BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c1665_g1_i1 len=1331 path=[1309:0-1330]

Length=1331
                                                                      Score     E

ref|XP_004244694.1|  PREDICTED: fasciclin-like arabinogalactan pr...    209   1e-60   
ref|XP_009593249.1|  PREDICTED: fasciclin-like arabinogalactan pr...    199   2e-56   
ref|XP_006357096.1|  PREDICTED: fasciclin-like arabinogalactan pr...    196   1e-55   
ref|XP_009781936.1|  PREDICTED: fasciclin-like arabinogalactan pr...    196   2e-55   
ref|XP_009612463.1|  PREDICTED: fasciclin-like arabinogalactan pr...    194   2e-54   
ref|XP_010324668.1|  PREDICTED: fasciclin-like arabinogalactan pr...    192   4e-54   
ref|XP_009787705.1|  PREDICTED: fasciclin-like arabinogalactan pr...    191   2e-53   
ref|XP_002527970.1|  conserved hypothetical protein                     188   3e-52   Ricinus communis
gb|EPS61284.1|  hypothetical protein M569_13515                         177   6e-49   
ref|XP_006382179.1|  putative surface family protein                    179   1e-48   
gb|KCW80704.1|  hypothetical protein EUGRSUZ_C02101                     177   6e-48   
ref|XP_006371803.1|  putative surface family protein                    176   7e-48   
ref|XP_011015272.1|  PREDICTED: fasciclin-like arabinogalactan pr...    174   4e-47   
ref|XP_011045030.1|  PREDICTED: fasciclin-like arabinogalactan pr...    174   5e-47   
gb|EYU22059.1|  hypothetical protein MIMGU_mgv1a011491mg                174   5e-47   
ref|XP_010048457.1|  PREDICTED: fasciclin-like arabinogalactan pr...    176   6e-47   
gb|KDP33435.1|  hypothetical protein JCGZ_07006                         174   1e-46   
ref|XP_010265495.1|  PREDICTED: fasciclin-like arabinogalactan pr...    166   9e-44   
ref|XP_007011569.1|  Fasciclin-like arabinogalactan protein 17, p...    165   1e-43   
ref|NP_001130104.1|  hypothetical protein precursor                     166   1e-43   Zea mays [maize]
ref|XP_010527113.1|  PREDICTED: fasciclin-like arabinogalactan pr...    162   2e-42   
gb|EPS65223.1|  hypothetical protein M569_09558                         161   4e-42   
ref|XP_009394682.1|  PREDICTED: fasciclin-like arabinogalactan pr...    159   1e-41   
ref|XP_004952427.1|  PREDICTED: fasciclin-like arabinogalactan pr...    160   2e-41   
emb|CAN66163.1|  hypothetical protein VITISV_008126                     160   2e-41   Vitis vinifera
ref|XP_011082039.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...    158   3e-41   
ref|XP_008445580.1|  PREDICTED: fasciclin-like arabinogalactan pr...    159   3e-41   
ref|XP_002282846.1|  PREDICTED: fasciclin-like arabinogalactan pr...    159   4e-41   Vitis vinifera
ref|XP_008466329.1|  PREDICTED: fasciclin-like arabinogalactan pr...    158   5e-41   
ref|XP_002452018.1|  hypothetical protein SORBIDRAFT_04g015850          158   8e-41   Sorghum bicolor [broomcorn]
ref|XP_004136457.1|  PREDICTED: fasciclin-like arabinogalactan pr...    157   8e-41   
ref|XP_009418876.1|  PREDICTED: fasciclin-like arabinogalactan pr...    154   3e-39   
ref|XP_004138878.1|  PREDICTED: fasciclin-like arabinogalactan pr...    154   3e-39   
ref|XP_009396684.1|  PREDICTED: fasciclin-like arabinogalactan pr...    154   3e-39   
gb|KFK32632.1|  hypothetical protein AALP_AA6G268600                    153   4e-39   
ref|XP_006368661.1|  hypothetical protein POPTR_0001s07490g             154   4e-39   
emb|CDP12467.1|  unnamed protein product                                150   2e-38   
ref|XP_002880584.1|  hypothetical protein ARALYDRAFT_481301             150   3e-38   
ref|NP_180021.1|  fasciclin-like arabinogalactan protein 3              150   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002271150.1|  PREDICTED: fasciclin-like arabinogalactan pr...    151   4e-38   Vitis vinifera
ref|XP_011034724.1|  PREDICTED: fasciclin-like arabinogalactan pr...    150   7e-38   
ref|XP_011082708.1|  PREDICTED: fasciclin-like arabinogalactan pr...    150   8e-38   
ref|XP_011082038.1|  PREDICTED: fasciclin-like arabinogalactan pr...    149   9e-38   
emb|CAN62804.1|  hypothetical protein VITISV_011795                     151   9e-38   Vitis vinifera
gb|KDP41920.1|  hypothetical protein JCGZ_26938                         146   3e-37   
ref|XP_002512774.1|  Glycoprotein X precursor, putative                 149   4e-37   Ricinus communis
ref|XP_010472452.1|  PREDICTED: fasciclin-like arabinogalactan pr...    147   6e-37   
ref|XP_010417204.1|  PREDICTED: fasciclin-like arabinogalactan pr...    147   6e-37   
ref|XP_010429425.1|  PREDICTED: fasciclin-like arabinogalactan pr...    147   7e-37   
ref|XP_006664971.1|  PREDICTED: fasciclin-like arabinogalactan pr...    147   1e-36   
ref|XP_009615226.1|  PREDICTED: fasciclin-like arabinogalactan pr...    147   1e-36   
ref|XP_006296192.1|  hypothetical protein CARUB_v10025354mg             146   1e-36   
emb|CDX76814.1|  BnaC08g34000D                                          145   3e-36   
gb|AFK40899.1|  unknown                                                 145   3e-36   
ref|XP_010034870.1|  PREDICTED: fasciclin-like arabinogalactan pr...    147   3e-36   
ref|XP_009133982.1|  PREDICTED: fasciclin-like arabinogalactan pr...    145   3e-36   
gb|KCW53929.1|  hypothetical protein EUGRSUZ_J03138                     145   3e-36   
ref|XP_006404978.1|  hypothetical protein EUTSA_v10000470mg             144   6e-36   
gb|KFK38614.1|  hypothetical protein AALP_AA3G137100                    143   1e-35   
emb|CDY34771.1|  BnaA09g41380D                                          143   1e-35   
ref|XP_009117125.1|  PREDICTED: fasciclin-like arabinogalactan pr...    143   1e-35   
ref|XP_008799982.1|  PREDICTED: fasciclin-like arabinogalactan pr...    143   2e-35   
ref|XP_009784353.1|  PREDICTED: fasciclin-like arabinogalactan pr...    143   2e-35   
ref|XP_008786366.1|  PREDICTED: fasciclin-like arabinogalactan pr...    142   2e-35   
ref|XP_010909123.1|  PREDICTED: fasciclin-like arabinogalactan pr...    141   5e-35   
emb|CDY20316.1|  BnaC04g36400D                                          141   9e-35   
ref|XP_003545530.1|  PREDICTED: fasciclin-like arabinogalactan pr...    142   1e-34   
ref|XP_004498590.1|  PREDICTED: fasciclin-like arabinogalactan pr...    142   1e-34   
ref|XP_010669451.1|  PREDICTED: fasciclin-like arabinogalactan pr...    141   1e-34   
ref|XP_006483738.1|  PREDICTED: fasciclin-like arabinogalactan pr...    140   1e-34   
ref|XP_006450136.1|  hypothetical protein CICLE_v10010765mg             140   1e-34   
ref|XP_009398985.1|  PREDICTED: fasciclin-like arabinogalactan pr...    144   1e-34   
gb|ABK28554.1|  unknown                                                 139   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187872.1|  fasciclin-like arabinogalactan protein 14             139   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009140554.1|  PREDICTED: fasciclin-like arabinogalactan pr...    139   4e-34   
ref|XP_008219800.1|  PREDICTED: fasciclin-like arabinogalactan pr...    139   4e-34   
ref|XP_008781934.1|  PREDICTED: fasciclin-like arabinogalactan pr...    139   1e-33   
ref|XP_010914304.1|  PREDICTED: fasciclin-like arabinogalactan pr...    138   1e-33   
ref|NP_001046792.1|  Os02g0461500                                       138   1e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010938482.1|  PREDICTED: fasciclin-like arabinogalactan pr...    137   2e-33   
ref|XP_007224727.1|  hypothetical protein PRUPE_ppa024912mg             137   2e-33   
ref|XP_008799981.1|  PREDICTED: fasciclin-like arabinogalactan pr...    137   2e-33   
ref|XP_006357108.1|  PREDICTED: fasciclin-like arabinogalactan pr...    138   2e-33   
ref|XP_010465042.1|  PREDICTED: fasciclin-like arabinogalactan pr...    136   3e-33   
ref|XP_004305605.1|  PREDICTED: uncharacterized protein LOC101308896    142   6e-33   
ref|XP_002882785.1|  hypothetical protein ARALYDRAFT_478625             135   8e-33   
ref|XP_007221854.1|  hypothetical protein PRUPE_ppa021523mg             135   8e-33   
ref|XP_009377364.1|  PREDICTED: fasciclin-like arabinogalactan pr...    135   1e-32   
gb|KHN10392.1|  Fasciclin-like arabinogalactan protein 3                135   2e-32   
ref|XP_010526275.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   2e-32   
gb|EMS62729.1|  hypothetical protein TRIUR3_26693                       134   2e-32   
ref|XP_008378295.1|  PREDICTED: fasciclin-like arabinogalactan pr...    134   4e-32   
ref|XP_009338843.1|  PREDICTED: fasciclin-like arabinogalactan pr...    133   4e-32   
gb|ABV27488.1|  fasciclin-like arabinogalactan protein 17               133   5e-32   Gossypium hirsutum [American cotton]
gb|EYU32014.1|  hypothetical protein MIMGU_mgv1a007039mg                136   5e-32   
ref|XP_009363599.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   8e-32   
ref|XP_008219801.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   8e-32   
ref|XP_010102851.1|  hypothetical protein L484_004423                   132   1e-31   
gb|EMT17229.1|  hypothetical protein F775_11240                         131   2e-31   
ref|XP_010938483.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   2e-31   
ref|XP_010102850.1|  hypothetical protein L484_004422                   131   2e-31   
ref|XP_010499304.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   3e-31   
ref|XP_008361057.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   4e-31   
ref|XP_009120424.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   6e-31   
ref|XP_010913663.1|  PREDICTED: fasciclin-like arabinogalactan pr...    131   6e-31   
ref|XP_004305606.1|  PREDICTED: fasciclin-like arabinogalactan pr...    130   7e-31   
ref|XP_010486992.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   8e-31   
ref|XP_009605451.1|  PREDICTED: fasciclin-like arabinogalactan pr...    132   9e-31   
ref|XP_004486594.1|  PREDICTED: fasciclin-like arabinogalactan pr...    131   1e-30   
ref|XP_008352034.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   1e-30   
gb|ABR16344.1|  unknown                                                 131   2e-30   Picea sitchensis
dbj|BAP11158.1|  putative Fasciclin-like Arabinogalactan-protein 10     126   2e-30   
dbj|BAP11162.1|  putative Fasciclin-like Arabinogalactan-protein 10     126   2e-30   
ref|XP_007024813.1|  FASCICLIN-like arabinogalactan protein 14 pr...    129   3e-30   
dbj|BAP11159.1|  putative Fasciclin-like Arabinogalactan-protein 10     125   3e-30   
dbj|BAP11161.1|  putative Fasciclin-like Arabinogalactan-protein 10     125   4e-30   
ref|XP_010438048.1|  PREDICTED: fasciclin-like arabinogalactan pr...    128   4e-30   
emb|CDP17792.1|  unnamed protein product                                130   5e-30   
ref|XP_006298989.1|  hypothetical protein CARUB_v10015115mg             127   5e-30   
gb|KDP28734.1|  hypothetical protein JCGZ_14505                         130   6e-30   
gb|KEH39774.1|  fasciclin domain protein                                127   7e-30   
ref|XP_002320736.1|  Fasciclin-like arabinogalactan protein 8 pre...    129   8e-30   Populus trichocarpa [western balsam poplar]
ref|XP_006412600.1|  hypothetical protein EUTSA_v10027390mg             127   9e-30   
ref|XP_010432871.1|  PREDICTED: fasciclin-like arabinogalactan pr...    127   1e-29   
gb|AFK47920.1|  unknown                                                 127   1e-29   
dbj|BAK06740.1|  predicted protein                                      126   1e-29   
gb|KEH39771.1|  fasciclin-like arabinogalactan protein                  126   1e-29   
ref|XP_011090995.1|  PREDICTED: fasciclin-like arabinogalactan pr...    129   2e-29   
ref|XP_010447580.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   2e-29   
ref|XP_006286247.1|  hypothetical protein CARUB_v10007817mg             126   2e-29   
emb|CDY42162.1|  BnaC05g40570D                                          125   2e-29   
ref|XP_003534603.1|  PREDICTED: fasciclin-like arabinogalactan pr...    128   2e-29   
ref|XP_008460132.1|  PREDICTED: fasciclin-like arabinogalactan pr...    128   3e-29   
ref|XP_006858016.1|  hypothetical protein AMTR_s00069p00195790          128   3e-29   
ref|XP_006445226.1|  hypothetical protein CICLE_v10020328mg             127   4e-29   
gb|KHM99327.1|  Fasciclin-like arabinogalactan protein 3                125   5e-29   
ref|XP_006491459.1|  PREDICTED: fasciclin-like arabinogalactan pr...    127   5e-29   
ref|XP_011034618.1|  PREDICTED: fasciclin-like arabinogalactan pr...    127   5e-29   
ref|XP_009363600.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   6e-29   
ref|NP_194865.1|  FASCICLIN-like arabinogalactan protein 5              124   9e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CDY00793.1|  BnaC03g37770D                                          124   1e-28   
ref|XP_011097758.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   1e-28   
ref|XP_004144998.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   1e-28   
gb|KEH39773.1|  fasciclin domain protein                                124   1e-28   
ref|XP_007161299.1|  hypothetical protein PHAVU_001G058300g             124   1e-28   
ref|XP_010277448.1|  PREDICTED: fasciclin-like arabinogalactan pr...    126   1e-28   
ref|XP_010092859.1|  hypothetical protein L484_022454                   125   2e-28   
ref|XP_009379279.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   2e-28   
ref|XP_008232692.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   2e-28   
ref|XP_009381782.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   2e-28   
ref|XP_008343059.1|  PREDICTED: fasciclin-like arabinogalactan pr...    125   2e-28   
ref|XP_003523715.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   2e-28   
ref|XP_002511740.1|  conserved hypothetical protein                     125   2e-28   Ricinus communis
ref|XP_003581094.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   3e-28   
emb|CDY52668.1|  BnaC01g38580D                                          122   4e-28   
ref|XP_010518164.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   4e-28   
gb|EPS62290.1|  fasciclin-like arabinogalactan protein 13               124   4e-28   
emb|CDY18927.1|  BnaC04g04230D                                          124   5e-28   
ref|XP_010506492.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   5e-28   
emb|CDY36445.1|  BnaC03g67650D                                          122   5e-28   
ref|XP_003526450.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   5e-28   
ref|XP_010056276.1|  PREDICTED: fasciclin-like arabinogalactan pr...    124   6e-28   
ref|NP_001150349.1|  fasciclin-like arabinogalactan protein 8 pre...    121   6e-28   Zea mays [maize]
ref|XP_009108932.1|  PREDICTED: fasciclin-like arabinogalactan pr...    121   6e-28   
emb|CDY23293.1|  BnaA08g12530D                                          121   6e-28   
ref|XP_007218052.1|  hypothetical protein PRUPE_ppa006158mg             124   6e-28   
ref|XP_002882015.1|  hypothetical protein ARALYDRAFT_483684             124   8e-28   
ref|XP_009402000.1|  PREDICTED: fasciclin-like arabinogalactan pr...    121   9e-28   
ref|XP_008649024.1|  PREDICTED: fasciclin-like arabinogalactan pr...    121   9e-28   
ref|XP_002867304.1|  hypothetical protein ARALYDRAFT_491605             121   1e-27   
ref|XP_006845641.1|  hypothetical protein AMTR_s00019p00223190          123   1e-27   
ref|XP_010508167.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   1e-27   
ref|XP_003552347.1|  PREDICTED: fasciclin-like arabinogalactan pr...    123   1e-27   
emb|CDY50538.1|  BnaA01g30420D                                          120   2e-27   
ref|XP_009146602.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   2e-27   
emb|CDY08417.1|  BnaA05g26530D                                          119   2e-27   
gb|ABK24724.1|  unknown                                                 122   3e-27   Picea sitchensis
ref|XP_009625162.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   3e-27   
ref|XP_009143146.1|  PREDICTED: fasciclin-like arabinogalactan pr...    122   3e-27   
ref|XP_009417795.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   3e-27   
ref|NP_566043.1|  FASCICLIN-like arabinogalactan protein 8              121   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009802278.1|  PREDICTED: fasciclin-like arabinogalactan pr...    121   4e-27   
gb|AAM66074.1|  endosperm-specific protein-like protein                 121   4e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CDX74743.1|  BnaA05g04890D                                          121   4e-27   
ref|XP_006296250.1|  hypothetical protein CARUB_v10025417mg             121   5e-27   
ref|XP_006844054.1|  hypothetical protein AMTR_s00006p00245830          120   5e-27   
ref|XP_009785088.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   7e-27   
ref|XP_004306902.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   8e-27   
gb|ABR16637.1|  unknown                                                 120   8e-27   Picea sitchensis
gb|EYU33706.1|  hypothetical protein MIMGU_mgv1a007367mg                120   8e-27   
gb|AIY35292.1|  fasciclin-like arabinogalactan 12                       120   1e-26   
ref|XP_006339448.1|  PREDICTED: fasciclin-like arabinogalactan pr...    120   1e-26   
ref|XP_006397729.1|  hypothetical protein EUTSA_v10001463mg             120   1e-26   
ref|XP_004229828.1|  PREDICTED: fasciclin-like arabinogalactan pr...    119   2e-26   
ref|XP_002270426.2|  PREDICTED: fasciclin-like arabinogalactan pr...    119   2e-26   Vitis vinifera
ref|XP_004965683.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   2e-26   
ref|XP_002438784.1|  hypothetical protein SORBIDRAFT_10g026140          117   2e-26   Sorghum bicolor [broomcorn]
emb|CDX73808.1|  BnaA03g32390D                                          116   2e-26   
dbj|BAJ34929.1|  fasciclin-like arabinogalactan protein                 119   3e-26   
ref|XP_009135245.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   3e-26   
ref|XP_007139983.1|  hypothetical protein PHAVU_008G075000g             119   4e-26   
emb|CDP13717.1|  unnamed protein product                                118   4e-26   
emb|CAN65447.1|  hypothetical protein VITISV_011425                     118   5e-26   Vitis vinifera
ref|XP_006352538.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   7e-26   
gb|ABV27483.1|  fasciclin-like arabinogalactan protein 12               117   8e-26   Gossypium hirsutum [American cotton]
ref|XP_004248342.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   9e-26   
ref|XP_004492650.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   1e-25   
ref|XP_009104281.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   1e-25   
emb|CDX72305.1|  BnaC07g43270D                                          115   1e-25   
ref|NP_001149463.1|  fasciclin-like arabinogalactan protein 8 pre...    115   1e-25   Zea mays [maize]
ref|XP_004516114.1|  PREDICTED: fasciclin-like arabinogalactan pr...    117   1e-25   
gb|ABV27484.1|  fasciclin-like arabinogalactan protein 13               117   2e-25   Gossypium hirsutum [American cotton]
gb|KFK37339.1|  hypothetical protein AALP_AA4G243700                    116   2e-25   
ref|XP_007052018.1|  FASCICLIN-like arabinogalactan protein 8           116   2e-25   
ref|XP_009767783.1|  PREDICTED: fasciclin-like arabinogalactan pr...    116   3e-25   
ref|XP_010252769.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   3e-25   
gb|AAK55685.1|AF378882_1  AT3g60900/T4C21_310                           115   4e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDY13425.1|  BnaA03g51430D                                          113   4e-25   
ref|NP_191649.1|  fasciclin-like arabinogalactan protein 10             115   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011095539.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   4e-25   
ref|XP_009138006.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   6e-25   
ref|XP_004305460.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   7e-25   
ref|XP_010243936.1|  PREDICTED: fasciclin-like arabinogalactan pr...    115   7e-25   
ref|XP_004305604.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   7e-25   
ref|XP_009150168.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   7e-25   
emb|CDY37904.1|  BnaA06g19130D                                          114   7e-25   
ref|XP_007049368.1|  FASCICLIN-like arabinogalactan 2                   114   9e-25   
ref|XP_002878353.1|  AT3g60900/T4C21_310                                114   9e-25   
ref|XP_008777689.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   1e-24   
ref|XP_009615606.1|  PREDICTED: fasciclin-like arabinogalactan pr...    114   1e-24   
ref|NP_193009.1|  fasciclin-like arabinogalactan protein 2              114   1e-24   Arabidopsis thaliana [mouse-ear cress]
gb|EPS66997.1|  hypothetical protein M569_07779                         113   2e-24   
gb|KDO59100.1|  hypothetical protein CISIN_1g015356mg                   113   2e-24   
ref|XP_006474892.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   2e-24   
emb|CDX87001.1|  BnaC03g52710D                                          113   2e-24   
gb|AAM65777.1|  putative pollen surface protein                         113   3e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002267946.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   3e-24   Vitis vinifera
gb|EAZ01938.1|  hypothetical protein OsI_23966                          111   3e-24   Oryza sativa Indica Group [Indian rice]
gb|AAK20858.1|AF333971_1  fasciclin-like arabinogalactan-protein 2      113   3e-24   Arabidopsis thaliana [mouse-ear cress]
emb|CAN61077.1|  hypothetical protein VITISV_012919                     113   3e-24   Vitis vinifera
ref|XP_006346133.1|  PREDICTED: fasciclin-like arabinogalactan pr...    113   3e-24   
ref|XP_008463001.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   4e-24   
ref|XP_010919185.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   4e-24   
ref|XP_006452590.1|  hypothetical protein CICLE_v10008218mg             113   5e-24   
emb|CBI28444.3|  unnamed protein product                                113   5e-24   
ref|XP_003623747.1|  Fasciclin-like arabinogalactan protein             112   5e-24   
gb|KEH23329.1|  fasciclin-like arabinogalactan protein                  112   6e-24   
ref|XP_007212310.1|  hypothetical protein PRUPE_ppa006726mg             112   6e-24   
ref|XP_009382277.1|  PREDICTED: fasciclin-like arabinogalactan pr...    112   9e-24   
ref|XP_008227156.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   9e-24   
gb|KHN16466.1|  Fasciclin-like arabinogalactan protein 14               107   1e-23   
ref|XP_006652672.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   1e-23   
gb|EYU27439.1|  hypothetical protein MIMGU_mgv1a007268mg                111   1e-23   
ref|XP_004148925.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   1e-23   
ref|XP_010557720.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   1e-23   
ref|XP_004244059.1|  PREDICTED: fasciclin-like arabinogalactan pr...    111   2e-23   
ref|XP_004291803.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   2e-23   
ref|XP_008780048.1|  PREDICTED: fasciclin-like arabinogalactan pr...    110   2e-23   
emb|CDX71771.1|  BnaC08g31030D                                          110   2e-23   
ref|XP_002863317.1|  hypothetical protein ARALYDRAFT_497154             110   2e-23   
ref|XP_003560388.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   2e-23   
ref|XP_006657210.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   2e-23   
ref|XP_006292436.1|  hypothetical protein CARUB_v10018654mg             110   2e-23   
ref|XP_006402530.1|  hypothetical protein EUTSA_v10005998mg             110   3e-23   
ref|NP_001053617.1|  Os04g0574200                                       110   3e-23   Oryza sativa Japonica Group [Japonica rice]
gb|AFK41095.1|  unknown                                                 110   3e-23   
gb|KFK32403.1|  hypothetical protein AALP_AA6G237100                    109   4e-23   
ref|XP_008229928.1|  PREDICTED: fasciclin-like arabinogalactan pr...    109   5e-23   
emb|CDY66159.1|  BnaCnng49680D                                          109   6e-23   
gb|KEH34088.1|  fasciclin-like arabinogalactan protein                  108   9e-23   
ref|NP_001058255.1|  Os06g0656800                                       106   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006603146.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   1e-22   
gb|KDO38095.1|  hypothetical protein CISIN_1g013841mg                   108   1e-22   
ref|XP_010088447.1|  hypothetical protein L484_018219                   108   1e-22   
ref|XP_010479980.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   1e-22   
ref|XP_006653238.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   2e-22   
ref|XP_007146643.1|  hypothetical protein PHAVU_006G057400g             108   2e-22   
emb|CDY52341.1|  BnaA09g38900D                                          107   2e-22   
ref|XP_010689281.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   2e-22   
dbj|BAE75863.1|  putative fasciclin-like arabinogalactan protein        107   2e-22   
ref|XP_010496525.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   3e-22   
ref|XP_007215592.1|  hypothetical protein PRUPE_ppa007675mg             106   3e-22   
gb|AGV54413.1|  fasciclin-like arabinogalactan protein 1-like pro...    107   3e-22   
ref|XP_008380005.1|  PREDICTED: fasciclin-like arabinogalactan pr...    108   3e-22   
ref|XP_009375067.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   3e-22   
ref|XP_006286070.1|  hypothetical protein CARUB_v10007603mg             107   3e-22   
ref|XP_006447810.1|  hypothetical protein CICLE_v10015469mg             107   4e-22   
ref|XP_010435371.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   4e-22   
emb|CDY37043.1|  BnaA04g26210D                                          107   4e-22   
ref|XP_006469451.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   4e-22   
ref|XP_009142340.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   4e-22   
ref|XP_010469133.1|  PREDICTED: fasciclin-like arabinogalactan pr...    107   4e-22   
ref|XP_010512424.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   5e-22   
ref|XP_006601616.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   5e-22   
ref|XP_010542030.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   6e-22   
emb|CDX68507.1|  BnaC01g25850D                                          106   7e-22   
ref|XP_011010616.1|  PREDICTED: fasciclin-like arabinogalactan pr...    106   7e-22   
ref|XP_006415013.1|  hypothetical protein EUTSA_v10025352mg             106   8e-22   
gb|KHG09433.1|  Fasciclin-like arabinogalactan protein 1                106   8e-22   
ref|XP_009151619.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   1e-21   
gb|AIY35291.1|  fasciclin-like arabinogalactan 11                       105   1e-21   
gb|ABV27482.1|  fasciclin-like arabinogalactan protein 11               105   1e-21   
emb|CDX86346.1|  BnaA06g30630D                                          105   1e-21   
gb|ABV27490.1|  fasciclin-like arabinogalactan protein 19               105   1e-21   
gb|KHG10798.1|  Fasciclin-like arabinogalactan protein 2                105   1e-21   
ref|XP_007020499.1|  Fasciclin-like arabinogalactan protein 1           105   2e-21   
ref|XP_011011127.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   2e-21   
ref|XP_004303568.1|  PREDICTED: fasciclin-like arabinogalactan pr...    104   2e-21   
ref|XP_009116767.1|  PREDICTED: fasciclin-like arabinogalactan pr...    105   2e-21   
ref|XP_009351261.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   4e-21   
gb|ACL36352.1|  fascilin-like arabinogalactan protein                   103   4e-21   
ref|XP_003576707.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   5e-21   
gb|ABV27481.1|  fasciclin-like arabinogalactan protein 10               103   6e-21   
ref|XP_008342240.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   6e-21   
ref|XP_010692313.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   7e-21   
ref|XP_010675939.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   8e-21   
ref|XP_002316776.2|  hypothetical protein POPTR_0011s09590g             103   8e-21   
gb|AGN92424.2|  putative fasciclin-like arabinogalactan protein 4       102   9e-21   
ref|XP_009120095.1|  PREDICTED: fasciclin-like arabinogalactan pr...    103   9e-21   
emb|CDY28643.1|  BnaC09g32320D                                          103   9e-21   
ref|XP_011038795.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   1e-20   
emb|CDX67846.1|  BnaA07g18860D                                          102   1e-20   
ref|XP_003532178.1|  PREDICTED: fasciclin-like arabinogalactan pr...    102   2e-20   
gb|KDP39270.1|  hypothetical protein JCGZ_01027                         102   2e-20   
gb|ABI95393.1|  fasciclin-like protein FLA3                             102   2e-20   
gb|ADP88924.1|  fasciclin-like AGP                                      101   2e-20   
ref|XP_004501250.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.0    2e-20   
ref|XP_009799147.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   3e-20   
ref|XP_002298869.2|  hypothetical protein POPTR_0001s37650g             101   3e-20   
ref|XP_003580362.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   3e-20   
gb|KDP29933.1|  hypothetical protein JCGZ_18502                         101   3e-20   
dbj|BAJ90388.1|  predicted protein                                      101   4e-20   
ref|XP_008462050.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   4e-20   
ref|XP_002320524.2|  hypothetical protein POPTR_0014s16610g             101   4e-20   
ref|XP_004144548.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   4e-20   
ref|XP_010063266.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   5e-20   
ref|XP_008788906.1|  PREDICTED: fasciclin-like arabinogalactan pr...    101   6e-20   
gb|ABI95395.1|  fasciclin-like protein FLA5                             100   6e-20   
gb|EYU43168.1|  hypothetical protein MIMGU_mgv1a011668mg              98.6    7e-20   
ref|XP_006357643.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   8e-20   
gb|EAY93407.1|  hypothetical protein OsI_15204                        98.6    8e-20   
ref|XP_008803297.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   9e-20   
ref|XP_003603528.1|  Fasciclin-like arabinogalactan protein           98.2    9e-20   
emb|CAD40213.2|  OSJNBa0019J05.11                                     98.2    9e-20   
ref|XP_009370988.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.4    1e-19   
ref|XP_008228867.1|  PREDICTED: mucin-17-like                           102   1e-19   
gb|KEH39772.1|  fasciclin domain protein                              96.3    2e-19   
ref|XP_010525235.1|  PREDICTED: fasciclin-like arabinogalactan pr...    100   2e-19   
ref|XP_002267825.1|  PREDICTED: fasciclin-like arabinogalactan pr...  99.0    2e-19   
emb|CAH66152.1|  OSIGBa0097I11.4                                      97.1    2e-19   
gb|EMT07250.1|  hypothetical protein F775_26198                       99.0    3e-19   
ref|XP_010545276.1|  PREDICTED: fasciclin-like arabinogalactan pr...  98.6    4e-19   
gb|AAA91129.1|  putative surface protein                              96.3    4e-19   
ref|XP_008651121.1|  PREDICTED: uncharacterized protein LOC100274...  98.2    4e-19   
gb|KCW58153.1|  hypothetical protein EUGRSUZ_H00875                   97.8    6e-19   
ref|XP_010933921.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.8    7e-19   
gb|EPS69372.1|  fasciclin-like arabinogalactan protein 19             96.7    7e-19   
tpg|DAA36388.1|  TPA: fasciclin-like arabinogalactan protein 10       97.8    8e-19   
ref|NP_001151356.1|  fasciclin-like arabinogalactan protein 10 pr...  97.8    9e-19   
ref|XP_010069727.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.8    1e-18   
ref|XP_009606546.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.1    1e-18   
gb|ABI95391.1|  fasciclin-like protein FLA1                           97.4    1e-18   
emb|CDY20747.1|  BnaA02g08870D                                        97.4    1e-18   
ref|XP_010497131.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.5    1e-18   
ref|XP_004251538.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.7    1e-18   
gb|EAZ42295.1|  hypothetical protein OsJ_26868                        96.7    2e-18   
ref|XP_006352015.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.3    2e-18   
emb|CDY36762.1|  BnaA03g11240D                                        93.2    2e-18   
ref|XP_010536730.1|  PREDICTED: fasciclin-like arabinogalactan pr...  96.7    2e-18   
ref|XP_004965239.1|  PREDICTED: fasciclin-like arabinogalactan pr...  97.1    2e-18   
ref|XP_002522745.1|  conserved hypothetical protein                   96.3    2e-18   
ref|XP_007142534.1|  hypothetical protein PHAVU_008G288800g           96.3    2e-18   
ref|XP_006838924.1|  hypothetical protein AMTR_s00002p00270100        97.1    3e-18   
ref|XP_006401420.1|  hypothetical protein EUTSA_v10013639mg           96.3    3e-18   
ref|XP_007137111.1|  hypothetical protein PHAVU_009G1004000g          92.0    3e-18   
ref|XP_002448368.1|  hypothetical protein SORBIDRAFT_06g026030        96.3    3e-18   
ref|XP_004953764.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.5    4e-18   
ref|XP_010323900.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.5    4e-18   
ref|XP_003571006.2|  PREDICTED: fasciclin-like arabinogalactan pr...  94.4    5e-18   
ref|XP_002462113.1|  hypothetical protein SORBIDRAFT_02g019380        95.1    5e-18   
ref|XP_010418601.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.5    5e-18   
gb|EMS65354.1|  hypothetical protein TRIUR3_14037                     94.7    6e-18   
ref|XP_009385381.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.1    6e-18   
ref|XP_009379991.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.1    6e-18   
ref|XP_002866110.1|  hypothetical protein ARALYDRAFT_495659           95.1    6e-18   
ref|XP_004956400.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.7    6e-18   
gb|ABI95418.1|  fasciclin-like protein FLA28                          94.7    7e-18   
gb|EMT28749.1|  hypothetical protein F775_29839                       94.7    7e-18   
ref|XP_003519683.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.7    7e-18   
ref|XP_010545153.1|  PREDICTED: fasciclin-like arabinogalactan pr...  95.1    9e-18   
gb|KFK27162.1|  hypothetical protein AALP_AA8G343200                  94.4    1e-17   
emb|CBI39739.3|  unnamed protein product                              94.0    1e-17   
ref|XP_003618047.1|  Fasciclin-like arabinogalactan protein           94.4    1e-17   
ref|XP_009616556.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.0    1e-17   
ref|XP_009388359.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.0    1e-17   
ref|NP_001061532.1|  Os08g0321000                                     94.0    2e-17   
ref|NP_200384.1|  fasciclin-like arabinogalactan protein 1            94.0    2e-17   
ref|XP_009126981.1|  PREDICTED: fasciclin-like arabinogalactan pr...  94.0    2e-17   
gb|AEI98736.1|  fasciclin-like arabinogalactan 2                      93.6    2e-17   
ref|NP_001131728.1|  endosperm specific protein precursor             94.0    2e-17   
emb|CDP18905.1|  unnamed protein product                              93.2    3e-17   
ref|XP_010061458.1|  PREDICTED: fasciclin-like arabinogalactan pr...  93.2    3e-17   
ref|XP_009792211.1|  PREDICTED: fasciclin-like arabinogalactan pr...  93.2    3e-17   
ref|XP_003545484.2|  PREDICTED: fasciclin-like arabinogalactan pr...  93.2    3e-17   
ref|XP_004491619.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.8    3e-17   
ref|XP_008797603.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.8    4e-17   
gb|EMT00417.1|  hypothetical protein F775_14876                       90.5    4e-17   
ref|XP_006660446.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.4    5e-17   
ref|XP_008228897.1|  PREDICTED: fasciclin-like arabinogalactan pr...  93.6    5e-17   
ref|NP_001105408.1|  endosperm specific protein1 precursor            92.4    5e-17   
ref|NP_001047988.1|  Os02g0726000                                     90.1    5e-17   
gb|EAY87366.1|  hypothetical protein OsI_08770                        90.1    5e-17   
ref|XP_010928138.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.0    5e-17   
ref|XP_010943291.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.4    6e-17   
ref|XP_009391103.1|  PREDICTED: flocculation protein FLO11-like       92.8    6e-17   
ref|XP_007216704.1|  hypothetical protein PRUPE_ppa026501mg           93.2    7e-17   
ref|XP_010253181.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.0    7e-17   
gb|EMT13908.1|  hypothetical protein F775_11763                       89.7    7e-17   
ref|NP_001141906.1|  uncharacterized protein LOC100274054 precursor   92.0    7e-17   
dbj|BAE71278.1|  putative fasciclin-like arabinogalactan protein ...  92.0    7e-17   
ref|XP_009418107.1|  PREDICTED: fasciclin-like arabinogalactan pr...  92.4    7e-17   
ref|XP_008803592.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.5    7e-17   
ref|XP_010942271.1|  PREDICTED: fasciclin-like arabinogalactan pr...  91.7    9e-17   
ref|XP_006647825.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.4    1e-16   
gb|ABI95423.1|  fasciclin-like protein FLA33                          89.4    1e-16   
ref|XP_006659292.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.9    1e-16   
ref|XP_008809683.1|  PREDICTED: fasciclin-like arabinogalactan pr...  90.9    2e-16   
gb|AFW66310.1|  hypothetical protein ZEAMMB73_332533                  89.4    2e-16   
ref|XP_002982557.1|  hypothetical protein SELMODRAFT_58104            86.7    3e-16   
ref|NP_001062666.1|  Os09g0248100                                     89.7    4e-16   
ref|XP_009396657.1|  PREDICTED: serine/threonine-protein phosphat...  91.3    4e-16   
ref|XP_004952425.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.0    4e-16   
ref|XP_010485145.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.4    4e-16   
ref|XP_009132640.1|  PREDICTED: fasciclin-like arabinogalactan pr...  86.3    5e-16   
dbj|BAK07804.1|  predicted protein                                    87.4    5e-16   
dbj|BAK00054.1|  predicted protein                                    89.0    6e-16   
gb|EYU42817.1|  hypothetical protein MIMGU_mgv1a007557mg              89.0    6e-16   
ref|XP_011100491.1|  PREDICTED: fasciclin-like arabinogalactan pr...  89.0    6e-16   
ref|XP_001770866.1|  predicted protein                                85.5    1e-15   
ref|XP_008680887.1|  PREDICTED: fasciclin-like arabinogalactan pr...  88.2    1e-15   
ref|XP_008342795.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.5    2e-15   
dbj|BAK07384.1|  predicted protein                                    85.9    2e-15   
ref|XP_011085650.1|  PREDICTED: LOW QUALITY PROTEIN: fasciclin-li...  87.8    2e-15   
ref|XP_004244698.2|  PREDICTED: skin secretory protein xP2-like       85.9    2e-15   
dbj|BAK07212.1|  predicted protein                                    84.7    2e-15   
ref|XP_006280472.1|  hypothetical protein CARUB_v10026407mg           87.8    2e-15   
ref|XP_008362415.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.7    2e-15   
ref|XP_011089459.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.4    3e-15   
ref|XP_004976555.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.4    3e-15   
ref|XP_004954690.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.7    3e-15   
ref|XP_002451646.1|  hypothetical protein SORBIDRAFT_04g005190        85.5    4e-15   
ref|XP_008802746.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.0    4e-15   
ref|XP_010922339.1|  PREDICTED: fasciclin-like arabinogalactan pr...  87.0    4e-15   
ref|XP_008342793.1|  PREDICTED: uncharacterized protein LOC103405558  87.0    4e-15   
ref|XP_006649316.1|  PREDICTED: fasciclin-like arabinogalactan pr...  86.3    4e-15   
ref|XP_010252126.1|  PREDICTED: fasciclin-like arabinogalactan pr...  86.7    5e-15   
ref|XP_009354314.1|  PREDICTED: fasciclin-like arabinogalactan pr...  86.7    5e-15   
ref|XP_009370989.1|  PREDICTED: fasciclin-like arabinogalactan pr...  86.7    5e-15   
ref|XP_002436882.1|  hypothetical protein SORBIDRAFT_10g010500        86.7    7e-15   
ref|XP_008646777.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.3    9e-15   
ref|XP_004973191.1|  PREDICTED: fasciclin-like arabinogalactan pr...  85.5    1e-14   
gb|EAZ25443.1|  hypothetical protein OsJ_09260                        84.7    1e-14   
gb|AAM19119.1|AC104427_17  Putative endosperm specific protein        84.7    2e-14   
ref|XP_011089814.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.7    2e-14   
ref|XP_002452625.1|  hypothetical protein SORBIDRAFT_04g029330        84.0    3e-14   
ref|NP_001147121.1|  rat frizzled homolog1                            84.0    3e-14   
gb|ACN30673.1|  unknown                                               84.0    3e-14   
ref|XP_008776771.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.3    3e-14   
ref|XP_008674840.1|  PREDICTED: fasciclin-like arabinogalactan pr...  84.3    3e-14   
ref|XP_010236293.1|  PREDICTED: fasciclin-like arabinogalactan pr...  80.9    4e-14   
ref|XP_006647318.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.3    4e-14   
ref|XP_009354315.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.4    4e-14   
ref|XP_009365292.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.8    6e-14   
ref|XP_002451998.1|  hypothetical protein SORBIDRAFT_04g013580        80.9    6e-14   
ref|XP_010931257.1|  PREDICTED: fasciclin-like arabinogalactan pr...  83.2    7e-14   
gb|ACU21313.1|  unknown                                               80.1    7e-14   
gb|KHN13519.1|  Fasciclin-like arabinogalactan protein 1              79.3    8e-14   
ref|XP_008679063.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.8    8e-14   
ref|XP_010104070.1|  hypothetical protein L484_014256                 82.4    8e-14   
gb|EAY85759.1|  hypothetical protein OsI_07116                        80.1    9e-14   
ref|XP_003572987.1|  PREDICTED: fasciclin-like arabinogalactan pr...  82.4    9e-14   
ref|NP_001046788.1|  Os02g0461000                                     79.7    1e-13   
gb|EAZ22946.1|  hypothetical protein OsJ_06633                        79.3    1e-13   
ref|XP_003571258.1|  PREDICTED: fasciclin-like arabinogalactan pr...  79.7    1e-13   
ref|XP_002979355.1|  hypothetical protein SELMODRAFT_55277            82.0    1e-13   
tpg|DAA56901.1|  TPA: hypothetical protein ZEAMMB73_426702            82.8    2e-13   
ref|XP_010030212.1|  PREDICTED: uncharacterized protein LOC104420...  82.8    2e-13   
ref|XP_010030210.1|  PREDICTED: uncharacterized protein LOC104420...  82.8    2e-13   
ref|NP_001132327.1|  hypothetical protein precursor                   82.0    2e-13   
ref|XP_002992353.1|  hypothetical protein SELMODRAFT_45227            81.6    2e-13   
ref|XP_002440657.1|  hypothetical protein SORBIDRAFT_09g004700        81.3    3e-13   
gb|ACF83222.1|  unknown                                               79.0    3e-13   
ref|XP_010043558.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.3    3e-13   
ref|XP_009595320.1|  PREDICTED: fasciclin-like arabinogalactan pr...  81.3    4e-13   
ref|XP_002439922.1|  hypothetical protein SORBIDRAFT_09g022560        80.9    4e-13   
ref|XP_004961853.1|  PREDICTED: fasciclin-like arabinogalactan pr...  80.9    5e-13   
gb|EEE60667.1|  hypothetical protein OsJ_14125                        78.2    5e-13   
ref|XP_004236212.1|  PREDICTED: fasciclin-like arabinogalactan pr...  80.5    6e-13   
ref|NP_001044764.1|  Os01g0841100                                     79.7    9e-13   
gb|EEC71769.1|  hypothetical protein OsI_04379                        79.7    9e-13   



>ref|XP_004244694.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Solanum 
lycopersicum]
Length=251

 Score =   209 bits (533),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 134/170 (79%), Gaps = 5/170 (3%)
 Frame = +1

Query  259  AVILLTCIL-----STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVK  423
            ++I L C       S+ASAFN+T+IL++YP+Y  FNDL+++TGLA+ INA STIT+LA+ 
Sbjct  4    SIIPLLCSFLFLSASSASAFNVTKILSQYPDYTNFNDLISKTGLASEINAKSTITLLAIP  63

Query  424  NGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFL  603
            NG IGDL+S+P D+V +IL THV+LDY+D MKL +LK+  +KLTTM+Q++G A  +QGFL
Sbjct  64   NGAIGDLTSKPNDVVKKILTTHVVLDYYDTMKLQKLKDKTSKLTTMFQESGKASNDQGFL  123

Query  604  NVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            NVT+  +  VFGSAV+ +  D+ LE+ VM++PYNIS+LG+S  IVTPG+D
Sbjct  124  NVTAKDNTFVFGSAVKDAQRDSRLEKSVMNQPYNISILGISQPIVTPGID  173



>ref|XP_009593249.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Nicotiana 
tomentosiformis]
Length=272

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 129/169 (76%), Gaps = 4/169 (2%)
 Frame = +1

Query  259  AVILLTC----ILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKN  426
            +++ L C    + S+ASAFNIT+IL+++ +Y  FNDLL+++GLAT IN  +TIT+LAV N
Sbjct  4    SIVALLCYFLLLASSASAFNITKILSQFSDYSTFNDLLSKSGLATEINKRATITILAVPN  63

Query  427  GGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLN  606
            G IGDL+S+  D++  +L T+V+LDY+DI KL  LK+  AKLTTMYQQ+G A  +QGFLN
Sbjct  64   GAIGDLTSKSDDVLKSVLSTYVVLDYYDIPKLKNLKDKTAKLTTMYQQSGKAGYDQGFLN  123

Query  607  VTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            VT+     VFGSAV+ +  D+ LE+ VM++PYNIS+LG+S  IVTPGLD
Sbjct  124  VTAKDGSFVFGSAVKGAQRDSRLEKSVMNQPYNISILGISQPIVTPGLD  172



>ref|XP_006357096.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Solanum 
tuberosum]
Length=262

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 121/150 (81%), Gaps = 0/150 (0%)
 Frame = +1

Query  304  NITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEILR  483
            NIT+IL++YP+Y  FNDL+++TGLA+ INA STIT+LA+ NG IGDL+S+  D+V +IL 
Sbjct  24   NITKILSQYPDYTNFNDLISKTGLASEINAKSTITLLAIPNGAIGDLTSKSNDVVKKILT  83

Query  484  THVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFGSAVRRSPH  663
            THV+LDY+D MKL +LK+   KLTTM+Q++G A  +QGFLNVT+  +  VFGSAV+ +  
Sbjct  84   THVVLDYYDTMKLQKLKDKTTKLTTMFQESGKASNDQGFLNVTAKDNTFVFGSAVKDAQR  143

Query  664  DAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            D+ LE+ VM++PYNIS+LG+S  IVTPG+D
Sbjct  144  DSRLEKSVMNQPYNISILGISQPIVTPGID  173



>ref|XP_009781936.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Nicotiana 
sylvestris]
Length=273

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 129/169 (76%), Gaps = 4/169 (2%)
 Frame = +1

Query  259  AVILLTC----ILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKN  426
            +++ L C    + S+ASAFNIT+IL+++ +Y  FNDLL+++GLAT IN  +TIT+LAV N
Sbjct  4    SIVTLLCYFLLLASSASAFNITKILSQFSDYSTFNDLLSKSGLATEINKRTTITILAVPN  63

Query  427  GGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLN  606
            G IGDL+S+  D+++ +L T+V+LDY+DI KL  LK+  AK+TTMYQQ+G A  +QGFLN
Sbjct  64   GAIGDLTSKSDDVLNSVLSTYVVLDYYDIPKLKSLKDKTAKMTTMYQQSGKARFDQGFLN  123

Query  607  VTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            +T+     VFGSAV+ +  D+ LE+ VM++PYNISVLG+S   VTPGLD
Sbjct  124  MTAKDGSFVFGSAVKDAQRDSRLEKSVMNQPYNISVLGISQPFVTPGLD  172



>ref|XP_009612463.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Nicotiana 
tomentosiformis]
Length=276

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 125/168 (74%), Gaps = 3/168 (2%)
 Frame = +1

Query  259  AVILLTCIL---STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNG  429
            A +L T +L   ++ASAFNIT+IL++Y +Y  FN+LL+++GLAT IN  +TITVLAV NG
Sbjct  6    APLLCTFLLLAATSASAFNITKILSQYSDYSTFNELLSKSGLATEINKRATITVLAVPNG  65

Query  430  GIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNV  609
             IGDL+S+  D++   L THV+LDY+D MKL  +K   AKLT MYQQ+G A  +QGFLNV
Sbjct  66   AIGDLTSKSDDVLKRDLSTHVVLDYYDPMKLRNMKEKTAKLTNMYQQSGKAAYDQGFLNV  125

Query  610  TSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            T+     VFGSAV+ +  D+ LE+ VM++PYNIS+LG+S  I TPGLD
Sbjct  126  TAKDGSFVFGSAVKGAQRDSRLEKSVMNQPYNISILGISQPIFTPGLD  173



>ref|XP_010324668.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Solanum 
lycopersicum]
Length=265

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/162 (55%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = +1

Query  268  LLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLS  447
             L    S+ASAFNIT+IL +Y +Y  FN+LL+++GLA+ IN+  TIT+LAV NG +GDL+
Sbjct  12   FLILFASSASAFNITKILGQYSDYSTFNELLSKSGLASDINSRGTITLLAVPNGAVGDLT  71

Query  448  SRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG  627
            S+  D++  +L THV+LDY+D MKL ++K+  AK+TTM+QQ+G A  +QGFLNVT+    
Sbjct  72   SKSDDVLKRVLATHVVLDYYDPMKLQKMKDKTAKMTTMFQQSGKAAYDQGFLNVTAKDGS  131

Query  628  IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
             VFGSAV  +  D+ LE+ VM++PYNIS+LG+S  IVTPGLD
Sbjct  132  FVFGSAVVGAQRDSKLEKSVMNQPYNISILGISQPIVTPGLD  173



>ref|XP_009787705.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Nicotiana 
sylvestris]
Length=267

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/168 (55%), Positives = 125/168 (74%), Gaps = 3/168 (2%)
 Frame = +1

Query  259  AVILLTCIL---STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNG  429
            A IL T +L   ++ASAFNIT+IL++Y +Y  FN+LL+++GLA  IN  +TIT+LAV NG
Sbjct  6    APILCTFLLLAATSASAFNITKILSQYSDYSTFNELLSKSGLAAEINKRATITILAVPNG  65

Query  430  GIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNV  609
             IGDL+S+  D++   L T+VILDY+DI KL  +K   AK+T MYQQ+G A  +QGFLNV
Sbjct  66   AIGDLTSKSDDVLKRELSTYVILDYYDIPKLRSMKEKTAKMTNMYQQSGKAAYDQGFLNV  125

Query  610  TSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            T+     VFGSAV+ +  D+ LE+ VM++PYNIS+LG+S  +VTPGLD
Sbjct  126  TAKDGSFVFGSAVKGAQRDSRLEKSVMNQPYNISILGISQPMVTPGLD  173



>ref|XP_002527970.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34382.1| conserved hypothetical protein [Ricinus communis]
Length=280

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 117/165 (71%), Gaps = 1/165 (1%)
 Frame = +1

Query  265  ILLTCILS-TASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGD  441
            + L CI S T++AFNITRIL+ YP++  FN LLT+TGLA  IN+  TITVLAV NG IG 
Sbjct  11   LALFCIFSSTSTAFNITRILSNYPDFSTFNSLLTQTGLAQQINSRQTITVLAVSNGAIGG  70

Query  442  LSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGK  621
            +S +P+D+V  IL  HVILDY+D  KL  +K   + LTT+YQ TG A+  QGFLNVT   
Sbjct  71   VSGKPVDIVKRILSAHVILDYYDQKKLENIKKQSSILTTLYQTTGSANDQQGFLNVTKTP  130

Query  622  DGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
            +GIVFGSAV+ +P    LE  V S+PYNISVL V  +I  PG+++
Sbjct  131  NGIVFGSAVKGAPLTVSLEGSVASQPYNISVLQVGGVIEAPGIEN  175



>gb|EPS61284.1| hypothetical protein M569_13515, partial [Genlisea aurea]
Length=220

 Score =   177 bits (450),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 119/164 (73%), Gaps = 3/164 (2%)
 Frame = +1

Query  265  ILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDL  444
            +L++ I  + S FNIT +L RYPE+  F+DLLTRT LA  IN  STITVLAV N  +G +
Sbjct  1    VLISAI--SVSGFNITVLLGRYPEFSNFSDLLTRTQLAEEINHRSTITVLAVTNDKLGGV  58

Query  445  SSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKD  624
            + +P+D+   IL  HVILDYFD++KL++LKN + ++TT+YQ +G+A+  QGFL++    D
Sbjct  59   AGKPLDVAKRILSNHVILDYFDVLKLNKLKNTRTEVTTLYQASGVANDAQGFLDIVHKLD  118

Query  625  G-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            G +VFGSAVR S  D  LE  V S+PYNISVL VS +I+ PG+D
Sbjct  119  GSVVFGSAVRGSGLDCKLEGSVASQPYNISVLAVSQVIIAPGMD  162



>ref|XP_006382179.1| putative surface family protein [Populus trichocarpa]
 gb|ERP59976.1| putative surface family protein [Populus trichocarpa]
Length=302

 Score =   179 bits (454),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 117/164 (71%), Gaps = 0/164 (0%)
 Frame = +1

Query  265  ILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDL  444
            I   C++ST++AFN T+IL +YPE+  FNDLL+++GLA  +N+  TITVL + NG I  L
Sbjct  11   IAFLCLISTSTAFNSTKILAQYPEFANFNDLLSQSGLAQEMNSRQTITVLVLDNGSIDGL  70

Query  445  SSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKD  624
            S RP+D+   IL  HVILDY+D +KL +L+     +TT+YQ +G+AD  QGFLN++   +
Sbjct  71   SGRPLDIAKRILSAHVILDYYDQIKLSKLQKASTIVTTLYQASGVADNRQGFLNISRTAE  130

Query  625  GIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
            GI FGSA++ +P  A L + + S+PYNISVL VS  I TPG+++
Sbjct  131  GIKFGSAMKGAPLVASLVKSIYSQPYNISVLQVSEPIETPGIEN  174



>gb|KCW80704.1| hypothetical protein EUGRSUZ_C02101 [Eucalyptus grandis]
Length=286

 Score =   177 bits (449),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 108/156 (69%), Gaps = 0/156 (0%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
            S ASAFNIT++L+RYP++  FND LT+T L   IN   TITVLA+ N  +GD+S +P D+
Sbjct  19   SAASAFNITKLLSRYPDFSTFNDFLTQTKLYEQINRRQTITVLALDNSAVGDISGKPADV  78

Query  466  VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFGSA  645
            +  IL  HV+LDY+DI KL  L      LTT+YQ +G A   QGFLNVT     IVFGSA
Sbjct  79   LKSILSAHVVLDYYDIEKLTDLSKKSTLLTTLYQSSGTAQNQQGFLNVTKQSGEIVFGSA  138

Query  646  VRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            V+ + H+A L + V ++PYNISVL VS+ I+ PG+D
Sbjct  139  VKGASHNAKLVKAVAAQPYNISVLQVSSPIIAPGID  174



>ref|XP_006371803.1| putative surface family protein [Populus trichocarpa]
 gb|ERP49600.1| putative surface family protein [Populus trichocarpa]
Length=271

 Score =   176 bits (447),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = +1

Query  262  VILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGD  441
            + +L  I ST++AFNIT+IL +YPE+  FNDLLT++GLA  +++  TITVLA+ N  IG 
Sbjct  11   IAILCLISSTSTAFNITKILAQYPEFVSFNDLLTQSGLAKEMSSRETITVLALDNSSIGG  70

Query  442  LSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGK  621
            LS RP+D+   IL  HVILDY+D +KL +LK     +TT+YQ +G AD  QGFLN++   
Sbjct  71   LSGRPLDIAKRILSAHVILDYYDQIKLSKLKKASTIVTTLYQASGAADDRQGFLNISRTA  130

Query  622  DGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
            +GI FGSAV+ +P  A L + V ++PYNISVL VS  I  PG+++
Sbjct  131  EGIKFGSAVKGAPLVASLVKPVYAQPYNISVLQVSEPIEAPGIEN  175



>ref|XP_011015272.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Populus 
euphratica]
Length=271

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = +1

Query  262  VILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGD  441
            + +L  I ST++AFNIT+IL +YPE+  FNDLLT++GLA  +++  TITVLA+ N  IG 
Sbjct  11   IAILCLISSTSTAFNITKILGQYPEFVGFNDLLTQSGLAKEMSSRETITVLALDNSSIGG  70

Query  442  LSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGK  621
            L+ RP+D+   IL  HVILDY+D +KL +LK     +TT+YQ +G AD  QGFLN++   
Sbjct  71   LNGRPLDIAKRILSAHVILDYYDQIKLSKLKKASTIVTTLYQASGAADDRQGFLNISRTA  130

Query  622  DGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
            +GI FGSAV+ +P  A L + V ++PYNISVL VS  I  PG+++
Sbjct  131  EGIKFGSAVKGAPLVASLVKPVYAQPYNISVLQVSEPIEAPGIEN  175



>ref|XP_011045030.1| PREDICTED: fasciclin-like arabinogalactan protein 3 isoform X1 
[Populus euphratica]
 ref|XP_011045031.1| PREDICTED: fasciclin-like arabinogalactan protein 3 isoform X2 
[Populus euphratica]
Length=271

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 117/165 (71%), Gaps = 0/165 (0%)
 Frame = +1

Query  262  VILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGD  441
            + +L  I ST++AFNIT+IL +YPE+  FNDLLT++GLA  +++  TITVLA+ N  IG 
Sbjct  11   IAILCLISSTSTAFNITKILAQYPEFVGFNDLLTQSGLAKEMSSRETITVLALDNSSIGG  70

Query  442  LSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGK  621
            L+ RP+D+   IL  HVILDY+D +KL +LK     +TT+YQ +G AD  QGFLN++   
Sbjct  71   LNGRPLDIAKRILSAHVILDYYDQIKLSKLKKASTIVTTLYQASGAADDRQGFLNISRTA  130

Query  622  DGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
            +GI FGSAV+ +P  A L + V ++PYNISVL VS  I  PG+++
Sbjct  131  EGIKFGSAVKGAPLVASLVKPVYAQPYNISVLQVSEPIEAPGIEN  175



>gb|EYU22059.1| hypothetical protein MIMGU_mgv1a011491mg [Erythranthe guttata]
Length=280

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 121/176 (69%), Gaps = 2/176 (1%)
 Frame = +1

Query  232  MSPLQLSAAAVILLTCILS-TASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTIT  408
            MSP   ++  VI    +LS T SA NIT IL++YPE+  +N LLT T LAT IN   T+T
Sbjct  1    MSPSAAASLFVISAVLLLSATTSAHNITLILDQYPEFTTYNSLLTATDLATKINRRKTLT  60

Query  409  VLAVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADR  588
            +LA+ N  IGDL+ + +D+   IL TH++LDYFD++KL++ KN ++ +TT+YQ TG AD 
Sbjct  61   ILALTNDRIGDLAGKSVDVQTRILSTHIVLDYFDMLKLYKFKNTKSVVTTLYQSTGTADD  120

Query  589  NQGFLNVTSGKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
             QGFLNV    DG I FGSA+  +P DA +E  V  +PYNISVL +S +IV PG+D
Sbjct  121  MQGFLNVIHSTDGNIYFGSAMNGAPLDAKVEGSVAKQPYNISVLSISHVIVAPGID  176



>ref|XP_010048457.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Eucalyptus 
grandis]
Length=345

 Score =   176 bits (446),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 108/156 (69%), Gaps = 0/156 (0%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
            S ASAFNIT++L+RYP++  FND LT+T L   IN   TITVLA+ N  +GD+S +P D+
Sbjct  78   SAASAFNITKLLSRYPDFSTFNDFLTQTKLYEQINRRQTITVLALDNSAVGDISGKPADV  137

Query  466  VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFGSA  645
            +  IL  HV+LDY+DI KL  L      LTT+YQ +G A   QGFLNVT     IVFGSA
Sbjct  138  LKSILSAHVVLDYYDIEKLTDLSKKSTLLTTLYQSSGTAQNQQGFLNVTKQSGEIVFGSA  197

Query  646  VRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            V+ + H+A L + V ++PYNISVL VS+ I+ PG+D
Sbjct  198  VKGASHNAKLVKAVAAQPYNISVLQVSSPIIAPGID  233



>gb|KDP33435.1| hypothetical protein JCGZ_07006 [Jatropha curcas]
Length=299

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 111/164 (68%), Gaps = 0/164 (0%)
 Frame = +1

Query  262  VILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGD  441
            ++L T   ST+ AFNITR+L+ YPE+  FN LL++TGLA  IN+  TITVLAV N  I D
Sbjct  12   LVLFTVFSSTSMAFNITRLLSNYPEFSTFNRLLSQTGLAQQINSRQTITVLAVANRAIRD  71

Query  442  LSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGK  621
            LS +P+D+   +L  HVILDY+D  KL +L+     LTT+YQ TG+A   QGFLNVT   
Sbjct  72   LSGKPLDVTKRVLGAHVILDYYDETKLSKLQEKSNILTTLYQTTGVAVDQQGFLNVTRTP  131

Query  622  DGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
             GI+FG A + +P    L+  V S+PYNISVL VS +I  PG++
Sbjct  132  KGIMFGPAAKGAPLTVSLKGVVASQPYNISVLKVSGVIEAPGIE  175



>ref|XP_010265495.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Nelumbo 
nucifera]
Length=295

 Score =   166 bits (420),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 86/173 (50%), Positives = 120/173 (69%), Gaps = 3/173 (2%)
 Frame = +1

Query  247  LSAAAVILLTCILSTAS--AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAV  420
            ++ AA+++L+  L+ AS  AFNITR+L++Y ++  FND LT+T LA  IN   TITVLAV
Sbjct  19   MATAAILVLSLFLAFASTEAFNITRLLSQYSDFSNFNDYLTQTKLADSINRRQTITVLAV  78

Query  421  KNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGF  600
             NG +  LS +  DL+ ++L  HVILDY+DI K+ +L N    LTT++Q TG+A   QGF
Sbjct  79   DNGAVSSLSGKSPDLIKKVLSLHVILDYYDIDKIKKLSNKSTILTTLFQSTGVAVNKQGF  138

Query  601  LNVTSGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
            LNVT    G V FGSAV+ S  DA L ++V ++PYN+SVL VS++I   G++D
Sbjct  139  LNVTRFASGEVRFGSAVKGSSLDAQLIKKVAAQPYNLSVLQVSSVIYPTGIED  191



>ref|XP_007011569.1| Fasciclin-like arabinogalactan protein 17, putative [Theobroma 
cacao]
 gb|EOY29188.1| Fasciclin-like arabinogalactan protein 17, putative [Theobroma 
cacao]
Length=277

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 112/164 (68%), Gaps = 1/164 (1%)
 Frame = +1

Query  268  LLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLS  447
             L  + +T++AFN+T++L +YP+YG FNDLL++T LA  I+   TIT+LA+ N  I  ++
Sbjct  13   FLLALSTTSTAFNVTKVLGQYPDYGSFNDLLSQTKLAEEISHRQTITILALDNASISSIA  72

Query  448  SRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS-GKD  624
            SRP D V +IL  HV+LDYFD  K+ +L      LTT+YQ TG+A   QGFLN+T  G  
Sbjct  73   SRPSDEVKKILMNHVVLDYFDTFKIQKLGKKSVILTTLYQTTGLAQGQQGFLNITKLGPG  132

Query  625  GIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
             +VFGSAV+ +P  + L   V+S+P+N+SVL VST IV PG  +
Sbjct  133  EVVFGSAVKGAPLVSKLLGSVVSQPFNLSVLHVSTPIVAPGFGE  176



>ref|NP_001130104.1| hypothetical protein precursor [Zea mays]
 gb|ACF78231.1| unknown [Zea mays]
 gb|AFW70826.1| hypothetical protein ZEAMMB73_792931 [Zea mays]
Length=296

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 111/166 (67%), Gaps = 1/166 (1%)
 Frame = +1

Query  256  AAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGI  435
            A V++L C  S A+AFNITR+L ++ ++  FN+LL++T LA  IN   TITVLAV NG  
Sbjct  9    ALVLILACFSSPAAAFNITRLLGQFSDFTTFNNLLSQTKLAEDINRRQTITVLAVDNGAA  68

Query  436  GDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS  615
            G +SS P D+  ++L  HV+LDY+D  KL  +KNH A LTTM+Q +G A    GFLN T 
Sbjct  69   GGISSLPSDVQRKVLSMHVVLDYYDTAKLEAIKNHSALLTTMFQSSGQATDRMGFLNFTK  128

Query  616  GKDGI-VFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              DG+ VFGSA   +   +H+ + V SRPYNISVL VS  IV PG+
Sbjct  129  RSDGVMVFGSAQPGAQMTSHMVKSVTSRPYNISVLQVSAPIVPPGV  174



>ref|XP_010527113.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Tarenaya 
hassleriana]
Length=304

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/162 (49%), Positives = 105/162 (65%), Gaps = 0/162 (0%)
 Frame = +1

Query  265  ILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDL  444
            ILL    +T SA NITR+L ++P +   N+L T TG+A  IN H TITVLAV NG IG +
Sbjct  13   ILLILSSTTISALNITRVLEKFPNFSTMNELFTETGVAATINQHQTITVLAVDNGAIGSI  72

Query  445  SSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKD  624
            S+RP +    IL THV+LDYFD +KL  LK+     TT+YQ TG+ ++  GFLN T+   
Sbjct  73   SARPEEEQKNILMTHVVLDYFDELKLKGLKDRSNMFTTLYQTTGLGEQQNGFLNCTNING  132

Query  625  GIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             + FGSAV+ +P +A     V   PYN+SV+ +ST IV PGL
Sbjct  133  TLAFGSAVKGAPLNARYVTTVFQNPYNLSVIQISTPIVAPGL  174



>gb|EPS65223.1| hypothetical protein M569_09558, partial [Genlisea aurea]
Length=276

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 106/156 (68%), Gaps = 1/156 (1%)
 Frame = +1

Query  289  TASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLV  468
            T + FNIT IL +YP++  FN+ LT+  LA+ IN+  TITVLAV NGG+  LS    D +
Sbjct  19   TLAGFNITHILEQYPDFDSFNNFLTQAKLASQINSRQTITVLAVDNGGVSSLSGMSSDAM  78

Query  469  DEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSA  645
              +L  HV+LDY+D  KLH+L N  A LTT++Q +G+    QGFLNVT    G + FGSA
Sbjct  79   KNVLSAHVVLDYYDEAKLHKLSNKSAILTTLFQSSGLGRGQQGFLNVTILSGGKVAFGSA  138

Query  646  VRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            V  +P  A+L + V S+PYN+SVL VS++I+ PG+D
Sbjct  139  VAGAPLGANLVKSVFSQPYNVSVLQVSSLIIPPGID  174



>ref|XP_009394682.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=267

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/161 (50%), Positives = 110/161 (68%), Gaps = 1/161 (1%)
 Frame = +1

Query  277  CILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRP  456
            C    A++ NIT IL ++P++  F+DLLTRT LA+ IN+  TITVLAV NG I   S +P
Sbjct  11   CQGKGAASHNITTILAKFPDFSTFSDLLTRTQLASDINSRKTITVLAVNNGAISSASGQP  70

Query  457  IDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-  633
             D++ +IL  HV+LDY+D  K H+L+N  A LTT++Q +G+A    GFLNVT   +G V 
Sbjct  71   TDVLKKILSLHVVLDYYDGDKFHKLRNRSAILTTLFQSSGVASGRSGFLNVTDMDNGQVS  130

Query  634  FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
            FGSAV  S  DA+    + ++PYNISV+ +S++IV PGL D
Sbjct  131  FGSAVPGSSLDANFVTVLATQPYNISVVEISSVIVPPGLSD  171



>ref|XP_004952427.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Setaria 
italica]
Length=295

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 110/166 (66%), Gaps = 1/166 (1%)
 Frame = +1

Query  256  AAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGI  435
            A +++L  + S A+AFNITR+L  +P++  FN+LL++  LA  IN   TITVLAV NG  
Sbjct  9    ALLLVLAGLTSPAAAFNITRLLGEFPDFTTFNNLLSQAKLADDINRRQTITVLAVDNGAA  68

Query  436  GDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS  615
            G +SS P D+  ++L  HV+LDY+D  KL  +KNH   LTTM+Q +G A    GFLN T 
Sbjct  69   GGISSLPSDVQRKVLSMHVVLDYYDTAKLGAIKNHTTLLTTMFQSSGQATDRMGFLNFTK  128

Query  616  GKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              DG +VFGSA   +P ++ + + V SRPYNISVL VS  IV PG+
Sbjct  129  RSDGTMVFGSAEPGAPKNSQMVKSVASRPYNISVLQVSAPIVPPGV  174



>emb|CAN66163.1| hypothetical protein VITISV_008126 [Vitis vinifera]
Length=305

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 107/154 (69%), Gaps = 1/154 (1%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVD  471
            A AFNITR+L ++P++  FN  L++T ++  IN   TITVLAV+NG I  ++ + +D + 
Sbjct  25   AQAFNITRLLGQFPDFSTFNSYLSQTNISIGINKRQTITVLAVENGAIAPITXKSLDDIK  84

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSAV  648
             ILR HVILDY+D+ KLH+L N  A LTT++Q TG A+  QGFLNVT    G +VFGSAV
Sbjct  85   NILRLHVILDYYDVAKLHKLSNKTALLTTLFQATGQANGQQGFLNVTELSSGQVVFGSAV  144

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              S   A L + V S+P+NISVL +ST I+ PG+
Sbjct  145  AGSGLQAKLVKTVASQPFNISVLQISTPILAPGI  178



>ref|XP_011082039.1| PREDICTED: LOW QUALITY PROTEIN: fasciclin-like arabinogalactan 
protein 3 [Sesamum indicum]
Length=266

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 119/175 (68%), Gaps = 12/175 (7%)
 Frame = +1

Query  247  LSAAAVILLTCIL-----STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITV  411
            +S +A+IL+  +L     +T SAFNITR+L +YPE+  FN LL++T          T+TV
Sbjct  1    MSHSAMILIAAVLLISSAATTSAFNITRMLEQYPEFSEFNGLLSKT------RRRRTVTV  54

Query  412  LAVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRN  591
            LA+  G +GDLSS+  D+   IL  HV+LDY+D  KL++LKN +A LTT+YQ +G AD  
Sbjct  55   LALSAGHLGDLSSKTEDVQKRILSNHVVLDYYDTTKLNKLKNGKAVLTTLYQASGTADDQ  114

Query  592  QGFLNVTSGKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            QGF+NVT   +G I+FGSA + S  ++ LE  V+++PYNISVL +S+ I+  G+D
Sbjct  115  QGFINVTHNTEGHIIFGSAEKGSQMNSQLEGAVVAQPYNISVLSISSPIIANGID  169



>ref|XP_008445580.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Cucumis 
melo]
Length=296

 Score =   159 bits (402),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 104/151 (69%), Gaps = 2/151 (1%)
 Frame = +1

Query  304  NITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEILR  483
            NITR+LNR+PE+G FNDLLT+T L   IN   TITVLA+ N  +G +S   +D++ +IL 
Sbjct  34   NITRLLNRFPEFGAFNDLLTKTRLFEQINTRQTITVLALNNATVGAISGNSLDVIKQILS  93

Query  484  THVILDYFDIMKLHRLKNHQAK-LTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAVRRS  657
             HVILDY+D+ K+ +L   +A  LTTM+Q TG A+  QGFL V   K G V FGSA +++
Sbjct  94   AHVILDYYDVAKMRKLSADKATVLTTMFQSTGDAENQQGFLKVVLNKRGEVEFGSASKKA  153

Query  658  PHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            P  A L + V S+PYNISVL +S  IV PG+
Sbjct  154  PLSAKLVKPVASQPYNISVLQISAPIVIPGI  184



>ref|XP_002282846.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Vitis vinifera]
Length=305

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 107/154 (69%), Gaps = 1/154 (1%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVD  471
            A AFNITR+L ++P++  FN  L++T ++  IN   TITVLAV+NG I  ++ + +D + 
Sbjct  25   AQAFNITRLLGQFPDFSTFNSYLSQTNISIGINRRQTITVLAVENGAIAPITGKSMDDIK  84

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSAV  648
             ILR HVILDY+D+ KLH+L N  A LTT++Q TG A+  QGFLNVT    G +VFGSAV
Sbjct  85   NILRLHVILDYYDVAKLHKLSNKTALLTTLFQATGQANGQQGFLNVTELSSGQVVFGSAV  144

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              S   A L + V S+P+NISVL +ST I+ PG+
Sbjct  145  AGSGLQAKLVKTVASQPFNISVLQISTPILAPGI  178



>ref|XP_008466329.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Cucumis 
melo]
Length=278

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 116/169 (69%), Gaps = 2/169 (1%)
 Frame = +1

Query  253  AAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGG  432
            +AA++    + S ASAFNIT++L+++P++  FNDLLT+T LA  IN   TIT+LAV NG 
Sbjct  7    SAALLFNFLLFSAASAFNITKLLSQFPDFTNFNDLLTQTKLADDINNRKTITILAVDNGA  66

Query  433  IGDLSSRPIDLVDEILRTHVILDYFDIMKLHRL-KNHQAKLTTMYQQTGIADRNQGFLNV  609
            I  +S +P+D++  IL  HVILDY+D+ KL +L  ++   LTT+YQ +G A   QGFL V
Sbjct  67   ISGISGKPLDVMKRILSVHVILDYYDVQKLGKLSSDNTTVLTTLYQTSGAATNQQGFLKV  126

Query  610  TSGKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            T   +G + F SAV+ +  D+ L + V S+PYNISVL +++ I  PG+D
Sbjct  127  TLINEGEVAFESAVKGATADSKLVKSVASQPYNISVLQITSPIQVPGID  175



>ref|XP_002452018.1| hypothetical protein SORBIDRAFT_04g015850 [Sorghum bicolor]
 gb|EES04994.1| hypothetical protein SORBIDRAFT_04g015850 [Sorghum bicolor]
Length=296

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 109/166 (66%), Gaps = 1/166 (1%)
 Frame = +1

Query  256  AAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGI  435
            A  ++L+   S A+AFNITR+L  + ++  FN+LL++T LA  IN   TITVLAV NG  
Sbjct  9    AVALILSYFSSPAAAFNITRLLGEFSDFTTFNNLLSQTKLAEDINRRQTITVLAVDNGAA  68

Query  436  GDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS  615
            G +SS P D+  ++L  HV+LDY+D  KL  +KNH A LTTM+Q +G A    GFLN T 
Sbjct  69   GGISSLPSDVQRKVLSMHVVLDYYDTAKLGAIKNHSALLTTMFQSSGKATDRMGFLNFTK  128

Query  616  GKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              DG++ FGSA   +   +H+ + V SRPYNISVL VS  IV PG+
Sbjct  129  RSDGVMLFGSAQPGAQMTSHMVKSVASRPYNISVLQVSDPIVPPGV  174



>ref|XP_004136457.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Cucumis 
sativus]
 ref|XP_004162501.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Cucumis 
sativus]
 gb|KGN60156.1| hypothetical protein Csa_3G881690 [Cucumis sativus]
Length=280

 Score =   157 bits (398),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 117/169 (69%), Gaps = 2/169 (1%)
 Frame = +1

Query  253  AAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGG  432
            +AA++    + S ASAFNIT++L+++P++  FNDLLT+T LA  IN+  TIT+LAV NG 
Sbjct  7    SAALLFNFLLFSAASAFNITKLLSQFPDFTNFNDLLTQTKLADDINSRKTITILAVDNGA  66

Query  433  IGDLSSRPIDLVDEILRTHVILDYFDIMKLHRL-KNHQAKLTTMYQQTGIADRNQGFLNV  609
            I  +S +P+D++  IL  HVILDY+D+ KL +L  ++   LTT+YQ +G A   QGFL V
Sbjct  67   ISGISGKPLDVMKRILSVHVILDYYDVQKLGKLSSDNTTVLTTLYQTSGTATNEQGFLKV  126

Query  610  TSGKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            T   +G + F SAV+ +  D+ L + V+S+PYNI VL +++ I  PG+D
Sbjct  127  TLINEGEVAFKSAVKGATADSKLVKSVVSQPYNIVVLQITSPIQVPGID  175



>ref|XP_009418876.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=296

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 107/154 (69%), Gaps = 1/154 (1%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVD  471
            A++ NITRIL ++ ++  FN LLT+T L + IN+  TITVLAV NG    +SSRP D + 
Sbjct  19   AASHNITRILAQFDDFSTFNSLLTQTQLVSDINSRRTITVLAVDNGAASSVSSRPTDELK  78

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSAV  648
            +IL  HV+LDY+D  KLH+L NH A LTT++Q TG+A    GFLNVT+  +G I FGSAV
Sbjct  79   KILSVHVVLDYYDDAKLHKLPNHTAILTTLFQATGLASGRNGFLNVTNMGNGQIAFGSAV  138

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              S   A+  + V +RPYNISV+ +S++IV P +
Sbjct  139  PGSSLVANFVKVVATRPYNISVIQISSVIVPPNI  172



>ref|XP_004138878.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Cucumis 
sativus]
 ref|XP_004160862.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Cucumis 
sativus]
 gb|KGN62878.1| hypothetical protein Csa_2G379090 [Cucumis sativus]
Length=300

 Score =   154 bits (388),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +1

Query  304  NITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEILR  483
            NITR+LNR+P++G FN+LLT+T L   IN+  TITVLA+ N  +G ++   +D++ +IL 
Sbjct  35   NITRLLNRFPDFGAFNELLTKTHLYEQINSRQTITVLALSNATVGAIAGNSLDVIKQILS  94

Query  484  THVILDYFDIMKLHRLKNHQAK-LTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAVRRS  657
             HVILDY+D+ K+ +L   +A  LTTM+Q TG A+  QGFL V   K G V FGSA +++
Sbjct  95   AHVILDYYDVEKMRKLSTDKATVLTTMFQSTGDAENQQGFLKVVLNKRGEVEFGSAAKKA  154

Query  658  PHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            P  A L + V S+PYNIS+L VS  IV PG+
Sbjct  155  PLSAKLMKTVASQPYNISLLQVSAPIVIPGI  185



>ref|XP_009396684.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=309

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 106/150 (71%), Gaps = 1/150 (1%)
 Frame = +1

Query  304  NITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEILR  483
            NIT++L + P++  FNDLLT+T LA  IN+ STIT+LAV NG +  +S  PID + +IL 
Sbjct  26   NITKMLAQLPDFSTFNDLLTQTHLAADINSRSTITILAVSNGAVSSVSDEPIDTIKKILS  85

Query  484  THVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSAVRRSP  660
             HVILDY+D  K+H++ NH A LTT++Q +G A    GFLNVT+ ++G I FGSAV  S 
Sbjct  86   LHVILDYYDDNKIHKISNHTAILTTLFQASGGAAGQNGFLNVTNMENGQIAFGSAVAGSS  145

Query  661  HDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              A+  + + ++PYNISVL +S++IV P L
Sbjct  146  LTANFVKVLATQPYNISVLQISSVIVPPSL  175



>gb|KFK32632.1| hypothetical protein AALP_AA6G268600 [Arabis alpina]
Length=279

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 104/174 (60%), Gaps = 4/174 (2%)
 Frame = +1

Query  241  LQLSAAAVILLTCIL----STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTIT  408
            + L A++ IL   IL    S  SA NITR+L +YPE+   N+LL +T L   IN   TIT
Sbjct  1    MGLKASSSILCLTILLGVSSIVSAVNITRVLEKYPEFSTMNELLAKTELTPIINKRQTIT  60

Query  409  VLAVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADR  588
            VLA+ N  IG +S RP + +  IL  HV+LDYFD +KL  LK+    LTT+YQ TG+  +
Sbjct  61   VLALSNDAIGSISGRPEEEIKSILMNHVVLDYFDELKLKALKDKSTMLTTLYQSTGLGQQ  120

Query  589  NQGFLNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              GFLN +     I FGSAV+ +P  A     V   P+N+SV+ +S  IV PG+
Sbjct  121  QNGFLNCSKSNGKIYFGSAVKGTPQTAEYITTVFRNPFNLSVVQISMPIVAPGI  174



>ref|XP_006368661.1| hypothetical protein POPTR_0001s07490g [Populus trichocarpa]
 gb|ERP65230.1| hypothetical protein POPTR_0001s07490g [Populus trichocarpa]
Length=310

 Score =   154 bits (388),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 110/166 (66%), Gaps = 1/166 (1%)
 Frame = +1

Query  280  ILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPI  459
            + +T  A NIT+IL++YP++  F+  LT+T LA  IN+  TITVL V+NG +  LS +P 
Sbjct  18   LFNTVRASNITQILSQYPDFSTFSSYLTQTQLAGEINSRQTITVLVVENGNMSPLSGKPN  77

Query  460  DLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS-GKDGIVF  636
              +  +L  HVILDY+D+ KL +L+N  A LTT++Q +G A   QGFLNVT  G + + F
Sbjct  78   GEIKNVLSGHVILDYYDVAKLQKLQNKTAMLTTLFQSSGQAKGQQGFLNVTVLGSNSVAF  137

Query  637  GSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDDDDGRTA  774
            GSAV  S   ++L + V S+PYNISVL VS IIV+ G  + +  T+
Sbjct  138  GSAVPGSSLSSNLVKSVSSQPYNISVLQVSNIIVSAGTGNANSTTS  183



>emb|CDP12467.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/169 (42%), Positives = 111/169 (66%), Gaps = 5/169 (3%)
 Frame = +1

Query  259  AVILLTCIL----STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKN  426
            ++I L+C+L     T +AFNIT IL   P +  FNDLL++ GL   IN+ S +T+LA+ N
Sbjct  9    SLIFLSCLLLASSVTTAAFNITAILGDIPSFSNFNDLLSKAGLVKAINSQSPVTILAIPN  68

Query  427  GGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLN  606
              IGDL+ +P D++   L THV+LDY+D++KL   KN   ++TT++Q+TG+A  +QGFL 
Sbjct  69   EHIGDLAGKPADVIKITLMTHVVLDYYDLLKLANAKN-GTRMTTLFQKTGVATYDQGFLI  127

Query  607  VTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            +      ++F SA + +PH+  +   V   P+N S++ VS+ I+TPG+D
Sbjct  128  LNRSHGQLIFSSAAKGAPHNVQVVATVTQHPFNYSIISVSSAIMTPGVD  176



>ref|XP_002880584.1| hypothetical protein ARALYDRAFT_481301 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56843.1| hypothetical protein ARALYDRAFT_481301 [Arabidopsis lyrata subsp. 
lyrata]
Length=279

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 102/172 (59%), Gaps = 2/172 (1%)
 Frame = +1

Query  241  LQLSAAAVIL--LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVL  414
            L++S++ V L  L  + S  SA NITR+L +YPE+    +LL +T L   IN   TITVL
Sbjct  3    LKVSSSLVCLTILLGVSSIVSAVNITRVLEKYPEFSTMTELLAKTELTPIINKRQTITVL  62

Query  415  AVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQ  594
            A+ N  IG +S RP + +  IL  HVILDYFD +KL  LK     LTT+YQ TG+  +  
Sbjct  63   ALSNDAIGSISGRPEEELKNILMNHVILDYFDELKLKALKERSTLLTTLYQSTGLGQQQN  122

Query  595  GFLNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            GFLN T     I FGS V+ +P  A     V   PYN+SV+ +S  IV PGL
Sbjct  123  GFLNCTKSNGKIYFGSGVKGAPQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>ref|NP_180021.1| fasciclin-like arabinogalactan protein 3 [Arabidopsis thaliana]
 sp|Q9ZQ23.1|FLA3_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAD18116.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAS76230.1| At2g24450 [Arabidopsis thaliana]
 gb|AAS92327.1| At2g24450 [Arabidopsis thaliana]
 dbj|BAF00374.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 dbj|BAF01512.1| predicted GPI-anchored protein [Arabidopsis thaliana]
 gb|AEC07579.1| fasciclin-like arabinogalactan protein 3 [Arabidopsis thaliana]
Length=280

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/172 (45%), Positives = 102/172 (59%), Gaps = 2/172 (1%)
 Frame = +1

Query  241  LQLSAAAVIL--LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVL  414
            L++S++ + L  L  + S  SA NITR+L +YPE+    +LL +T L   IN   TITVL
Sbjct  3    LKVSSSLLCLTILLAVSSIVSAVNITRVLEKYPEFSTMTELLAKTELTPIINKRQTITVL  62

Query  415  AVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQ  594
            A+ N  IG +S RP + V  IL  HV+LDYFD +KL  LK     LTT+YQ TG+  +  
Sbjct  63   ALNNDAIGSISGRPEEEVKNILMNHVVLDYFDELKLKALKEKSTLLTTLYQSTGLGQQQN  122

Query  595  GFLNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            GFLN T     I FGS V+ +P  A     V   PYN+SV+ +S  IV PGL
Sbjct  123  GFLNCTKSNGKIYFGSGVKGAPQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>ref|XP_002271150.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Vitis vinifera]
Length=312

 Score =   151 bits (382),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 108/156 (69%), Gaps = 1/156 (1%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVD  471
            A+AFNIT++L ++ ++  FN  LT T LA  IN   +IT+LAV NGG+  LS +P D++ 
Sbjct  23   ATAFNITQLLAQFSDFSTFNGYLTDTQLAADINKRQSITILAVDNGGLSPLSGKPKDVIK  82

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS-GKDGIVFGSAV  648
            +++  HV+LDYFD+ KL +L N+ A L T++Q +G +   QGFLNVT     G+VFGSAV
Sbjct  83   KVVSLHVVLDYFDVPKLQKLPNNTATLPTLFQASGESTGQQGFLNVTHLSTGGVVFGSAV  142

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
              +   A+L + + S+PYNISVL +ST+I+  GLD+
Sbjct  143  HGTTLGANLVKSIASQPYNISVLQISTVIIPSGLDN  178



>ref|XP_011034724.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Populus 
euphratica]
Length=314

 Score =   150 bits (380),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 108/166 (65%), Gaps = 1/166 (1%)
 Frame = +1

Query  280  ILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPI  459
            + +T  A NIT+IL++YP++  F+  LT+T LA  IN+  TITVL V+NG +  LS +P 
Sbjct  18   LFNTVRASNITQILSQYPDFSTFSSYLTQTQLAGEINSRQTITVLVVENGNMSPLSGKPN  77

Query  460  DLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS-GKDGIVF  636
              +  +L  HVILDY+D+ KL +L+   A LTT++Q +G A   QGFLNVT  G + + F
Sbjct  78   GEIKNVLSEHVILDYYDVAKLQKLQKKTAMLTTLFQSSGQAKGQQGFLNVTVLGSNSVAF  137

Query  637  GSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDDDDGRTA  774
            GSAV  S   ++L + V S+PYNISVL VS IIV  G  + +  T+
Sbjct  138  GSAVPGSSLSSNLVKSVSSQPYNISVLQVSNIIVPAGTGNTNSSTS  183



>ref|XP_011082708.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Sesamum 
indicum]
Length=322

 Score =   150 bits (380),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 106/162 (65%), Gaps = 1/162 (1%)
 Frame = +1

Query  271  LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS  450
             + +  +A AFNIT++L++Y  +  FN  LT T LA+ IN+  +ITVL V+N  +  LS 
Sbjct  13   FSLLFHSAVAFNITQVLSQYASFSTFNSFLTLTNLASEINSRQSITVLVVENNNLSPLSG  72

Query  451  RPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS-GKDG  627
            +  D++ +I+  HVILDYFD+ KL +L N    +TT++Q TG+A   QGF+NVT    D 
Sbjct  73   KSSDVLKKIMSVHVILDYFDVPKLQKLSNKSTIVTTLFQTTGLAKGQQGFVNVTQLSSDS  132

Query  628  IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            I FGSAV  S   ++L + V+S+PYN SVL V+ +I+  G+D
Sbjct  133  IAFGSAVPGSTISSNLVKSVVSQPYNFSVLQVTNVIIPEGID  174



>ref|XP_011082038.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Sesamum 
indicum]
Length=255

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 118/178 (66%), Gaps = 7/178 (4%)
 Frame = +1

Query  232  MSPLQLSAAAVILLTCIL----STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHS  399
            MSP   S +A+IL++ +L    +T SAFN+T IL +YP+Y  FN+LL++TG+A  IN  +
Sbjct  1    MSP---STSALILVSAVLLLSSATTSAFNVTLILEKYPDYTEFNNLLSKTGVADEINRRN  57

Query  400  TITVLAVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGI  579
            TIT+LA+ NG  GD+SS+  D+   I+ THV+LDY+D+ KL +    +  LTT+ Q  G 
Sbjct  58   TITILALSNGRFGDISSKKEDVQKRIISTHVVLDYYDVAKLKQYNTSKGPLTTLCQTYGQ  117

Query  580  ADRNQGFLNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            A + QGFLNV      +   SAV+ +  D+ +E  V S+PYNIS+L +S+ I+ PG+D
Sbjct  118  AKQQQGFLNVVVKDSEVFLSSAVKGASMDSKVESSVASQPYNISILSISSPIIAPGID  175



>emb|CAN62804.1| hypothetical protein VITISV_011795 [Vitis vinifera]
Length=365

 Score =   151 bits (382),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 108/156 (69%), Gaps = 1/156 (1%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVD  471
            A+AFNIT++L +Y ++  FN  LT T LA  IN   +IT+LAV NGG+  LS +P D++ 
Sbjct  23   ATAFNITQLLAQYSDFSTFNGYLTDTQLAADINKRQSITILAVDNGGLSPLSGKPKDVIK  82

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS-GKDGIVFGSAV  648
            +++  HV+LDYFD+ KL +L N+ A L T++Q +G +   QGFLNVT     G+VFGSAV
Sbjct  83   KVVSLHVVLDYFDVPKLQKLPNNTATLPTLFQASGESTGQQGFLNVTHLSTGGVVFGSAV  142

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
              +   A+L + + S+PYNISVL +ST+I+  GLD+
Sbjct  143  HGTTLGANLVKSIASQPYNISVLQISTVIIPSGLDN  178



>gb|KDP41920.1| hypothetical protein JCGZ_26938 [Jatropha curcas]
Length=228

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 98/146 (67%), Gaps = 0/146 (0%)
 Frame = +1

Query  316  ILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEILRTHVI  495
            +LN+Y +YG FNDLL++T +A  IN+  TITVLAV NG +G L+    D+   IL  HV+
Sbjct  1    MLNQYSDYGTFNDLLSKTRIAEAINSRRTITVLAVDNGNLGALTGYSTDVQKHILDLHVV  60

Query  496  LDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFGSAVRRSPHDAHL  675
            LDY+D  KL  +K   A LTT+YQ TG A   QGFLNVT+    I FGSAV+ S  +A+L
Sbjct  61   LDYYDETKLKNIKKKSALLTTLYQSTGSARGQQGFLNVTNDGGSIRFGSAVKGSGLNANL  120

Query  676  EEEVMSRPYNISVLGVSTIIVTPGLD  753
               V S+PYNISVL VS II+  GLD
Sbjct  121  VGSVTSQPYNISVLQVSNIIIPQGLD  146



>ref|XP_002512774.1| Glycoprotein X precursor, putative [Ricinus communis]
 gb|EEF49277.1| Glycoprotein X precursor, putative [Ricinus communis]
Length=339

 Score =   149 bits (376),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 82/174 (47%), Positives = 114/174 (66%), Gaps = 6/174 (3%)
 Frame = +1

Query  232  MSPLQLSAAAVILLTC-----ILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAH  396
            MS L LS+ +V  L C     + ST SAFNIT+IL+ + ++  FNDLLT+T LA  IN+ 
Sbjct  1    MSLLTLSSNSVPAL-CFSFFILFSTVSAFNITKILSDHSDFSNFNDLLTKTQLAATINSR  59

Query  397  STITVLAVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTG  576
             TIT+LAV NG I  +S + +D+  +IL  HVILDY+D  KL +L N    LTT+YQ +G
Sbjct  60   QTITILAVDNGNISPISGQSVDMQKKILSMHVILDYYDDAKLQKLPNKTELLTTLYQSSG  119

Query  577  IADRNQGFLNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIV  738
             A   +GFLN T   + +  GSAV  S  +A L + V+++PYN+S+L VS+II+
Sbjct  120  QAKGQEGFLNATLVNNQVTLGSAVPGSGLNAKLVKAVVTQPYNVSILQVSSIIM  173



>ref|XP_010472452.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Camelina 
sativa]
Length=280

 Score =   147 bits (371),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 101/172 (59%), Gaps = 2/172 (1%)
 Frame = +1

Query  241  LQLSAAAVIL--LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVL  414
            L++S++ + L  L  + S  SA NITR L +YPE+    +L  +T L   IN   TITVL
Sbjct  3    LKVSSSLLCLAILLAVSSVVSAVNITRALEKYPEFSSMTELFAKTELTPIINKRQTITVL  62

Query  415  AVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQ  594
            A+ N  IG +S RP + +  IL  HV+LDYFD +KL  LK+    LTT+YQ TG+  +  
Sbjct  63   ALSNDAIGSISGRPEEELKNILMNHVVLDYFDELKLKALKDKSTLLTTLYQSTGLGQQQN  122

Query  595  GFLNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            GFLN T     I FGS V+ +P  A     V   PYN+SV+ +S  IV PGL
Sbjct  123  GFLNCTKSNGKIYFGSGVKGAPQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>ref|XP_010417204.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Camelina 
sativa]
Length=280

 Score =   147 bits (371),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 101/172 (59%), Gaps = 2/172 (1%)
 Frame = +1

Query  241  LQLSAAAVIL--LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVL  414
            L++S++ + L  L  + S  SA NITR L +YPE+    +L  +T L   IN   TITVL
Sbjct  3    LKVSSSLLCLAILLAVSSVVSAVNITRALEKYPEFSSMTELFAKTELTPIINKRQTITVL  62

Query  415  AVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQ  594
            A+ N  IG +S RP + +  IL  HV+LDYFD +KL  LK+    LTT+YQ TG+  +  
Sbjct  63   ALSNDAIGSISGRPEEELKNILMNHVVLDYFDELKLKALKDKSTLLTTLYQSTGLGQQQN  122

Query  595  GFLNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            GFLN T     I FGS V+ +P  A     V   PYN+SV+ +S  IV PGL
Sbjct  123  GFLNCTKSNGKIYFGSGVKGAPQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>ref|XP_010429425.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Camelina 
sativa]
Length=281

 Score =   147 bits (370),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 73/161 (45%), Positives = 94/161 (58%), Gaps = 0/161 (0%)
 Frame = +1

Query  268  LLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLS  447
            +L  + S  SA NITR L +YPE+    +L  +T L   IN   TITVLA+ N  IG +S
Sbjct  14   ILLAVSSIVSAVNITRALEKYPEFSSMTELFAKTELTPIINKRQTITVLALSNDAIGSIS  73

Query  448  SRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG  627
             RP + +  IL  HV+LDYFD +KL  LK+    LTT+YQ TG+  +  GFLN T     
Sbjct  74   GRPEEELKNILMNHVVLDYFDELKLKALKDKSTLLTTLYQSTGLGQQQNGFLNCTKSNGK  133

Query  628  IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            I FGS V+ +P  A     V   PYN+SV+ +S  IV PGL
Sbjct  134  IYFGSGVKGAPQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>ref|XP_006664971.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Oryza 
brachyantha]
Length=305

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 99/151 (66%), Gaps = 1/151 (1%)
 Frame = +1

Query  301  FNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEIL  480
            FNITRIL    ++  FN+LL +  LA  IN   TITVLAV NG  G +SS P D+  ++L
Sbjct  26   FNITRILGELSDFSTFNNLLMQKKLADEINRRQTITVLAVDNGAAGGISSLPSDVQRKVL  85

Query  481  RTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSAVRRS  657
              HV+LDY+D  KL+ +KNH  +LTT++Q +G A  + GFLN T   DG +VFGSA   +
Sbjct  86   SVHVVLDYYDTKKLNAMKNHSTRLTTLFQSSGQATNHMGFLNCTKHSDGTMVFGSAEPGA  145

Query  658  PHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            P  + L + + SRPYNISVL VS+ IV P +
Sbjct  146  PVTSQLVKLIASRPYNISVLQVSSAIVPPSI  176



>ref|XP_009615226.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Nicotiana 
tomentosiformis]
Length=299

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 106/159 (67%), Gaps = 1/159 (1%)
 Frame = +1

Query  280  ILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPI  459
            IL  A AFNIT +LN+Y  +  FN+ LT+TG+A+ IN+  TITVL V+N  +  LS +  
Sbjct  16   ILCHAKAFNITNLLNQYSSFSNFNNYLTQTGVASAINSRQTITVLVVENSNLSPLSGKSQ  75

Query  460  DLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS-GKDGIVF  636
            D++  I+R HV+LDY+D+ KL +L N   K  T++Q TG A+ +QG+LNVT  G   +  
Sbjct  76   DVLANIMRVHVLLDYYDVQKLQKLPNKTMKAPTLFQTTGQANSDQGYLNVTDLGSGSVAL  135

Query  637  GSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            GSA + S   ++L + + S+PYNIS+L +S +I+  G+D
Sbjct  136  GSAAKGSTLGSNLVKSIASQPYNISILQISNVIIPLGID  174



>ref|XP_006296192.1| hypothetical protein CARUB_v10025354mg [Capsella rubella]
 gb|EOA29090.1| hypothetical protein CARUB_v10025354mg [Capsella rubella]
Length=280

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 102/169 (60%), Gaps = 3/169 (2%)
 Frame = +1

Query  253  AAAVILLTCIL---STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVK  423
            +++++ LT +L   S  SA NITR+L +YPE+    +L  +T L   IN   TITVLA+ 
Sbjct  6    SSSLLCLTILLGVSSIVSAVNITRVLEKYPEFSSMLELFAKTELTPIINKRQTITVLALS  65

Query  424  NGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFL  603
            N  IG +S RP + +  IL  HV+LDY+D +KL  LK+    LTT+YQ TG+  +  GFL
Sbjct  66   NDAIGSISGRPEEEIKNILMNHVVLDYYDELKLKALKDKSTLLTTLYQSTGLGQQQNGFL  125

Query  604  NVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            N +     I FGSAV+ +P  A     V   PYN+SV+ +S  IV PGL
Sbjct  126  NCSKSNGKIYFGSAVKGAPQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>emb|CDX76814.1| BnaC08g34000D [Brassica napus]
Length=280

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 103/174 (59%), Gaps = 4/174 (2%)
 Frame = +1

Query  241  LQLSAAAVILLTCIL----STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTIT  408
            + L A++ +L   IL    S AS+ NITR L  YPE+    +LL +T L   IN   TIT
Sbjct  1    MGLKASSSLLCLAILLGVSSLASSVNITRALENYPEFSTMIELLAKTELTPIINKRQTIT  60

Query  409  VLAVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADR  588
            VLA+ N  IG +S RP + +  IL  HV+LDY+D +KL  LK+    LTT+YQ TG+  +
Sbjct  61   VLALSNDAIGSISGRPEEELKNILMNHVVLDYYDELKLKALKDKSTLLTTLYQSTGLGQQ  120

Query  589  NQGFLNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              GFLN +     IVFGSAV+ +P  A     V   P+N+SV+ +S  IV PGL
Sbjct  121  QNGFLNCSKANGKIVFGSAVKGAPLTAEYITTVFRNPFNLSVVQISMPIVAPGL  174



>gb|AFK40899.1| unknown [Lotus japonicus]
Length=285

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 99/157 (63%), Gaps = 1/157 (1%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
            S   AF+IT+IL++YPE+  F+  LT T L   IN+ +TITVLAV N  I  +S +  D 
Sbjct  19   SATQAFDITKILSQYPEFSTFSKYLTETKLTEQINSRNTITVLAVDNSAISAISGKSADA  78

Query  466  VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT-SGKDGIVFGS  642
            +  ++ TH++LD+FD  KL      + +LTT+YQ +G+A   QGFL V   G+  + FGS
Sbjct  79   IKAVVSTHIVLDFFDEKKLMEALGSKQQLTTLYQASGLAVNQQGFLKVALIGEGEVAFGS  138

Query  643  AVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            AV  +  DA L + V S+PYNISVL VS  IV PG D
Sbjct  139  AVNGAATDAELVKTVTSQPYNISVLQVSKPIVFPGAD  175



>ref|XP_010034870.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Eucalyptus 
grandis]
Length=345

 Score =   147 bits (370),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 104/154 (68%), Gaps = 1/154 (1%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVD  471
            A+AFNIT IL++YPE+  FN+ LT + +A+ INA  +ITVLAV N G+  LS  P + V 
Sbjct  20   ATAFNITNILSKYPEFSTFNNDLTLSQVASAINARQSITVLAVDNSGMSALSGNPAETVK  79

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKD-GIVFGSAV  648
            +IL   V+LDY+D  KL +L N  A LTT+ Q +G A   QGFLNVTS    GI FGSAV
Sbjct  80   DILSLLVVLDYYDPQKLQQLPNKTAILTTLLQASGRAVGLQGFLNVTSSSSGGIAFGSAV  139

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            + S   A+L + V S+P+NISVL +S+ IV P +
Sbjct  140  QGSSVHANLVKSVTSQPFNISVLQISSAIVPPNI  173



>ref|XP_009133982.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Brassica 
rapa]
Length=280

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 100/174 (57%), Gaps = 4/174 (2%)
 Frame = +1

Query  241  LQLSAAAVILLTCIL----STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTIT  408
            + L A++ +L   IL    S  SA NITR L +YPE+    +L  +T L   IN   TIT
Sbjct  1    MDLKASSSLLCLAILFGVSSIVSAVNITRALEKYPEFSTMVELFGKTELTPIINKRQTIT  60

Query  409  VLAVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADR  588
            VLA+ N  IG +S RP + +  +L  HV+LDYFD +KL  LK+    LTT+YQ TG+  +
Sbjct  61   VLALSNDAIGSISGRPEEELKNVLMNHVVLDYFDELKLKALKDRSTLLTTLYQSTGLGQQ  120

Query  589  NQGFLNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              GFLN T     I FGS V+ +P  A     V   PYN+SV+ +S  IV PGL
Sbjct  121  QNGFLNCTKTNGKIYFGSGVKGAPQTAEYITTVFRNPYNLSVIQISMPIVAPGL  174



>gb|KCW53929.1| hypothetical protein EUGRSUZ_J03138 [Eucalyptus grandis]
Length=309

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 104/154 (68%), Gaps = 1/154 (1%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVD  471
            A+AFNIT IL++YPE+  FN+ LT + +A+ INA  +ITVLAV N G+  LS  P + V 
Sbjct  20   ATAFNITNILSKYPEFSTFNNDLTLSQVASAINARQSITVLAVDNSGMSALSGNPAETVK  79

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKD-GIVFGSAV  648
            +IL   V+LDY+D  KL +L N  A LTT+ Q +G A   QGFLNVTS    GI FGSAV
Sbjct  80   DILSLLVVLDYYDPQKLQQLPNKTAILTTLLQASGRAVGLQGFLNVTSSSSGGIAFGSAV  139

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            + S   A+L + V S+P+NISVL +S+ IV P +
Sbjct  140  QGSSVHANLVKSVTSQPFNISVLQISSAIVPPNI  173



>ref|XP_006404978.1| hypothetical protein EUTSA_v10000470mg [Eutrema salsugineum]
 gb|ESQ46431.1| hypothetical protein EUTSA_v10000470mg [Eutrema salsugineum]
Length=277

 Score =   144 bits (363),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 101/174 (58%), Gaps = 4/174 (2%)
 Frame = +1

Query  241  LQLSAAAVILLTCIL----STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTIT  408
            + L A++ +L   IL    S  S+ NITR L +YPE+    +L  +T L   IN   T+T
Sbjct  1    MGLKASSSLLCLAILLGVSSIVSSVNITRALEKYPEFSTMTELFAKTELTPIINKRQTLT  60

Query  409  VLAVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADR  588
            VLA+ N  IG +S RP + +  IL  HV+LDY+D +KL  LK+    LTT+YQ TG+  +
Sbjct  61   VLALSNDAIGSISGRPEEELKNILMNHVVLDYYDELKLKALKDKSTLLTTLYQSTGLGQQ  120

Query  589  NQGFLNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              GFLN +     I FGSAV+ +P  A     V   PYN+SV+ +S  IV PGL
Sbjct  121  QNGFLNCSKSNGKIYFGSAVKGAPQTAEYITTVFRNPYNLSVVQISMPIVAPGL  174



>gb|KFK38614.1| hypothetical protein AALP_AA3G137100 [Arabis alpina]
Length=256

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 111/165 (67%), Gaps = 1/165 (1%)
 Frame = +1

Query  274  TCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR  453
            + + +++++FNIT IL+++ ++  FNDLLT+T LA+ IN+  TITVLAV NG +  LS +
Sbjct  16   SFLYTSSNSFNITNILDQHHDFSTFNDLLTQTQLASAINSRQTITVLAVSNGALSSLSDK  75

Query  454  PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-I  630
            P  ++  IL  H++LDY+D  KL  L      LTT++Q +G+A   QGFLN T  KDG +
Sbjct  76   PKAMLKNILSLHIVLDYYDEKKLKNLNKKSVILTTLFQSSGLARGQQGFLNATVTKDGDV  135

Query  631  VFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDDDDG  765
             FGSAV  SP +A LEE V+S P+NISVL +S+ I+   +  D+ 
Sbjct  136  SFGSAVPGSPLNAQLEESVVSLPFNISVLHISSAIMIDDVKADNA  180



>emb|CDY34771.1| BnaA09g41380D [Brassica napus]
Length=280

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 102/174 (59%), Gaps = 4/174 (2%)
 Frame = +1

Query  241  LQLSAAAVILLTCIL----STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTIT  408
            + L A++ +L   IL    S  S+ NITR L  YPE+    +LL +T L   IN   TIT
Sbjct  1    MGLKASSSLLCLAILLGVSSIVSSVNITRALENYPEFSTMIELLAKTELTPIINKRQTIT  60

Query  409  VLAVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADR  588
            VLA+ N  IG +S RP + +  IL  HV+LDY+D +KL  LK+    LTT+YQ TG+  +
Sbjct  61   VLALSNDAIGSISGRPEEELKNILMNHVVLDYYDELKLKALKDKSTLLTTLYQSTGLGQQ  120

Query  589  NQGFLNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              GFLN +     IVFGSAV+ +P  A     V   P+N+SV+ +S  IV PGL
Sbjct  121  QNGFLNCSKANGKIVFGSAVKGAPLTAEYITTVFRNPFNLSVVQISMPIVAPGL  174



>ref|XP_009117125.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Brassica 
rapa]
Length=280

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 102/174 (59%), Gaps = 4/174 (2%)
 Frame = +1

Query  241  LQLSAAAVILLTCIL----STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTIT  408
            + L A++ +L   IL    S  S+ NITR L  YPE+    +LL +T L   IN   TIT
Sbjct  1    MGLKASSSLLCLAILLGVSSIVSSVNITRALENYPEFSTMIELLAKTELTPIINKRQTIT  60

Query  409  VLAVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADR  588
            VLA+ N  IG +S RP + +  IL  HV+LDY+D +KL  LK+    LTT+YQ TG+  +
Sbjct  61   VLALSNDAIGSISGRPEEELKNILMNHVVLDYYDELKLKALKDKSTLLTTLYQSTGLGQQ  120

Query  589  NQGFLNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              GFLN +     IVFGSAV+ +P  A     V   P+N+SV+ +S  IV PGL
Sbjct  121  QNGFLNCSKANGKIVFGSAVKGAPLTAEYITTVFRNPFNLSVVQISMPIVAPGL  174



>ref|XP_008799982.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Phoenix 
dactylifera]
Length=281

 Score =   143 bits (360),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/174 (43%), Positives = 108/174 (62%), Gaps = 4/174 (2%)
 Frame = +1

Query  241  LQLSAAAVILLT---CILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITV  411
            + L    VIL+     +LS+  AFNIT IL  +PE+  F++ L +T L   IN   TITV
Sbjct  1    MALKPQVVILVLFPFLLLSSTMAFNITMILEPFPEFATFSNYLNQTKLVHEINHRQTITV  60

Query  412  LAVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRN  591
            L V N  +  +SS P + +  ++  HVILDY+DI K+ R+      LTT++Q TGIA   
Sbjct  61   LVVDNSRMSAISSLPEESLKHVMEVHVILDYYDIRKISRIPRRSFLLTTLFQTTGIATNR  120

Query  592  QGFLNVT-SGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             GFLN+T    + +VFGSAVR +PH + L +++++ PYNISVL +S  I+ PG+
Sbjct  121  MGFLNLTHKAGESVVFGSAVRGAPHTSILIKKIVTMPYNISVLQISEPIIPPGI  174



>ref|XP_009784353.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Nicotiana 
sylvestris]
Length=300

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 104/159 (65%), Gaps = 1/159 (1%)
 Frame = +1

Query  280  ILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPI  459
            IL  A AFNIT +LN+Y  +  FN+ LT+TG+A+ IN+  TITVL V+N  +  LS +  
Sbjct  17   ILCYAKAFNITNLLNQYSSFSNFNNYLTQTGVASAINSRQTITVLVVENSNLSPLSGKSQ  76

Query  460  DLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS-GKDGIVF  636
            D++  I+R HV+LDY+D+ KL +L N   K   ++Q TG A+ +QG+LNVT  G   +  
Sbjct  77   DVLANIMRVHVLLDYYDVQKLQKLPNKTMKAPALFQTTGQANSDQGYLNVTDLGSGSVAL  136

Query  637  GSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            GSA + +   ++L + V S+PYNIS+L +S  I+  G+D
Sbjct  137  GSAAKGATLGSNLVKSVASQPYNISILQISNAIIPLGID  175



>ref|XP_008786366.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Phoenix 
dactylifera]
Length=277

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 102/157 (65%), Gaps = 1/157 (1%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
            S+A AFNIT IL  +PE+  F++ L +T L   IN   TITVL V N  +  +SS P + 
Sbjct  18   SSAVAFNITAILEPFPEFATFSNYLNQTKLVHEINHRQTITVLVVDNSRMSAISSLPEES  77

Query  466  VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT-SGKDGIVFGS  642
            +  ++  HVILDY+DI K++ +      LTT++Q TGIA    GFLNVT    + +VFGS
Sbjct  78   LKHVMGVHVILDYYDIRKINNIPRKSFILTTLFQTTGIATNRMGFLNVTHKAGESVVFGS  137

Query  643  AVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            AVR +PH + L ++V++ PYNISVL +S  I+ PG+D
Sbjct  138  AVRGAPHTSTLIKKVVAMPYNISVLHISEPIIPPGID  174



>ref|XP_010909123.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Elaeis 
guineensis]
Length=259

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 100/153 (65%), Gaps = 1/153 (1%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEI  477
            AFNIT IL  Y  Y  FN+ LT+T LA  IN   TIT+L V N  +  + S+PI+++  I
Sbjct  20   AFNITHILESYSSYSTFNNYLTQTKLAEEINHRQTITILVVDNSKMSAVFSKPIEILKNI  79

Query  478  LRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS-GKDGIVFGSAVRR  654
            +  H+ILDY+D  KL  + +  A LTT++Q +GIA+   GFLNVT+   D +VFGSA   
Sbjct  80   MAIHIILDYYDTNKLSHIPHKSALLTTLFQTSGIANNKLGFLNVTNMPNDDVVFGSATPE  139

Query  655  SPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            +P  +   + V+++PYNIS+L +S +I+ PG++
Sbjct  140  APLSSTFTKMVVTKPYNISILEISDLILPPGIE  172



>emb|CDY20316.1| BnaC04g36400D [Brassica napus]
Length=286

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 95/159 (60%), Gaps = 0/159 (0%)
 Frame = +1

Query  280  ILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPI  459
            + S  SA NITR L++YPE+    +LL +T L   IN   TIT+LA+ N  IG +S RP 
Sbjct  18   VSSIVSAVNITRALDKYPEFSTMTELLAKTKLTPIINKRQTITLLALSNDAIGSISGRPE  77

Query  460  DLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFG  639
            D +  IL  HV+LD++D +KL  +K+    LTT+YQ TG+  +  GFL  +     I FG
Sbjct  78   DELKNILMNHVVLDFYDGLKLKAIKDKSTMLTTLYQSTGLGQQQNGFLKCSKTNGKIYFG  137

Query  640  SAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
            SAV+ +P  A     V   P+N+SV+ +S  IV PGL D
Sbjct  138  SAVKGAPQTAEYITTVFRNPFNLSVVQISMPIVAPGLGD  176



>ref|XP_003545530.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Glycine 
max]
Length=306

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 101/156 (65%), Gaps = 2/156 (1%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEI  477
            AF+IT++L +YPE+  FN  LT T LA  IN+ +TITVLAV++  +  ++++  + +  I
Sbjct  23   AFDITQLLGQYPEFSTFNKYLTETKLADEINSRNTITVLAVEDSAMNSIAAKSPEAIKAI  82

Query  478  LRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT-SGKDGIVFGSAVRR  654
            + THVILD+FD  KL   + +  +LTT++Q +GIA   QGFL V   G+  I FGSAV  
Sbjct  83   ISTHVILDFFDEKKLMEAQANSQQLTTLFQASGIAVNQQGFLKVALVGEGEIAFGSAVSG  142

Query  655  SPHDA-HLEEEVMSRPYNISVLGVSTIIVTPGLDDD  759
            +P DA  L   V S PYNIS+L V+  I+ PG+D  
Sbjct  143  APVDATELMRTVTSEPYNISILQVTKPILVPGVDSQ  178



>ref|XP_004498590.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Cicer 
arietinum]
Length=316

 Score =   142 bits (357),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 98/153 (64%), Gaps = 1/153 (1%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEI  477
            AF+IT++L + P++  FN  LT T LA  IN+ +TIT+LAV + G+  LS +    +   
Sbjct  23   AFDITKLLGQNPDFATFNKYLTETKLAEPINSRNTITILAVSDAGLSSLSGKSQQFIKAS  82

Query  478  LRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT-SGKDGIVFGSAVRR  654
            L THVILD+FD  KL   +     LTT+YQ +G+A   QGF+ V   G+  I FGSAV  
Sbjct  83   LSTHVILDFFDEKKLMEAQGSGQLLTTLYQSSGLAMNQQGFIKVALIGEGEIAFGSAVNG  142

Query  655  SPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            +P D  L + V+S+PYNIS+L V+ +IV PGLD
Sbjct  143  APLDVSLVKTVVSQPYNISILQVTKLIVVPGLD  175



>ref|XP_010669451.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Beta vulgaris 
subsp. vulgaris]
Length=292

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/176 (40%), Positives = 108/176 (61%), Gaps = 5/176 (3%)
 Frame = +1

Query  241  LQLSAAAVILL-----TCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTI  405
            + L A+ +IL+         ++ SAFNIT  L ++ E+  +N+LLT++G+A  IN   T+
Sbjct  1    MALKASNIILIFTTILCTTTTSISAFNITYFLEQHSEFSTYNNLLTQSGVAAAINKQGTV  60

Query  406  TVLAVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIAD  585
            TVL V N  +G ++  P   +  IL THVILDY+D  KL  L     K T ++QQTG  +
Sbjct  61   TVLVVDNSAVGPITGVPQSKLSFILATHVILDYYDATKLDNLNGKSVKATNLFQQTGKTN  120

Query  586  RNQGFLNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
              QG LN+T+    ++F S+ + +P D+ + + V S+P++ISV+ +S  IVTPGLD
Sbjct  121  GEQGLLNITNSDGNVIFASSAKGAPQDSKMVKVVSSQPFHISVIQISKPIVTPGLD  176



>ref|XP_006483738.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Citrus 
sinensis]
 gb|KDO67241.1| hypothetical protein CISIN_1g042255mg [Citrus sinensis]
Length=280

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 98/153 (64%), Gaps = 2/153 (1%)
 Frame = +1

Query  301  FNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEIL  480
            F+I +IL+ +P    F+DLL++T L   IN   TITVLAV N  IG L+ RP+D +  IL
Sbjct  29   FDIIKILSNHPNLLAFSDLLSQTKLNEAINKRKTITVLAVDNSSIGGLNDRPVDEIKNIL  88

Query  481  RTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS-GKDGIVFGSAVRRS  657
              HVILDY+D+ KL +L    +  TTM+Q TG A+  QG++N T    +  VFGS+V+ S
Sbjct  89   SVHVILDYYDMNKLKKLP-KTSSWTTMFQSTGNANDKQGYINCTRLPGEQFVFGSSVKNS  147

Query  658  PHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
            P  A   + V S+P+NISVL VS  IV PGL D
Sbjct  148  PPVAKFVKSVFSQPFNISVLQVSQPIVAPGLGD  180



>ref|XP_006450136.1| hypothetical protein CICLE_v10010765mg [Citrus clementina]
 gb|ESR63376.1| hypothetical protein CICLE_v10010765mg [Citrus clementina]
Length=280

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 98/153 (64%), Gaps = 2/153 (1%)
 Frame = +1

Query  301  FNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEIL  480
            F+I +IL+ +P    F+DLL++T L   IN   TITVLAV N  IG L+ RP+D +  IL
Sbjct  29   FDIIKILSNHPNLLAFSDLLSQTKLNEAINKRKTITVLAVDNSSIGGLNDRPVDEIKNIL  88

Query  481  RTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS-GKDGIVFGSAVRRS  657
              HVILDY+D+ KL +L    +  TTM+Q TG A+  QG++N T    +  VFGS+V+ S
Sbjct  89   SVHVILDYYDMNKLKKLP-KTSSWTTMFQSTGNANDKQGYINCTRLPGEQFVFGSSVKNS  147

Query  658  PHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
            P  A   + V S+P+NISVL VS  IV PGL D
Sbjct  148  PPVAKFVKSVFSQPFNISVLQVSQPIVAPGLGD  180



>ref|XP_009398985.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=441

 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 108/159 (68%), Gaps = 1/159 (1%)
 Frame = +1

Query  283  LSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPID  462
            +S+A AF++TR+L ++ ++  FNDLL RT L+  I+   ++T+LAV+NG +   S +P +
Sbjct  20   VSSAIAFDVTRLLAQFSDFSTFNDLLIRTQLSADISTRKSVTILAVQNGALSSESGQPDE  79

Query  463  LVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFG  639
            ++ +I+  HV+LDY D  KLH+L +H A LTTM Q +G A    GFLNVT  K+G + FG
Sbjct  80   VIKKIIALHVVLDYLDSEKLHQLSSHTAILTTMLQASGRASGLSGFLNVTDLKNGQVAFG  139

Query  640  SAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
            SAV  SP  ++    +++ PY+ISV+ +S +IV PG+ D
Sbjct  140  SAVPGSPLSSYFVRVILTHPYDISVVQISGLIVPPGIRD  178



>gb|ABK28554.1| unknown [Arabidopsis thaliana]
Length=256

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 102/156 (65%), Gaps = 1/156 (1%)
 Frame = +1

Query  274  TCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR  453
            T + +++++FNIT ILN + ++  FN LL+ T LA+ IN   TITVL V NG +  LS +
Sbjct  15   TFLYTSSNSFNITNILNEHDDFSNFNQLLSETQLASTINKRQTITVLVVSNGALSSLSGQ  74

Query  454  PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-I  630
            P  ++ +IL  H++LDY+D  KL  L      LTT++Q +G+A   QGFLN T  K+G +
Sbjct  75   PTSVIKKILSLHIVLDYYDQKKLKNLSKKTVLLTTLFQSSGLARGQQGFLNATVMKNGDV  134

Query  631  VFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIV  738
             FGSAV  S  DA L++ V + P+NISVL +S+ I+
Sbjct  135  AFGSAVPGSSLDAQLQDTVAALPFNISVLHISSAIM  170



>ref|NP_187872.1| fasciclin-like arabinogalactan protein 14 [Arabidopsis thaliana]
 sp|Q9LTW9.1|FLA14_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 14; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG51033.1|AC069474_32 hypothetical protein; 8734-7967 [Arabidopsis thaliana]
 dbj|BAB02409.1| unnamed protein product [Arabidopsis thaliana]
 gb|ABE65936.1| fasciclin-like arabinogalactan family protein [Arabidopsis thaliana]
 gb|AEE75229.1| fasciclin-like arabinogalactan protein 14 [Arabidopsis thaliana]
Length=255

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 102/156 (65%), Gaps = 1/156 (1%)
 Frame = +1

Query  274  TCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR  453
            T + +++++FNIT ILN + ++  FN LL+ T LA+ IN   TITVL V NG +  LS +
Sbjct  15   TFLYTSSNSFNITNILNEHDDFSNFNQLLSETQLASTINKRQTITVLVVSNGALSSLSGQ  74

Query  454  PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-I  630
            P  ++ +IL  H++LDY+D  KL  L      LTT++Q +G+A   QGFLN T  K+G +
Sbjct  75   PTSVIKKILSLHIVLDYYDQKKLKNLSKKTVLLTTLFQSSGLARGQQGFLNATVMKNGDV  134

Query  631  VFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIV  738
             FGSAV  S  DA L++ V + P+NISVL +S+ I+
Sbjct  135  AFGSAVPGSSLDAQLQDTVAALPFNISVLHISSAIM  170



>ref|XP_009140554.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Brassica 
rapa]
Length=285

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 94/159 (59%), Gaps = 0/159 (0%)
 Frame = +1

Query  280  ILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPI  459
            + S  SA NITR L++YPE+    +L  +T L   IN   TIT+LA+ N  IG +S RP 
Sbjct  18   VSSIVSAVNITRALDKYPEFSTMTELFAKTKLTPIINKRQTITLLALSNDAIGSISGRPE  77

Query  460  DLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFG  639
            D +  IL  HV+LD++D +KL  +K+    LTT+YQ TG+  +  GFL  +     I FG
Sbjct  78   DELKNILMNHVVLDFYDGLKLKAIKDKSTMLTTLYQSTGLGQQQNGFLKCSKTNGKIYFG  137

Query  640  SAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
            SAV+ +P  A     V   P+N+S++ +S  IV PGL D
Sbjct  138  SAVKGAPQTAEYITTVFRNPFNLSIVQISMPIVAPGLGD  176



>ref|XP_008219800.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Prunus 
mume]
Length=285

 Score =   139 bits (351),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 104/159 (65%), Gaps = 3/159 (2%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
            S+ SAFNIT+IL +  ++  FN+LL++T LA  IN  STIT+LAV NGG G LS +  D+
Sbjct  25   SSVSAFNITKILEKQSDFSNFNNLLSQTKLADEINRRSTITILAVDNGGAGGLSGQSSDM  84

Query  466  VDEILRTHVILDYFDIMKLHRL--KNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFG  639
              +IL  HV+LDY+D  KL ++   N  A LTT++Q TG A R QGF+ V+     I FG
Sbjct  85   AKKILSVHVVLDYYDQDKLKKIFKSNKSATLTTLFQSTGQARREQGFIKVSVNNGQISFG  144

Query  640  SAVR-RSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            SA +  + +  +  + V+S+PYNISVL V +II  P ++
Sbjct  145  SAAKGGNGNSVNFVKSVVSQPYNISVLQVGSIINVPDIE  183



>ref|XP_008781934.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Phoenix 
dactylifera]
Length=308

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 101/154 (66%), Gaps = 1/154 (1%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVD  471
            A+AFNIT+IL ++ ++   N+LLTRT LA+ IN+  T+TVLAV N  +  +S+ P D++ 
Sbjct  20   ATAFNITQILGQFSDFSNLNNLLTRTQLASEINSRQTVTVLAVNNAALSSVSNLPTDVLK  79

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSAV  648
            ++L  HV+LDYFD  K+ RL N  A L T++Q +G+A    GFLNVT   +G I  GSA 
Sbjct  80   KVLALHVVLDYFDRDKITRLSNRSAILATLFQASGLATGQNGFLNVTDMGNGQIALGSAA  139

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              S  DA     +++ PYNISVL +S +I  PGL
Sbjct  140  PGSNLDARFVGVLVTHPYNISVLKISGVITPPGL  173



>ref|XP_010914304.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Elaeis guineensis]
Length=282

 Score =   138 bits (347),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 99/152 (65%), Gaps = 1/152 (1%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEI  477
            A+N+T+IL  + ++  FN+ LTRT LA  IN   TITVL V N  +  LSS  ++ +  +
Sbjct  21   AYNVTQILEPFSDFATFNNYLTRTKLADEINRRQTITVLVVDNSKMSALSSLDVETLKHV  80

Query  478  LRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT-SGKDGIVFGSAVRR  654
            +  HVILDY+D  KL  + N+ A LTT++Q TGIA  N GFLNVT    + ++FGSA ++
Sbjct  81   MAVHVILDYYDENKLSHISNNSALLTTLFQTTGIAKNNLGFLNVTRKPNEAMLFGSAFQK  140

Query  655  SPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            +P  +   + +++ PYNIS+L +S  IV PG+
Sbjct  141  APLSSTFSKVIITMPYNISILQISDPIVPPGI  172



>ref|NP_001046792.1| Os02g0461500 [Oryza sativa Japonica Group]
 dbj|BAD19640.1| endosperm specific protein-like [Oryza sativa Japonica Group]
 dbj|BAF08706.1| Os02g0461500 [Oryza sativa Japonica Group]
 dbj|BAG98518.1| unnamed protein product [Oryza sativa Japonica Group]
Length=304

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 99/153 (65%), Gaps = 3/153 (2%)
 Frame = +1

Query  301  FNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEIL  480
            FNITRIL  + ++  FN LLT+T LA  IN   TITVLA+ NG  G +SS P D   ++L
Sbjct  32   FNITRILGEFSDFSTFNHLLTQTKLADEINRRQTITVLALDNGAAGGVSSLPSDEQRKVL  91

Query  481  RTHVILDYFDIMKL--HRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGI-VFGSAVR  651
              HV+LDY+D  KL   ++KN  A LTT++Q +G A    GFLN T   DGI VFGSA  
Sbjct  92   SVHVVLDYYDTEKLGGMKMKNRSAVLTTLFQSSGQATDRMGFLNYTKRSDGIMVFGSAEP  151

Query  652  RSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             +   + + + V++RPYNISVL V++ IV PG+
Sbjct  152  GAQATSQMVKVVVTRPYNISVLQVNSPIVPPGI  184



>ref|XP_010938482.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Elaeis guineensis]
Length=257

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/153 (45%), Positives = 96/153 (63%), Gaps = 1/153 (1%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEI  477
            AF IT IL  + E+  F++ L +T L   IN   TIT+L V N  +  +SS P + +  +
Sbjct  2    AFKITAILKPFSEFATFSNYLNQTKLVHEINHRQTITILVVDNSKMSAISSLPEESLKHV  61

Query  478  LRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKD-GIVFGSAVRR  654
            +  HVILDY+DI K+  + +    LTT++Q TG+A +  GFLNVT   D  +VFGSAV  
Sbjct  62   MEVHVILDYYDIRKISHIPSKSFLLTTLFQTTGVATKRMGFLNVTRKADESVVFGSAVLG  121

Query  655  SPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            +PH + L + VM+ PYNISVL VS  I+ PG+D
Sbjct  122  APHTSTLIKNVMTMPYNISVLQVSEPIIPPGID  154



>ref|XP_007224727.1| hypothetical protein PRUPE_ppa024912mg [Prunus persica]
 gb|EMJ25926.1| hypothetical protein PRUPE_ppa024912mg [Prunus persica]
Length=268

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/163 (47%), Positives = 104/163 (64%), Gaps = 3/163 (2%)
 Frame = +1

Query  265  ILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDL  444
            +L     S+ASAF+IT++L +  E+  FN  L  T L   IN+ STITVLAV NG I  L
Sbjct  13   LLFIVFSSSASAFDITKLLEKQSEFSNFNTYLKETKLGEQINSRSTITVLAVGNGAISSL  72

Query  445  SSRPIDLVDEILRTHVILDYFDIMKLHRL-KNHQA-KLTTMYQQTGIADRNQGFLNVTSG  618
            + +  D+V +IL  HVILDY+D  KL +L K+ +A  LTTM+Q +G A   QGF+N    
Sbjct  73   AGKSQDVVKKILSAHVILDYYDEQKLTKLAKSSKATTLTTMFQSSGQAQNQQGFINAGIV  132

Query  619  KDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTP  744
             +G + FGSA + S  +A L + V+S+P+NISVL VS +I  P
Sbjct  133  NEGELAFGSAAKGSKLNAKLVKSVVSQPFNISVLQVSELIDIP  175



>ref|XP_008799981.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Phoenix 
dactylifera]
Length=281

 Score =   137 bits (345),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 103/157 (66%), Gaps = 3/157 (2%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
            S+A AFNIT IL  +PE+  F++ L++T L   IN   TITVL V N  +  +SS P + 
Sbjct  19   SSAMAFNITMILEPFPEFATFSNYLSQTKLVHEINHRQTITVLVVDNSRMSAISSLPEES  78

Query  466  VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT--SGKDGIVFG  639
            +  ++  HVILDY+DI K+  +      LTT++Q TGIA    GFLN++  +GK  +VFG
Sbjct  79   LKHVMEVHVILDYYDITKISSIPRKNFLLTTLFQTTGIATSRIGFLNLSHKAGK-SVVFG  137

Query  640  SAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            SAVR +PH + L +++++ PYNISVL +S  I+ PG+
Sbjct  138  SAVRGAPHTSILIKKIVTMPYNISVLQISEPIIPPGI  174



>ref|XP_006357108.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Solanum 
tuberosum]
Length=328

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 1/157 (1%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
            S A +FNIT +LN Y  Y  FN+ LT+TG+A  IN+  TITVL V+N  +  L     D+
Sbjct  18   SQAKSFNITSLLNHYSSYSNFNNYLTQTGVAAAINSRQTITVLVVENNNLSPLKGMSQDV  77

Query  466  VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS-GKDGIVFGS  642
            +  I+R HV+LDY+D+ K+  L N   K  T++Q TG A+ +QGFLN+T  G   I  GS
Sbjct  78   IANIMRVHVLLDYYDVPKMQMLPNKTMKTPTLFQTTGYANNDQGFLNMTDLGTGSISLGS  137

Query  643  AVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            A +     + L + + S+PYNIS+L +S +I+  G+D
Sbjct  138  AAKGETLGSKLVKSIASQPYNISILQISNVIIPSGID  174



>ref|XP_010465042.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Camelina 
sativa]
Length=254

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 104/156 (67%), Gaps = 1/156 (1%)
 Frame = +1

Query  274  TCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR  453
            T + +++++FNIT ILN + ++  FN LLT T LA+ IN+  TITVL V NGG+  LS +
Sbjct  14   TFLYTSSNSFNITNILNEHDDFSTFNKLLTETQLASTINSRQTITVLVVSNGGLSSLSGQ  73

Query  454  PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-I  630
            PI+L+ +IL  H+ILDY+D  KL  L      LTT++Q +G A   QGFLN T  KDG +
Sbjct  74   PINLIKKILSLHIILDYYDEKKLKNLNKKSVLLTTLFQSSGQARGQQGFLNATVTKDGDV  133

Query  631  VFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIV  738
            +FGSAV     +A L + V S P+NISVL +S+ I+
Sbjct  134  LFGSAVPGPDVNAELLDSVASLPFNISVLHISSAIM  169



>ref|XP_004305605.1| PREDICTED: uncharacterized protein LOC101308896 [Fragaria vesca 
subsp. vesca]
Length=717

 Score =   142 bits (357),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 76/168 (45%), Positives = 106/168 (63%), Gaps = 4/168 (2%)
 Frame = +1

Query  262  VILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGD  441
            ++++   +S+ SAFNIT++L +  ++  FN  L+ T LA  IN  STITVLAV N  IG 
Sbjct  14   LVMMLLSISSCSAFNITKLLEKEDDFSTFNQHLSDTKLADQINKRSTITVLAVDNSAIGG  73

Query  442  LSSRPIDLVDEILRTHVILDYFDIMKLHRL--KNHQAKLTTMYQQTGIADRNQGFLNVTS  615
            L    +  V  I+  HVILDY+D  KL +L   N  A LTT+YQ +G+A   QGF+ + +
Sbjct  74   LGDDSV--VKAIMSVHVILDYYDKEKLTKLAKNNKSATLTTLYQTSGLAKNEQGFVRIAT  131

Query  616  GKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDDD  759
              DGI FGSA + S  ++ L + V S+PYNISVL VS+II  P ++ D
Sbjct  132  DDDGITFGSASKGSQMNSKLVKSVTSQPYNISVLQVSSIIEVPNINAD  179



>ref|XP_002882785.1| hypothetical protein ARALYDRAFT_478625 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59044.1| hypothetical protein ARALYDRAFT_478625 [Arabidopsis lyrata subsp. 
lyrata]
Length=251

 Score =   135 bits (339),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 102/156 (65%), Gaps = 1/156 (1%)
 Frame = +1

Query  274  TCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR  453
            T + S++++FNIT ILN + ++  FN LL+ T LA+ IN   TITVL V NG +  +S +
Sbjct  14   TFLYSSSNSFNITNILNEHDDFSTFNQLLSETQLASTINKRQTITVLVVSNGALSSISGQ  73

Query  454  PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-I  630
            P  ++ +IL  H++LDY+D  KL  L      LTT++Q +G+A   QGFLN T  KDG +
Sbjct  74   PTAVIKKILSLHIVLDYYDQKKLKNLSKKSVLLTTLFQSSGLARGQQGFLNATVTKDGDV  133

Query  631  VFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIV  738
             FGSAV  S  DA L++ V S P+NISVL +S+ I+
Sbjct  134  AFGSAVPGSSLDAQLQDTVASLPFNISVLHISSAIM  169



>ref|XP_007221854.1| hypothetical protein PRUPE_ppa021523mg [Prunus persica]
 gb|EMJ23053.1| hypothetical protein PRUPE_ppa021523mg [Prunus persica]
Length=285

 Score =   135 bits (341),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 102/159 (64%), Gaps = 3/159 (2%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
            S+ SAFNIT++L +  ++  FN+LL++T LA  IN  STIT+LAV NGG G LS    D+
Sbjct  25   SSVSAFNITKLLEKQSDFSNFNNLLSQTKLADEINRRSTITILAVDNGGAGGLSGESSDM  84

Query  466  VDEILRTHVILDYFDIMKLHRL--KNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFG  639
              +IL  HV+LDY+D  KL ++   N  A LTT++Q TG A R QGF+ V+     I F 
Sbjct  85   AKKILSVHVVLDYYDQDKLKKIFKSNKSATLTTLFQSTGQARREQGFIKVSVNNGQISFE  144

Query  640  SAVR-RSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            SA +  + +  +  + V+S+PYNISVL V +II  P ++
Sbjct  145  SAAKGGNGNSVNFVKSVVSQPYNISVLQVGSIINVPDME  183



>ref|XP_009377364.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Pyrus x 
bretschneideri]
Length=283

 Score =   135 bits (339),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 102/173 (59%), Gaps = 2/173 (1%)
 Frame = +1

Query  232  MSPLQLSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITV  411
            M   + SA   + L  + S+ASAF+I ++L +  E   F + L  T L   IN  STITV
Sbjct  1    MENTKASAILCLALFLVFSSASAFDIVKLLEKQSELSSFTNYLKETKLGDEINKRSTITV  60

Query  412  LAVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRL--KNHQAKLTTMYQQTGIAD  585
            LAV NGG+  +S +  D++ +IL  HV+LDYFD  KL  L   + ++ LTTM Q +G A 
Sbjct  61   LAVDNGGMSSISGKSQDVIKKILSAHVVLDYFDQKKLTSLAGSSKESTLTTMLQSSGQAK  120

Query  586  RNQGFLNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTP  744
              QGF+ V      I FGSAV+ +  +A L + V+S+PYNISVL +S  I  P
Sbjct  121  DQQGFIIVGKSDGEIAFGSAVKGAKLNAKLVKAVVSQPYNISVLQISNAIEIP  173



>gb|KHN10392.1| Fasciclin-like arabinogalactan protein 3 [Glycine soja]
Length=305

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 100/156 (64%), Gaps = 3/156 (2%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEI  477
            AF+IT++L +YPE+  FN  LT T LA  IN+ +TITVLAV++  +  ++++  + +  I
Sbjct  23   AFDITQLLGQYPEFSTFNKYLTETKLADEINSRNTITVLAVEDSAMNSIAAKSPEAIKAI  82

Query  478  LRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT-SGKDGIVFGSAVRR  654
            + THVILD+FD  KL   + +  +LTT++Q +GIA   QGFL V   G+  I FG AV  
Sbjct  83   ISTHVILDFFDEKKLMEAQANSQQLTTLFQASGIAVNQQGFLKVALVGEGEIAFG-AVSG  141

Query  655  SPHDA-HLEEEVMSRPYNISVLGVSTIIVTPGLDDD  759
            +P DA  L   V S PYNIS+L V+  I+ PG+D  
Sbjct  142  APVDATELMRTVTSEPYNISILQVTKPILVPGVDSQ  177



>ref|XP_010526275.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Tarenaya 
hassleriana]
Length=282

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 99/162 (61%), Gaps = 0/162 (0%)
 Frame = +1

Query  265  ILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDL  444
            IL+    +T SA NITR+L +YP +   NDL TRTGL   IN   TIT+LAV N  +G +
Sbjct  18   ILIVFSSTTISAVNITRVLEKYPNFSTMNDLFTRTGLNVPINKRQTITILAVDNDAMGSI  77

Query  445  SSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKD  624
            S RP + +  IL  HV+LDY+D +KL  LK+    LTT+YQ TG+  +  GFLN T    
Sbjct  78   SGRPEEEIKNILMNHVVLDYYDEIKLKGLKDRSTLLTTLYQTTGLGQQQNGFLNCTKMNG  137

Query  625  GIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             I FGS V+ SP +A     V   P+N+SV+ +S  IV PGL
Sbjct  138  KIFFGSGVKGSPLNAQYVNPVFQNPFNLSVVQISMPIVAPGL  179



>gb|EMS62729.1| hypothetical protein TRIUR3_26693 [Triticum urartu]
Length=261

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 92/149 (62%), Gaps = 1/149 (1%)
 Frame = +1

Query  301  FNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEIL  480
            FNIT +LN+ PE+  FN LL++T LA  IN   TITVL V N     ++S P D   ++L
Sbjct  26   FNITEVLNKSPEFLTFNSLLSKTNLAEEINKRQTITVLVVDNSAASGITSLPTDTQKKVL  85

Query  481  RTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT-SGKDGIVFGSAVRRS  657
              HVIL+Y+D MKL  ++   A LT+++Q TG A    GF+N T S  D +VFGSA   +
Sbjct  86   AVHVILNYYDPMKLENIEKGTALLTSLFQTTGAATDRMGFVNYTHSADDQMVFGSAEPGA  145

Query  658  PHDAHLEEEVMSRPYNISVLGVSTIIVTP  744
            P  + L + V  RPYN+SV+ VS  I+ P
Sbjct  146  PLSSQLVKVVACRPYNLSVMQVSAAIIPP  174



>ref|XP_008378295.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Malus domestica]
Length=283

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/168 (45%), Positives = 101/168 (60%), Gaps = 5/168 (3%)
 Frame = +1

Query  256  AAVIL---LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKN  426
            A+VIL   L  + S+ASAF+I ++L +  E   F + L  T L   IN  STITVLAV N
Sbjct  6    ASVILCLALFLVFSSASAFDIVKLLEKQSELSSFTNYLKETKLGDEINKRSTITVLAVDN  65

Query  427  GGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRL--KNHQAKLTTMYQQTGIADRNQGF  600
            GG+  +S +  D++ +IL  HV+LDYFD  KL  L   + ++ LTTM Q +G A   QGF
Sbjct  66   GGMSSISGKSQDVIKKILSAHVVLDYFDQKKLTSLAGSSKESTLTTMLQSSGQAKDQQGF  125

Query  601  LNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTP  744
            + V      I FGSAV+    +A L + V+S+PYNISVL +S  I  P
Sbjct  126  IIVGKSDGEIAFGSAVKGGKLNAKLVKAVVSQPYNISVLQISNAIEIP  173



>ref|XP_009338843.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Pyrus x 
bretschneideri]
Length=267

 Score =   133 bits (335),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 100/155 (65%), Gaps = 4/155 (3%)
 Frame = +1

Query  304  NITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEILR  483
            NIT++L +  ++  FN+LL+ T LA  IN  STIT+LAV NG  G LS +  DL  +IL 
Sbjct  21   NITKLLEKQSDFSNFNNLLSETKLADEINRRSTITILAVDNGAAGGLSGKSSDLTKKILS  80

Query  484  THVILDYFDIMKLHRL--KNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFGSAVRRS  657
             HV+LDY+D  KL ++   N  A LTT++Q TG A + QGF+ V+   + + FGSA + +
Sbjct  81   VHVVLDYYDTDKLKKIFKSNKSATLTTLFQSTGEARKEQGFITVSVKDNQVSFGSAAKGN  140

Query  658  PHDAH--LEEEVMSRPYNISVLGVSTIIVTPGLDD  756
              D H  L + V+S+PYNISVL V +II  P +++
Sbjct  141  NGDNHVSLVKSVISQPYNISVLQVGSIINVPDIEN  175



>gb|ABV27488.1| fasciclin-like arabinogalactan protein 17 [Gossypium hirsutum]
Length=285

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 103/167 (62%), Gaps = 2/167 (1%)
 Frame = +1

Query  259  AVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIG  438
            A ILL  + +T +A NIT+ L  Y +Y   +DL  +T L   IN   TIT+LA+ N  I 
Sbjct  13   AAILLP-LATTCTALNITKSLAPYSDYSTLSDLFRKTKLTDAINRRQTITILALDNSSIQ  71

Query  439  DLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSG  618
             ++ R  D + +IL  H+ILDY+D  K+ +L    A LTT+YQ TG A   QGF+N+T  
Sbjct  72   SITDRSSDELRKILMNHIILDYYDRQKIQKLGKKSALLTTLYQTTGSAINQQGFVNITRI  131

Query  619  KDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
              G +VFGSAV+ +P    L   V+S+P+N+SVL +ST IV PG+ D
Sbjct  132  ARGEVVFGSAVKGAPLVGKLLGSVISQPFNLSVLHISTPIVAPGIGD  178



>gb|EYU32014.1| hypothetical protein MIMGU_mgv1a007039mg [Erythranthe guttata]
Length=422

 Score =   136 bits (342),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 102/167 (61%), Gaps = 3/167 (2%)
 Frame = +1

Query  241  LQLSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAV  420
            L LS  AV+ L  + S A+A NIT IL+ YPEY  FN LL++T LA  IN+   +TV  +
Sbjct  5    LTLSLLAVVTLAAV-SIAAATNITEILDGYPEYSEFNTLLSQTKLADEINSREPVTVCVL  63

Query  421  KNGGIGDLSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQG  597
             NG +   + + P+ +V+ IL  HV+LDYFD  KLH++       TT+YQ TG AD N G
Sbjct  64   PNGALSSFTGKYPLSVVENILALHVLLDYFDAPKLHKISEGSVLSTTLYQTTGNADGNLG  123

Query  598  FLNVTSGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            F+N+T  K G V FGS V  SP D+   + V   PYN+SV+ VS  I
Sbjct  124  FVNITDLKGGKVGFGSGVAGSPLDSTYTKSVKQIPYNVSVIEVSKAI  170



>ref|XP_009363599.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Pyrus x 
bretschneideri]
Length=262

 Score =   132 bits (332),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 101/160 (63%), Gaps = 7/160 (4%)
 Frame = +1

Query  280  ILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPI  459
            + S+ASAF+I ++L +  ++  F + L  T L   IN  STITVLAV NGGI  +S +  
Sbjct  17   VFSSASAFDIVKLLEKQSDFSSFTNYLKETKLGDEINKRSTITVLAVDNGGISSISGKSQ  76

Query  460  DLVDEILRTHVILDYFDIMKLHRL--KNHQAKLTTMYQQTGIADRNQGFLNVTSGK---D  624
            D++ +IL  HV+LDY+D  KL  L   +  + LTTM Q TG A   QGF+N+  GK    
Sbjct  77   DVIKKILSAHVVLDYYDQKKLTNLVTSSKVSTLTTMLQSTGQAKDQQGFINL--GKIDEG  134

Query  625  GIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTP  744
            G+ FGSAV+ S  +A L + V+S+P+NISVL +S +I  P
Sbjct  135  GLAFGSAVKGSKLNAKLVKSVVSQPFNISVLQISNVIEIP  174



>ref|XP_008219801.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Prunus 
mume]
Length=271

 Score =   132 bits (333),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 99/160 (62%), Gaps = 3/160 (2%)
 Frame = +1

Query  265  ILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDL  444
            +L     S+ASAF+IT++L +  E+  FN  L  T L   IN+ STITVLAV NG I  L
Sbjct  13   LLFIVFSSSASAFDITKLLEKQSEFSNFNTYLKETKLGEQINSRSTITVLAVGNGAISSL  72

Query  445  SSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQ--AKLTTMYQQTGIADRNQGFLNVTSG  618
            + +  D+V +IL  HVILDY+D  KL +L        LTTM+Q +G A   QGF+N    
Sbjct  73   AGKSQDVVKKILSAHVILDYYDEQKLTKLAKSSKVTTLTTMFQSSGQAQNQQGFINAGVI  132

Query  619  KDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
             +G + FGSA + S  +A L + V+S+P+NIS+L VS +I
Sbjct  133  NEGELAFGSAAKGSILNAKLVKSVVSQPFNISILQVSELI  172



>ref|XP_010102851.1| hypothetical protein L484_004423 [Morus notabilis]
 gb|EXB94232.1| hypothetical protein L484_004423 [Morus notabilis]
Length=300

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 100/155 (65%), Gaps = 4/155 (3%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEI  477
            AFNIT+IL+++PE+  FN  L++T LA  IN   TITVL V N     LS +P+D+V +I
Sbjct  24   AFNITKILSQHPEFATFNGFLSQTKLADEINRRQTITVLVVDNAAASSLSGKPLDVVKKI  83

Query  478  LRTHVILDYFDIMKLHRL--KNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSAV  648
            L  HVILDY+D+ KL +L   N  + LTT+    G AD+ +GF+NV+   +G I FGS+ 
Sbjct  84   LSVHVILDYYDVEKLTKLGISNKTSALTTLLAGAGAADQ-RGFINVSLVNEGEIAFGSSA  142

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            +    ++ L E V + P+NISVL ++  +  PG++
Sbjct  143  KGGALNSKLVESVAAHPFNISVLQITAPVQVPGIE  177



>gb|EMT17229.1| hypothetical protein F775_11240 [Aegilops tauschii]
Length=261

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 89/149 (60%), Gaps = 1/149 (1%)
 Frame = +1

Query  301  FNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEIL  480
            FNIT +LN  PE+  FN LL++T LA  IN   TITVL V N     + S P D   ++L
Sbjct  26   FNITEVLNESPEFLTFNSLLSKTNLAEEINKRQTITVLVVDNSAASGIMSLPTDTQKKVL  85

Query  481  RTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT-SGKDGIVFGSAVRRS  657
              HVILDY+D MKL  ++   A LT+++Q TG A    GF+N T S  D +VFGSA   +
Sbjct  86   AVHVILDYYDPMKLETIEKGTALLTSLFQTTGAATDRMGFVNYTRSADDQMVFGSAEPGA  145

Query  658  PHDAHLEEEVMSRPYNISVLGVSTIIVTP  744
            P  + L + V  RPYN+SV+ V   I+ P
Sbjct  146  PLSSQLVKVVACRPYNLSVMQVRAAIIPP  174



>ref|XP_010938483.1| PREDICTED: fasciclin-like arabinogalactan protein 3 [Elaeis guineensis]
Length=277

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 98/157 (62%), Gaps = 1/157 (1%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
            ++A AFNIT IL  + ++  F++ L +T L   IN   TIT+L + N  +  +SS P + 
Sbjct  18   TSAMAFNITAILEPFSKFTTFSNYLNQTKLVHEINHRRTITILVIDNSRMSAISSLPEES  77

Query  466  VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKD-GIVFGS  642
            +  ++  HVILDY+DI K+  +      LT ++Q T +A +  GFLNVT   D   VFGS
Sbjct  78   LKHVMEVHVILDYYDIRKISHIPRKSFLLTILFQTTDVATKRMGFLNVTRMADESEVFGS  137

Query  643  AVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            A+ R+PH + L ++VM+ PYNISVL VS  I+ PG+D
Sbjct  138  AILRAPHTSTLIKKVMTMPYNISVLQVSEPIIPPGID  174



>ref|XP_010102850.1| hypothetical protein L484_004422 [Morus notabilis]
 gb|EXB94231.1| hypothetical protein L484_004422 [Morus notabilis]
Length=282

 Score =   131 bits (330),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 103/156 (66%), Gaps = 6/156 (4%)
 Frame = +1

Query  301  FNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIG-DLSSRPIDLVDEI  477
            FNITR+L  +PE+G FNDLLTRT L+  IN   TITVLA+ N  I   L+ +P+D++ +I
Sbjct  31   FNITRLLGHFPEFGAFNDLLTRTKLSEIINHRQTITVLALNNDAISTSLAGKPLDVIKDI  90

Query  478  LRTHVILDYFDIMKL-HRLKNHQAK--LTTMYQQTGIADRNQGFLNVTSGKDG--IVFGS  642
            L  H++LD+F + KL + +K+H++     T++Q TG A   QGF+NV+   +G  I FGS
Sbjct  91   LSVHIVLDFFGLPKLRYIVKDHRSGSVFATLFQATGKAKDCQGFVNVSVSDNGQNIAFGS  150

Query  643  AVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            AV  SP  A +   V  RP+NISVL VS+ IV  G+
Sbjct  151  AVEGSPLVAKVVGSVAVRPHNISVLHVSSPIVPHGV  186



>ref|XP_010499304.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Camelina 
sativa]
Length=250

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 102/156 (65%), Gaps = 1/156 (1%)
 Frame = +1

Query  274  TCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR  453
            T + +++++FNIT ILN + ++  FN LL+ T LA+ IN+  TITVL V NG +  LS +
Sbjct  14   TFLYTSSNSFNITNILNEHDDFSTFNKLLSETQLASTINSRQTITVLVVSNGALSSLSGQ  73

Query  454  PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-I  630
            P +L+ +IL  H+ILDY+D  KL  L      LTT++Q +G A   QGFLN T  KDG +
Sbjct  74   PANLIKKILSLHIILDYYDQKKLKNLSKKSVLLTTLFQSSGQARGQQGFLNATVTKDGNV  133

Query  631  VFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIV  738
            +FGSAV     +A L + V S P+NISVL +S+ I+
Sbjct  134  LFGSAVPGPDLNAELLDSVASLPFNISVLHISSAIM  169



>ref|XP_008361057.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Malus domestica]
Length=262

 Score =   130 bits (327),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 100/160 (63%), Gaps = 7/160 (4%)
 Frame = +1

Query  280  ILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPI  459
            + S+ASAF+I ++L +  ++  F + L  T L   IN  STITVLAV NGGI  +S +  
Sbjct  17   VFSSASAFDIVKLLEKQSDFSSFTNYLKETKLGDEINKRSTITVLAVDNGGISSISGKSQ  76

Query  460  DLVDEILRTHVILDYFDIMKLHRL--KNHQAKLTTMYQQTGIADRNQGFLNVTSGK---D  624
            D++ +IL  HV+LDY+D  KL  L   +  + LTTM Q TG A   QGF+N+  GK    
Sbjct  77   DVIKKILSAHVVLDYYDQKKLTNLVTSSKVSTLTTMLQSTGQAKDQQGFINL--GKIDEG  134

Query  625  GIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTP  744
            G+ FGSAV+ S  +A   + V+S+P+NISVL +S +I  P
Sbjct  135  GLAFGSAVKGSKLNAKFVKSVVSQPFNISVLQISNVIEIP  174



>ref|XP_009120424.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Brassica 
rapa]
Length=264

 Score =   130 bits (326),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 97/149 (65%), Gaps = 1/149 (1%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVD  471
            A+AFNITRILN   E+  FN+LL++TGLA+ IN+  TITVLA+ N  +   S +  +   
Sbjct  23   ANAFNITRILNLNNEFSSFNNLLSQTGLASTINSRQTITVLALSNDAMSIFSDQSTEDNK  82

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSAV  648
            + L  H++LDY+DI KL  L      LTT++Q +G A   QGF+N T   +G ++FGSAV
Sbjct  83   KSLSLHIVLDYYDIKKLKSLNKRSVILTTLFQSSGQAKGQQGFINATVMNNGDVMFGSAV  142

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            R S  D+ L + V + PYNISVL +S+ I
Sbjct  143  RGSLLDSKLIDSVATHPYNISVLHISSYI  171



>ref|XP_010913663.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Elaeis 
guineensis]
Length=312

 Score =   131 bits (329),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 101/154 (66%), Gaps = 1/154 (1%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVD  471
            A+AFNIT IL ++ ++   N+LLT+T LA+ IN+   ITVL+V N  +  +S+ P D+++
Sbjct  20   ATAFNITSILGQFSDFSNLNNLLTQTQLASEINSRQIITVLSVNNAALSSVSNLPTDVLE  79

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSAV  648
            ++L  HV+LDYFD   + +L N  A LTT+ Q +G+A    GFLNVT   +G I  GSA 
Sbjct  80   KVLSFHVVLDYFDRDNITKLSNRSAILTTLLQASGLATGQNGFLNVTDMGNGQIALGSAA  139

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              S   +   + +++ PYNISVL +S++IV PGL
Sbjct  140  PGSNLTSQFVKVLVTHPYNISVLHISSVIVPPGL  173



>ref|XP_004305606.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Fragaria 
vesca subsp. vesca]
Length=282

 Score =   130 bits (327),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 100/166 (60%), Gaps = 2/166 (1%)
 Frame = +1

Query  262  VILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGD  441
            V+L    + + SAFNIT++LN+  ++  FN  L+ T LA  IN  STITVLA+ N  +G 
Sbjct  13   VLLSMLSIRSCSAFNITKLLNKESDFSTFNKYLSATKLADEINKQSTITVLALNNDAMGG  72

Query  442  LSSRPIDLVDEILRTHVILDYFDIMKLHRL--KNHQAKLTTMYQQTGIADRNQGFLNVTS  615
            +SS     +  ++  H+ILDYFD  KL +L   N   KLTT++Q +G A   QGF+ V  
Sbjct  73   ISSDNSFPLKSVMSVHIILDYFDKEKLAKLAKNNSSTKLTTLFQSSGEAKDQQGFVRVEV  132

Query  616  GKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
                I FGSA + +  ++ L   V ++PYNISVL VS+II  P ++
Sbjct  133  VDGEIFFGSASKGAQMNSKLVRSVTAQPYNISVLEVSSIIRVPNIN  178



>ref|XP_010486992.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Camelina 
sativa]
Length=255

 Score =   129 bits (324),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/150 (48%), Positives = 98/150 (65%), Gaps = 1/150 (1%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVD  471
            +++FNIT ILN + ++  FN LL+ T LA+ IN+  TITVL V NG I  LS +P +L+ 
Sbjct  21   SNSFNITNILNEHDDFSTFNKLLSETQLASTINSRQTITVLVVSNGAISSLSGQPTNLIK  80

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSAV  648
            +IL  H+ILDY+D  KL  L      LTT++Q +G A   QGFLN T  KDG ++FGSAV
Sbjct  81   KILSLHIILDYYDQKKLKNLSKKSVLLTTLFQSSGQARGQQGFLNATVTKDGNVLFGSAV  140

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIV  738
                 +A L + V S P+NISVL +S+ I+
Sbjct  141  PGPDLNAELLDSVASLPFNISVLHISSAIM  170



>ref|XP_009605451.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Nicotiana 
tomentosiformis]
Length=422

 Score =   132 bits (333),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 106/172 (62%), Gaps = 4/172 (2%)
 Frame = +1

Query  247  LSAAAVILLTCILSTAS--AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAV  420
            + A  + L T +  T S  A NIT IL+++PEY  FN  LT+T LA  IN+  TITVLA+
Sbjct  1    MGALHIFLFTLMSITISIHAHNITEILSKFPEYSEFNSYLTQTKLADEINSRQTITVLAL  60

Query  421  KNGGIGDLSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQG  597
             NG + D+  + P+ ++  +L  H++LDYFD  KLH++ +     TT+YQ TG A+ N G
Sbjct  61   TNGAMSDVVGKHPLSVIKNVLSLHILLDYFDSTKLHKISDGTTLSTTLYQTTGNANGNLG  120

Query  598  FLNVTSGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             +N+T  K G V FGSAV  SP  +   + V    YNISVL +S+ I+ PG+
Sbjct  121  SVNITDLKGGKVGFGSAVSHSPLASTYTKSVKQIEYNISVLEISSPIIAPGI  172



>ref|XP_004486594.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Cicer 
arietinum]
Length=344

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 101/153 (66%), Gaps = 5/153 (3%)
 Frame = +1

Query  295  SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDE  474
            + F++T++L++YP Y  +++ LT+T LAT INA  TITVL V N G+  +S +P+D++ +
Sbjct  26   TCFDVTKMLSQYPAYSTYSNYLTQTQLATEINAKPTITVLVVDNSGMAPISGKPMDVIKK  85

Query  475  ILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSAVR  651
            +L  HVILDYFD+ K   L N    ++TM++  G+    + F+ +T    G + F SA  
Sbjct  86   VLSVHVILDYFDVQKFQHLGNKTITVSTMFESKGM----ERFIKITDLNTGAVTFTSAAD  141

Query  652  RSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             +P  A+L + ++++PYNIS++ +ST+I+ P L
Sbjct  142  PNPTGANLIKAIVAQPYNISLVQISTVIIPPSL  174



>ref|XP_008352034.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Malus domestica]
 ref|XP_008361056.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Malus domestica]
Length=291

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 99/162 (61%), Gaps = 5/162 (3%)
 Frame = +1

Query  304  NITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEILR  483
            NIT+IL +  ++  FN LL+ T LA  IN   TIT+LAV NGG+G LS +  DL  +IL 
Sbjct  25   NITKILEKQSDFSNFNSLLSETKLANEINKRKTITILAVDNGGVGGLSGQSSDLTKKILS  84

Query  484  THVILDYFDIMKLHRL--KNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFGSAVRRS  657
             HVILDY+D  KL +L   N    LTTM+Q TG A   QGF+ V+   + I F SA + +
Sbjct  85   VHVILDYYDSDKLKKLFKSNKSVTLTTMFQSTGQARHQQGFITVSVKDNHISFASAYKGN  144

Query  658  PHD---AHLEEEVMSRPYNISVLGVSTIIVTPGLDDDDGRTA  774
             +     +L + V+S+PYNISVL V +II  P +++ D   A
Sbjct  145  NNGGNHVNLVKSVVSQPYNISVLQVGSIIDVPDIENTDSAPA  186



>gb|ABR16344.1| unknown [Picea sitchensis]
Length=387

 Score =   131 bits (329),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 97/160 (61%), Gaps = 1/160 (1%)
 Frame = +1

Query  265  ILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDL  444
            +LL   L  A+AFNIT+IL+ YP+Y +FND LTRT LA  IN+  TITVL V NG +  L
Sbjct  7    VLLLSFLCCANAFNITKILDAYPDYSIFNDDLTRTKLADEINSRKTITVLVVNNGAMASL  66

Query  445  SSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKD  624
            S   +  V   L  HV+LD+FD  KLH++ N     TT+YQ TG A  N GF+N+T  K 
Sbjct  67   SGLDLASVKRALSLHVVLDFFDAEKLHQVTNGTTLSTTLYQTTGSAAGNAGFINITDLKG  126

Query  625  GIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVT  741
            G V FG + R +  D+   + V    +N+SV+ VS  I T
Sbjct  127  GKVGFGLSGRGAKLDSTYVKSVKQDGFNLSVVEVSQPITT  166



>dbj|BAP11158.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
 dbj|BAP11160.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 97/161 (60%), Gaps = 1/161 (1%)
 Frame = +1

Query  271  LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS  450
            L+ + +  S  NIT IL  +PEY  FN  L++T LA  IN+  TITVLA+ NG + DL+ 
Sbjct  3    LSLLATKISGHNITDILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAMSDLAK  62

Query  451  RPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGI  630
             P+ ++   L   V+LDY+D  KLH++       TT+YQ TG A  N GF+N+T  + G 
Sbjct  63   HPLSVIKSALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGK  122

Query  631  V-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            V FGSA   S  D+   + V   PYN+SVL +++ I+ PG+
Sbjct  123  VGFGSAAPGSKLDSSYTKSVKQIPYNVSVLEINSPIIAPGI  163



>dbj|BAP11162.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
 dbj|BAP11163.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 97/161 (60%), Gaps = 1/161 (1%)
 Frame = +1

Query  271  LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS  450
            L+ + +  S  NIT IL  +PEY  FN  L++T LA  IN+  TITVLA+ NG + DL+ 
Sbjct  3    LSLLATKISGHNITDILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAMSDLAK  62

Query  451  RPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGI  630
             P+ ++   L   V+LDY+D  KLH++       TT+YQ TG A  N GF+N+T  + G 
Sbjct  63   HPLSVIKNALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGK  122

Query  631  V-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            V FGSA   S  D+   + V   PYN+SVL +++ I+ PG+
Sbjct  123  VGFGSAAPGSKLDSSYTKSVKQIPYNVSVLEINSPIIAPGI  163



>ref|XP_007024813.1| FASCICLIN-like arabinogalactan protein 14 precursor, putative 
[Theobroma cacao]
 gb|EOY27435.1| FASCICLIN-like arabinogalactan protein 14 precursor, putative 
[Theobroma cacao]
Length=304

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 99/153 (65%), Gaps = 2/153 (1%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVD  471
            A AFNIT+IL+++P++  FN+ L  TG+A  IN+  T+TVL V NG + ++S +  D + 
Sbjct  22   ADAFNITQILSQFPDFTTFNNYLIHTGVADQINSEQTVTVLVVANGNMSEVSGQSPDAMK  81

Query  472  EILRTHVILDYFDIMKLHRLKNHQA-KLTTMYQQTGIADRNQGFLNVTS-GKDGIVFGSA  645
            + L  HVILDYF + KL  L+N  A  LTT+YQQ+G A   QGFLNV   G  G+ FGSA
Sbjct  82   KTLSVHVILDYFGVEKLKNLQNKTALTLTTLYQQSGQAQNQQGFLNVAHVGNGGVAFGSA  141

Query  646  VRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTP  744
               S  D+   + V S+PYNISVL +S II  P
Sbjct  142  AAGSNLDSIFIKPVASQPYNISVLQISNIINVP  174



>dbj|BAP11159.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 97/161 (60%), Gaps = 1/161 (1%)
 Frame = +1

Query  271  LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS  450
            L+ + +  S  NIT IL  +PEY  FN  L++T LA  IN+  TITVLA+ NG + DL+ 
Sbjct  3    LSLLATKISGHNITDILKDFPEYSQFNSYLSQTKLADEINSRQTITVLALPNGAMSDLAK  62

Query  451  RPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGI  630
             P+ ++   L   ++LDY+D  KLH++       TT+YQ TG A  N GF+N+T  + G 
Sbjct  63   HPLSVIKSALSLLILLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGK  122

Query  631  V-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            V FGSA   S  D+   + V   PYN+SVL +++ I+ PG+
Sbjct  123  VGFGSAAPGSKLDSSYTKSVKQIPYNVSVLEINSPIIAPGI  163



>dbj|BAP11161.1| putative Fasciclin-like Arabinogalactan-protein 10, partial [Zanthoxylum 
ailanthoides]
Length=188

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 97/161 (60%), Gaps = 1/161 (1%)
 Frame = +1

Query  271  LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS  450
            L+ + +  S  NIT IL  +PEY  FN  L++T LA  IN+  T+TVLA+ NG + DL+ 
Sbjct  3    LSLLATKISGHNITDILKDFPEYSQFNSYLSQTKLADEINSRQTLTVLALPNGAMSDLAK  62

Query  451  RPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGI  630
             P+ ++   L   V+LDY+D  KLH++       TT+YQ TG A  N GF+N+T  + G 
Sbjct  63   HPLSVIKSALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGK  122

Query  631  V-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            V FGSA   S  D+   + V   PYN+SVL +++ I+ PG+
Sbjct  123  VGFGSAAPGSKLDSSYTKSVKQIPYNVSVLEINSPIIAPGI  163



>ref|XP_010438048.1| PREDICTED: fasciclin-like arabinogalactan protein 5 [Camelina 
sativa]
Length=286

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 97/168 (58%), Gaps = 0/168 (0%)
 Frame = +1

Query  247  LSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKN  426
            LS  ++ +L       +A NIT    +Y  +   ++L T+T L   I+ + TITVLAV N
Sbjct  7    LSLFSLTILLVFSKVVAADNITLAFEKYSNFSTMSNLFTQTKLTVPISKYQTITVLAVSN  66

Query  427  GGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLN  606
              I  +++R    +  IL THVILDY+D +KL  ++     LTT+YQ TG+ +   GFLN
Sbjct  67   DAISSITNRSDVELKNILMTHVILDYYDELKLQAMREKSIMLTTLYQTTGLGEEMNGFLN  126

Query  607  VTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            VT  +  + FGSAV+ SP +A     V   PYN+S++ +S  IV PGL
Sbjct  127  VTKMEGRVYFGSAVKNSPLNAEYVSTVYHNPYNLSIIEISMPIVAPGL  174



>emb|CDP17792.1| unnamed protein product [Coffea canephora]
Length=460

 Score =   130 bits (328),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 95/153 (62%), Gaps = 2/153 (1%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PIDLVDE  474
            A NIT IL+ +PEY  +N  LT T LA  IN+  TITVL + N  +  L+++ P+ +V +
Sbjct  62   AHNITEILSAFPEYSEYNKFLTDTKLADEINSRETITVLVLTNSAMDSLAAKHPLSVVKK  121

Query  475  ILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAVR  651
             L  HV+LDY+D  KLH + N     TT+YQ TG A  NQGF+N+T  K G V FGSAV 
Sbjct  122  ALSLHVVLDYYDAGKLHDISNGTTLSTTLYQTTGNAPGNQGFVNITDLKGGKVGFGSAVP  181

Query  652  RSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             S  D+   + V   PYNISV+ +S  I+ PG+
Sbjct  182  GSKLDSTYTKSVKQIPYNISVIEISAPIIAPGV  214



>ref|XP_006298989.1| hypothetical protein CARUB_v10015115mg [Capsella rubella]
 gb|EOA31887.1| hypothetical protein CARUB_v10015115mg [Capsella rubella]
Length=252

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 99/152 (65%), Gaps = 1/152 (1%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
            +++++FNIT ILN + ++  FN+LL+ T LA+ IN   TITVL V NG +  LS +P D+
Sbjct  20   TSSNSFNITNILNEHDDFSTFNNLLSETQLASTINKRQTITVLVVSNGALSSLSGQPTDV  79

Query  466  VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGS  642
            + +IL  H++LDY+D  KL  L      LTT++Q +G A   QGFLN T   +G + FGS
Sbjct  80   IKKILSLHIVLDYYDQKKLKNLSKKSVLLTTLFQSSGQAKGQQGFLNATVMTNGDVAFGS  139

Query  643  AVRRSPHDAHLEEEVMSRPYNISVLGVSTIIV  738
            AV  S  ++ L + V S P+NISVL +S+ I+
Sbjct  140  AVPGSDRNSQLLDSVASLPFNISVLHISSAIM  171



>gb|KDP28734.1| hypothetical protein JCGZ_14505 [Jatropha curcas]
Length=423

 Score =   130 bits (326),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 98/161 (61%), Gaps = 1/161 (1%)
 Frame = +1

Query  271  LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS  450
             + I +T SA NIT IL+ +P+Y  FN  LT+T LA  IN+  TITVLA+ NG I  ++ 
Sbjct  12   FSVISTTISAHNITDILSGFPDYSEFNKYLTQTKLADEINSRETITVLALNNGAISSIAK  71

Query  451  RPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGI  630
             P+ ++  IL   V+LDY+D  KLH++       TT+YQ TG A  N GF+N+T  + G 
Sbjct  72   HPLPVIKNILSLLVLLDYYDPSKLHQISKGTTLSTTLYQTTGSAPGNLGFVNITDLQGGK  131

Query  631  V-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            V FGSA   S  ++   + V   PYNISVL VS  I+ PG+
Sbjct  132  VGFGSAAPGSKLESSYTKSVKQVPYNISVLEVSAPIIAPGI  172



>gb|KEH39774.1| fasciclin domain protein [Medicago truncatula]
Length=268

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 97/163 (60%), Gaps = 1/163 (1%)
 Frame = +1

Query  268  LLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLS  447
            L   + S+  A +IT++L + P++  FN  LT T L   IN+ +TITVLAV +G +  +S
Sbjct  13   LFLAVSSSIHALDITKLLGQNPDFAAFNKQLTETKLVDQINSRNTITVLAVSDGAMSAIS  72

Query  448  SRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT-SGKD  624
             +    +  I+ THV+LDYFD  KL         LTT++Q +G A   QGFL V   G+ 
Sbjct  73   GKSPQAIKAIMSTHVVLDYFDEKKLSEAVGSGILLTTLFQASGQAKNQQGFLKVKLIGEG  132

Query  625  GIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
             + FGSAV  +P D  L + V+ +PYNIS+L V+  I+ PG+D
Sbjct  133  EMDFGSAVSGAPIDVALVKTVVKQPYNISILQVAKPIIFPGVD  175



>ref|XP_002320736.1| Fasciclin-like arabinogalactan protein 8 precursor [Populus trichocarpa]
 gb|EEE99051.1| Fasciclin-like arabinogalactan protein 8 precursor [Populus trichocarpa]
Length=421

 Score =   129 bits (325),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 104/175 (59%), Gaps = 2/175 (1%)
 Frame = +1

Query  232  MSPLQLSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITV  411
            M+ LQ S      L+ ++ST  A NIT IL+ +PEY  FN  LT+T LA  IN   TITV
Sbjct  1    MATLQYSLLLSFTLSALVSTILAHNITDILSGFPEYSEFNKYLTQTKLADEINTRQTITV  60

Query  412  LAVKNGGIGDLSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADR  588
            LA+ NG +  L+++ P+ ++   L   V+LDY+D  KLH++       TT+YQ TG A  
Sbjct  61   LALNNGAMTALAAKHPLSVIKNALSLLVVLDYYDPTKLHQISKGTTLSTTLYQTTGNAPG  120

Query  589  NQGFLNVTSGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            N GF+N+T  + G V FGSA   S  D+   + V   PYNIS+L +S  I+ PG+
Sbjct  121  NLGFVNITDLQGGKVGFGSAAPGSKLDSSYTKSVKQVPYNISILEISQPIIAPGI  175



>ref|XP_006412600.1| hypothetical protein EUTSA_v10027390mg [Eutrema salsugineum]
 gb|ESQ54053.1| hypothetical protein EUTSA_v10027390mg [Eutrema salsugineum]
Length=286

 Score =   127 bits (319),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 92/152 (61%), Gaps = 0/152 (0%)
 Frame = +1

Query  295  SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDE  474
            +A NITR   +Y  +   +DL  +T L   I+ + TITVLAV N  I  +++R    +  
Sbjct  23   TASNITRAFAKYSNFSTMSDLFIKTKLTIPISKYRTITVLAVSNDAISSITNRSDIELKN  82

Query  475  ILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFGSAVRR  654
            IL THVILDY+D +KL+ LK     LTT+YQ TG+ +   GF+N+T  K  I FGS V+ 
Sbjct  83   ILMTHVILDYYDELKLNGLKEKSIMLTTLYQTTGLGEEMNGFINLTKSKGRIYFGSEVKG  142

Query  655  SPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            SP +A   + +   PYN+S++ +S  IV PGL
Sbjct  143  SPLNAEYVKTLYHNPYNLSIIQISMPIVAPGL  174



>ref|XP_010432871.1| PREDICTED: fasciclin-like arabinogalactan protein 5 [Camelina 
sativa]
Length=286

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 97/168 (58%), Gaps = 0/168 (0%)
 Frame = +1

Query  247  LSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKN  426
            LS  ++ +L       +A NIT    +Y  +   ++L T+T L   I+ + TITVLAV N
Sbjct  7    LSLFSLTILLVFSKVVTADNITLAFEKYSNFSTMSNLFTQTKLTVPISKYQTITVLAVSN  66

Query  427  GGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLN  606
              I  +++R    +  IL THVILDY+D +KL  ++     LTT+YQ TG+ +   GFLN
Sbjct  67   DAISSITNRSDVELKNILMTHVILDYYDELKLQGMREKSIMLTTLYQTTGLGEEMNGFLN  126

Query  607  VTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            VT  +  + FGSAV+ SP +A     V   PYN+S++ +S  IV PGL
Sbjct  127  VTKLEGRVYFGSAVKNSPLNAEYVSTVYHNPYNLSIIEISMPIVAPGL  174



>gb|AFK47920.1| unknown [Medicago truncatula]
Length=287

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 101/170 (59%), Gaps = 1/170 (1%)
 Frame = +1

Query  247  LSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKN  426
            LS   + L   + S+  AF+I ++L+R PE+  FN  L  T L   IN  +TITV A+ N
Sbjct  6    LSFLCLALFLTVSSSIHAFDIQKLLDRTPEFSTFNKYLNETKLVGQINRRNTITVFALDN  65

Query  427  GGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLN  606
            G +  +S +  + +  I+ THV+LDY+D  KL    + +  LTT+YQ +GIA   QG+L 
Sbjct  66   GAMSSVSDKMPEAIRAIMATHVLLDYYDPTKLIGAMHKREPLTTLYQSSGIAVDQQGYLK  125

Query  607  VTSGKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            V    DG +  GSAV  +P D  L + V ++PYNI+++ V+  I+ PGL+
Sbjct  126  VNRTSDGDLAIGSAVSGAPIDVKLVKVVFAQPYNITIIQVAKPIMFPGLE  175



>dbj|BAK06740.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=275

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 87/149 (58%), Gaps = 1/149 (1%)
 Frame = +1

Query  301  FNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEIL  480
            FNIT +L+  PE+  FN LL++T L   IN   TITVL V N     ++S P D   ++L
Sbjct  27   FNITEVLDESPEFSTFNSLLSKTNLVEEINKRQTITVLVVDNSAASAITSLPTDTQKKVL  86

Query  481  RTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT-SGKDGIVFGSAVRRS  657
               VILDY+D MKL  ++   A LTT++Q TG A    G +N T S  D + FGSA   +
Sbjct  87   AVQVILDYYDPMKLEGIEKRTALLTTLFQTTGAATDRAGLVNYTHSADDQMAFGSAEPGA  146

Query  658  PHDAHLEEEVMSRPYNISVLGVSTIIVTP  744
            P  + L + V  RPYN+SV+ VS  I+ P
Sbjct  147  PLSSQLVKVVACRPYNLSVMQVSAAIIPP  175



>gb|KEH39771.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=287

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/170 (39%), Positives = 101/170 (59%), Gaps = 1/170 (1%)
 Frame = +1

Query  247  LSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKN  426
            LS   + L   + S+  AF+I ++L+R PE+  FN  L  T L   IN  +TITV A+ N
Sbjct  6    LSFLCLALFLTVSSSIHAFDIQKLLDRTPEFSTFNKYLNETKLVGQINRRNTITVFALDN  65

Query  427  GGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLN  606
            G +  +S +  + +  I+ THV+LDY+D  KL    + +  LTT+YQ +GIA   QG+L 
Sbjct  66   GAMSSVSDKMPEAIRAIMATHVLLDYYDPTKLIGAMHKREPLTTLYQSSGIAVDQQGYLK  125

Query  607  VTSGKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            V    DG +  GSAV  +P D  L + V ++PYNI+++ V+  I+ PGL+
Sbjct  126  VNRTSDGDLAIGSAVSGAPIDVKLVKVVFAQPYNITIIQVAKPILFPGLE  175



>ref|XP_011090995.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Sesamum 
indicum]
Length=426

 Score =   129 bits (323),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 68/152 (45%), Positives = 94/152 (62%), Gaps = 2/152 (1%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PID  462
            ++ASA NIT IL+ +PEY  FNDLL++T LA  IN+   +TV  + NG +   + + P+ 
Sbjct  19   ASASASNITEILSGFPEYSEFNDLLSQTKLADEINSREPVTVCVLPNGALSSFTGKYPLS  78

Query  463  LVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FG  639
            ++  IL  HV+LDYFD  KLH++       TT+YQ TG A  N GF+N+T  + G V FG
Sbjct  79   VIKNILALHVLLDYFDAPKLHKISEGSVLSTTLYQTTGNAAGNLGFVNITDLRGGKVGFG  138

Query  640  SAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            S V  SP D+   + V   PYN+SV+ VS  I
Sbjct  139  SGVPGSPLDSTFTKSVKQVPYNLSVIEVSKAI  170



>ref|XP_010447580.1| PREDICTED: fasciclin-like arabinogalactan protein 5 [Camelina 
sativa]
Length=284

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 97/168 (58%), Gaps = 0/168 (0%)
 Frame = +1

Query  247  LSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKN  426
            LS  ++ +L       +A NIT    +Y  +   ++L T+T L   I+ + TITVLAV N
Sbjct  7    LSLFSLTILLVFSKVVTADNITLAFEKYSNFSTMSNLFTQTKLTVPISKYQTITVLAVSN  66

Query  427  GGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLN  606
              I  +++R    +  IL THVILDY+D +KL  ++     +TT+YQ TG+ +   GFLN
Sbjct  67   DAISSITNRSDVELKNILMTHVILDYYDELKLQGMREKSIMVTTLYQTTGLGEEMNGFLN  126

Query  607  VTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            VT  +  + FGSAV+ SP +A     V   PYN+S++ +S  IV PGL
Sbjct  127  VTKMEGRVYFGSAVKNSPLNAEYVSTVYHNPYNLSIIEISMPIVAPGL  174



>ref|XP_006286247.1| hypothetical protein CARUB_v10007817mg [Capsella rubella]
 gb|EOA19145.1| hypothetical protein CARUB_v10007817mg [Capsella rubella]
Length=286

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 95/168 (57%), Gaps = 0/168 (0%)
 Frame = +1

Query  247  LSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKN  426
            LS  ++ +L       +A NIT    +Y  +   + L T+T L   I+ + TITVLAV N
Sbjct  7    LSLFSLTILLVFSKVVTADNITLAFQKYSNFSTMSSLFTQTKLTVPISKYQTITVLAVSN  66

Query  427  GGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLN  606
              I  +++R    +  IL THVILDY+D +KL  ++     LTT+YQ TG+ +   GFLN
Sbjct  67   DAISSITNRSDVELKNILMTHVILDYYDELKLQGMREKSIMLTTLYQTTGLGEEMNGFLN  126

Query  607  VTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            VT     + FGSAV+ SP +A     V   PYN+S++ +S  IV PGL
Sbjct  127  VTKLNGRVYFGSAVKNSPLNAEYVSTVYHNPYNLSIIQISMPIVAPGL  174



>emb|CDY42162.1| BnaC05g40570D [Brassica napus]
Length=251

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 99/155 (64%), Gaps = 1/155 (1%)
 Frame = +1

Query  274  TCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR  453
            T + +++++FNIT ILN+  E+  FN+LLT+T LA+ IN+  TITVLA+ N  +   S +
Sbjct  17   TFLYTSSNSFNITNILNQNNEFSTFNNLLTQTNLASAINSRQTITVLALSNDAVSHFSDQ  76

Query  454  PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-I  630
              +   ++L   +ILDY+DI KL  L      LTT++Q +G A   QGF+N T   +G +
Sbjct  77   SAEDNKKVLSLLIILDYYDIKKLRSLNKKSVILTTLFQASGQAKGEQGFVNATVMNNGDV  136

Query  631  VFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            +FGSAV  S  D+ L + V + PYNISVL +S+ I
Sbjct  137  MFGSAVPGSILDSKLIDSVATHPYNISVLHISSYI  171



>ref|XP_003534603.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Glycine 
max]
Length=416

 Score =   128 bits (322),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PID  462
            +TASA NIT IL   P+Y  FND L++TGLA  IN   TITVL + N     ++++ P+ 
Sbjct  15   ATASAHNITDILAANPDYSDFNDFLSQTGLAGDINTRQTITVLVLNNAAFSAVAAKHPLS  74

Query  463  LVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FG  639
            +V  +L  H++LDYFD  KLH++ N     TT+YQ TG A+ N G +N+T  K G V FG
Sbjct  75   VVKNLLSLHILLDYFDNTKLHQITNGTTLSTTLYQTTGNANGNVGSVNITDLKGGKVGFG  134

Query  640  SAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            SA   S  D+   + V S PYNISV+ +S  I+ PG+
Sbjct  135  SAAPGSKLDSSYIKSVKSIPYNISVIEISAPIMAPGI  171



>ref|XP_008460132.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Cucumis 
melo]
Length=423

 Score =   128 bits (321),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 96/154 (62%), Gaps = 2/154 (1%)
 Frame = +1

Query  295  SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGD-LSSRPIDLVD  471
            SA NIT +L  YP+Y VF++ L +T LA  IN+  TITVL V NG +   L   P+ ++ 
Sbjct  21   SAHNITDMLKDYPQYSVFSNYLQQTRLADEINSRQTITVLVVSNGALSPILDKHPLSVIK  80

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSAV  648
             IL  H++LDY+D  KLH++ N     TT+YQ TG A  N GF+N+T  + G + FGSAV
Sbjct  81   NILSLHIVLDYYDPAKLHKISNGTTLSTTLYQTTGHAPGNLGFVNITDLQGGKVAFGSAV  140

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              S  ++   + V+S PYNISV+ +S  IV  G+
Sbjct  141  PGSKLESSYTKSVVSMPYNISVIEISAPIVAQGI  174



>ref|XP_006858016.1| hypothetical protein AMTR_s00069p00195790 [Amborella trichopoda]
 gb|ERN19483.1| hypothetical protein AMTR_s00069p00195790 [Amborella trichopoda]
Length=421

 Score =   128 bits (321),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 93/156 (60%), Gaps = 1/156 (1%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
            S +SA NIT +L+ +P+Y ++N  LT+T L   IN   T+TV  + N  +  L+  P+ +
Sbjct  20   SLSSAHNITEMLSAFPDYSLYNSYLTQTKLCDEINTRQTLTVFVLNNAAMSALAKHPLSV  79

Query  466  VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGS  642
            V  +L   ++LDYFD  KLH + +     TT+YQ TG A  N GF+N+T  K G V FGS
Sbjct  80   VKNVLSLLIVLDYFDNQKLHSITDGSMLSTTLYQTTGDAKGNFGFVNITDLKGGKVGFGS  139

Query  643  AVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            A   SP D+   + V   PYNISV+ +S  I+ PGL
Sbjct  140  AAPGSPLDSTYTKSVKQVPYNISVMEISAPIIAPGL  175



>ref|XP_006445226.1| hypothetical protein CICLE_v10020328mg [Citrus clementina]
 gb|ESR58466.1| hypothetical protein CICLE_v10020328mg [Citrus clementina]
 gb|KDO85869.1| hypothetical protein CISIN_1g035767mg [Citrus sinensis]
Length=418

 Score =   127 bits (320),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 98/158 (62%), Gaps = 2/158 (1%)
 Frame = +1

Query  283  LSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PI  459
            ++ +SA NIT IL  +PEY  FN  LT+T LA  IN+  TITVL + NG + DL+++ P+
Sbjct  15   ITISSAHNITDILKDFPEYSQFNSYLTQTKLADEINSRQTITVLVLPNGAMSDLTAKHPL  74

Query  460  DLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-F  636
             ++   L   V+LDY+D  KLH++       TT+YQ TG A  N GF+N+T  + G V F
Sbjct  75   SVIKSALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGF  134

Query  637  GSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            GSA   S  D+   + V   PYN+SVL +S+ I+ PG+
Sbjct  135  GSAASGSKLDSTYTKSVKQIPYNVSVLEISSPIIAPGI  172



>gb|KHM99327.1| Fasciclin-like arabinogalactan protein 3 [Glycine soja]
Length=303

 Score =   125 bits (314),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 95/153 (62%), Gaps = 7/153 (5%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEI  477
            AF+IT++L +YPE+  FN  LT T LA  IN+ +TITVLAV++  +  ++++  + +  I
Sbjct  23   AFDITQLLGQYPEFSTFNKYLTETKLADQINSRNTITVLAVEDSAMHSIAAKSPEAIKAI  82

Query  478  LRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFGSAVRRS  657
            + THVILD+FD  KL   +    +LTT++Q +G+A   QGFL V    +G +       +
Sbjct  83   IGTHVILDFFDEKKLMEAQASSQQLTTLFQASGLAVNQQGFLKVALVGEGEI------AA  136

Query  658  PHDA-HLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            P DA  L   V S PYNIS+L V+  I+ PG+D
Sbjct  137  PVDATELMRTVTSEPYNISILQVTKPILVPGVD  169



>ref|XP_006491459.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like, partial 
[Citrus sinensis]
Length=459

 Score =   127 bits (320),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 98/158 (62%), Gaps = 2/158 (1%)
 Frame = +1

Query  283  LSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PI  459
            ++ +SA NIT IL  +PEY  FN  LT+T LA  IN+  TITVL + NG + DL+++ P+
Sbjct  56   ITISSAHNITDILKDFPEYSQFNSYLTQTKLADEINSRQTITVLVLPNGAMSDLTAKHPL  115

Query  460  DLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-F  636
             ++   L   V+LDY+D  KLH++       TT+YQ TG A  N GF+N+T  + G V F
Sbjct  116  SVIKSALSLLVLLDYYDPQKLHQISKGTTLSTTLYQTTGNAPGNLGFVNITDLQGGKVGF  175

Query  637  GSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            GSA   S  D+   + V   PYN+SVL +S+ I+ PG+
Sbjct  176  GSAASGSKLDSTYTKSVKQIPYNVSVLEISSPIIAPGI  213



>ref|XP_011034618.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Populus 
euphratica]
Length=421

 Score =   127 bits (319),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 103/175 (59%), Gaps = 2/175 (1%)
 Frame = +1

Query  232  MSPLQLSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITV  411
            M+ LQ S      L  ++ST  A NIT IL+ +PEY  FN  LT+T LA  IN   TITV
Sbjct  1    MAKLQYSLLLSFTLLALVSTILAHNITDILSGFPEYSEFNKYLTQTKLADEINTRQTITV  60

Query  412  LAVKNGGIGDLSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADR  588
            LA+ NG +  L+++ P+ ++   L   V+LDY+D  KLH++       TT+YQ TG A  
Sbjct  61   LALNNGAMTALAAKHPLSVIKNALSLLVVLDYYDPTKLHQISKGTTLSTTLYQTTGNAPG  120

Query  589  NQGFLNVTSGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            N GF+N+T  + G V FGSA   S  D+   + V   PYNIS+L +S  I+ PG+
Sbjct  121  NLGFVNITDLQGGKVGFGSAAPGSKLDSSYTKSVKQVPYNISILEISQPIIAPGI  175



>ref|XP_009363600.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Pyrus x 
bretschneideri]
Length=291

 Score =   125 bits (313),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 103/167 (62%), Gaps = 5/167 (3%)
 Frame = +1

Query  289  TASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLV  468
            T+SAFNIT+IL +  ++  FN LL+ T LA  IN   TITVLAV NGG+G LS    DL 
Sbjct  20   TSSAFNITKILEKQSDFSNFNSLLSETKLANEINKRKTITVLAVDNGGVGGLSGGSSDLT  79

Query  469  DEILRTHVILDYFDIMKLHRL--KNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFGS  642
             +IL  HV+LDY+D  KL +L   N    LTTM+Q TG A   QGF+ V+   + I F S
Sbjct  80   KKILSVHVVLDYYDTDKLKKLFKSNKSVTLTTMFQSTGQARHQQGFITVSVKDNHISFAS  139

Query  643  AVRRSPHD---AHLEEEVMSRPYNISVLGVSTIIVTPGLDDDDGRTA  774
            A + + +     +L + V+S+PYNISVL V +II  P +++ D   A
Sbjct  140  AYKGNNNGGNHVNLVKSVVSQPYNISVLQVGSIIDVPDIENTDSSPA  186



>ref|NP_194865.1| FASCICLIN-like arabinogalactan protein 5 [Arabidopsis thaliana]
 sp|O49586.1|FLA5_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 5; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAA16540.1| predicted protein [Arabidopsis thaliana]
 emb|CAB79855.1| predicted protein [Arabidopsis thaliana]
 gb|ABG48399.1| At4g31370 [Arabidopsis thaliana]
 gb|AEE85901.1| FASCICLIN-like arabinogalactan protein 5 [Arabidopsis thaliana]
Length=278

 Score =   124 bits (311),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 90/152 (59%), Gaps = 0/152 (0%)
 Frame = +1

Query  295  SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDE  474
            +A NIT    +Y ++    DL  +T L   I+ + TITVLAV N  I  +++R    +  
Sbjct  23   TANNITLAFQKYSKFSTMRDLFIKTKLIAAIDKYQTITVLAVSNDAISSITNRSEVELRN  82

Query  475  ILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFGSAVRR  654
            IL THVILDY+D +KL  ++     LTT+YQ TG+ ++  GFLNV+  K  + FGS V+ 
Sbjct  83   ILMTHVILDYYDELKLQGMREKSIMLTTLYQTTGLGEQMNGFLNVSKSKGRVYFGSEVKN  142

Query  655  SPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            SP +A     V   PYN+S++ ++  IV PGL
Sbjct  143  SPLNAEYVSTVYHNPYNLSIIQITMPIVAPGL  174



>emb|CDY00793.1| BnaC03g37770D [Brassica napus]
Length=266

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 102/164 (62%), Gaps = 9/164 (5%)
 Frame = +1

Query  271  LTCILSTASAF--------NITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKN  426
            LT I   ASAF        NIT IL++  ++  FN LL++TGLA+ IN+  TITVLA+ N
Sbjct  7    LTLIFFFASAFLYTPSNSFNITTILSQNKDFSTFNKLLSQTGLASTINSRQTITVLALAN  66

Query  427  GGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLN  606
              +   + + ++    IL  HVILDY+DI KL  L    A LTT++QQ+G A   QGF+N
Sbjct  67   DAVYLFADQSMEDNKVILSLHVILDYYDIKKLKSLSKKTAILTTLFQQSGQAKGQQGFVN  126

Query  607  VTSGKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            VT   +G I FGSAVR S  D+ L + V S P+NISVL +S+ I
Sbjct  127  VTVKDNGDIAFGSAVRGSLLDSQLIDSVASEPFNISVLHISSYI  170



>ref|XP_011097758.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Sesamum 
indicum]
Length=416

 Score =   126 bits (317),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 106/183 (58%), Gaps = 20/183 (11%)
 Frame = +1

Query  241  LQLS--AAAVILLTCIL-----STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHS  399
            +QLS  AAA +++ CI      ST+ A NITRIL ++PE+  FN  LT T LA  IN   
Sbjct  1    MQLSRAAAASVVVLCISLFLLPSTSDAHNITRILAKFPEFSTFNHYLTVTQLAPEINRRE  60

Query  400  TITVLAVKNGGIGDLSSRPIDL--VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQT  573
            TITV AV N G+ DL S+ + L  +  +L  HV+LDYFD  KLH + +  A   TM+Q T
Sbjct  61   TITVCAVDNAGMADLLSKHLTLGALKNVLSLHVLLDYFDAKKLHEITDGTALAATMFQAT  120

Query  574  GIADRNQGFLNVTSGKDGIVFGSAVRRSPHD------AHLEEEVMSRPYNISVLGVSTII  735
            G A  + GF+N+T  K     G  V  SP D      A   + V + PYNISV+ +STI+
Sbjct  121  GSATGSSGFVNITDLK-----GGKVGFSPEDNGGVVSATFVKTVQAIPYNISVIQISTIL  175

Query  736  VTP  744
             +P
Sbjct  176  PSP  178



>ref|XP_004144998.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 ref|XP_004153890.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 ref|XP_004160662.1| PREDICTED: fasciclin-like arabinogalactan protein 8-like [Cucumis 
sativus]
 gb|KGN46232.1| hypothetical protein Csa_6G076800 [Cucumis sativus]
Length=423

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 106/172 (62%), Gaps = 5/172 (3%)
 Frame = +1

Query  250  SAAAVILLTCILSTA---SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAV  420
            ++ +++L   I +TA   SA NIT +L  +P+Y VF++ L +T LA  IN+  TITVL V
Sbjct  3    ASKSLLLFLAIAATAAIVSAHNITDMLKDFPQYSVFSNYLQQTRLADEINSRQTITVLVV  62

Query  421  KNGGIGD-LSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQG  597
             NG +   L   P+ ++  +L  H++LDY+D  KLH++ N     TT+YQ TG A  N G
Sbjct  63   ANGALSPILDKHPLSVIKNLLSLHIVLDYYDPAKLHKISNGTTLSTTLYQTTGHAPGNLG  122

Query  598  FLNVTSGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            F+N+T  + G V FGSAV  S  ++   + V+S PYNISV+ +S  IV  G+
Sbjct  123  FVNITDLQGGKVGFGSAVPGSKLESSYTKSVVSLPYNISVIEISAPIVAQGI  174



>gb|KEH39773.1| fasciclin domain protein [Medicago truncatula]
Length=287

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 99/170 (58%), Gaps = 1/170 (1%)
 Frame = +1

Query  247  LSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKN  426
            LS   + L   + S+  AF+I ++L+R PE+  FN  L  T L   IN  +TITV A+ N
Sbjct  6    LSFLCLALFLTVSSSIHAFDIQKLLDRTPEFSTFNKYLNETKLVGQINRRNTITVFALDN  65

Query  427  GGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLN  606
            G +  +S +  + +  I+ THV+LDY+D  KL      +  L T+YQ +GIA   QG+L 
Sbjct  66   GAMSSVSDKMPEAIRAIMATHVLLDYYDPTKLIGAMRKRELLITLYQSSGIAVDQQGYLK  125

Query  607  VTSGKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            V    DG +  GSAV  +P D  L + V ++PYNI+++ V+  I+ PGL+
Sbjct  126  VNRTSDGDLAIGSAVSGAPIDVKLVKVVFAQPYNITIIQVAKPILYPGLE  175



>ref|XP_007161299.1| hypothetical protein PHAVU_001G058300g [Phaseolus vulgaris]
 gb|ESW33293.1| hypothetical protein PHAVU_001G058300g [Phaseolus vulgaris]
Length=282

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/180 (36%), Positives = 109/180 (61%), Gaps = 4/180 (2%)
 Frame = +1

Query  241  LQLSAAAVILLTCILSTASA---FNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITV  411
            +   +++++ +  +L+ +SA   F+IT++L + PE   FN  +T   LA  IN+ +TITV
Sbjct  1    MSFKSSSLLCIAFLLAFSSAVYGFDITKMLEKEPELSSFNKYITEAKLADQINSRNTITV  60

Query  412  LAVKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRN  591
            LAV N  I  ++ +  +L+  I+ THVILDY+D  KL   +    +LTT++Q +G A + 
Sbjct  61   LAVGNDAISSIAGKSPELIKAIISTHVILDYYDEKKLVEAQASTPQLTTLFQSSGNAVKE  120

Query  592  QGFLNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDDDDGRT  771
            QGF+ V+   +G +  S+V  S + + L + + S PYNIS+L V+  I+ PGLD    ++
Sbjct  121  QGFVKVSLIGEGEIAFSSVGSSDY-SELVKPIASEPYNISILQVTKPIIPPGLDSQTAQS  179



>ref|XP_010277448.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Nelumbo 
nucifera]
Length=427

 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 97/162 (60%), Gaps = 2/162 (1%)
 Frame = +1

Query  271  LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS  450
            L+  +  ++A NIT IL+ +PEY   ND LTRT LA  IN   TIT L + N  +  L++
Sbjct  16   LSIFVIPSTAHNITEILSGFPEYSAMNDYLTRTKLADEINTRETITCLVLPNSAMSALAA  75

Query  451  -RPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG  627
             +P+ +V  +LR  V+LDY+D  KLH++       TT+YQ TG A  N GF+N+T  K G
Sbjct  76   NKPLSVVKNVLRLLVLLDYYDGAKLHQISKGTTLTTTLYQVTGDAHGNLGFVNITDLKGG  135

Query  628  IV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             V FGSA   S  D+   + V   PYNISVL +S  I+ PG+
Sbjct  136  KVGFGSAAPGSKLDSTYTKSVKQIPYNISVLEISAPIIAPGI  177



>ref|XP_010092859.1| hypothetical protein L484_022454 [Morus notabilis]
 gb|EXB52677.1| hypothetical protein L484_022454 [Morus notabilis]
Length=424

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 104/173 (60%), Gaps = 5/173 (3%)
 Frame = +1

Query  247  LSAAAVILLTCILS---TASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLA  417
            L+ + V L   IL+     SA NIT IL+ +P+Y  +N  LT+T LA  IN+ +T+TVL 
Sbjct  4    LNQSLVFLCLSILALNAVVSAHNITAILSEFPDYSDYNKYLTQTKLADEINSRTTVTVLV  63

Query  418  VKNGGIGDLSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQ  594
            + NG    L+S+ P  ++ ++L  H++LDYFD  KLH+L +     TT+YQ TG A  N 
Sbjct  64   LNNGAFSALASKHPASVLKKVLSLHIVLDYFDAQKLHKLPDGSTLSTTLYQTTGNAPGNL  123

Query  595  GFLNVTSGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            G +N+T  K G V FGSA + S  D+   + V   PYNISVL +S  I+  G+
Sbjct  124  GSINITDLKGGKVGFGSAAQGSKLDSTYTKTVKEIPYNISVLEISAPIIATGI  176



>ref|XP_009379279.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Pyrus x 
bretschneideri]
Length=425

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 94/151 (62%), Gaps = 2/151 (1%)
 Frame = +1

Query  304  NITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PIDLVDEIL  480
            NIT IL+ +P+Y ++N  LT+T LA  IN H TITVL + N  I  L+++ P+ ++   L
Sbjct  25   NITDILSAFPDYSLYNSYLTQTRLADEINTHQTITVLVLNNAAISALAAKHPLAVIKNAL  84

Query  481  RTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAVRRS  657
              HV+LDY+D  KLH++ +     TT+YQ TG A  N GF+N+T  + G V FGSA   S
Sbjct  85   SLHVLLDYYDAPKLHKISDGSVLTTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAPGS  144

Query  658  PHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              D+   + V   PYNISVL +S  ++ PG+
Sbjct  145  KLDSSYTKSVKQIPYNISVLEISAPVIAPGI  175



>ref|XP_008232692.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Prunus mume]
 ref|XP_008232693.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Prunus mume]
Length=425

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 94/155 (61%), Gaps = 2/155 (1%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PIDLV  468
            +SA NIT IL+ +PEY  +N  LT+T LA  IN   TIT+L + N  I  L+++ P+ +V
Sbjct  21   SSAHNITAILSAFPEYSQYNSFLTQTRLADEINTRQTITILVLNNAAISALAAKHPLSVV  80

Query  469  DEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSA  645
               L  HV+LDY+D  KLH++       TT+YQ TG A  N GF+N+T  + G V FGSA
Sbjct  81   KNALSLHVLLDYYDPTKLHQISKGSTLSTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSA  140

Query  646  VRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
               S  D+   + V   PYNIS+L ++  I+ PGL
Sbjct  141  APGSKLDSSYTKSVKQIPYNISILEINAPIIAPGL  175



>ref|XP_009381782.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=303

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 94/166 (57%), Gaps = 1/166 (1%)
 Frame = +1

Query  253  AAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGG  432
            A+ + LL  + S +SA +I  IL  +PEY  F   LT+T +A  IN   TITVL V +  
Sbjct  7    ASVLFLLLFVSSASSALDIVEILQPFPEYSTFTKYLTQTKVADEINRRKTITVLVVNDSA  66

Query  433  IGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT  612
            I  LSS   D +   +  HVILDY+D   L  L N  A LTT++Q +G A    GFLN T
Sbjct  67   IAPLSSLSGDALKNAISVHVILDYYDPYTLDNLPNKTALLTTLFQASGHATGRLGFLNYT  126

Query  613  S-GKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPG  747
                + + FGSA   +P ++ L + V  RPY+ISVLG+S  IV  G
Sbjct  127  ELPGEQMTFGSAAPGAPLNSELNKVVAVRPYDISVLGISAAIVPSG  172



>ref|XP_008343059.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Malus domestica]
Length=425

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 93/151 (62%), Gaps = 2/151 (1%)
 Frame = +1

Query  304  NITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PIDLVDEIL  480
            NIT IL+ +P+Y ++N  LT+T LA  IN H TITVL   N  I  L+++ P+ ++   L
Sbjct  25   NITDILSAFPDYSLYNSYLTQTRLADEINTHQTITVLVFNNAAISALAAKHPLSVIKNAL  84

Query  481  RTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAVRRS  657
              HV+LDY+D  KLH++ +     TT+YQ TG A  N GF+N+T  + G V FGSA   S
Sbjct  85   SLHVLLDYYDAPKLHKISDGSVLTTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSAAPGS  144

Query  658  PHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              D+   + V   PYNISVL +S  ++ PG+
Sbjct  145  KLDSSYTKSVKQIPYNISVLEISAPVIAPGI  175



>ref|XP_003523715.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Glycine 
max]
Length=232

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 65/165 (39%), Positives = 98/165 (59%), Gaps = 3/165 (2%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
            ST    +IT++L +YPEY  FN  LT T LA  IN+ + +TVLA+ +  +  LS++P D 
Sbjct  20   STIHGLDITKLLGQYPEYAQFNKYLTETKLADQINSLNAVTVLALDDAAMASLSAKPQDA  79

Query  466  VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGS  642
            V  IL THV+++++D  KL   +  +AK+ T++Q +G+A  NQG++ V    +G I FGS
Sbjct  80   VKAILSTHVLVNFYDEKKLMEAEGSRAKVETLFQSSGVAKPNQGYIYVALINEGEIAFGS  139

Query  643  AVR--RSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDDDDGRT  771
            A     +P +  L   V S+P   S+L VS  IV PG++     T
Sbjct  140  AAAAPNAPFEVVLVRSVTSQPDAASILQVSKPIVAPGVESAASAT  184



>ref|XP_002511740.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50409.1| conserved hypothetical protein [Ricinus communis]
Length=425

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 103/175 (59%), Gaps = 2/175 (1%)
 Frame = +1

Query  232  MSPLQLSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITV  411
            M  LQ      +  + + +T +A NIT IL+ +P+Y  FN  LT+T LA  IN+  TITV
Sbjct  1    MEALQRLFFLFLAFSALSTTITAHNITDILSGFPDYSEFNKYLTQTKLADEINSRETITV  60

Query  412  LAVKNGGIGDLSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADR  588
            LA+ NG +  L+S+ P+ ++   L   V+LDY+D  KLH++       TT+YQ TG A  
Sbjct  61   LALSNGAMSALASKHPLSVIKNALSLLVLLDYYDPSKLHQISKGTTLSTTLYQTTGNAPG  120

Query  589  NQGFLNVTSGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            N GF+N+T  + G V FGSA   S  D+   + V   PYNISV+ VS  IV PG+
Sbjct  121  NLGFVNITDLQGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVIEVSAPIVAPGI  175



>ref|XP_003581094.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Brachypodium 
distachyon]
Length=277

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 92/158 (58%), Gaps = 2/158 (1%)
 Frame = +1

Query  283  LSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINA-HSTITVLAVKNGGIGDLSSRPI  459
             S ++ FNIT I++  PE+  FN LL++T +A  INA    ITVL V +   G +++ P 
Sbjct  21   FSNSAKFNITEIISESPEFKTFNSLLSKTKVAEEINARQDAITVLVVDDKAAGAITALPA  80

Query  460  DLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKD-GIVF  636
            D   ++L  HVILDY+D MKL  +    A LTT++Q TG A  + G +  T G D  + F
Sbjct  81   DTQKKVLAVHVILDYYDPMKLDSVHGKTAMLTTLFQTTGAAADSMGLIKYTQGADEQMSF  140

Query  637  GSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             SA   S   + L + V  RPYN+SV+ VS  I+ PG+
Sbjct  141  ASAEPGSSASSQLVKVVACRPYNLSVMQVSAAIIPPGI  178



>emb|CDY52668.1| BnaC01g38580D [Brassica napus]
Length=262

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 98/160 (61%), Gaps = 1/160 (1%)
 Frame = +1

Query  259  AVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIG  438
            ++         A AFNITRILN   E+  FN+LL++TGLA+ IN+  TITVLA+ N  + 
Sbjct  12   SLFFFASTFLNAHAFNITRILNLNNEFSTFNNLLSQTGLASTINSRQTITVLALSNDAMS  71

Query  439  DLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSG  618
              S +  +   + L  H++LDY+DI KL  L      LTT++Q +G A   QGF+N T  
Sbjct  72   LFSDQSTEDNKKSLSLHIVLDYYDIKKLKSLNKKSVILTTLFQSSGQAKGQQGFINATVM  131

Query  619  KDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
             +G ++FGSAVR S  D+ L + V + PYNISVL +S+ I
Sbjct  132  NNGDVMFGSAVRGSLLDSKLIDSVATHPYNISVLHISSYI  171



>ref|XP_010518164.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Camelina 
sativa]
Length=423

 Score =   124 bits (312),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 99/172 (58%), Gaps = 2/172 (1%)
 Frame = +1

Query  241  LQLSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAV  420
            L L A     +    ST S+ NIT+IL   P+Y  FN  LT+T LA  IN+ +TITVL +
Sbjct  9    LSLLAFVTFSILAFASTVSSHNITQILADSPDYSSFNSYLTQTKLADEINSRTTITVLVL  68

Query  421  KNGGIGDLSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQG  597
             NG +  L+ + P+ ++   L   V+LDY+D +KLH L       TT+YQ TG A  N G
Sbjct  69   NNGAMSSLAGKHPLSVIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLG  128

Query  598  FLNVTSGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            F+N+T  K G V FGSAV  S  D+   + V   PYNIS+L +   I+ PG+
Sbjct  129  FVNITDLKGGKVGFGSAVSGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGV  180



>gb|EPS62290.1| fasciclin-like arabinogalactan protein 13, partial [Genlisea 
aurea]
Length=400

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 92/148 (62%), Gaps = 2/148 (1%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PIDLVDE  474
            A NIT+IL+ YPEY  FN LLT+T LA  I++   +TVLA+ N  +  +S + P+ +V  
Sbjct  1    ATNITKILDAYPEYSDFNALLTQTKLADEIDSREPVTVLALPNSELSSISGKYPLGVVKS  60

Query  475  ILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAVR  651
            +L  HV+LDYFD  KLH++ +     TT+ Q TG A  N GF+N+T  + G V FGS + 
Sbjct  61   VLSLHVLLDYFDAAKLHKISDGSVLSTTLLQTTGNAAGNVGFVNITDLRGGKVGFGSGIA  120

Query  652  RSPHDAHLEEEVMSRPYNISVLGVSTII  735
             SP D+   + V   PYNISV+ VS  I
Sbjct  121  GSPLDSTFTKSVQQIPYNISVIEVSKAI  148



>emb|CDY18927.1| BnaC04g04230D [Brassica napus]
Length=416

 Score =   124 bits (311),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 96/162 (59%), Gaps = 2/162 (1%)
 Frame = +1

Query  271  LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS  450
            L  + ST    NIT+IL   PEY  FN  L++T LA  IN+ STIT+L + NG +  L+ 
Sbjct  16   LLALASTVRCHNITQILADNPEYSSFNSYLSQTKLADEINSRSTITLLVLNNGAMASLAG  75

Query  451  R-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG  627
            + P+ ++   L   V+LDY+D  KLH++ +     TT+YQ TG A  N GF+N+T  K G
Sbjct  76   KHPLSVIKNALSLLVLLDYYDPQKLHKISDGTVLTTTLYQTTGNAPGNLGFVNITDLKGG  135

Query  628  IV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             V FGSA   S  D+   + V   PYNISVL +   I++PGL
Sbjct  136  KVGFGSAASGSKLDSSYTKSVKQIPYNISVLEIDAPIISPGL  177



>ref|XP_010506492.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X1 
[Camelina sativa]
 ref|XP_010506494.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X2 
[Camelina sativa]
 ref|XP_010506495.1| PREDICTED: fasciclin-like arabinogalactan protein 8 isoform X3 
[Camelina sativa]
Length=423

 Score =   124 bits (311),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 97/163 (60%), Gaps = 3/163 (2%)
 Frame = +1

Query  268  LLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLS  447
            +L C  ST S+ NIT+IL   P+Y  FN  LT+T LA  IN+ +TITVL + NG +  L+
Sbjct  19   ILACA-STVSSHNITQILTDSPDYSSFNSYLTQTKLADEINSRTTITVLVLNNGAMSSLA  77

Query  448  SR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKD  624
             + P+ ++   L   V+LDY+D +KLH L       TT+YQ TG A  N GF+N+T  K 
Sbjct  78   GKHPLSVIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNITDLKG  137

Query  625  GIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            G V FGSA   S  D+   + V   PYNIS+L +   I+ PG+
Sbjct  138  GKVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGV  180



>emb|CDY36445.1| BnaC03g67650D [Brassica napus]
Length=277

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 95/170 (56%), Gaps = 1/170 (1%)
 Frame = +1

Query  244  QLSAAAVILLTCILSTA-SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAV  420
             L   ++  L    STA +A NIT+   +Y  +   NDLL +T L   I+ + TIT+LAV
Sbjct  6    SLCLFSLTFLLVFFSTAITADNITQAFEKYSNFSTMNDLLIKTKLNIPISKYLTITLLAV  65

Query  421  KNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGF  600
             N  I  + +R    +  IL  HVILDY+D MK + +K     LTT+YQ TG+ +   GF
Sbjct  66   SNEAITPIINRSDVELKNILMNHVILDYYDEMKFNGMKEKSIMLTTLYQTTGLGEEMNGF  125

Query  601  LNVTSGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            LN T  K  + FGS V+ SP  A   + +   PYN+S++ +S  IV PGL
Sbjct  126  LNCTKSKGRVYFGSGVKGSPLVAEYVKALYHNPYNMSIVQISMPIVAPGL  175



>ref|XP_003526450.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Glycine 
max]
Length=239

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 101/172 (59%), Gaps = 5/172 (3%)
 Frame = +1

Query  247  LSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKN  426
            L + A++L  C  S+    +IT++L  YPEY  FN  LT T LA  IN+ + +TVLA+ +
Sbjct  8    LLSVALVLAFC--SSIQGLDITKLLGEYPEYAQFNKYLTETKLADQINSRNAVTVLALDD  65

Query  427  GGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLN  606
              +  LS +  D V  IL THV+++++D  KL   +  + K+ T++Q +G+A  NQG++ 
Sbjct  66   AAMASLSGKSQDAVKAILSTHVLVNFYDEKKLMEAEGSRTKVETLFQSSGVAKPNQGYIY  125

Query  607  VTSGKDG-IVFGSAVR--RSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            V    +G I FGSA     +P +  L   V S+P  +SVL VS  IV PG++
Sbjct  126  VALINEGEIAFGSAAAAPNAPFEVVLVRSVTSQPDTVSVLQVSKPIVAPGVE  177



>ref|XP_010056276.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Eucalyptus 
grandis]
Length=425

 Score =   124 bits (311),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 93/154 (60%), Gaps = 2/154 (1%)
 Frame = +1

Query  295  SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLS-SRPIDLVD  471
            S  NIT IL  +PEY +F+  L++T LA  IN+  TITVLA+ NG +  L+  +P+ ++ 
Sbjct  23   SGHNITAILEGFPEYSLFSSYLSQTKLADEINSRQTITVLALDNGAMSALAGKKPLSVIK  82

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAV  648
              L  HV+LDYFD  KLH++       TT+YQ TG A  N GF+N+T  + G V FG+A 
Sbjct  83   NELAVHVVLDYFDPQKLHQIPKGSTLSTTLYQTTGNAPGNTGFVNITDLQGGKVGFGAAA  142

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              S  D+   + V   PYNISVL +S  I+ P +
Sbjct  143  PGSKLDSSYTKSVKQIPYNISVLQISAPILVPAI  176



>ref|NP_001150349.1| fasciclin-like arabinogalactan protein 8 precursor [Zea mays]
 gb|ACG38763.1| fasciclin-like arabinogalactan protein 8 precursor [Zea mays]
Length=276

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 94/160 (59%), Gaps = 7/160 (4%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR----PI  459
            A+AFN+T IL+RYPE+ +FN LL++T +A  +N  S +TVL   N  +  L  R    P 
Sbjct  30   AAAFNVTEILSRYPEFKLFNLLLSKTRVAREVNRRSAVTVLVPDNSAVDWLLRRSARLPR  89

Query  460  DLVDEILRTHVILDYFDIMKLHRLKN--HQAKLTTMYQQTGIADRNQGFLNVTS-GKDGI  630
              + E++  HV LDY D  KL  +      A +TT++Q TG A    GFLNVT+ G+ G 
Sbjct  90   AALVELVSVHVALDYIDAAKLAAMPRSGQPAVVTTLFQTTGAALNRTGFLNVTAVGRAGA  149

Query  631  VFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            VF SA   S   A L   V +RPYNISVL +S  +V PG+
Sbjct  150  VFVSAAPGSLVSATLRRAVTARPYNISVLQISNFVVPPGV  189



>ref|XP_009108932.1| PREDICTED: fasciclin-like arabinogalactan protein 5 [Brassica 
rapa]
Length=277

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 65/162 (40%), Positives = 91/162 (56%), Gaps = 0/162 (0%)
 Frame = +1

Query  265  ILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDL  444
             LL    +  +A NIT+   +Y  +   NDLL +T L   I+ + TIT+LAV N  I  +
Sbjct  14   FLLVFFSTVITADNITQAFEKYSNFSTMNDLLIKTKLTIPISKYLTITLLAVSNEAITPI  73

Query  445  SSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKD  624
             +R    +  IL  HVILDY+D MK + +K     LTT+YQ TG+ +   GFLN T  K 
Sbjct  74   INRSDVELKNILMNHVILDYYDEMKFNGMKEKSIMLTTLYQTTGLGEEMNGFLNCTKSKG  133

Query  625  GIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             + FGS V+ SP  A   + +   PYN+S++ +S  IV PGL
Sbjct  134  RVYFGSGVKVSPLVAEYVKALYHNPYNMSIVQISMPIVAPGL  175



>emb|CDY23293.1| BnaA08g12530D [Brassica napus]
Length=277

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 92/161 (57%), Gaps = 1/161 (1%)
 Frame = +1

Query  271  LTCILSTA-SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLS  447
            L    STA +A NIT+   +Y  +   NDLL +T L   I+ + TIT+LAV N  I  + 
Sbjct  15   LLVFFSTAITADNITQAFEKYSNFSTMNDLLIKTKLTIPISKYLTITLLAVSNEAITPII  74

Query  448  SRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG  627
            +R    +  IL  HVILDY+D MK + +K     LTT+YQ TG+ +   GFLN T  K  
Sbjct  75   NRSDVELKNILMNHVILDYYDEMKFNGMKEKSIMLTTLYQTTGLGEEMNGFLNCTKSKGR  134

Query  628  IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            + FGS V+ SP  A   + +   PYN+S++ +S  IV PGL
Sbjct  135  VYFGSGVKGSPLVAEYVKALYHNPYNMSIVQISMPIVAPGL  175



>ref|XP_007218052.1| hypothetical protein PRUPE_ppa006158mg [Prunus persica]
 gb|EMJ19251.1| hypothetical protein PRUPE_ppa006158mg [Prunus persica]
Length=425

 Score =   124 bits (311),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 94/155 (61%), Gaps = 2/155 (1%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PIDLV  468
            +SA NIT IL+ +P+Y  +N  LT+T LA  IN   TIT+L + N  I  L+++ P+ +V
Sbjct  21   SSAHNITEILSAFPDYSQYNSFLTQTKLADEINTRQTITILVLNNAAISALAAKHPLSVV  80

Query  469  DEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSA  645
               L  HV+LDY+D  KLH++       TT+YQ TG A  N GF+N+T  + G V FGSA
Sbjct  81   KNALSLHVLLDYYDPTKLHQISKGSTLSTTLYQTTGHAPGNLGFVNITDLQGGKVGFGSA  140

Query  646  VRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
               S  D+   + V   PYNIS+L ++  I+ PG+
Sbjct  141  APGSKLDSSYTKSVKQIPYNISILEINAPIIAPGI  175



>ref|XP_002882015.1| hypothetical protein ARALYDRAFT_483684 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58274.1| hypothetical protein ARALYDRAFT_483684 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   124 bits (310),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 97/162 (60%), Gaps = 2/162 (1%)
 Frame = +1

Query  271  LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS  450
            L  + ST S+ NIT+IL   P+Y  FN  L++T LA  IN+ +TITVL + NG +  L+ 
Sbjct  16   LLAVASTVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLNNGAMSALAG  75

Query  451  R-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG  627
            + P+ ++   L   V+LDY+D +KLH++       TT+YQ TG A  N GF+N+T  K G
Sbjct  76   KHPLSVIKSALSLLVLLDYYDPLKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDLKGG  135

Query  628  IV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             V FGSA   S  D+   + V   PYNIS+L +   I+ PG+
Sbjct  136  KVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGI  177



>ref|XP_009402000.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=271

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 99/162 (61%), Gaps = 1/162 (1%)
 Frame = +1

Query  268  LLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLS  447
            LL    S  +A +I  IL  + E+  F   LT+T +A  IN   TITVLAV N  I  LS
Sbjct  15   LLLISSSAVAALDIVGILQPFDEFSTFTKYLTQTKVADEINRRQTITVLAVDNSAISALS  74

Query  448  SRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS-GKD  624
            S   D +  ++  HVILDY+D  KL ++    A LTT++Q +G+A  N GFLN T    +
Sbjct  75   SLSADTLKNVISVHVILDYYDPYKLDKVPKKTALLTTLFQASGLAANNMGFLNYTELPGE  134

Query  625  GIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             ++FGSA   +P +++L++ V +RPYN+SVL VST I+ PG+
Sbjct  135  QMMFGSAAPGAPLNSNLQKVVAARPYNVSVLQVSTAIMPPGI  176



>ref|XP_008649024.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Zea mays]
 gb|AFW76147.1| fasciclin-like arabinogalactan protein 8 [Zea mays]
Length=275

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 93/160 (58%), Gaps = 7/160 (4%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR----PI  459
            A+AFN+T IL+RYPE+ +FN LL++T +A  +N  S +TVL   N  +  L  R    P 
Sbjct  31   AAAFNVTEILSRYPEFKLFNLLLSKTRVAREVNRRSAVTVLVPDNSAVDWLLRRSARLPR  90

Query  460  DLVDEILRTHVILDYFDIMKLHRLKN--HQAKLTTMYQQTGIADRNQGFLNVTS-GKDGI  630
              + E++  HV LDY D  KL  L      A +TT++Q TG A    GFLNVT+ G+ G 
Sbjct  91   AALVELVSVHVALDYIDAAKLAALPRSGQPAVVTTLFQTTGAALNRTGFLNVTAVGRAGA  150

Query  631  VFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            VF SA   S   A     V +RPYNISVL +S  +V PG+
Sbjct  151  VFVSAAPGSLVSATFRRAVTARPYNISVLQISNFVVPPGV  190



>ref|XP_002867304.1| hypothetical protein ARALYDRAFT_491605 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43563.1| hypothetical protein ARALYDRAFT_491605 [Arabidopsis lyrata subsp. 
lyrata]
Length=278

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/152 (39%), Positives = 92/152 (61%), Gaps = 0/152 (0%)
 Frame = +1

Query  295  SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDE  474
            +A NIT    +Y ++ + ++L  +T L   I+ + TITVLAV N  I  +++R    +  
Sbjct  23   TANNITLAFQKYSKFSIMSNLFIKTKLIVPISKYQTITVLAVSNDAISSITNRSEVELRN  82

Query  475  ILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFGSAVRR  654
            IL THVILDY+D +KL  ++     LTT+YQ TG+ ++  GFLNV+  +  + FGS V+ 
Sbjct  83   ILMTHVILDYYDELKLQGMREKSIMLTTLYQTTGLGEQMNGFLNVSKSEGRVYFGSEVKN  142

Query  655  SPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            SP +A     V   P+N+S++ ++  IV PGL
Sbjct  143  SPLNAEYVSTVYHNPFNLSIIQITMPIVAPGL  174



>ref|XP_006845641.1| hypothetical protein AMTR_s00019p00223190 [Amborella trichopoda]
 gb|ERN07316.1| hypothetical protein AMTR_s00019p00223190 [Amborella trichopoda]
Length=398

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 98/160 (61%), Gaps = 4/160 (3%)
 Frame = +1

Query  295  SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLS--SRPIDLV  468
            + FNIT+IL+++PE+ VFN  LT T +   IN  +TIT+LA+++  +  ++  +   +++
Sbjct  118  TCFNITKILDQHPEFNVFNSYLTLTKVVGEINKRNTITILAIEDSAMSSITGGNFAPEVL  177

Query  469  DEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKD--GIVFGS  642
              I+  HV+LDY+D  KL  L    A LT ++Q TG A   QGFLNVT  K    I+FGS
Sbjct  178  HNIMSVHVVLDYYDSKKLDNLSEGTALLTALFQSTGSAVGQQGFLNVTKSKQTGEILFGS  237

Query  643  AVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDDDD  762
            AV  S   A L + V S PYNISVL +S  I+  G+D  +
Sbjct  238  AVLGSALSAKLVKSVASEPYNISVLQISRPIIPQGIDKSN  277



>ref|XP_010508167.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Camelina 
sativa]
Length=423

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 95/157 (61%), Gaps = 2/157 (1%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PID  462
            ST S+ NIT+IL   P+Y  FN+ LT+T LA  IN+ +TITVL + NG +  L+ + P+ 
Sbjct  24   STVSSHNITQILADSPDYSSFNNYLTQTKLADEINSRTTITVLVLNNGAMSSLAGKHPLS  83

Query  463  LVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FG  639
            ++   L   V+LDY+D +KLH L       TT+YQ TG A  N GF+N+T  K G V FG
Sbjct  84   VIKSALSLLVLLDYYDPLKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNITDLKGGKVGFG  143

Query  640  SAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            SA   S  D+   + V   PYNIS+L +   I+ PG+
Sbjct  144  SAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGV  180



>ref|XP_003552347.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Glycine 
max]
Length=416

 Score =   123 bits (308),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 95/154 (62%), Gaps = 2/154 (1%)
 Frame = +1

Query  295  SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PIDLVD  471
            SA NIT IL   P+Y  FN  L++TGLA  IN   TITVL + N  +  ++++ P+ +V 
Sbjct  18   SAHNITDILAANPDYSDFNGFLSQTGLAGEINTRQTITVLVLNNAALSAVAAKHPLSVVK  77

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAV  648
             +L  H++LDYFD  KLH++ N     TT+YQ TG A+ N G +N+T  K G V FGSA 
Sbjct  78   NLLSLHILLDYFDNTKLHQIPNGTTLSTTLYQTTGNANGNVGSVNITDLKGGKVGFGSAA  137

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              S  D+   + V   PYNISV+ +S  I++PG+
Sbjct  138  PGSKLDSSYTKSVKQIPYNISVMEISAPIISPGI  171



>emb|CDY50538.1| BnaA01g30420D [Brassica napus]
Length=259

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 97/149 (65%), Gaps = 1/149 (1%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVD  471
            A+AFNITRILN   E+  FN+LL++TGLA+ I++  TITVLA+ N  +   S +  +   
Sbjct  18   ANAFNITRILNLNNEFSTFNNLLSQTGLASTIDSRQTITVLALSNDAMSLFSDQSTEDNK  77

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSAV  648
            + L  H++LDY+DI KL  L      LTT++Q +G A   QGF+N T   +G ++FGSAV
Sbjct  78   KSLSLHIVLDYYDIKKLKSLNKKSVILTTLFQSSGQAKGQQGFINATVMNNGDVMFGSAV  137

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            R S  D+ L + V + PYNISVL +S+ I
Sbjct  138  RGSLLDSKLIDSVATHPYNISVLHISSYI  166



>ref|XP_009146602.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Brassica 
rapa]
Length=270

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 71/168 (42%), Positives = 105/168 (63%), Gaps = 9/168 (5%)
 Frame = +1

Query  274  TCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR  453
            T + +++++FNIT ILN+  E+ +FN+LL++TGLA+ IN+  TITVLA+ N  +   S+ 
Sbjct  16   TFLYTSSNSFNITNILNQNNEFSIFNNLLSQTGLASTINSRQTITVLALSNDAMSFFST-  74

Query  454  PIDLVDE---ILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKD  624
             I  ++E    L  HV+LDY+DI K   +      LTT++Q TG A   QGF+N T   +
Sbjct  75   -IQSIEENKIRLSLHVVLDYYDIKKFRSMNKKSVILTTLFQSTGQAKGLQGFINTTIMNN  133

Query  625  G-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDDDDG  765
            G ++FGSAV  S   + L + V + PYNISVL +S+ I    L + DG
Sbjct  134  GDVMFGSAVPGSGIYSKLIDSVATHPYNISVLHISSSI---SLMNPDG  178



>emb|CDY08417.1| BnaA05g26530D [Brassica napus]
Length=251

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 95/151 (63%), Gaps = 1/151 (1%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
            ++ ++FNIT ILN+  E+  FN+LLT+T LA+ IN+  TITVLA+ N  +   S +  + 
Sbjct  21   TSTNSFNITNILNQNNEFSTFNNLLTQTNLASAINSRQTITVLALSNDAVSHFSDQSAED  80

Query  466  VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGS  642
              ++L   +ILDY+DI KL  L      LTT++Q +G A   QGF+N T   +G ++FGS
Sbjct  81   NKKVLSLLIILDYYDIKKLRSLNKKSVILTTLFQASGQAKGEQGFVNATVMDNGDVMFGS  140

Query  643  AVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            AV  S  D+ L + V + PYNISVL + + I
Sbjct  141  AVPGSILDSKLIDSVATHPYNISVLHIDSSI  171



>gb|ABK24724.1| unknown [Picea sitchensis]
 gb|ACN41086.1| unknown [Picea sitchensis]
Length=409

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 89/150 (59%), Gaps = 1/150 (1%)
 Frame = +1

Query  295  SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDE  474
            +AFNIT+IL +YPEY  FN  L++T LA  IN+  TITVLA+ N  +  LS   +  +  
Sbjct  21   NAFNITKILAKYPEYSKFNHDLSQTKLADEINSRQTITVLALSNSQMASLSGLDLASLKR  80

Query  475  ILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAVR  651
            +L  HV+LD+FD  KLH + N     TT+YQ TG A  N GF+N+T  K G V FG A  
Sbjct  81   VLSLHVVLDFFDAKKLHEITNGTTLSTTLYQTTGNAPGNTGFINITDLKAGKVGFGPAAH  140

Query  652  RSPHDAHLEEEVMSRPYNISVLGVSTIIVT  741
             +  DA   + V    YNISV+ VS  I T
Sbjct  141  GAKLDATYVKSVKQEGYNISVIEVSKPITT  170



>ref|XP_009625162.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
tomentosiformis]
Length=415

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 93/158 (59%), Gaps = 3/158 (2%)
 Frame = +1

Query  271  LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS  450
            L  +L    A NITRIL ++P++  FN  LT T LA  IN   TIT+ AV N G+ DL S
Sbjct  16   LALLLCATEAHNITRILAKHPQFSTFNHYLTTTHLAYEINRRQTITICAVDNAGMSDLLS  75

Query  451  RPIDL--VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKD  624
            + + +  +  +L  HV+LDYF   KLH++ N  A   TM+Q TG A  + GF+N+T+ K 
Sbjct  76   KHLSIYAMKNVLSFHVLLDYFGAKKLHQITNGTALAATMFQATGSASGSSGFVNITNLKG  135

Query  625  G-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            G +VF  A    P  A   + V   PYNISV+ +STI+
Sbjct  136  GKVVFSPADYDGPPPAKFVKSVEEIPYNISVIQISTIL  173



>ref|XP_009143146.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Brassica 
rapa]
Length=416

 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 92/151 (61%), Gaps = 2/151 (1%)
 Frame = +1

Query  304  NITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PIDLVDEIL  480
            NIT+IL   PEY  FN  L++T LA  IN+ STIT+L + NG +  L+ + P+ ++   L
Sbjct  27   NITQILADNPEYSSFNSYLSQTKLADEINSRSTITLLVLNNGAMASLAGKHPLSVIKNAL  86

Query  481  RTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAVRRS  657
               V+LDY+D  KLH++ +     TT+YQ TG A  N GF+N+T  K G V FGSA   S
Sbjct  87   SLLVLLDYYDPQKLHKISDGTVLTTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASGS  146

Query  658  PHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              D+   + V   PYNISVL +   I++PGL
Sbjct  147  KLDSSYTKSVKQIPYNISVLEIDAPIISPGL  177



>ref|XP_009417795.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Musa acuminata 
subsp. malaccensis]
Length=281

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 107/172 (62%), Gaps = 2/172 (1%)
 Frame = +1

Query  244  QLSAAAVIL-LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAV  420
            QLS   V +    +LS+A+A NITR+L+++P++  FN LL++  +A+ +N   TITVLAV
Sbjct  6    QLSLLLVFVSFLVLLSSATAHNITRLLSQFPDFSNFNSLLSQADIASEVNRRQTITVLAV  65

Query  421  KNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGF  600
             N     LSS   D + ++L  HVILDY+D  K+H LK      TT++Q TG+A    GF
Sbjct  66   DNSAASSLSSLDSDTLKQVLSIHVILDYYDKEKIHNLKRRSTLFTTLFQTTGVAANRMGF  125

Query  601  LNVTSGKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            LN T   DG + FGS V  SP  A   + V ++PYN+SVL +S +IV  G++
Sbjct  126  LNATKLSDGRLAFGSGVPGSPLVATYVKSVAAKPYNLSVLQISAVIVPQGIN  177



>ref|NP_566043.1| FASCICLIN-like arabinogalactan protein 8 [Arabidopsis thaliana]
 sp|O22126.1|FLA8_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 8; Short=AtAGP8; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB82617.1| expressed protein [Arabidopsis thaliana]
 gb|AAM19815.1| At2g45470/F4L23.2 [Arabidopsis thaliana]
 gb|AAN31110.1| At2g45470/F4L23.2 [Arabidopsis thaliana]
 gb|AEC10559.1| FASCICLIN-like arabinogalactan protein 8 [Arabidopsis thaliana]
Length=420

 Score =   121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 95/162 (59%), Gaps = 2/162 (1%)
 Frame = +1

Query  271  LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS  450
            L    ST S+ NIT+IL   P+Y  FN  L++T LA  IN+ +TITVL + NG +  L+ 
Sbjct  16   LLAFASTVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLNNGAMSALAG  75

Query  451  R-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG  627
            + P+ ++   L   V+LDY+D  KLH++       TT+YQ TG A  N GF+N+T  K G
Sbjct  76   KHPLSVIKSALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDLKGG  135

Query  628  IV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             V FGSA   S  D+   + V   PYNIS+L +   I+ PG+
Sbjct  136  KVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGV  177



>ref|XP_009802278.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
sylvestris]
Length=415

 Score =   121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 93/158 (59%), Gaps = 3/158 (2%)
 Frame = +1

Query  271  LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS  450
            L  +L    A +ITRIL ++P++  FN  LT T LA  IN   TITV AV N G+ DL S
Sbjct  16   LALLLCATEAHDITRILAKHPQFSTFNHYLTTTHLANEINRRQTITVFAVDNAGMSDLLS  75

Query  451  RPIDL--VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKD  624
            + + +  +  +L  HV+LDYF   KLH++ N  A   TM+Q TG A  + GF+N+T+ K 
Sbjct  76   KHLSIYAMKNVLSFHVLLDYFGAKKLHQITNGTALAATMFQATGSASGSSGFVNITNVKG  135

Query  625  G-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            G +VF  A    P  A   + V   PYNISV+ +STI+
Sbjct  136  GKVVFSPADYDGPPPAKFVKSVEEIPYNISVIQISTIL  173



>gb|AAM66074.1| endosperm-specific protein-like protein [Arabidopsis thaliana]
Length=420

 Score =   121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 95/162 (59%), Gaps = 2/162 (1%)
 Frame = +1

Query  271  LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS  450
            L    ST S+ NIT+IL   P+Y  FN  L++T LA  IN+ +TITVL + NG +  L+ 
Sbjct  16   LLAFASTVSSHNITQILADSPDYSSFNSYLSQTKLADEINSRTTITVLVLNNGAMSALAG  75

Query  451  R-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG  627
            + P+ ++   L   V+LDY+D  KLH++       TT+YQ TG A  N GF+N+T  K G
Sbjct  76   KHPLSVIKSALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGFVNITDLKGG  135

Query  628  IV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             V FGSA   S  D+   + V   PYNIS+L +   I+ PG+
Sbjct  136  KVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGV  177



>emb|CDX74743.1| BnaA05g04890D [Brassica napus]
Length=416

 Score =   121 bits (304),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 92/151 (61%), Gaps = 2/151 (1%)
 Frame = +1

Query  304  NITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PIDLVDEIL  480
            NIT+IL   PEY  FN  L++T LA  IN+ STIT+L + NG +  L+ + P+ ++   L
Sbjct  27   NITQILADNPEYSSFNSYLSQTKLADEINSRSTITLLVLNNGAMASLAGKHPLSVIKNAL  86

Query  481  RTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAVRRS  657
               V+LDY+D  KLH++ +     TT+YQ TG A  N GF+N+T  K G V FGSA   S
Sbjct  87   SLLVLLDYYDPQKLHKISDGTVLTTTLYQTTGNAPGNLGFVNITDLKGGKVGFGSAASGS  146

Query  658  PHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              D+   + V   PYNISVL +   I++PGL
Sbjct  147  KLDSSYTKSVKQIPYNISVLEIDAPIISPGL  177



>ref|XP_006296250.1| hypothetical protein CARUB_v10025417mg [Capsella rubella]
 gb|EOA29148.1| hypothetical protein CARUB_v10025417mg [Capsella rubella]
Length=420

 Score =   121 bits (303),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 94/162 (58%), Gaps = 2/162 (1%)
 Frame = +1

Query  271  LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS  450
            L    ST S+ NIT+IL   P+Y  FN  LT+T LA  IN+ +TITVL + NG +  L+ 
Sbjct  16   LLAFASTVSSHNITQILADSPDYSSFNSYLTQTKLADEINSRTTITVLVLNNGAMSSLAG  75

Query  451  R-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG  627
            + P+ ++   L   V+LDY+D  KLH L       TT+YQ TG A  N GF+N+T  K G
Sbjct  76   KHPLSVIKGALSLLVLLDYYDPQKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNITDLKGG  135

Query  628  IV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             V FGSA   S  D+   + V   PYNIS+L +   I+ PG+
Sbjct  136  KVGFGSAASGSKLDSSYTKSVKQIPYNISILEIDAPIIAPGV  177



>ref|XP_006844054.1| hypothetical protein AMTR_s00006p00245830 [Amborella trichopoda]
 gb|ERN05729.1| hypothetical protein AMTR_s00006p00245830 [Amborella trichopoda]
Length=392

 Score =   120 bits (302),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 96/163 (59%), Gaps = 3/163 (2%)
 Frame = +1

Query  256  AAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGI  435
            AA++   C++S  S  NIT+IL ++ E+  FND L+RT LA+ IN  +TITVLAV N  +
Sbjct  6    AALLFFLCLISATSGHNITKILAQFHEFSKFNDYLSRTHLASEINRRTTITVLAVDNAAM  65

Query  436  GDLSSRPIDL--VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNV  609
             D+ ++   +  +  IL  H++LDYF   KLH++ N  A   T+YQ TG A    GF+N+
Sbjct  66   DDILAKNYGIYEIKNILSLHILLDYFGAKKLHQITNGTALAATLYQTTGSAPGTSGFVNI  125

Query  610  TSGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            T  K G V  G+       DA   + V   PYNISVL VS I+
Sbjct  126  TDEKGGKVSIGADDNGGVLDASYVKSVKELPYNISVLQVSKIL  168



>ref|XP_009785088.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Nicotiana 
sylvestris]
Length=422

 Score =   120 bits (302),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 107/172 (62%), Gaps = 4/172 (2%)
 Frame = +1

Query  247  LSAAAVILLTCILSTAS--AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAV  420
            + A  + L T +  T S  A NIT IL+++PEY  FN  LT+T LA  IN+ +TIT+LA+
Sbjct  1    MGALYIFLFTLMSFTISIHAHNITEILSKFPEYSEFNSYLTQTKLADEINSRTTITILAL  60

Query  421  KNGGIGDLSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQG  597
             NG + D+  + P+ ++  +L  H++LDYFD  KLH++ +     TT+YQ TG A+ N G
Sbjct  61   TNGAMADVVGKHPLSVIKNVLSLHILLDYFDNTKLHKISDGTTLTTTLYQTTGNANGNLG  120

Query  598  FLNVTSGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             +N+T  K G V FGSAV  SP  +   + V    YNISVL +S+ I+ PG+
Sbjct  121  SVNITDLKGGKVGFGSAVSHSPLASTYTKSVKQIEYNISVLEISSPIIAPGI  172



>ref|XP_004306902.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Fragaria 
vesca subsp. vesca]
Length=421

 Score =   120 bits (302),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 91/151 (60%), Gaps = 2/151 (1%)
 Frame = +1

Query  304  NITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PIDLVDEIL  480
            NIT IL   PEY  +N  LT+T LA  IN  +T+TVL + NG +  L+++ P+ ++   L
Sbjct  24   NITAILEATPEYSQYNSFLTQTRLADEINTRTTVTVLVLTNGVMSSLAAKHPLSVIKNAL  83

Query  481  RTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAVRRS  657
              H++LDY+D  KLH++ +     TT+YQ TG A  N GF+N+T    G V FGSA   S
Sbjct  84   SLHILLDYYDPAKLHKISDGSVLTTTLYQTTGHAPGNLGFVNITDLSGGKVGFGSAAPGS  143

Query  658  PHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              D+   + V   PYNISVL +S  ++ PG+
Sbjct  144  KLDSSYTKSVKQIPYNISVLEISAPVLAPGI  174



>gb|ABR16637.1| unknown [Picea sitchensis]
Length=409

 Score =   120 bits (301),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 89/150 (59%), Gaps = 1/150 (1%)
 Frame = +1

Query  295  SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDE  474
            +AFNIT+IL +YPEY  FN  L++T LA  IN+  TITVLA+ N  +  LS   +  +  
Sbjct  21   NAFNITKILAKYPEYSKFNHDLSQTKLADEINSRQTITVLALSNSEMALLSGLDLASLKR  80

Query  475  ILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAVR  651
            +L  HV+LD+FD  KLH + N     TT+YQ TG A  N GF+N+T  K G V FG A  
Sbjct  81   VLSLHVVLDFFDAKKLHEITNGTTLSTTLYQTTGNAPGNTGFINITDLKAGKVGFGPAAH  140

Query  652  RSPHDAHLEEEVMSRPYNISVLGVSTIIVT  741
             +  DA   + V    YNISV+ VS  I T
Sbjct  141  GAKLDATYVKSVKQEGYNISVIEVSKPITT  170



>gb|EYU33706.1| hypothetical protein MIMGU_mgv1a007367mg [Erythranthe guttata]
Length=410

 Score =   120 bits (301),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +1

Query  289  TASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR--PID  462
            T  A NITRIL +YPE   FN  LT T LA  IN   TITV AV NGG+GDL S+   I 
Sbjct  27   TVDAHNITRILAKYPELSTFNHYLTVTQLAPEINRRETITVCAVDNGGMGDLLSKRLTIG  86

Query  463  LVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FG  639
             +  +L  HV+LDYFD  KLH++ +  A   TM+Q TG A  + GF+N+T  K G V F 
Sbjct  87   AIRNVLELHVLLDYFDAKKLHQITDGTALAATMFQATGSAPGSSGFVNITELKGGKVGFS  146

Query  640  SAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
                     A+  + + + PYNISV+ +STI+
Sbjct  147  PEENGGVISAYFVKSIEAIPYNISVIQISTIL  178



>gb|AIY35292.1| fasciclin-like arabinogalactan 12 [Gossypium hirsutum]
Length=415

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 101/164 (62%), Gaps = 2/164 (1%)
 Frame = +1

Query  265  ILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDL  444
            + L+ +    +A NIT IL  +P+Y V+ND LT+T LA  IN   TIT L + NG +  L
Sbjct  14   LTLSLLAVAVNAHNITAILEGFPDYSVYNDFLTKTKLADEINTRQTITCLVLNNGAMSAL  73

Query  445  SSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGK  621
            +++ P+ +V  IL  HV+LDY+D  KLH++ +     TT+YQ TG A  N GF+N+T  +
Sbjct  74   TAKHPLSVVKNILSLHVLLDYYDPQKLHKISDGTTLTTTLYQTTGNAPGNLGFVNITDLQ  133

Query  622  DGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             G V FGSAV  S  D+   + V   PYNIS+L +S  I+ PG+
Sbjct  134  GGKVGFGSAVPGSKLDSSYTKSVKQVPYNISILEISAPIIAPGV  177



>ref|XP_006339448.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Solanum 
tuberosum]
Length=415

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 102/170 (60%), Gaps = 2/170 (1%)
 Frame = +1

Query  247  LSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKN  426
            ++A    L T    +  A NIT ILN++PEY VFN  L++T LA  IN+  TITVLA+ N
Sbjct  1    MTALHFFLFTLFTVSVHAHNITEILNQFPEYSVFNSYLSQTKLADEINSRETITVLALPN  60

Query  427  GGIGDLSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFL  603
            G +  +  + P+ ++  +L  HV+LDYFD  KLH++ +     TT+YQ TG A  N G +
Sbjct  61   GAMSAVVDKHPLSVIKNVLSLHVLLDYFDGTKLHKISDGTTTSTTLYQTTGNAHGNVGSV  120

Query  604  NVTSGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            N+T  K G V FGSA+  SP  +   + V    YNISVL VS  I+ PG+
Sbjct  121  NITDLKGGKVGFGSAIPNSPLASTYTKSVKQIQYNISVLEVSAPIIAPGI  170



>ref|XP_006397729.1| hypothetical protein EUTSA_v10001463mg [Eutrema salsugineum]
 gb|ESQ39182.1| hypothetical protein EUTSA_v10001463mg [Eutrema salsugineum]
Length=418

 Score =   120 bits (300),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 95/167 (57%), Gaps = 2/167 (1%)
 Frame = +1

Query  256  AAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGI  435
            A V  L  +  T    NIT+IL   PEY  FN  L++T LA  IN+ +TIT+L + NG +
Sbjct  11   AFVFSLLAVAFTVRGHNITQILADSPEYSSFNSYLSQTKLADEINSRTTITLLVLNNGAM  70

Query  436  GDLSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT  612
              L+ + P+ ++   L   V+LDY+D  KLH++       TT+YQ TG A  N GF+N+T
Sbjct  71   SSLAGKHPLSVIKNALSLLVLLDYYDPQKLHKISKGTTLSTTLYQTTGNAPGNLGFVNIT  130

Query  613  SGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              K G V FGSA   S  D+   + V   PYNISVL +   I+ PG+
Sbjct  131  DLKGGKVGFGSAASGSKLDSSYTKSVKQIPYNISVLEIDAPIIAPGV  177



>ref|XP_004229828.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Solanum 
lycopersicum]
Length=414

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 100/164 (61%), Gaps = 2/164 (1%)
 Frame = +1

Query  265  ILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDL  444
             L T +  +  A NIT ILN++PEY VFN  L++T LA  IN+  TITVLA+ NG +  +
Sbjct  7    FLFTLLTVSVHAHNITEILNKFPEYSVFNSYLSQTKLADEINSRETITVLALPNGAMSAI  66

Query  445  SSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGK  621
              + P+ ++  +L  HV+LDYFD  KLH++ +     TT+YQ TG A  N G +N+T  K
Sbjct  67   VDKHPLSVIKNVLSLHVLLDYFDGTKLHKISDGTTTSTTLYQTTGNAHGNIGSVNITDLK  126

Query  622  DGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             G V FGSA+  SP  +   + V    YNISVL VS  I+ PG+
Sbjct  127  GGKVGFGSAIPNSPLASTYTKSVKQIQYNISVLEVSAPIIAPGI  170



>ref|XP_002270426.2| PREDICTED: fasciclin-like arabinogalactan protein 10 [Vitis vinifera]
Length=416

 Score =   119 bits (299),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 98/165 (59%), Gaps = 2/165 (1%)
 Frame = +1

Query  262  VILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGD  441
            V+ L+ +  +  A NIT +L+ +PEY ++N  L++T LA  IN+  T+T L + N  +  
Sbjct  8    VLALSTLAVSVRAHNITDMLSPFPEYSLYNSYLSQTKLADEINSRQTLTCLVLNNAAMSA  67

Query  442  LSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSG  618
            L+ + P+ ++ + L   V+LDY+D  KLH + +     TT+YQ TG A  N GF+N+T  
Sbjct  68   LAGKHPLSVIKKALMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVNITDL  127

Query  619  KDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            K G V FGSA   S  D+   + V   PYNISVL +S  I+ PGL
Sbjct  128  KGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEISAPIIAPGL  172



>ref|XP_004965683.1| PREDICTED: fasciclin-like arabinogalactan protein 3-like [Setaria 
italica]
Length=270

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 91/157 (58%), Gaps = 6/157 (4%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVD--  471
            AFN+T IL RYPE+ +FN LL++T +A  IN+ S++T+L   N  +  L  R   L    
Sbjct  36   AFNVTEILRRYPEFKLFNLLLSKTRVAREINSRSSVTILVPDNSAVDWLLRRSTRLARTS  95

Query  472  --EILRTHVILDYFDIMKLHRLKNHQAK-LTTMYQQTGIADRNQGFLNVTSG-KDGIVFG  639
              E++  HV+LDY D  KL  L   Q   +TT++Q TG A    GFLNVT+  + G  F 
Sbjct  96   LVELMSVHVVLDYIDDAKLAALPRGQPTVVTTLFQTTGTARNRTGFLNVTAAPRGGAAFV  155

Query  640  SAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            SA   S   A  +  V ++PYNISVL +S  +V PG+
Sbjct  156  SAAPGSLVSATFKRTVTAKPYNISVLQISNFVVPPGI  192



>ref|XP_002438784.1| hypothetical protein SORBIDRAFT_10g026140 [Sorghum bicolor]
 gb|EER90151.1| hypothetical protein SORBIDRAFT_10g026140 [Sorghum bicolor]
Length=288

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 94/157 (60%), Gaps = 7/157 (4%)
 Frame = +1

Query  301  FNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR----PIDLV  468
            FN+T IL+RYPE+ +F+ LL+ TG+A  +N+ +++TVL   N  +  L  R    P   +
Sbjct  36   FNVTEILSRYPEFELFSFLLSNTGVARKVNSRNSVTVLIPDNSAVDWLLRRSARLPRAAL  95

Query  469  DEILRTHVILDYFDIMKLHRLKN--HQAKLTTMYQQTGIADRNQGFLNVT-SGKDGIVFG  639
             E++  HV+LDY D  KL  L        +TT++Q TG A    GFLNVT +G+ G VF 
Sbjct  96   VELISVHVVLDYIDAAKLAALPRGGQPTVVTTLFQTTGTARNRTGFLNVTGTGRGGAVFV  155

Query  640  SAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            SA   S  +A  +  V +RPYNISVL +S  +V PG+
Sbjct  156  SAAPGSLINATFKRAVTARPYNISVLQISNFVVPPGI  192



>emb|CDX73808.1| BnaA03g32390D [Brassica napus]
Length=249

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 95/147 (65%), Gaps = 1/147 (1%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEI  477
            +FNIT IL++  ++  FN LL++TGLA+ IN+  TITVLA+ N  +     + ++    +
Sbjct  24   SFNITTILSQNKDFSTFNKLLSQTGLASTINSRQTITVLALANDAVYLFGDQSMEDNKVV  83

Query  478  LRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSAVRR  654
            L  H+ILDY+DI KL  L    A LTT++QQ+G A   QGF+NVT   +G I FGSAV  
Sbjct  84   LSLHIILDYYDIKKLKSLSKKTAILTTLFQQSGQAKGQQGFVNVTVKDNGDIAFGSAVPG  143

Query  655  SPHDAHLEEEVMSRPYNISVLGVSTII  735
            S  D+ + + V S P+NISVL +S+ I
Sbjct  144  SLLDSQVIDSVASEPFNISVLHISSYI  170



>dbj|BAJ34929.1| fasciclin-like arabinogalactan protein [Vitis hybrid cultivar]
Length=416

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 97/165 (59%), Gaps = 2/165 (1%)
 Frame = +1

Query  262  VILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGD  441
            V  L+ +  +  A NIT +L+ +PEY ++N  L++T LA  IN+  T+T L + N  +  
Sbjct  8    VFALSTLAVSVRAHNITDMLSPFPEYSLYNSYLSQTKLADEINSRQTLTCLVLNNAAMSA  67

Query  442  LSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSG  618
            L+ + P+ ++ + L   V+LDY+D  KLH + +     TT+YQ TG A  N GF+N+T  
Sbjct  68   LAGKHPLSVIKKALMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVNITDL  127

Query  619  KDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            K G V FGSA   S  D+   + V   PYNISVL +S  I+ PGL
Sbjct  128  KGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEISAPIIAPGL  172



>ref|XP_009135245.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Brassica 
rapa]
Length=263

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 95/147 (65%), Gaps = 1/147 (1%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDEI  477
            +FNIT IL++  ++  FN LL++TGLA+ IN+  TITVLA+ N  +     + ++    +
Sbjct  24   SFNITTILSQNKDFSTFNKLLSQTGLASTINSRQTITVLALANDAVYLFGDQSMEDNKVV  83

Query  478  LRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSAVRR  654
            L  H+ILDY+DI KL  L    A LTT++QQ+G A   QGF+NVT   +G I FGSAV  
Sbjct  84   LSLHIILDYYDIKKLKSLSKKTAILTTLFQQSGQAKGQQGFVNVTVKDNGDIAFGSAVPG  143

Query  655  SPHDAHLEEEVMSRPYNISVLGVSTII  735
            S  D+ + + V S P+NISVL +S+ I
Sbjct  144  SLLDSQVIDSVASEPFNISVLHISSYI  170



>ref|XP_007139983.1| hypothetical protein PHAVU_008G075000g [Phaseolus vulgaris]
 gb|ESW11977.1| hypothetical protein PHAVU_008G075000g [Phaseolus vulgaris]
Length=419

 Score =   119 bits (297),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 92/154 (60%), Gaps = 2/154 (1%)
 Frame = +1

Query  295  SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PIDLVD  471
            SA NIT IL   P+Y  FN+ L++T LA  IN   TITVL + N     ++ + P+ +V 
Sbjct  20   SAHNITDILAADPQYSDFNNFLSQTRLADEINTRQTITVLVLNNAAFSAVADKHPLSVVK  79

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAV  648
             +L  H++LDYFD  KLH++ N     TT+YQ TG A+ N G +N+T  K G V FGSA 
Sbjct  80   NLLSLHILLDYFDNNKLHQITNGTTLSTTLYQTTGTANGNVGSVNITDLKGGKVGFGSAA  139

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              S  D+   + V   PYNISV+ +S  I+ PG+
Sbjct  140  SGSKLDSTYTKSVKQIPYNISVIEISAPIIAPGI  173



>emb|CDP13717.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   118 bits (296),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 92/164 (56%), Gaps = 5/164 (3%)
 Frame = +1

Query  259  AVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIG  438
            A+ILL    S   A NIT+IL  +PE+  FN  LT T LA  IN   TITV AV N G+ 
Sbjct  19   ALILLP---SPTEAHNITKILAEFPEFSTFNHFLTTTHLANDINNRETITVCAVDNAGMA  75

Query  439  DLSSRPIDL--VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT  612
            DL  + + +  +  +L  HV+LDYF   KLH + N  A   TMYQ TG A  + GF+N+T
Sbjct  76   DLLGKHLSIFALKNVLSLHVLLDYFGAKKLHDITNGTALAATMYQATGSAPGSSGFVNIT  135

Query  613  SGKDGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTP  744
              K G V   AV     DA   + V   PYNISV+ +S I+ +P
Sbjct  136  DLKGGKVGFGAVDNGGIDATFVKSVKEIPYNISVIQISKILPSP  179



>emb|CAN65447.1| hypothetical protein VITISV_011425 [Vitis vinifera]
Length=416

 Score =   118 bits (296),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/165 (40%), Positives = 97/165 (59%), Gaps = 2/165 (1%)
 Frame = +1

Query  262  VILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGD  441
            V  L+ +  +  A NIT +L+ +PEY ++N  L++T LA  IN+  T+T L + N  +  
Sbjct  8    VXALSTLAVSVRAHNITDMLSPFPEYSLYNSYLSQTKLADEINSRQTLTCLVLNNAAMSA  67

Query  442  LSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSG  618
            L+ + P+ ++ + L   V+LDY+D  KLH + +     TT+YQ TG A  N GF+N+T  
Sbjct  68   LAGKHPLSVIKKALMLLVVLDYYDGKKLHEISDGTTLSTTLYQTTGNAPGNLGFVNITDL  127

Query  619  KDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            K G V FGSA   S  D+   + V   PYNISVL +S  I+ PGL
Sbjct  128  KGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEISAPIIAPGL  172



>ref|XP_006352538.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Solanum 
tuberosum]
Length=415

 Score =   117 bits (294),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 90/152 (59%), Gaps = 3/152 (2%)
 Frame = +1

Query  289  TASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL-  465
            T SA NIT IL +YP++  FN  LT T LA  IN+  TITV AV N G+ +L S+ + + 
Sbjct  24   TTSAHNITHILAKYPQFSTFNHYLTETHLAAEINSRETITVCAVDNAGMAELLSKHLSIY  83

Query  466  -VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FG  639
             +  ++  HV+LDYF   KLH++ N  A   TM+Q TG A  + GF+N+T  K G V FG
Sbjct  84   TIKNVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFG  143

Query  640  SAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
             A       A   + V   PYNISV+ +ST++
Sbjct  144  PAENHGTLPATFVKSVEEIPYNISVIQISTML  175



>gb|ABV27483.1| fasciclin-like arabinogalactan protein 12 [Gossypium hirsutum]
Length=415

 Score =   117 bits (294),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 97/154 (63%), Gaps = 2/154 (1%)
 Frame = +1

Query  295  SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PIDLVD  471
            +A +IT IL  +P+Y V+ND LT+T LA  IN   TIT L + NG +  L+++ P+ +V 
Sbjct  24   NAHSITAILEGFPDYSVYNDFLTKTKLADEINTRQTITCLVLNNGAMSALTAKHPLSVVK  83

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAV  648
             IL  HV+LDY+D  KLH++ +     TT+YQ TG A  N GF+N+T  + G V FGSAV
Sbjct  84   NILSLHVLLDYYDPQKLHKISDGTTLTTTLYQTTGNAPGNLGFVNITDLQGGKVGFGSAV  143

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              S  D+   + V   PYNIS+L +S  I+ PG+
Sbjct  144  PGSKLDSSYTKSVKQVPYNISILEISAPIIAPGV  177



>ref|XP_004248342.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Solanum 
lycopersicum]
Length=415

 Score =   117 bits (294),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 96/166 (58%), Gaps = 5/166 (3%)
 Frame = +1

Query  253  AAAVILLTCILS--TASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKN  426
            A  V  L  +LS  T SA NIT IL +YP++  FN  LT T LA  IN+  TITV AV N
Sbjct  10   AMVVFSLGLLLSPHTTSAHNITHILAKYPQFSTFNHYLTETHLAAEINSRETITVCAVDN  69

Query  427  GGIGDLSSRPIDL--VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGF  600
             G+ +L S+ + +  +  ++  HV+LDYF   KLH++ N  A   TM+Q TG A  + GF
Sbjct  70   AGMEELLSKHLSIYTIKNVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGF  129

Query  601  LNVTSGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            +N+T  K G V FG A       A   + V   PYNISV+ +ST++
Sbjct  130  VNITDLKGGKVGFGPAENHGNLPATFVKSVEEIPYNISVIQISTML  175



>ref|XP_004492650.1| PREDICTED: fasciclin-like arabinogalactan protein 10-like [Cicer 
arietinum]
Length=423

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 96/160 (60%), Gaps = 2/160 (1%)
 Frame = +1

Query  277  CILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-  453
             I +T SA NIT IL+  P+Y  +N+ L++T LA  IN+  TITVL + N     ++S+ 
Sbjct  16   SITTTISAHNITEILSDNPDYSQYNNFLSQTKLADEINSRQTITVLVLNNAAFSSITSKH  75

Query  454  PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-I  630
            P+ +V  +L   ++LDYFD  KLH++ N     TT++Q TG A  + G +N+T  K G +
Sbjct  76   PLSVVKNVLSLLILLDYFDNTKLHQITNGTTISTTLFQTTGNAQNSVGSVNITDIKGGKV  135

Query  631  VFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             FGSA   S  D+   + +   PYNISVL ++  I+ PG+
Sbjct  136  AFGSAAPGSKLDSTYTKSIKQIPYNISVLEINAPIIAPGI  175



>ref|XP_009104281.1| PREDICTED: fasciclin-like arabinogalactan protein 10 [Brassica 
rapa]
Length=424

 Score =   117 bits (293),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 95/160 (59%), Gaps = 2/160 (1%)
 Frame = +1

Query  277  CILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-  453
             ++ T S  NIT+IL+  PEY  FN  L++T L   IN+ +TIT+L + N  +  L+ + 
Sbjct  18   AVIYTVSGHNITQILSESPEYSSFNSYLSQTKLNDEINSRTTITILVLNNDVMSSLAGKH  77

Query  454  PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV  633
            P+ +V   L   V+LDY+D +KLH++       TT+YQ TG A  N GF+NVT  K G V
Sbjct  78   PLSVVKTALSLLVLLDYYDPLKLHKISQGTTLPTTLYQTTGRAAGNLGFVNVTDLKGGKV  137

Query  634  -FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             FGSA   S   A+  + V   PYNISVL ++  I+ PG+
Sbjct  138  GFGSAAPGSKLGANYTKSVKQIPYNISVLEINAPIIAPGI  177



>emb|CDX72305.1| BnaC07g43270D [Brassica napus]
Length=293

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 90/153 (59%), Gaps = 0/153 (0%)
 Frame = +1

Query  289  TASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLV  468
            T +A NIT    +Y  +   +DL T+T L T I+ + TIT+LAV N  I  ++++    +
Sbjct  22   TVTADNITHAFEKYSNFSTMSDLFTKTKLTTLISKYQTITLLAVNNNNISSITNKSAIEL  81

Query  469  DEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFGSAV  648
              IL THVILDY+D +KL  +K     LTT+YQ TG+ +   GFLN T  K  + FGS V
Sbjct  82   KNILMTHVILDYYDELKLKGMKEKSIMLTTLYQTTGLGEEMNGFLNCTKSKGRVYFGSGV  141

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPG  747
            + SP +A     +   P+N+S++ +S  IV PG
Sbjct  142  KGSPLNAEYVTTLYHNPFNLSIIQISMPIVAPG  174



>ref|NP_001149463.1| fasciclin-like arabinogalactan protein 8 precursor [Zea mays]
 gb|ACG35529.1| fasciclin-like arabinogalactan protein 8 precursor [Zea mays]
 gb|AFW87638.1| fasciclin-like arabinogalactan protein 8 [Zea mays]
Length=278

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 93/160 (58%), Gaps = 8/160 (5%)
 Frame = +1

Query  295  SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR----PID  462
            +AFN+T IL RYPE+ +FN LL++T +A  +N+ S +TVL   N  +  L  R    P  
Sbjct  28   TAFNVTEILGRYPEFKLFNLLLSKTRVAREVNSRSPVTVLVPGNSAVDWLLRRSARLPRA  87

Query  463  LVDEILRTHVILDYFDIMKLHRLKNHQAK-LTTMYQQTGIADRNQGFLNVTSGKDG---I  630
             + E++  HV LDY D  KL  L   Q   +TT++Q TG A    GFLNVT+   G    
Sbjct  88   ALVELVSVHVALDYIDAAKLASLPRGQPTVVTTLFQTTGSALGRTGFLNVTAAGRGGASA  147

Query  631  VFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            VF SA   S   A L+  V ++PYNISVL +S ++V PG+
Sbjct  148  VFVSAAPGSLVSATLKRAVTAKPYNISVLQISNLVVPPGI  187



>ref|XP_004516114.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like, partial 
[Cicer arietinum]
Length=478

 Score =   117 bits (294),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 102/173 (59%), Gaps = 5/173 (3%)
 Frame = +1

Query  232  MSPLQLSA--AAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTI  405
            + P  L+A  AA++ ++ I ST++A NITRIL ++PE+  FN  LT T LA  IN  +TI
Sbjct  68   LRPPTLAAFTAALLFISAIFSTSNAQNITRILEKHPEFSTFNHYLTLTHLALEINTRTTI  127

Query  406  TVLAVKNGGIGDLSSR--PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGI  579
            TV AV N  + +L ++   I  +  IL  HV+LDYF   KLH++ N  A   T+YQ TG 
Sbjct  128  TVCAVDNSAMTNLLAKHPSISTIKNILSLHVLLDYFGAKKLHQITNGTALAATLYQATGS  187

Query  580  ADRNQGFLNVTSGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            A  + GF+N+T  + G V FG+        A   + V   PYNISV+ +S I+
Sbjct  188  APGSSGFVNITDLRGGKVGFGAEDNNGALPALYVKSVEEIPYNISVIQISQIL  240



>gb|ABV27484.1| fasciclin-like arabinogalactan protein 13 [Gossypium hirsutum]
Length=425

 Score =   117 bits (292),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 99/162 (61%), Gaps = 2/162 (1%)
 Frame = +1

Query  271  LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS  450
            L+ ++   +  NIT IL  +P+Y V+N  LT+T LA  IN   TIT L + NG +  L+S
Sbjct  14   LSLVVIAVNGHNITAILEGFPDYSVYNSFLTQTKLADEINTRETITCLVLNNGAMSALTS  73

Query  451  R-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG  627
            + P+ +V  IL  HV+LDY+D  KLH++ +     TT+YQ TG A  N GF+N+T  + G
Sbjct  74   KHPLSVVKNILSLHVLLDYYDPQKLHKISDGTTLTTTLYQTTGNAPGNLGFVNITDLQGG  133

Query  628  IV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             V FGSA+  S  D+   + V   PYNIS+L +S  I+ PG+
Sbjct  134  KVGFGSAIPGSKLDSSYTKSVKQIPYNISILEISAPIIAPGI  175



>gb|KFK37339.1| hypothetical protein AALP_AA4G243700 [Arabis alpina]
Length=415

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 96/167 (57%), Gaps = 2/167 (1%)
 Frame = +1

Query  256  AAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGI  435
            A  + L  + +T  + NIT+IL   P+Y  FN  LT+T LA  IN+ +TIT+L + NG +
Sbjct  11   AITLSLLAVSTTVKSHNITQILADSPDYSSFNSYLTQTKLADEINSRTTITLLVLNNGAM  70

Query  436  GDLSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT  612
              L+ + P+ ++   L   V+LDY+D  KLH L       TT+YQ TG A  N GF+N+T
Sbjct  71   SSLAGKHPLSVIKNALSLLVLLDYYDPQKLHGLSKGTTLSTTLYQTTGNAPGNLGFVNIT  130

Query  613  SGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              K G V FGSA   S  ++     V   PYNISVL ++  I+ PG+
Sbjct  131  DLKGGKVGFGSAAPGSKLESSYTRSVKQIPYNISVLEINAPIIAPGV  177



>ref|XP_007052018.1| FASCICLIN-like arabinogalactan protein 8 [Theobroma cacao]
 gb|EOX96175.1| FASCICLIN-like arabinogalactan protein 8 [Theobroma cacao]
Length=425

 Score =   116 bits (291),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 100/162 (62%), Gaps = 2/162 (1%)
 Frame = +1

Query  271  LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS  450
            L+ +  TA A NIT IL  +P+Y V+N  L++T LA  IN+  TIT L + NG +  L++
Sbjct  14   LSLVAITAHAHNITAILEGFPDYSVYNSFLSQTKLADEINSRETITCLVLSNGAMSALTA  73

Query  451  R-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG  627
            + P+ ++  IL  HV+LDY+D  KLH++       TT+YQ TG A  N GF+N+T  + G
Sbjct  74   KHPLSVIKNILSLHVLLDYYDPQKLHQISKGTTLTTTLYQTTGNAPGNLGFVNITDLQGG  133

Query  628  -IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
             + FGSA+  S  D+   + V   PYNIS++ +S  I+ PG+
Sbjct  134  KVAFGSAIPGSKLDSSYTKSVKQIPYNISIIEISAPIIAPGI  175



>ref|XP_009767783.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
sylvestris]
Length=416

 Score =   116 bits (290),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 90/153 (59%), Gaps = 3/153 (2%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
            +T  A NIT+IL +YP++  FN  LT T LA  IN   TITV AV N G+ +L S+ + +
Sbjct  23   NTTEAHNITKILAKYPQFSTFNHYLTETHLAAEINNRETITVCAVDNAGMAELLSKHLSI  82

Query  466  --VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVF  636
              +  ++  HV+LDYF   KLH++ N  A   TM+Q TG A  + GF+N+T  K G + F
Sbjct  83   YTIKNVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVAF  142

Query  637  GSAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            G A       A   + V   PYNISV+ +ST++
Sbjct  143  GPAENHGNLPATFVKAVEEIPYNISVIQISTML  175



>ref|XP_010252769.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nelumbo 
nucifera]
Length=412

 Score =   115 bits (289),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 88/151 (58%), Gaps = 3/151 (2%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL--VD  471
            A NIT IL + P++ +FN  LT T LA  IN   TIT+  V NGG+ DL S+ + +  + 
Sbjct  25   AHNITSILAKNPDFSIFNQFLTLTHLAVEINQRETITICTVDNGGMSDLLSKQLSIYTIK  84

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAV  648
             +L  HV+LDYF   KLH++ N  A   TM+Q TG A  + GF+N+T  K G V FG+  
Sbjct  85   NVLSLHVLLDYFGAQKLHQITNGTALTATMFQATGSAPGSSGFVNITDLKGGKVGFGAES  144

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTIIVT  741
                 DA   + V   PYNISV+ +S I+ +
Sbjct  145  NHGNLDATFVKSVEEIPYNISVIQISKIMAS  175



>gb|AAK55685.1|AF378882_1 AT3g60900/T4C21_310 [Arabidopsis thaliana]
Length=410

 Score =   115 bits (289),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 101/167 (60%), Gaps = 2/167 (1%)
 Frame = +1

Query  256  AAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGI  435
            A  + L  + ST S  NIT+IL+  PEY  FN+ L++T LA  IN+ +TITVL + NG +
Sbjct  11   AFTLSLLTVASTVSGHNITQILSDTPEYSSFNNYLSQTKLADEINSRTTITVLVLNNGAM  70

Query  436  GDLSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT  612
              L+ + P+ +V   L   V+LDY+D +KLH+L       TT+YQ TG A  N GF+NVT
Sbjct  71   SSLAGKHPLSVVKNALSLLVLLDYYDPLKLHQLSKGTTLTTTLYQTTGHALGNLGFVNVT  130

Query  613  SGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              K G V FGSA   S  D+   + V   PYNISVL ++  I+ PG+
Sbjct  131  DLKGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEINAPIIAPGI  177



>emb|CDY13425.1| BnaA03g51430D [Brassica napus]
Length=279

 Score =   113 bits (283),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 89/151 (59%), Gaps = 0/151 (0%)
 Frame = +1

Query  295  SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDE  474
            +A NIT    +Y  +   ++L T+T L T I+ + TIT+LAV N  I  ++++    +  
Sbjct  23   TADNITHAFEKYSNFSTMSELFTKTKLTTLISKYQTITLLAVNNNNISSITNKSAIELKN  82

Query  475  ILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFGSAVRR  654
            IL THVILDY+D +KL  +K     LTT+YQ TG+ +   GFLN T  K  + FGS V+ 
Sbjct  83   ILMTHVILDYYDELKLKGMKEKSIMLTTLYQTTGLGEEMNGFLNCTKSKGKVYFGSGVKG  142

Query  655  SPHDAHLEEEVMSRPYNISVLGVSTIIVTPG  747
            SP +A     +   P+N+S++ +S  IV PG
Sbjct  143  SPLNAEYVTTLYHNPFNLSIIQISMPIVAPG  173



>ref|NP_191649.1| fasciclin-like arabinogalactan protein 10 [Arabidopsis thaliana]
 sp|Q9LZX4.1|FLA10_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 10; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB82694.1| endosperm specific protein-like [Arabidopsis thaliana]
 gb|AAM65173.1| endosperm specific protein-like [Arabidopsis thaliana]
 gb|AEE80125.1| fasciclin-like arabinogalactan protein 10 [Arabidopsis thaliana]
Length=422

 Score =   115 bits (289),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 101/167 (60%), Gaps = 2/167 (1%)
 Frame = +1

Query  256  AAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGI  435
            A  + L  + ST S  NIT+IL+  PEY  FN+ L++T LA  IN+ +TITVL + NG +
Sbjct  11   AFTLSLLTVASTVSGHNITQILSDTPEYSSFNNYLSQTKLADEINSRTTITVLVLNNGAM  70

Query  436  GDLSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT  612
              L+ + P+ +V   L   V+LDY+D +KLH+L       TT+YQ TG A  N GF+NVT
Sbjct  71   SSLAGKHPLSVVKNALSLLVLLDYYDPLKLHQLSKGTTLTTTLYQTTGHALGNLGFVNVT  130

Query  613  SGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              K G V FGSA   S  D+   + V   PYNISVL ++  I+ PG+
Sbjct  131  DLKGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEINAPIIAPGI  177



>ref|XP_011095539.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Sesamum 
indicum]
Length=415

 Score =   115 bits (288),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 95/161 (59%), Gaps = 13/161 (8%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
            ST  A NITRIL++YP++  FN  LT T LA  IN   TITV AV N  + DL S+ +++
Sbjct  24   STTYAHNITRILDKYPDFSTFNHYLTLTQLAPEINRRETITVCAVDNARMSDLLSKHLNI  83

Query  466  --VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFG  639
              +  +L  HV+LDYFD  KLH++ +  A   TM+Q TG A  + GF+N+T  K     G
Sbjct  84   GAIKNVLSLHVLLDYFDSKKLHQITDGTALAATMFQATGSAPGSAGFVNITDLK-----G  138

Query  640  SAVRRSPHD------AHLEEEVMSRPYNISVLGVSTIIVTP  744
              V  +P D      A   + V + PYNISV+ +S+I+ +P
Sbjct  139  GKVGFAPQDNGGVVSATFVKPVEAIPYNISVIQISSILPSP  179



>ref|XP_009138006.1| PREDICTED: fasciclin-like arabinogalactan protein 5 [Brassica 
rapa]
Length=294

 Score =   113 bits (283),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 89/151 (59%), Gaps = 0/151 (0%)
 Frame = +1

Query  295  SAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDLVDE  474
            +A NIT    +Y  +   ++L T+T L T I+ + TIT+LAV N  I  ++++    +  
Sbjct  23   TADNITHAFEKYSNFSTMSELFTKTKLTTLISKYQTITLLAVNNNNISSITNKSAIELKN  82

Query  475  ILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFGSAVRR  654
            IL THVILDY+D +KL  +K     LTT+YQ TG+ +   GFLN T  K  + FGS V+ 
Sbjct  83   ILMTHVILDYYDELKLKGMKEKSIMLTTLYQTTGLGEEMNGFLNCTKSKGKVYFGSGVKG  142

Query  655  SPHDAHLEEEVMSRPYNISVLGVSTIIVTPG  747
            SP +A     +   P+N+S++ +S  IV PG
Sbjct  143  SPLNAEYVTTLYHNPFNLSIIQISMPIVAPG  173



>ref|XP_004305460.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Fragaria 
vesca subsp. vesca]
Length=274

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/159 (40%), Positives = 91/159 (57%), Gaps = 5/159 (3%)
 Frame = +1

Query  277  CILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRP  456
            C+ S + AFNIT++L+ Y ++  FND LTRT +A  IN   ++T+  V NG +G ++ + 
Sbjct  14   CLFSCSYAFNITQMLSNYKDFSTFNDYLTRTTVADQINKRESLTIFVVDNGAMGSVTKKS  73

Query  457  IDLVDEILRTHVILDYFDIMKLHRLKNHQAKL-TTMYQQTGIADRNQGFLNVT----SGK  621
            +D+  +IL  HV L+YFD  KL +L  ++  L TT+ Q  G     QGFL  T    S  
Sbjct  74   LDMASKILSLHVALEYFDTKKLQQLPTNEPTLMTTLLQANGQPTGQQGFLKATIGGNSSG  133

Query  622  DGIVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIV  738
             G V  S    S   A + + V S+PYNISV+ +S  IV
Sbjct  134  GGGVSISLASSSDQSASVVQSVTSQPYNISVIQISNAIV  172



>ref|XP_010243936.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nelumbo 
nucifera]
Length=408

 Score =   115 bits (287),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 89/153 (58%), Gaps = 3/153 (2%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
             T  A NITRIL ++PE+  FN  LT T LA  IN   TITV AV N G+ +L S+ + +
Sbjct  22   CTTGAHNITRILAKHPEFSTFNHYLTVTHLAAEINRRETITVCAVDNAGMSELLSKHLSI  81

Query  466  --VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-F  636
              +  +L  H++LDYF   KLH++ N  A   TM+Q TG A  + GF+N+T  K G V F
Sbjct  82   YAIKNVLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGF  141

Query  637  GSAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            G+       D+   + +   PYNIS++ +S I+
Sbjct  142  GAEANDGKIDSTFVKSIQEIPYNISIIQISKIL  174



>ref|XP_004305604.1| PREDICTED: fasciclin-like arabinogalactan protein 14-like [Fragaria 
vesca subsp. vesca]
Length=276

 Score =   112 bits (281),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 102/174 (59%), Gaps = 5/174 (3%)
 Frame = +1

Query  244  QLSAAAVILLTCIL-STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAH-STITVLA  417
            ++ A+++I L+ +L ++ SA +I ++L +  ++  F   L  + LA  IN H S+ITVLA
Sbjct  3    RMRASSIIFLSFVLVASTSAIDILKLLEKESDFSTFRTALKDSKLADDINNHGSSITVLA  62

Query  418  VKNGGIGDLSSRPIDLVDEILRTHVILDYFDIMKLHRL--KNHQAKLTTMYQQTGIADRN  591
            V NG    LS    D   ++L THV+LDYFD  KL  L  K+  + + TM Q TG A   
Sbjct  63   VANGAASALSGLSPDEAKKLLATHVLLDYFDEAKLKGLAKKDKPSTVVTMLQTTGEAQHQ  122

Query  592  QGFLNVTSGKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            QG +NV   K G + FGSAV     D+   + V ++PYNISVL VS++I  P L
Sbjct  123  QGMVNVGVLKSGEVAFGSAVHGGGLDSKYIKSVTAQPYNISVLQVSSLIEIPDL  176



>ref|XP_009150168.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Brassica 
rapa]
Length=399

 Score =   114 bits (286),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 100/174 (57%), Gaps = 3/174 (2%)
 Frame = +1

Query  232  MSPLQLSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITV  411
            M+ L+ +A A+IL+  + + ++A NIT+IL + PE+  FN  L+ T LA  IN   TITV
Sbjct  1    MAYLRRAATALILIMQLFTLSNAHNITKILAKDPEFSTFNHYLSATHLADEINRRQTITV  60

Query  412  LAVKNGGIGDLSSRPIDL--VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIAD  585
            LAV N  +  + S+   L  +  IL  HV++DYF   KLH++ +      +M+Q TG A 
Sbjct  61   LAVDNSAMNSILSKGYSLYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSAT  120

Query  586  RNQGFLNVTSGKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTP  744
               G++N+T  K G + FG     S   AH  + +  + YNISVL +S ++ +P
Sbjct  121  GTSGYVNITDIKGGKVAFGVQEDDSRLTAHYVKSIFEKAYNISVLHISQVLTSP  174



>emb|CDY37904.1| BnaA06g19130D [Brassica napus]
Length=398

 Score =   114 bits (286),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 65/174 (37%), Positives = 100/174 (57%), Gaps = 3/174 (2%)
 Frame = +1

Query  232  MSPLQLSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITV  411
            M+ L+ +A A+IL+  + + ++A NIT+IL + PE+  FN  L+ T LA  IN   TITV
Sbjct  1    MAYLRRAATALILIMQLFTLSNAHNITKILAKDPEFSTFNHYLSATHLADEINRRQTITV  60

Query  412  LAVKNGGIGDLSSRPIDL--VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIAD  585
            LAV N  +  + S+   L  +  IL  HV++DYF   KLH++ +      +M+Q TG A 
Sbjct  61   LAVDNSAMNSILSKGYSLYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSAT  120

Query  586  RNQGFLNVTSGKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTP  744
               G++N+T  K G + FG     S   AH  + +  + YNISVL +S ++ +P
Sbjct  121  GTSGYVNITDIKGGKVAFGVQEDDSRLTAHYVKSIFEKAYNISVLHISQVLTSP  174



>ref|XP_007049368.1| FASCICLIN-like arabinogalactan 2 [Theobroma cacao]
 gb|EOX93525.1| FASCICLIN-like arabinogalactan 2 [Theobroma cacao]
Length=399

 Score =   114 bits (286),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 100/173 (58%), Gaps = 5/173 (3%)
 Frame = +1

Query  232  MSPLQLSAAAVILLTCILS--TASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTI  405
            ++P    + A+ +L    S  T++A NITRIL ++PE+  FN  LT T LA+ IN   TI
Sbjct  4    LTPTLFPSLALFILFIFSSSTTSNAHNITRILAKHPEFSTFNHYLTTTHLASEINRRQTI  63

Query  406  TVLAVKNGGIGDLSSRPIDL--VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGI  579
            TVLA+ N  +  L  + + L  V  +L  HV++DYF   KLH++ N  A  +TM+Q TG 
Sbjct  64   TVLALDNAAMSALLDKQLSLYTVKNVLSLHVLVDYFGSKKLHQITNGTALTSTMFQATGA  123

Query  580  ADRNQGFLNVTSGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            A  + G++N+T  K G V FG+       DA   + V   PYNISVL +S ++
Sbjct  124  APGSSGYINITDLKGGKVGFGAEDNNGKLDAVYVKSVAEIPYNISVLQISQVL  176



>ref|XP_002878353.1| AT3g60900/T4C21_310 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54612.1| AT3g60900/T4C21_310 [Arabidopsis lyrata subsp. lyrata]
Length=424

 Score =   114 bits (286),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 100/167 (60%), Gaps = 2/167 (1%)
 Frame = +1

Query  256  AAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGI  435
            A  + L  +  T S  NIT+IL+  PEY  FN+ L++T LA  IN+ +TITVL + NG +
Sbjct  11   AFTLSLLAVAYTVSGHNITQILSDTPEYSSFNNYLSQTKLADEINSRTTITVLVLNNGAM  70

Query  436  GDLSSR-PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT  612
              L+ + P+ +V   L   V+LDY+D +KLH+L       TT+YQ TG A  N GF+NVT
Sbjct  71   SSLAGKHPLSVVKNALSLLVLLDYYDPLKLHQLAKGSTLTTTLYQTTGHAPGNLGFVNVT  130

Query  613  SGKDGIV-FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
              K G V FGSA   S  D+   + V   PYNISVL ++  I+ PG+
Sbjct  131  DLKGGKVGFGSAAPGSKLDSSYTKSVKQIPYNISVLEINAPIIAPGI  177



>ref|XP_008777689.1| PREDICTED: fasciclin-like arabinogalactan protein 14 [Phoenix 
dactylifera]
Length=272

 Score =   112 bits (280),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 97/157 (62%), Gaps = 1/157 (1%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL  465
            S   A+NIT+IL  Y  + +FN+ LT+T LA  IN H TITVL V N  +  + S   ++
Sbjct  18   SFVGAYNITQILEPYSSFSIFNNYLTQTKLADEINRHQTITVLVVDNSKMSVIFSYLNEI  77

Query  466  VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTS-GKDGIVFGS  642
            +   +  HVILDY+DI KL  + +    LTT++  +GIA+   G LNVT+   D ++FGS
Sbjct  78   LKHTMAIHVILDYYDINKLSHILHKSTLLTTLFLTSGIANNKLGILNVTNMPNDIVIFGS  137

Query  643  AVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLD  753
            A   +   +   + V+++PYNISVL +S +I+ PG++
Sbjct  138  ATPEATLSSTFIKVVITKPYNISVLQMSNLIILPGIE  174



>ref|XP_009615606.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Nicotiana 
tomentosiformis]
Length=416

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 88/149 (59%), Gaps = 3/149 (2%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSRPIDL--VD  471
            A NIT+IL +YP++  FN  LT T LA  IN   TITV AV N G+ +L S+ + +  + 
Sbjct  27   AHNITKILAKYPQFSTFNHYLTETHLAAEINNRETITVCAVDNAGMAELLSKHLSIYTIK  86

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAV  648
             ++  HV+LDYF   KLH++ N  A   TM+Q TG A  + GF+N+T  K G V FG A 
Sbjct  87   NVISLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSTGFVNITDLKGGKVGFGPAE  146

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTII  735
                  A   + V   PYNISV+ +ST++
Sbjct  147  NHGNLPATFVKAVEEIPYNISVIQISTML  175



>ref|NP_193009.1| fasciclin-like arabinogalactan protein 2 [Arabidopsis thaliana]
 sp|Q9SU13.1|FLA2_ARATH RecName: Full=Fasciclin-like arabinogalactan protein 2; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB40990.1| putative pollen surface protein [Arabidopsis thaliana]
 emb|CAB78315.1| putative pollen surface protein [Arabidopsis thaliana]
 gb|AAL31207.1| AT4g12730/T20K18_80 [Arabidopsis thaliana]
 gb|AAM98329.1| At4g12730/T20K18_80 [Arabidopsis thaliana]
 dbj|BAF02161.1| fasciclin-like arabinogalactan protein FLA2 [Arabidopsis thaliana]
 gb|AEE83171.1| fasciclin-like arabinogalactan protein 2 [Arabidopsis thaliana]
Length=403

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 100/177 (56%), Gaps = 6/177 (3%)
 Frame = +1

Query  232  MSPLQLSAAAVIL---LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHST  402
            M+ L+ +A A++L   L   LS ++A NITRIL + P++  FN  L+ T LA  IN   T
Sbjct  1    MAYLRRAATALVLIFQLHLFLSLSNAHNITRILAKDPDFSTFNHYLSATHLADEINRRQT  60

Query  403  ITVLAVKNGGIGDLSSRPIDL--VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTG  576
            ITVLAV N  +  + S    L  +  IL  HV++DYF   KLH++ +      +M+Q TG
Sbjct  61   ITVLAVDNSAMSSILSNGYSLYQIRNILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTG  120

Query  577  IADRNQGFLNVTSGKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTP  744
             A    G++N+T  K G + FG     S   AH  + V  +PYNISVL +S ++ +P
Sbjct  121  SATGTSGYINITDIKGGKVAFGVQDDDSKLTAHYVKSVFEKPYNISVLHISQVLTSP  177



>gb|EPS66997.1| hypothetical protein M569_07779, partial [Genlisea aurea]
Length=401

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 90/159 (57%), Gaps = 13/159 (8%)
 Frame = +1

Query  292  ASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR--PIDL  465
            A A NIT IL++YPE   FN  LT T LA  IN   TITV AV N G+ DL S+   I  
Sbjct  19   ARAHNITTILDKYPELSTFNHYLTVTQLAPEINHRETITVCAVDNAGMSDLLSKHLTIGA  78

Query  466  VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFGSA  645
            +  +L  HV+LDYFD  KLH++ +  A   TM+Q TG A  + GF+N+T      + G  
Sbjct  79   IKNVLALHVLLDYFDAKKLHQITDGTALSATMFQATGSATGSSGFVNITD-----LAGGK  133

Query  646  VRRSPHD------AHLEEEVMSRPYNISVLGVSTIIVTP  744
            V  SP D      A   + V + PYNISV+ +S I+ +P
Sbjct  134  VGFSPQDNGGDVAATFVKSVEAIPYNISVIQISNILPSP  172



>gb|KDO59100.1| hypothetical protein CISIN_1g015356mg [Citrus sinensis]
Length=408

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 90/154 (58%), Gaps = 3/154 (2%)
 Frame = +1

Query  283  LSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR--P  456
            +S A A NITRIL  +P +  FN  L+ T LA  IN  +TITV A+ N G+ +L S+   
Sbjct  17   VSAAQAHNITRILAGHPSFSTFNHYLSVTHLADEINRKTTITVCAIDNAGMSELLSKHPS  76

Query  457  IDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-  633
            I  V  +L  H++LDYF   KLH++ N  A   TM+Q TG A  + GF+N+T  K G V 
Sbjct  77   ITTVKNVLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVG  136

Query  634  FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            FG+       DA   + V  +PYNISV+ +S ++
Sbjct  137  FGAKDNGGKLDALFVKSVEEKPYNISVIQISKVL  170



>ref|XP_006474892.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Citrus 
sinensis]
Length=408

 Score =   113 bits (283),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 90/154 (58%), Gaps = 3/154 (2%)
 Frame = +1

Query  283  LSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR--P  456
            +S A A NITRIL  +P +  FN  L+ T LA  IN  +TITV A+ N G+ +L S+   
Sbjct  17   VSAAQAHNITRILAGHPSFSTFNHYLSVTHLADEINRKTTITVCAIDNAGMSELLSKHPS  76

Query  457  IDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-  633
            I  V  +L  H++LDYF   KLH++ N  A   TM+Q TG A  + GF+N+T  K G V 
Sbjct  77   ITTVKNVLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVG  136

Query  634  FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            FG+       DA   + V  +PYNISV+ +S ++
Sbjct  137  FGAKDNGGKLDALFVKSVEEKPYNISVIQISKVL  170



>emb|CDX87001.1| BnaC03g52710D [Brassica napus]
Length=402

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/174 (37%), Positives = 100/174 (57%), Gaps = 3/174 (2%)
 Frame = +1

Query  232  MSPLQLSAAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITV  411
            M+ L+ +A A+IL+  + + ++A NIT+IL + P++  FN  L+ T LA  IN   TITV
Sbjct  1    MAYLRRAATALILIMQLFTLSNAHNITKILAKDPDFSTFNHYLSATHLADEINRRQTITV  60

Query  412  LAVKNGGIGDLSSRPIDL--VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIAD  585
            LAV N  +  + S+   L  +  IL  HV++DYF   KLH++ +      +M+Q TG A 
Sbjct  61   LAVDNSAMNSILSKGYSLYTIRNILSLHVLVDYFGAKKLHQITDGSTSTASMFQSTGSAT  120

Query  586  RNQGFLNVTSGKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTP  744
               G++N+T  K G + FG     S   AH  + +  + YNISVL +S ++ +P
Sbjct  121  GTSGYVNITDIKGGKVAFGVQEDDSRLTAHYVKSIFEKAYNISVLHISQVLTSP  174



>gb|AAM65777.1| putative pollen surface protein [Arabidopsis thaliana]
Length=403

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 99/177 (56%), Gaps = 6/177 (3%)
 Frame = +1

Query  232  MSPLQLSAAAVIL---LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHST  402
            M+  + +A A++L   L   LS ++A NITRIL + P++  FN  L+ T LA  IN   T
Sbjct  1    MAYFRRAATALVLIFQLHLFLSLSNAHNITRILAKDPDFSTFNHYLSATHLADEINRRQT  60

Query  403  ITVLAVKNGGIGDLSSRPIDL--VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTG  576
            ITVLAV N  +  + S    L  +  IL  HV++DYF   KLH++ +      +M+Q TG
Sbjct  61   ITVLAVDNSAMSSILSNGYSLYQIRNILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTG  120

Query  577  IADRNQGFLNVTSGKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTP  744
             A    G++N+T  K G + FG     S   AH  + V  +PYNISVL +S ++ +P
Sbjct  121  SATGTSGYINITDIKGGKVAFGVQDDDSKLTAHYVKSVFEKPYNISVLHISQVLTSP  177



>ref|XP_002267946.1| PREDICTED: fasciclin-like arabinogalactan protein 2 [Vitis vinifera]
Length=407

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 97/166 (58%), Gaps = 7/166 (4%)
 Frame = +1

Query  253  AAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGG  432
            +  ++ L+C      A NIT IL +YPE+  F+  LT T LA  IN   TITVLAV N G
Sbjct  14   SVCLLFLSC---ATHAHNITHILAKYPEFSTFSHYLTVTHLAGEINRRQTITVLAVSNAG  70

Query  433  IGDLSSR--PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLN  606
            + DL S+   + ++  +L  HV++DYF   KLH++ +  A   T++Q TG A    GF+N
Sbjct  71   MADLLSKHLSVYVIKNVLSLHVLVDYFGARKLHQITDGTASSATLFQSTGSAPGTAGFVN  130

Query  607  VTSGKDGIVFGSAVRRSPH-DAHLEEEVMSRPYNISVLGVSTIIVT  741
            +T  K G V G   + S H +A+  + V+  PYNISVL +S I+ +
Sbjct  131  ITDLKHGKV-GFGAQDSGHLNAYFVKSVVEIPYNISVLEISQILTS  175



>gb|EAZ01938.1| hypothetical protein OsI_23966 [Oryza sativa Indica Group]
Length=289

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 94/156 (60%), Gaps = 6/156 (4%)
 Frame = +1

Query  301  FNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR----PIDLV  468
            FN+T IL R+PE+G+F+ L+++T +   IN+ +T+TVL   N  +  L  R    P   +
Sbjct  39   FNVTEILGRFPEFGLFSYLISKTHVDRDINSRNTVTVLVPDNSAVDWLLRRSARLPRAAL  98

Query  469  DEILRTHVILDYFDIMKLHRLKNHQAKL-TTMYQQTGIADRNQGFLNVT-SGKDGIVFGS  642
             E+L  HV+LDYFD  K+  L   +  + TT++Q TG A R  GFL +T + K G VF S
Sbjct  99   VELLSVHVVLDYFDAAKIAALPPGKPTVSTTLFQTTGNARRRTGFLAITPTAKGGAVFAS  158

Query  643  AVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            A   +  +A L+  V + PYNISVL +S  +V PG+
Sbjct  159  AAPGALVNATLKRVVAAVPYNISVLQISNFVVPPGV  194



>gb|AAK20858.1|AF333971_1 fasciclin-like arabinogalactan-protein 2 [Arabidopsis thaliana]
Length=403

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 68/177 (38%), Positives = 99/177 (56%), Gaps = 6/177 (3%)
 Frame = +1

Query  232  MSPLQLSAAAVIL---LTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHST  402
            M+  + +A A++L   L   LS ++A NITRIL + P++  FN  L+ T LA  IN   T
Sbjct  1    MAYFRRAATALVLIFQLHLFLSLSNAHNITRILAKDPDFSTFNHYLSATHLADEINRRQT  60

Query  403  ITVLAVKNGGIGDLSSRPIDL--VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTG  576
            ITVLAV N  +  + S    L  +  IL  HV++DYF   KLH++ +      +M+Q TG
Sbjct  61   ITVLAVDNSAMSSILSNGYSLYQIRNILSLHVLVDYFGTKKLHQITDGSTSTASMFQSTG  120

Query  577  IADRNQGFLNVTSGKDG-IVFGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTP  744
             A    G++N+T  K G + FG     S   AH  + V  +PYNISVL +S ++ +P
Sbjct  121  SATGTSGYINITDIKGGKVAFGVQDDDSKLTAHYVKSVFEKPYNISVLHISQVLTSP  177



>emb|CAN61077.1| hypothetical protein VITISV_012919 [Vitis vinifera]
Length=407

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 97/166 (58%), Gaps = 7/166 (4%)
 Frame = +1

Query  253  AAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGG  432
            +  ++ L+C      A NIT IL +YPE+  F+  LT T LA  IN   TITVLAV N G
Sbjct  14   SVCLLFLSC---XTHAHNITHILAKYPEFSTFSHYLTVTHLAGEINRRQTITVLAVSNAG  70

Query  433  IGDLSSR--PIDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLN  606
            + DL S+   + ++  +L  HV++DYF   KLH++ +  A   T++Q TG A    GF+N
Sbjct  71   MADLLSKHLSVYVIKNVLSLHVLVDYFGARKLHQITDGTASSATLFQSTGSAPGTAGFVN  130

Query  607  VTSGKDGIVFGSAVRRSPH-DAHLEEEVMSRPYNISVLGVSTIIVT  741
            +T  K G V G   + S H +A+  + V+  PYNISVL +S I+ +
Sbjct  131  ITDLKHGKV-GFGAQDSGHLNAYFVKSVVEIPYNISVLEISQILTS  175



>ref|XP_006346133.1| PREDICTED: fasciclin-like arabinogalactan protein 1-like [Solanum 
tuberosum]
Length=409

 Score =   113 bits (282),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 86/149 (58%), Gaps = 3/149 (2%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR--PIDLVD  471
            A NIT IL  + ++  FN  LT T LAT IN   TITV  V N G+ DL S+   I+ + 
Sbjct  25   AHNITHILANHTQFSTFNHYLTTTHLATEINRRQTITVCVVDNAGMSDLLSKHLSINTIK  84

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAV  648
             +L  HV+LDYFD  KLH++ N  A   T++Q TG A  + GF+N+T  K G V F  A 
Sbjct  85   NVLSFHVLLDYFDAKKLHQITNGTALAATIFQATGSATGSSGFVNITDLKGGKVGFSPAD  144

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTII  735
               P  A   + +   PYNISV+ +STI+
Sbjct  145  YNGPPPAKFVKSIEEIPYNISVIQISTIL  173



>ref|XP_008463001.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Cucumis 
melo]
Length=414

 Score =   112 bits (281),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 97/162 (60%), Gaps = 6/162 (4%)
 Frame = +1

Query  259  AVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIG  438
            AV+ L  ++STA+A NIT++L ++PE+  FN  LT T LA  IN  +TITV  V N  + 
Sbjct  17   AVLFL--VISTATAHNITKLLEKHPEFSTFNHYLTTTHLAPEINRRTTITVCVVDNSAMS  74

Query  439  DLSSRPIDL--VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVT  612
            DL ++ + +  +   L  HV+LDYF   KLH++ N  A   TM+Q TG A  + GF+N+T
Sbjct  75   DLLAKQLSIYSIKNTLSLHVLLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNIT  134

Query  613  SGKDGIVFGSAVRRSPH-DAHLEEEVMSRPYNISVLGVSTII  735
              K G V G  ++ S   DA   + V   PYNIS++ +S I+
Sbjct  135  DLKGGKV-GFGLQDSDDIDAMFVKSVEEVPYNISIIQISKIL  175



>ref|XP_010919185.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Elaeis guineensis]
Length=429

 Score =   112 bits (281),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 90/153 (59%), Gaps = 2/153 (1%)
 Frame = +1

Query  304  NITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR-PIDLVDEIL  480
            NIT IL+ +PEY ++N  L++T +   IN+  T+T L + N  +  L+++  +  +   L
Sbjct  23   NITAILDGFPEYSLYNSYLSQTKVCDEINSRETVTCLVLPNAAMSALAAKQSLAGIKNAL  82

Query  481  RTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDG-IVFGSAVRRS  657
            R   +LDYFD  KLH L +  A  TT+YQ TG A  N GF+N+T+ + G + F +A   S
Sbjct  83   RLLTLLDYFDPQKLHDLPHGSALTTTLYQTTGDATGNSGFVNITNLRGGRVAFAAATPGS  142

Query  658  PHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
              D+   + V   PYN+SVL +S  IV PGL D
Sbjct  143  KFDSSYTKSVRQVPYNLSVLEISAPIVFPGLLD  175



>ref|XP_006452590.1| hypothetical protein CICLE_v10008218mg [Citrus clementina]
 gb|ESR65830.1| hypothetical protein CICLE_v10008218mg [Citrus clementina]
Length=460

 Score =   113 bits (282),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 90/154 (58%), Gaps = 3/154 (2%)
 Frame = +1

Query  283  LSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSSR--P  456
            +S A A NITRIL  +P +  FN  L+ T LA  IN  +TITV A+ N G+ +L S+   
Sbjct  69   VSAAQAHNITRILAGHPSFSTFNHYLSVTHLADEINRKTTITVCAIDNAGMSELLSKHPS  128

Query  457  IDLVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-  633
            I  V  +L  H++LDYF   KLH++ N  A   TM+Q TG A  + GF+N+T  K G V 
Sbjct  129  ITTVKNVLSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSSGFVNITDLKGGKVG  188

Query  634  FGSAVRRSPHDAHLEEEVMSRPYNISVLGVSTII  735
            FG+       DA   + V  +PYNISV+ +S ++
Sbjct  189  FGAKDNGGKLDALFVKSVEEKPYNISVIQISKVL  222



>emb|CBI28444.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   113 bits (282),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 97/166 (58%), Gaps = 7/166 (4%)
 Frame = +1

Query  253  AAAVILLTCILSTASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGG  432
            +  ++ L+C      A NIT IL +YPE+  F+  LT T LA  IN   TITVLAV N G
Sbjct  127  SVCLLFLSC---ATHAHNITHILAKYPEFSTFSHYLTVTHLAGEINRRQTITVLAVSNAG  183

Query  433  IGDLSSRPIDL--VDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLN  606
            + DL S+ + +  +  +L  HV++DYF   KLH++ +  A   T++Q TG A    GF+N
Sbjct  184  MADLLSKHLSVYVIKNVLSLHVLVDYFGARKLHQITDGTASSATLFQSTGSAPGTAGFVN  243

Query  607  VTSGKDGIVFGSAVRRSPH-DAHLEEEVMSRPYNISVLGVSTIIVT  741
            +T  K G V G   + S H +A+  + V+  PYNISVL +S I+ +
Sbjct  244  ITDLKHGKV-GFGAQDSGHLNAYFVKSVVEIPYNISVLEISQILTS  288



>ref|XP_003623747.1| Fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=414

 Score =   112 bits (280),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 95/157 (61%), Gaps = 2/157 (1%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDL-SSRPID  462
            +T SA NIT IL+  P+Y  +N+ L++T LA  IN+  TITVL + N     + SS P+ 
Sbjct  17   TTISAHNITEILSSNPDYSQYNNFLSQTKLADEINSRQTITVLVLNNAAFSSITSSHPLS  76

Query  463  LVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FG  639
            +V +IL   ++LDYFD  KLH+L N     TT++Q TG A  N G +N+T  K G V FG
Sbjct  77   VVKKILSLLILLDYFDNTKLHQLTNGTTLSTTLFQTTGNAVNNIGSVNITDLKGGKVGFG  136

Query  640  SAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            SA   S  D+   + V   PYNISVL ++  I+ PG+
Sbjct  137  SAAPGSKLDSSYSKSVKQIPYNISVLEITAPIIAPGI  173



>gb|KEH23329.1| fasciclin-like arabinogalactan protein [Medicago truncatula]
Length=418

 Score =   112 bits (280),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 95/157 (61%), Gaps = 2/157 (1%)
 Frame = +1

Query  286  STASAFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDL-SSRPID  462
            +T SA NIT IL+  P+Y  +N+ L++T LA  IN+  TITVL + N     + SS P+ 
Sbjct  17   TTISAHNITEILSSNPDYSQYNNFLSQTKLADEINSRQTITVLVLNNAAFSSITSSHPLS  76

Query  463  LVDEILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FG  639
            +V +IL   ++LDYFD  KLH+L N     TT++Q TG A  N G +N+T  K G V FG
Sbjct  77   VVKKILSLLILLDYFDNTKLHQLTNGTTLSTTLFQTTGNAVNNIGSVNITDLKGGKVGFG  136

Query  640  SAVRRSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGL  750
            SA   S  D+   + V   PYNISVL ++  I+ PG+
Sbjct  137  SAAPGSKLDSSYSKSVKQIPYNISVLEITAPIIAPGI  173



>ref|XP_007212310.1| hypothetical protein PRUPE_ppa006726mg [Prunus persica]
 gb|EMJ13509.1| hypothetical protein PRUPE_ppa006726mg [Prunus persica]
Length=398

 Score =   112 bits (279),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 87/149 (58%), Gaps = 3/149 (2%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGD-LSSRP-IDLVD  471
            A NITRIL ++PE+  FN  LT T LA  IN H+TITV AV N  +   L+ +P I  + 
Sbjct  25   AHNITRILAKHPEFSTFNHYLTLTHLAAEINQHTTITVCAVDNSAMSALLAKKPSIYTIK  84

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAV  648
             IL  H++LDYF   KLH++ N  A   TM+Q TG A  + GF+N+T  K G V F    
Sbjct  85   NILSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSAGFVNITDLKGGKVGFTPQD  144

Query  649  RRSPHDAHLEEEVMSRPYNISVLGVSTII  735
                  AH  + V   PYNISV+ +S+I+
Sbjct  145  NDGTFPAHFVKSVEELPYNISVIHISSIL  173



>ref|XP_009382277.1| PREDICTED: fasciclin-like arabinogalactan protein 8 [Musa acuminata 
subsp. malaccensis]
Length=427

 Score =   112 bits (279),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 68/155 (44%), Positives = 90/155 (58%), Gaps = 2/155 (1%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGDLSS-RPIDLVDE  474
            A NIT IL RYPEY ++N  LTRT +   INAH T+T L + +G +  L++ RP+  +  
Sbjct  28   AHNITAILERYPEYTLYNSYLTRTKVCDEINAHETVTCLVLDDGAMSTLAAKRPLAAIKN  87

Query  475  ILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIV-FGSAVR  651
             LR   +LDYFD  KLH L +     TT+ Q TG    N GF+N+T+ + G V F S   
Sbjct  88   ALRLLALLDYFDPPKLHALSSGTTLTTTLLQTTGNEAGNLGFVNITNLRGGRVGFASTAP  147

Query  652  RSPHDAHLEEEVMSRPYNISVLGVSTIIVTPGLDD  756
             S  D+   + +   PYN+SVL VS  IV PGL D
Sbjct  148  GSKFDSTYTKSIEQIPYNLSVLAVSAPIVFPGLLD  182



>ref|XP_008227156.1| PREDICTED: fasciclin-like arabinogalactan protein 1 [Prunus mume]
Length=412

 Score =   111 bits (278),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 89/154 (58%), Gaps = 13/154 (8%)
 Frame = +1

Query  298  AFNITRILNRYPEYGVFNDLLTRTGLATHINAHSTITVLAVKNGGIGD-LSSRP-IDLVD  471
            A NITRIL ++PE+  FN  LT T LA  IN H+TITV AV N  +   L+ +P I  + 
Sbjct  25   AHNITRILAKHPEFSTFNHYLTLTHLAAEINQHTTITVCAVDNSAMSALLAKKPSIYTIK  84

Query  472  EILRTHVILDYFDIMKLHRLKNHQAKLTTMYQQTGIADRNQGFLNVTSGKDGIVFGSAVR  651
             IL  H++LDYF   KLH++ N  A   TM+Q TG A  + GF+N+T  K     G  V 
Sbjct  85   NILSLHILLDYFGAKKLHQITNGTALAATMFQATGSAPGSAGFVNITDLK-----GGKVG  139

Query  652  RSPHD------AHLEEEVMSRPYNISVLGVSTII  735
             +P D      AH  + V   PYNISV+ +S+I+
Sbjct  140  FTPQDNDGTFPAHFVKSVEELPYNISVIHISSIL  173



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3558215248710