sitchensis]
Length=308

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  + D  +   +G+   + IF +G  TNFEIG DG EA+QLYP+V YT +DEYL +++
Sbjct  250  LKLIADTPFPDNIGIAIGHSIFVKGDQTNFEIGPDGVEATQLYPDVKYTTVDEYLSKFV  308



>sp|Q9LD14.1|PILR1_THUPL RecName: Full=Bifunctional pinoresinol-lariciresinol reductase 
1; Short=PLR-Tp1; AltName: Full=(+)-pinoresinol reductase; 
AltName: Full=(-)-lariciresinol reductase; AltName: Full=(-)-pinoresinol 
reductase [Thuja plicata]
 pdb|1QYD|A Chain A, Crystal Structures Of Pinoresinol-Lariciresinol And 
Phenylcoumaran Benzylic Ether Reductases, And Their Relationship 
To Isoflavone Reductases
 pdb|1QYD|B Chain B, Crystal Structures Of Pinoresinol-Lariciresinol And 
Phenylcoumaran Benzylic Ether Reductases, And Their Relationship 
To Isoflavone Reductases
 pdb|1QYD|C Chain C, Crystal Structures Of Pinoresinol-Lariciresinol And 
Phenylcoumaran Benzylic Ether Reductases, And Their Relationship 
To Isoflavone Reductases
 pdb|1QYD|D Chain D, Crystal Structures Of Pinoresinol-Lariciresinol And 
Phenylcoumaran Benzylic Ether Reductases, And Their Relationship 
To Isoflavone Reductases
 gb|AAF63507.1|AF242503_1 pinoresinol-lariciresinol reductase [Thuja plicata]
Length=313

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            LA MKD  Y  K+     Y IF+ G L NFEIG +  EA++LYPEV Y  MD YL+RY+
Sbjct  255  LADMKDKSYEEKIVRCHLYQIFFRGDLYNFEIGPNAIEATKLYPEVKYVTMDSYLERYV  313



>emb|CCC55425.1| phenylcoumaran benzylic ether reductase [Pinus pinaster]
Length=308

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  + +  + G +G+   + IF +G  TNFEIG DG EASQLYP+V YT + EYL +++
Sbjct  250  LTLIAETPFPGNIGIAIGHSIFVKGDQTNFEIGPDGVEASQLYPDVKYTTVAEYLSKFV  308



>gb|ADM78139.1| isoflavone reductase-like protein, partial [Picea sitchensis]
Length=135

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  + +  + G +G+   + IF +G  TNFEIG DG EASQLY +V YT +D+YL +++
Sbjct  77   LTLISETPFPGNIGIAIGHSIFVKGDQTNFEIGPDGVEASQLYTDVKYTTVDDYLSKFV  135



>sp|P0DKC8.1|PILR_LINUS RecName: Full=Bifunctional pinoresinol-lariciresinol reductase; 
Short=LuPLR; Short=LuPLR1 [Linum usitatissimum]
Length=312

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 2/61 (3%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGE--EASQLYPEVHYTRMDEYLKRY  324
            LA M+  +   ++ +   YHI+YEGCLTNF+I  D +  EAS LYPEV YTRM +YL  Y
Sbjct  252  LALMEGKDVAEQIVIGHLYHIYYEGCLTNFDIDADQDQVEASSLYPEVEYTRMKDYLMIY  311

Query  323  L  321
            L
Sbjct  312  L  312



>gb|ABK23449.1| unknown [Picea sitchensis]
Length=308

 Score = 60.1 bits (144),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = -2

Query  488  MKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            + +  +   + +   + IF +G  TNFEIG DG EASQLYP+V YT +DEYL +++
Sbjct  253  ISETPFPANISLAISHSIFVKGDQTNFEIGPDGVEASQLYPDVKYTTVDEYLSKFV  308



>gb|ABK23528.1| unknown [Picea sitchensis]
Length=308

 Score = 59.7 bits (143),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -2

Query  488  MKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            + +  +   +     + IF +G  TNFEIG DG EASQLYP+V YT +DEYL +++
Sbjct  253  IAETPFPANISTAISHSIFVKGDQTNFEIGPDGVEASQLYPDVKYTTVDEYLSKFV  308



>gb|AAF64182.1|AF242499_1 phenylcoumaran benzylic ether reductase homolog TH7 [Tsuga heterophylla]
Length=308

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  + +  + G + +   + IF +G  TNFEIG DG EAS+LYP+V YT +DEYL +++
Sbjct  250  LKLIAETPFPGNISIAIRHSIFVKGDQTNFEIGPDGVEASELYPDVKYTTVDEYLIKFV  308



>gb|ABR16287.1| unknown [Picea sitchensis]
Length=307

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  + +  +   VG+   + IF +G  TNFEIG DG EASQLYP+V YT ++E+L +Y+
Sbjct  249  LKKIAETPFPDNVGMAIEHSIFVKGDQTNFEIGPDGVEASQLYPDVKYTTVEEFLSQYI  307



>gb|AGG40646.1| isoflavone reductase-like protein [Ginkgo biloba]
Length=306

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L ++ +  + G + +   + IF +G  TNFEIGD+G E S+LYP+V YT +DEYL +++
Sbjct  248  LKTIAETPFPGNIIISIAHSIFVKGDQTNFEIGDNGVEGSELYPDVKYTTVDEYLNQFV  306



>gb|ACN41153.1| unknown [Picea sitchensis]
Length=268

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  + D  +   +G+   + IF +   TNFEIG DG EA+QLYP+V YT +DEYL +++
Sbjct  210  LKLIADTPFPDNIGIAIGHSIFVKRDQTNFEIGPDGVEATQLYPDVKYTTVDEYLSKFV  268



>pdb|1QYC|A Chain A, Crystal Structures Of Pinoresinol-Lariciresinol And 
Phenylcoumaran Benzylic Ether Reductases, And Their Relationship 
To Isoflavone Reductases
 pdb|1QYC|B Chain B, Crystal Structures Of Pinoresinol-Lariciresinol And 
Phenylcoumaran Benzylic Ether Reductases, And Their Relationship 
To Isoflavone Reductases
 gb|AAF64173.2|AF242490_1 phenylcoumaran benzylic ether reductase PT1 [Pinus taeda]
Length=308

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -2

Query  488  MKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            + D  +   + +   + IF +G  TNFEIG  G EASQLYP+V YT +DEYL  ++
Sbjct  253  IADTPFPANISIAISHSIFVKGDQTNFEIGPAGVEASQLYPDVKYTTVDEYLSNFV  308



>gb|AAC32591.1| phenylcoumaran benzylic ether reductase [Pinus taeda]
Length=308

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 35/56 (63%), Gaps = 0/56 (0%)
 Frame = -2

Query  488  MKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            + D  +   + +   + IF +G  TNFEIG  G EASQLYP+V YT +DEYL  ++
Sbjct  253  IADTPFPANISIAISHSIFVKGDQTNFEIGPAGVEASQLYPDVKYTTVDEYLSNFV  308



>gb|ABK26927.1| unknown [Picea sitchensis]
Length=308

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -2

Query  488  MKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            + +  +   +     + IF +G  TNFEIG DG EASQLYP+V YT +DEYL +++
Sbjct  253  IAETPFPTNISTAIRHSIFVKGDQTNFEIGPDGVEASQLYPDVKYTTVDEYLSKFV  308



>gb|ABK25478.1| unknown [Picea sitchensis]
 gb|ACN40761.1| unknown [Picea sitchensis]
 gb|ACN41065.1| unknown [Picea sitchensis]
Length=308

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/56 (43%), Positives = 36/56 (64%), Gaps = 0/56 (0%)
 Frame = -2

Query  488  MKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            + +  +   + +   + IF +G  TNFEIG DG E SQLYP+V YT +DEYL +++
Sbjct  253  IAETPFPANIVIAISHSIFVKGDQTNFEIGPDGAEGSQLYPDVKYTTVDEYLSKFV  308



>sp|Q4R0H9.1|PILR1_LINUS RecName: Full=Bifunctional pinoresinol-lariciresinol reductase 
1; Short=PLR-Lu1; AltName: Full=(-)-lariciresinol reductase.; 
AltName: Full=(-)-pinoresinol reductase [Linum usitatissimum]
 emb|CAH60858.1| pinoresinol-lariciresinol reductase [Linum usitatissimum]
Length=312

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 39/61 (64%), Gaps = 2/61 (3%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEI--GDDGEEASQLYPEVHYTRMDEYLKRY  324
            LA M+  +   +V +   YHI+YEGCLTNF+I    D  EAS LYPEV Y RM +YL  Y
Sbjct  252  LALMEGKDVAEQVVIGHLYHIYYEGCLTNFDIDAAQDQVEASSLYPEVEYIRMKDYLMIY  311

Query  323  L  321
            L
Sbjct  312  L  312



>gb|ABK23542.1| unknown [Picea sitchensis]
Length=303

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  449  FYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
             Y+  F +G  TNFEIG +G EA+QLYPEV YT +DEYL +++
Sbjct  261  LYHSTFVQGNQTNFEIGPNGVEATQLYPEVKYTTVDEYLNQFV  303



>gb|ABK21421.1| unknown [Picea sitchensis]
Length=303

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  449  FYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
             Y+  F +G  TNFEIG +G EA+QLYPEV YT +DEYL +++
Sbjct  261  LYHSTFVQGNQTNFEIGANGVEATQLYPEVKYTTVDEYLNQFV  303



>gb|AAF64180.1|AF242497_1 phenylcoumaran benzylic ether reductase homolog TP5 [Tsuga heterophylla]
Length=307

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  443  YHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            + IF +G  TNFEIG DG EASQLYPEV YT ++EYL +Y+
Sbjct  267  HSIFVKGDQTNFEIGPDGVEASQLYPEVKYTTVEEYLGQYV  307



>gb|AAF64181.1|AF242498_1 phenylcoumaran benzylic ether reductase homolog TH6 [Tsuga heterophylla]
Length=307

 Score = 57.0 bits (136),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  443  YHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            + IF +G  TNFEIG DG EASQLYPEV YT ++EYL +Y+
Sbjct  267  HSIFVKGDQTNFEIGPDGVEASQLYPEVKYTTVEEYLGQYV  307



>gb|ABK24786.1| unknown [Picea sitchensis]
Length=307

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  443  YHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            + IF +G  TNFEIG DG EASQLYPEV YT ++E+L +Y+
Sbjct  267  HSIFVKGDQTNFEIGPDGVEASQLYPEVKYTTVEEFLSQYV  307



>gb|ABK24213.1| unknown [Picea sitchensis]
Length=307

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  443  YHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            + IF +G  TNFEIG DG EASQLYPEV YT ++E+L +Y+
Sbjct  267  HSIFVKGDQTNFEIGPDGVEASQLYPEVKYTTVEEFLSQYV  307



>gb|AAK27264.1| isoflavone reductase-like protein CJP-6 [Cryptomeria japonica]
Length=306

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  ++D  + G   V  ++ I+ +G  TNF+IG DG EAS LYP+V YT ++EY+  ++
Sbjct  248  LKLLQDTPFPGTFMVSIFHTIYVKGDQTNFQIGPDGVEASALYPDVKYTTVEEYISAFV  306



>gb|ABF39004.1| phenylcoumaran benzylic ether reductase [Pinus strobus]
Length=308

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L  +++  + G + +   +  F +G  TNFEIG +G E SQLYP+V YT +DE+L  ++
Sbjct  250  LKIIEETPFPGNIIIAISHSTFVKGDHTNFEIGANGVEGSQLYPDVKYTTVDEFLNAFV  308



>gb|ABR16114.1| unknown [Picea sitchensis]
Length=319

 Score = 51.2 bits (121),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  443  YHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            +++F +G LTNFEIG  G EA+QLYP V Y+ ++++L RY+
Sbjct  279  HYVFMKGDLTNFEIGPHGAEATQLYPNVTYSTVEDFLSRYV  319



>emb|CCC55424.1| pinoresinol-lariciresinol reductase [Pinus pinaster]
Length=312

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 3/61 (5%)
 Frame = -2

Query  497  LASMKD--MEYVGKVGVIFYYHIFYEGCLTNFEIGDDGE-EASQLYPEVHYTRMDEYLKR  327
            LA M+D       KV +  +YHIFY G L NFE+    + EA+ LYP+V YT ++ YL R
Sbjct  251  LAPMEDESTSVQRKVEMAIFYHIFYRGELANFELNQSNQLEAATLYPDVEYTSVERYLSR  310

Query  326  Y  324
            +
Sbjct  311  F  311



>ref|XP_002978069.1| hypothetical protein SELMODRAFT_233106 [Selaginella moellendorffii]
 gb|EFJ20726.1| hypothetical protein SELMODRAFT_233106 [Selaginella moellendorffii]
Length=309

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -2

Query  464  KVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            +  +  +Y IFY G L  FEIG DG +  +LYP+V YT +D YL RYL
Sbjct  263  RAALAHFYQIFYRGDLM-FEIGPDGRDTGELYPDVSYTTVDAYLDRYL  309



>ref|XP_002966667.1| hypothetical protein SELMODRAFT_230858 [Selaginella moellendorffii]
 gb|EFJ32694.1| hypothetical protein SELMODRAFT_230858 [Selaginella moellendorffii]
Length=309

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 31/48 (65%), Gaps = 1/48 (2%)
 Frame = -2

Query  464  KVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            +  +  +Y IFY G L  FEIG DG +  +LYP+V YT +D YL RYL
Sbjct  263  RAALAHFYQIFYRGDLM-FEIGPDGRDTGELYPDVSYTTVDAYLDRYL  309



>gb|AAF64177.1|AF242494_1 phenylcoumaran benzylic ether reductase homolog TH2 [Tsuga heterophylla]
 gb|AAF64178.1|AF242495_1 phenylcoumaran benzylic ether reductase homolog TH3 [Tsuga heterophylla]
Length=308

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -2

Query  488  MKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            + +  +   + +   + IF +G  TNF+IG DG E S LYP+V YT +DEYL  ++
Sbjct  253  IAETPFPANIVIAIGHSIFVKGDQTNFDIGPDGVEGSLLYPDVKYTTVDEYLSAFV  308



>gb|ADM79284.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79285.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79286.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79287.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79289.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79290.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79291.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79292.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79293.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79294.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79295.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79296.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79297.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79298.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79299.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79300.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79301.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79302.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79304.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79305.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79306.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79307.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79308.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79309.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79310.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79311.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79312.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79313.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79314.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79315.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79316.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79317.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79318.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79320.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79321.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79322.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79323.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79324.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79325.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79326.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79327.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79328.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79329.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79330.1| isoflavone reductase-like protein [Picea sitchensis]
 gb|ADM79331.1| isoflavone reductase-like protein [Picea sitchensis]
Length=164

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = -2

Query  497  LASMKD--MEYVGKVGVIFYYHIFYEGCLTNFEIGDDGE-EASQLYPEVHYTRMDEYLKR  327
            LA M+D       KV +  +YHIF++G L NF++    + EA+ LYP+V YT ++ YL R
Sbjct  103  LAPMEDGSTSVQRKVEMAIFYHIFFKGELANFDLNQSNQCEAASLYPDVEYTSVERYLSR  162

Query  326  Y  324
            +
Sbjct  163  F  163



>gb|ADM79288.1| isoflavone reductase-like protein [Picea sitchensis]
Length=164

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/61 (41%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = -2

Query  497  LASMKD--MEYVGKVGVIFYYHIFYEGCLTNFEIGDDGE-EASQLYPEVHYTRMDEYLKR  327
            LA M+D       KV +  +YHIF++G L NF++    + EA+ LYP+V YT ++ YL R
Sbjct  103  LAPMEDGSTSVQRKVEMAIFYHIFFKGELANFDLNQSNQCEAASLYPDVEYTSVERYLSR  162

Query  326  Y  324
            +
Sbjct  163  F  163



>gb|ADM79319.1| isoflavone reductase-like protein [Picea sitchensis]
Length=164

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -2

Query  464  KVGVIFYYHIFYEGCLTNFEIGDDGE-EASQLYPEVHYTRMDEYLKRY  324
            KV +  +YHIF++G L NF++    + EA+ LYP+V YT ++ YL R+
Sbjct  116  KVEMAIFYHIFFKGELANFDLNQSNQCEAASLYPDVEYTSVERYLSRF  163



>gb|ADM79303.1| isoflavone reductase-like protein [Picea sitchensis]
Length=164

 Score = 47.8 bits (112),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = -2

Query  464  KVGVIFYYHIFYEGCLTNFEIGDDGE-EASQLYPEVHYTRMDEYLKRY  324
            KV +  +YHIF++G L NF++    + EA+ LYP+V YT ++ YL R+
Sbjct  116  KVEMAIFYHIFFKGELANFDLNQSNQCEAASLYPDVEYTSVERYLSRF  163



>ref|XP_002283921.2| PREDICTED: LOW QUALITY PROTEIN: isoflavone reductase-like protein 
[Vitis vinifera]
Length=324

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDD-GEEASQLYPEVHYTRMDEYLKRY  324
            L ++++ E+   V +   + +F EG  TNFEI    G EAS+LYP+V YT +DEYL ++
Sbjct  247  LKNIQEAEFPVNVIMAISHSVFIEGDQTNFEIEPSFGVEASELYPDVKYTTVDEYLNQF  305



>emb|CBI37669.3| unnamed protein product [Vitis vinifera]
Length=306

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 38/59 (64%), Gaps = 1/59 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDD-GEEASQLYPEVHYTRMDEYLKRY  324
            L ++++ E+   V +   + +F EG  TNFEI    G EAS+LYP+V YT +DEYL ++
Sbjct  247  LKNIQEAEFPVNVIMAISHSVFIEGDQTNFEIEPSFGVEASELYPDVKYTTVDEYLNQF  305



>ref|XP_010034732.1| PREDICTED: isoflavone reductase-like protein [Eucalyptus grandis]
Length=143

 Score = 47.0 bits (110),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDD-GEEASQLYPEVHYTRMDEYLKRYL  321
            L  ++D      +    Y+ IF +G  TNFEI    G EAS+LYP V Y+ MDEYL +++
Sbjct  84   LKKIRDARSPDDLMWAIYHSIFVKGDQTNFEIEPSFGVEASELYPNVKYSTMDEYLDQFV  143



>ref|XP_006423307.1| hypothetical protein CICLE_v10028896mg [Citrus clementina]
 gb|ESR36547.1| hypothetical protein CICLE_v10028896mg [Citrus clementina]
Length=249

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDD-GEEASQLYPEVHYTRMDEYLKRYL  321
            L ++++     KV +  Y+  F +G  TNF+I    G EASQLYP+V YT +DEYL +++
Sbjct  190  LKNIQEAAPPHKVILSIYHSAFVKGVQTNFKIEPSFGVEASQLYPDVKYTTVDEYLNQFV  249



>gb|AEX13522.1| hypothetical protein UMN_7561_01 [Pinus taeda]
 gb|AEX13523.1| hypothetical protein UMN_7561_01 [Pinus taeda]
 gb|AEX13524.1| hypothetical protein UMN_7561_01 [Pinus taeda]
 gb|AEX13525.1| hypothetical protein UMN_7561_01 [Pinus radiata]
Length=77

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEI-GDDGEEASQLYPEVHYTRMDEYLKRYL  321
            L SM    Y  +V +   Y IF+ G L +FEI   +G ++S+LYP+V Y  ++EYL+R+L
Sbjct  19   LQSMNGAPYHLQVAITHMYQIFFRGDL-DFEITASEGVDSSELYPQVKYVTVEEYLQRFL  77



>gb|KDO42019.1| hypothetical protein CISIN_1g021596mg [Citrus sinensis]
Length=251

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDD-GEEASQLYPEVHYTRMDEYLKRYL  321
            L ++++      V +  Y+ +F  G  TNFEI    G EASQL+P+V YT +DEYL +++
Sbjct  192  LKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYTTVDEYLNQFV  251



>ref|XP_007148735.1| hypothetical protein PHAVU_005G010000g [Phaseolus vulgaris]
 gb|ESW20729.1| hypothetical protein PHAVU_005G010000g [Phaseolus vulgaris]
Length=317

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -2

Query  461  VGVIFYYHIFYEGCLTNFEIGDDGEEASQLYPEVHYTRMDEYLKRYL  321
            + V   + IF  G L NFEIG+D  EASQLYP+  YT +D+ L  +L
Sbjct  259  IPVSILHSIFVRGDLMNFEIGEDDLEASQLYPDYEYTSIDQLLNIFL  305



>gb|KDO42018.1| hypothetical protein CISIN_1g021596mg [Citrus sinensis]
Length=310

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (62%), Gaps = 1/60 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDD-GEEASQLYPEVHYTRMDEYLKRYL  321
            L ++++      V +  Y+ +F  G  TNFEI    G EASQL+P+V YT +DEYL +++
Sbjct  251  LKNIQEAAPPQNVILSIYHSVFMNGVQTNFEIEPSFGVEASQLFPDVKYTTVDEYLNQFV  310



>ref|XP_006423306.1| hypothetical protein CICLE_v10028896mg [Citrus clementina]
 gb|ESR36546.1| hypothetical protein CICLE_v10028896mg [Citrus clementina]
Length=309

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDD-GEEASQLYPEVHYTRMDEYLKRYL  321
            L ++++     KV +  Y+  F +G  TNF+I    G EASQLYP+V YT +DEYL +++
Sbjct  250  LKNIQEAAPPHKVILSIYHSAFVKGVQTNFKIEPSFGVEASQLYPDVKYTTVDEYLNQFV  309



>ref|XP_006469140.1| PREDICTED: isoflavone reductase homolog isoform X2 [Citrus sinensis]
Length=308

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDD-GEEASQLYPEVHYTRMDEYLKRYL  321
            L ++++     KV +  Y+  F +G  TNF+I    G EASQLYP+V YT +DEYL +++
Sbjct  249  LKNIQEAAPPHKVILSIYHSAFVKGVQTNFKIEPSFGVEASQLYPDVKYTTVDEYLNQFV  308



>ref|XP_006469139.1| PREDICTED: isoflavone reductase homolog isoform X1 [Citrus sinensis]
Length=309

 Score = 47.8 bits (112),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 1/60 (2%)
 Frame = -2

Query  497  LASMKDMEYVGKVGVIFYYHIFYEGCLTNFEIGDD-GEEASQLYPEVHYTRMDEYLKRYL  321
            L ++++     KV +  Y+  F +G  TNF+I    G EASQLYP+V YT +DEYL +++
Sbjct  250  LKNIQEAAPPHKVILSIYHSAFVKGVQTNFKIEPSFGVEASQLYPDVKYTTVDEYLNQFV  309



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 518883953212