BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16647_g1_i1 len=427 path=[113:0-69 183:70-161 274:162-192
112:193-426]

Length=427
                                                                      Score     E

ref|XP_002282035.1|  PREDICTED: cytochrome P450 CYP82D47-like           184   2e-52   Vitis vinifera
emb|CBI19610.3|  unnamed protein product                                186   1e-51   
ref|XP_006473406.1|  PREDICTED: cytochrome P450 82A3-like               181   2e-51   
ref|XP_010264712.1|  PREDICTED: cytochrome P450 CYP82D47-like           181   4e-51   
gb|KHN16363.1|  Cytochrome P450 82A4                                    181   5e-51   
ref|XP_007017405.1|  Cytochrome P450                                    180   1e-50   
ref|XP_007226343.1|  hypothetical protein PRUPE_ppa022174mg             179   1e-50   
ref|XP_011030924.1|  PREDICTED: cytochrome P450 CYP82D47-like           179   2e-50   
gb|KDO84377.1|  hypothetical protein CISIN_1g009899mg                   179   2e-50   
ref|XP_010106088.1|  Cytochrome P450 82A4                               179   2e-50   
ref|XP_006434891.1|  hypothetical protein CICLE_v10000852mg             179   2e-50   
ref|XP_007017404.1|  Cytochrome P450 82A3, putative                     178   4e-50   
ref|XP_007226598.1|  hypothetical protein PRUPE_ppa023495mg             177   9e-50   
ref|XP_003554857.2|  PREDICTED: cytochrome P450 82A4-like               180   1e-49   
ref|XP_003634362.2|  PREDICTED: cytochrome P450 CYP82D47-like           176   3e-49   
ref|XP_002283952.2|  PREDICTED: cytochrome P450 CYP82D47-like           176   3e-49   Vitis vinifera
ref|XP_007223263.1|  hypothetical protein PRUPE_ppa004464mg             175   4e-49   
emb|CAN74205.1|  hypothetical protein VITISV_031127                     175   5e-49   Vitis vinifera
ref|XP_007207908.1|  hypothetical protein PRUPE_ppa019731mg             175   6e-49   
ref|XP_009364189.1|  PREDICTED: cytochrome P450 82A3-like               174   9e-49   
ref|XP_010106079.1|  Cytochrome P450 82A3                               174   1e-48   
ref|XP_006375029.1|  putative cytochrome P450 family protein            174   1e-48   
gb|KDO42969.1|  hypothetical protein CISIN_1g048689mg                   167   1e-48   
ref|XP_011025653.1|  PREDICTED: cytochrome P450 CYP82H23-like           169   2e-48   
ref|XP_003618354.1|  Cytochrome P450                                    173   3e-48   
gb|KHG16624.1|  Cytochrome P450                                         170   3e-48   
ref|XP_002282111.2|  PREDICTED: cytochrome P450 82A3-like               173   3e-48   Vitis vinifera
gb|KDP38426.1|  hypothetical protein JCGZ_04351                         173   3e-48   
ref|XP_002282085.3|  PREDICTED: cytochrome P450 82A1-like               177   4e-48   Vitis vinifera
gb|AGN54072.1|  cytochrome P450 monooxygenase                           173   4e-48   
ref|XP_007017406.1|  Cytochrome P450 82A3, putative                     176   4e-48   
gb|KHN13272.1|  Cytochrome P450 82A4                                    172   5e-48   
ref|XP_003543523.2|  PREDICTED: cytochrome P450 82A4-like               172   6e-48   
ref|XP_002282118.1|  PREDICTED: cytochrome P450 CYP82D47-like           172   1e-47   Vitis vinifera
ref|XP_002282133.1|  PREDICTED: cytochrome P450 CYP82D47                171   1e-47   Vitis vinifera
ref|XP_007151145.1|  hypothetical protein PHAVU_004G021600g             171   2e-47   
ref|XP_007217488.1|  hypothetical protein PRUPE_ppa027160mg             171   2e-47   
gb|KCW45363.1|  hypothetical protein EUGRSUZ_L00956                     171   2e-47   
ref|XP_003554859.1|  PREDICTED: cytochrome P450 82A4-like               170   3e-47   
ref|XP_010040234.1|  PREDICTED: cytochrome P450 CYP82D47-like           171   3e-47   
emb|CAN76287.1|  hypothetical protein VITISV_027433                     170   4e-47   Vitis vinifera
gb|KDO40892.1|  hypothetical protein CISIN_1g009347mg                   170   6e-47   
ref|XP_008228483.1|  PREDICTED: cytochrome P450 CYP82D47-like           169   6e-47   
ref|XP_009364178.1|  PREDICTED: cytochrome P450 CYP82D47-like           169   8e-47   
ref|XP_007151146.1|  hypothetical protein PHAVU_004G021700g             169   9e-47   
ref|XP_007017407.1|  Cytochrome P450                                    169   9e-47   
ref|XP_011039260.1|  PREDICTED: cytochrome P450 CYP82D47-like           169   1e-46   
ref|XP_003618361.1|  Cytochrome P450                                    169   1e-46   
ref|XP_003527704.1|  PREDICTED: cytochrome P450 82A1-like               169   2e-46   
ref|XP_003618345.1|  Cytochrome P450                                    168   2e-46   
ref|XP_010106083.1|  Cytochrome P450 82A3                               168   2e-46   
ref|XP_010092357.1|  Cytochrome P450 82A3                               168   3e-46   
ref|XP_006432712.1|  hypothetical protein CICLE_v10000809mg             168   3e-46   
gb|KHN34164.1|  Cytochrome P450 82A4                                    167   3e-46   
gb|KDP38427.1|  hypothetical protein JCGZ_04352                         167   4e-46   
ref|NP_001240972.1|  cytochrome P450 82A3                               167   5e-46   
ref|XP_003554118.2|  PREDICTED: cytochrome P450 82A4-like               167   5e-46   
ref|XP_007017417.1|  Cytochrome P450 82A3, putative isoform 2           167   6e-46   
ref|XP_003554125.1|  PREDICTED: cytochrome P450 82A4-like               167   6e-46   
gb|KHG08974.1|  Cytochrome P450                                         163   8e-46   
ref|XP_007047111.1|  Cytochrome P450                                    166   9e-46   
ref|XP_006486179.1|  PREDICTED: cytochrome P450 82C4-like               166   9e-46   
ref|XP_007151148.1|  hypothetical protein PHAVU_004G021900g             166   1e-45   
ref|XP_006435903.1|  hypothetical protein CICLE_v10031215mg             166   1e-45   
ref|XP_007133366.1|  hypothetical protein PHAVU_011G173200g             166   1e-45   
ref|XP_008236910.1|  PREDICTED: cytochrome P450 CYP82D47-like           166   1e-45   
gb|AII31759.1|  cytochrome P450 monooxygenase                           166   1e-45   
ref|XP_009336448.1|  PREDICTED: cytochrome P450 82A3-like               166   1e-45   
ref|XP_006375023.1|  hypothetical protein POPTR_0014s03670g             159   2e-45   
ref|XP_006375031.1|  hypothetical protein POPTR_0014s03760g             166   2e-45   
ref|XP_007216265.1|  hypothetical protein PRUPE_ppa017300mg             165   2e-45   
ref|XP_004489343.1|  PREDICTED: cytochrome P450 82A3-like               165   3e-45   
ref|XP_007017416.1|  Cytochrome P450 82A3, putative isoform 1           167   3e-45   
gb|KHN16362.1|  Cytochrome P450 82A3                                    165   3e-45   
gb|KHG24650.1|  Cytochrome P450 protein                                 164   3e-45   
ref|XP_003611841.1|  Cytochrome P450 82A3                               160   4e-45   
ref|XP_004291926.1|  PREDICTED: cytochrome P450 82A3-like               165   4e-45   
gb|KEH37856.1|  cytochrome P450 family protein                          164   4e-45   
gb|KHN19614.1|  Cytochrome P450 82A4                                    164   5e-45   
gb|KDP38432.1|  hypothetical protein JCGZ_04357                         164   5e-45   
ref|XP_010106082.1|  Cytochrome P450 82A3                               164   6e-45   
ref|XP_011030967.1|  PREDICTED: cytochrome P450 CYP82D47-like           164   6e-45   
ref|XP_007151147.1|  hypothetical protein PHAVU_004G021800g             164   6e-45   
gb|KHG29695.1|  Cytochrome P450                                         164   8e-45   
ref|XP_008391540.1|  PREDICTED: cytochrome P450 82A4-like               164   8e-45   
gb|KHN44000.1|  Cytochrome P450 82A4                                    164   8e-45   
ref|XP_008388170.1|  PREDICTED: cytochrome P450 82A3-like               164   8e-45   
ref|XP_007017415.1|  Cytochrome P450, putative                          164   9e-45   
gb|KDO40894.1|  hypothetical protein CISIN_1g009786mg                   164   1e-44   
ref|XP_009336429.1|  PREDICTED: cytochrome P450 82A3-like               164   1e-44   
ref|XP_006432714.1|  hypothetical protein CICLE_v10000845mg             164   1e-44   
ref|XP_009364774.1|  PREDICTED: cytochrome P450 82A3-like               164   1e-44   
ref|XP_006375030.1|  hypothetical protein POPTR_0014s03750g             164   1e-44   
ref|XP_006375032.1|  hypothetical protein POPTR_0014s03770g             163   1e-44   
ref|XP_011030916.1|  PREDICTED: cytochrome P450 CYP82D47-like           163   1e-44   
ref|XP_007017411.1|  Cytochrome P450, putative                          163   1e-44   
ref|XP_003618363.1|  Cytochrome P450                                    163   1e-44   
ref|XP_009364169.1|  PREDICTED: cytochrome P450 CYP82D47-like           163   1e-44   
ref|XP_006387541.1|  hypothetical protein POPTR_0875s00200g             160   2e-44   
gb|KDP38434.1|  hypothetical protein JCGZ_04359                         163   2e-44   
ref|XP_006375027.1|  putative cytochrome P450 family protein            155   2e-44   
ref|XP_007151149.1|  hypothetical protein PHAVU_004G022000g             163   2e-44   
gb|KHG07801.1|  Cytochrome P450                                         162   2e-44   
emb|CAN66846.1|  hypothetical protein VITISV_002367                     162   2e-44   Vitis vinifera
ref|XP_010106080.1|  Cytochrome P450 82A3                               164   2e-44   
ref|XP_007222622.1|  hypothetical protein PRUPE_ppa004175mg             162   2e-44   
gb|KHG01290.1|  Cytochrome P450                                         162   2e-44   
ref|XP_010253830.1|  PREDICTED: cytochrome P450 CYP82D47-like           162   2e-44   
ref|XP_003554074.1|  PREDICTED: cytochrome P450 82A3-like               162   2e-44   
emb|CBI40977.3|  unnamed protein product                                162   3e-44   
ref|XP_009336438.1|  PREDICTED: cytochrome P450 82A3-like               162   3e-44   
ref|XP_009336944.1|  PREDICTED: cytochrome P450 82A3-like               162   3e-44   
ref|XP_006486182.1|  PREDICTED: cytochrome P450 82A3-like               159   3e-44   
ref|XP_009364766.1|  PREDICTED: cytochrome P450 82A3-like               162   3e-44   
ref|XP_011042272.1|  PREDICTED: cytochrome P450 82A4-like               158   3e-44   
ref|XP_006486513.1|  PREDICTED: cytochrome P450 82A3-like               160   3e-44   
ref|XP_003528211.2|  PREDICTED: cytochrome P450 82A1-like               162   3e-44   
ref|XP_008388075.1|  PREDICTED: cytochrome P450 82A3-like               162   4e-44   
ref|XP_008245476.1|  PREDICTED: cytochrome P450 CYP82D47-like           162   4e-44   
ref|XP_006432704.1|  hypothetical protein CICLE_v10000846mg             162   4e-44   
sp|O49859.1|C82A4_SOYBN  RecName: Full=Cytochrome P450 82A4; AltN...    162   4e-44   Glycine max [soybeans]
ref|XP_011030937.1|  PREDICTED: cytochrome P450 CYP82H23-like           158   4e-44   
ref|XP_003517019.1|  PREDICTED: cytochrome P450 82A4-like               162   4e-44   
ref|XP_007017414.1|  Cytochrome P450 82A3, putative                     163   5e-44   
ref|XP_006435895.1|  hypothetical protein CICLE_v10031217mg             162   5e-44   
ref|XP_002510311.1|  cytochrome P450, putative                          161   5e-44   Ricinus communis
gb|AJD25201.1|  cytochrome P450 CYP82D71                                161   6e-44   
ref|XP_002510308.1|  cytochrome P450, putative                          161   6e-44   Ricinus communis
ref|XP_006471190.1|  PREDICTED: cytochrome P450 82A3-like               155   7e-44   
ref|XP_003523886.1|  PREDICTED: cytochrome P450 82A1-like               161   7e-44   
ref|XP_010089020.1|  Cytochrome P450 82A3                               161   7e-44   
ref|XP_011099743.1|  PREDICTED: cytochrome P450 CYP82D47-like           161   7e-44   
ref|XP_010664625.1|  PREDICTED: cytochrome P450 CYP82D47-like           161   7e-44   
ref|XP_008343753.1|  PREDICTED: cytochrome P450 CYP82D47-like           161   8e-44   
ref|XP_009336967.1|  PREDICTED: cytochrome P450 82A4-like               161   8e-44   
ref|XP_011030947.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    161   1e-43   
ref|XP_008378426.1|  PREDICTED: cytochrome P450 CYP82D47-like           161   1e-43   
ref|XP_007017413.1|  Cytochrome P450                                    160   1e-43   
gb|KDO44281.1|  hypothetical protein CISIN_1g037130mg                   155   1e-43   
ref|XP_008351399.1|  PREDICTED: cytochrome P450 82A4-like               160   1e-43   
ref|XP_008388076.1|  PREDICTED: cytochrome P450 CYP82D47-like           160   1e-43   
ref|XP_011030954.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    160   1e-43   
ref|XP_002268915.2|  PREDICTED: cytochrome P450 82C2                    162   1e-43   Vitis vinifera
ref|XP_006384481.1|  hypothetical protein POPTR_0004s15460g             152   1e-43   
gb|KCW59278.1|  hypothetical protein EUGRSUZ_H01953                     159   2e-43   
ref|XP_002522370.1|  cytochrome P450, putative                          160   2e-43   Ricinus communis
ref|NP_001240077.1|  cytochrome P450 82A2                               160   2e-43   
ref|NP_001236179.1|  cytochrome P450 CYP82C1                            160   2e-43   
gb|KDO43361.1|  hypothetical protein CISIN_1g0369161mg                  156   2e-43   
ref|XP_007227272.1|  hypothetical protein PRUPE_ppa017703mg             160   2e-43   
ref|XP_010664626.1|  PREDICTED: cytochrome P450 CYP82D47                160   2e-43   
ref|XP_006435899.1|  hypothetical protein CICLE_v10031216mg             159   3e-43   
ref|XP_007151141.1|  hypothetical protein PHAVU_004G021200g             159   3e-43   
ref|XP_007017410.1|  Cytochrome P450 82A3, putative                     160   3e-43   
ref|XP_003546624.1|  PREDICTED: cytochrome P450 82A2-like               159   3e-43   
ref|XP_006375025.1|  hypothetical protein POPTR_0014s03700g             160   3e-43   
emb|CDP07595.1|  unnamed protein product                                162   4e-43   
ref|XP_007151144.1|  hypothetical protein PHAVU_004G021500g             159   4e-43   
gb|KCW68803.1|  hypothetical protein EUGRSUZ_F02402                     159   4e-43   
ref|XP_007136643.1|  hypothetical protein PHAVU_009G061500g             159   4e-43   
ref|XP_010064743.1|  PREDICTED: cytochrome P450 CYP82D47-like           159   4e-43   
emb|CDP16080.1|  unnamed protein product                                159   4e-43   
ref|XP_003619141.1|  Cytochrome P450                                    159   4e-43   
ref|XP_010070482.1|  PREDICTED: cytochrome P450 CYP82D47-like           159   5e-43   
ref|XP_009365841.1|  PREDICTED: cytochrome P450 CYP82D47-like           159   5e-43   
ref|XP_003619137.1|  Cytochrome P450                                    159   5e-43   
gb|KHG29694.1|  Cytochrome P450                                         159   5e-43   
gb|AII31758.1|  cytochrome P450 monooxygenase                           159   5e-43   
ref|XP_011030958.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    159   5e-43   
ref|XP_006435901.1|  hypothetical protein CICLE_v10031635mg             157   5e-43   
ref|XP_003516592.1|  PREDICTED: cytochrome P450 82A3-like isoform X1    159   5e-43   
ref|XP_006431672.1|  hypothetical protein CICLE_v10001614mg             156   5e-43   
ref|XP_004489342.1|  PREDICTED: cytochrome P450 82A1-like               159   6e-43   
ref|XP_008220885.1|  PREDICTED: cytochrome P450 82A3-like               162   6e-43   
gb|KHN36187.1|  Cytochrome P450 82A3                                    159   7e-43   
ref|XP_007151142.1|  hypothetical protein PHAVU_004G021300g             158   7e-43   
gb|KCW44328.1|  hypothetical protein EUGRSUZ_L02217                     158   7e-43   
gb|KDP38429.1|  hypothetical protein JCGZ_04354                         158   7e-43   
gb|KGN59916.1|  hypothetical protein Csa_3G853140                       154   8e-43   
ref|XP_004489341.1|  PREDICTED: cytochrome P450 82A3-like               158   8e-43   
ref|XP_008378401.1|  PREDICTED: cytochrome P450 CYP82D47-like           158   8e-43   
gb|KCW85809.1|  hypothetical protein EUGRSUZ_B02554                     158   8e-43   
ref|XP_002510313.1|  cytochrome P450, putative                          158   9e-43   Ricinus communis
ref|XP_009364154.1|  PREDICTED: cytochrome P450 CYP82D47-like           158   9e-43   
gb|KCW68807.1|  hypothetical protein EUGRSUZ_F02406                     158   9e-43   
ref|XP_006471496.1|  PREDICTED: cytochrome P450 82C4-like               158   1e-42   
emb|CBI19611.3|  unnamed protein product                                161   1e-42   
ref|XP_006471495.1|  PREDICTED: cytochrome P450 82C4-like               158   1e-42   
ref|XP_008464766.1|  PREDICTED: cytochrome P450 CYP82D47-like           158   1e-42   
gb|KDO38174.1|  hypothetical protein CISIN_1g0106221mg                  154   1e-42   
ref|XP_006366471.1|  PREDICTED: cytochrome P450 82A3-like               158   1e-42   
ref|XP_010064745.1|  PREDICTED: cytochrome P450 CYP82D47-like           158   1e-42   
ref|XP_010046449.1|  PREDICTED: cytochrome P450 CYP82D47-like           158   1e-42   
gb|AII31760.1|  cytochrome P450 monooxygenase                           157   1e-42   
ref|XP_006366435.1|  PREDICTED: cytochrome P450 82A3-like               157   1e-42   
gb|AAG09208.1|AF175278_1  wound-inducible P450 hydroxylase              157   2e-42   Pisum sativum [garden pea]
gb|KDO57198.1|  hypothetical protein CISIN_1g044206mg                   152   2e-42   
dbj|BAF98469.1|  cytochrome P450                                        157   2e-42   Coptis japonica var. dissecta
ref|XP_003537400.1|  PREDICTED: cytochrome P450 82A3-like               157   2e-42   
ref|XP_006471473.1|  PREDICTED: cytochrome P450 82A3-like               157   2e-42   
gb|KHN04536.1|  Cytochrome P450 82A1                                    157   2e-42   
gb|KDP34890.1|  hypothetical protein JCGZ_09178                         153   2e-42   
ref|XP_006432669.1|  hypothetical protein CICLE_v10000844mg             157   2e-42   
ref|XP_004488195.1|  PREDICTED: cytochrome P450 82A3-like               157   2e-42   
ref|XP_006581227.1|  PREDICTED: cytochrome P450 82A1-like               157   2e-42   
ref|XP_002510312.1|  cytochrome P450, putative                          157   2e-42   Ricinus communis
sp|Q43068.2|C82A1_PEA  RecName: Full=Cytochrome P450 82A1; AltNam...    157   2e-42   Pisum sativum [garden pea]
gb|EYU45077.1|  hypothetical protein MIMGU_mgv1a023617mg                157   3e-42   
gb|KCW59285.1|  hypothetical protein EUGRSUZ_H01963                     155   3e-42   
gb|KDO42181.1|  hypothetical protein CISIN_1g009844mg                   157   3e-42   
ref|XP_006432710.1|  hypothetical protein CICLE_v10000851mg             156   4e-42   
ref|XP_004154898.1|  PREDICTED: cytochrome P450 82A3-like               156   4e-42   
ref|XP_011083776.1|  PREDICTED: cytochrome P450 CYP82D47-like           156   4e-42   
ref|XP_010070483.1|  PREDICTED: cytochrome P450 CYP82D47-like           156   4e-42   
ref|XP_011099742.1|  PREDICTED: cytochrome P450 CYP82D47-like           156   5e-42   
ref|XP_011099830.1|  PREDICTED: cytochrome P450 CYP82D47-like           156   5e-42   
ref|XP_009606708.1|  PREDICTED: cytochrome P450 CYP82D47-like           156   5e-42   
gb|EYU23763.1|  hypothetical protein MIMGU_mgv1a023100mg                156   6e-42   
gb|KDO42182.1|  hypothetical protein CISIN_1g046041mg                   156   6e-42   
ref|XP_007224171.1|  hypothetical protein PRUPE_ppa016912mg             156   6e-42   
ref|XP_010106089.1|  Cytochrome P450 82C4                               156   6e-42   
ref|XP_007017403.1|  Cytochrome P450, family 82, subfamily C, pol...    156   7e-42   
ref|XP_006471191.1|  PREDICTED: cytochrome P450 82C4-like               156   7e-42   
ref|XP_004154825.1|  PREDICTED: cytochrome P450 82C4-like isoform 2     150   7e-42   
gb|KGN59915.1|  Cytochrome P450                                         155   8e-42   
ref|XP_006471151.1|  PREDICTED: cytochrome P450 82C4-like               155   9e-42   
emb|CAN81092.1|  hypothetical protein VITISV_004720                     155   1e-41   Vitis vinifera
ref|XP_006423130.1|  hypothetical protein CICLE_v10030016mg             155   1e-41   
ref|XP_007047112.1|  Cytochrome P450                                    156   1e-41   
ref|XP_010070486.1|  PREDICTED: cytochrome P450 CYP82D47-like           155   1e-41   
ref|XP_002284806.1|  PREDICTED: cytochrome P450 CYP82D47                155   2e-41   Vitis vinifera
gb|KDP38438.1|  hypothetical protein JCGZ_04363                         155   2e-41   
ref|XP_003604789.1|  Cytochrome P450                                    154   2e-41   
ref|XP_006423133.1|  hypothetical protein CICLE_v10028201mg             154   3e-41   
ref|XP_007151140.1|  hypothetical protein PHAVU_004G021100g             154   3e-41   
ref|XP_004291927.1|  PREDICTED: cytochrome P450 82A3-like               154   3e-41   
ref|XP_009804510.1|  PREDICTED: cytochrome P450 CYP82D47-like           154   3e-41   
ref|XP_006432711.1|  hypothetical protein CICLE_v10003589mg             153   4e-41   
ref|XP_002284031.1|  PREDICTED: cytochrome P450 82C4                    154   4e-41   Vitis vinifera
gb|KHG26594.1|  Cytochrome P450                                         154   4e-41   
ref|XP_008464769.1|  PREDICTED: cytochrome P450 CYP82D47-like           153   5e-41   
gb|AGF30366.1|  CYP450 monooxygenase CYP82D62                           153   5e-41   
ref|XP_007224041.1|  hypothetical protein PRUPE_ppa015200mg             153   5e-41   
gb|EYU23762.1|  hypothetical protein MIMGU_mgv1a004588mg                153   6e-41   
ref|XP_006573615.1|  PREDICTED: cytochrome P450 82A3-like isoform X2    153   6e-41   
ref|XP_006573616.1|  PREDICTED: cytochrome P450 82A3-like isoform X3    153   6e-41   
gb|KHN42044.1|  Cytochrome P450 82A3                                    153   7e-41   
prf||2209439B  cytochrome P450 monooxygenase                            153   7e-41
ref|XP_007033359.1|  Cytochrome P450                                    152   9e-41   
ref|XP_004147822.1|  PREDICTED: uncharacterized protein LOC101212976    155   1e-40   
ref|XP_004238199.1|  PREDICTED: cytochrome P450 CYP82D47-like           152   1e-40   
ref|XP_004505090.1|  PREDICTED: cytochrome P450 82A3-like               152   1e-40   
ref|XP_003589812.1|  Cytochrome P450                                    151   1e-40   
ref|XP_006364811.1|  PREDICTED: cytochrome P450 82A3-like               152   1e-40   
ref|XP_008378984.1|  PREDICTED: cytochrome P450 82A3-like               151   1e-40   
ref|XP_007017412.1|  Cytochrome P450, putative                          152   1e-40   
ref|XP_011073058.1|  PREDICTED: cytochrome P450 CYP82D47-like           152   1e-40   
ref|XP_009795251.1|  PREDICTED: cytochrome P450 CYP82D47-like           152   1e-40   
ref|XP_006366437.1|  PREDICTED: cytochrome P450 82A3-like               152   2e-40   
ref|XP_004238201.1|  PREDICTED: cytochrome P450 CYP82D47-like           152   2e-40   
ref|XP_007017409.1|  Cytochrome P450, family 82, subfamily C, pol...    152   2e-40   
ref|XP_004154826.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    152   2e-40   
gb|KGN59914.1|  hypothetical protein Csa_3G852630                       152   2e-40   
ref|XP_006473405.1|  PREDICTED: cytochrome P450 82C4-like               152   2e-40   
ref|XP_004291928.1|  PREDICTED: cytochrome P450 82A4-like               152   2e-40   
ref|XP_004147803.1|  PREDICTED: cytochrome P450 82C4-like               151   3e-40   
ref|XP_010061805.1|  PREDICTED: cytochrome P450 CYP82D47-like           151   3e-40   
gb|KHN36186.1|  Cytochrome P450 82A3                                    151   3e-40   
ref|XP_007151143.1|  hypothetical protein PHAVU_004G021400g             151   3e-40   
ref|XP_006856215.1|  hypothetical protein AMTR_s00059p00202900          152   3e-40   
ref|XP_003618351.1|  Cytochrome P450 82A1                               151   4e-40   
ref|XP_006464298.1|  PREDICTED: cytochrome P450 82C4-like               150   4e-40   
ref|XP_002510305.1|  cytochrome P450, putative                          150   5e-40   Ricinus communis
gb|KEH30995.1|  cytochrome P450 family protein                          149   5e-40   
gb|KEH30993.1|  cytochrome P450 family protein                          150   6e-40   
ref|XP_009364162.1|  PREDICTED: cytochrome P450 82C4-like               150   6e-40   
gb|KEH30997.1|  cytochrome P450 family protein                          150   6e-40   
ref|XP_010061806.1|  PREDICTED: cytochrome P450 CYP82D47-like           150   6e-40   
ref|XP_008464765.1|  PREDICTED: cytochrome P450 CYP82D47-like           150   7e-40   
ref|XP_009624056.1|  PREDICTED: cytochrome P450 82A3-like               150   7e-40   
ref|XP_004306669.1|  PREDICTED: cytochrome P450 82A3-like               150   8e-40   
gb|KCW68808.1|  hypothetical protein EUGRSUZ_F02407                     150   9e-40   
gb|AGF30364.1|  CYP450 monooxygenase CYP82D33                           150   1e-39   
ref|XP_004147804.1|  PREDICTED: cytochrome P450 82C4-like               150   1e-39   
ref|XP_007136644.1|  hypothetical protein PHAVU_009G061600g             150   1e-39   
ref|XP_010060881.1|  PREDICTED: cytochrome P450 82A3-like               145   1e-39   
ref|XP_006856218.1|  hypothetical protein AMTR_s00059p00203770          149   1e-39   
ref|XP_010026402.1|  PREDICTED: cytochrome P450 82C4-like               148   1e-39   
gb|KHN22285.1|  Cytochrome P450 82A4                                    149   1e-39   
ref|XP_008378409.1|  PREDICTED: cytochrome P450 82C4-like               149   1e-39   
ref|XP_006464328.1|  PREDICTED: cytochrome P450 82C4-like               149   1e-39   
ref|XP_003519977.1|  PREDICTED: cytochrome P450 82A4-like               149   2e-39   
gb|KGN59912.1|  Cytochrome P450                                         146   2e-39   
ref|XP_010064744.1|  PREDICTED: cytochrome P450 CYP82D47-like           149   2e-39   
ref|XP_006464299.1|  PREDICTED: cytochrome P450 82C4-like               149   2e-39   
ref|XP_010060880.1|  PREDICTED: cytochrome P450 CYP82D47-like           149   2e-39   
ref|XP_010070481.1|  PREDICTED: cytochrome P450 CYP82D47-like           149   2e-39   
gb|KCW68806.1|  hypothetical protein EUGRSUZ_F02405                     149   3e-39   
ref|XP_007156852.1|  hypothetical protein PHAVU_002G022900g             149   3e-39   
ref|XP_006486180.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    148   3e-39   
ref|XP_011030904.1|  PREDICTED: cytochrome P450 82C4-like               148   4e-39   
ref|XP_006486181.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    148   4e-39   
ref|XP_006434890.1|  hypothetical protein CICLE_v10003803mg             148   4e-39   
ref|XP_003618365.1|  Cytochrome P450                                    148   4e-39   
gb|KDP29948.1|  hypothetical protein JCGZ_18517                         148   4e-39   
gb|KDO39181.1|  hypothetical protein CISIN_1g045409mg                   143   4e-39   
gb|AAS90126.1|  cytochrome P450                                         148   5e-39   
gb|AES74583.2|  cytochrome P450 family 82 protein                       147   6e-39   
ref|XP_006366470.1|  PREDICTED: cytochrome P450 82A3-like               147   6e-39   
gb|KDO84376.1|  hypothetical protein CISIN_1g036812mg                   147   7e-39   
gb|KCW67760.1|  hypothetical protein EUGRSUZ_F01497                     147   7e-39   
gb|AGO03797.1|  cytochrome P450-like protein                            147   7e-39   
ref|XP_002519132.1|  cytochrome P450, putative                          144   8e-39   
ref|XP_004238200.1|  PREDICTED: cytochrome P450 CYP82D47-like           147   9e-39   
ref|XP_006464300.1|  PREDICTED: cytochrome P450 82C4-like               147   1e-38   
ref|XP_010070484.1|  PREDICTED: cytochrome P450 CYP82D47-like           147   1e-38   
ref|XP_004147820.1|  PREDICTED: cytochrome P450 82C4-like               147   1e-38   
ref|XP_004147802.1|  PREDICTED: cytochrome P450 82A4-like               146   2e-38   
gb|AES74584.2|  cytochrome P450 family protein                          146   2e-38   
gb|KHN00733.1|  Cytochrome P450 82A4                                    146   2e-38   
ref|XP_006379218.1|  hypothetical protein POPTR_0009s11180g             146   2e-38   
ref|XP_002510314.1|  conserved hypothetical protein                     142   2e-38   
ref|XP_003618366.1|  Cytochrome P450                                    146   2e-38   
ref|XP_010918630.1|  PREDICTED: cytochrome P450 82C4-like               145   2e-38   
gb|EPS58631.1|  hypothetical protein M569_16182                         145   3e-38   
ref|XP_011005663.1|  PREDICTED: cytochrome P450 CYP82D47-like           145   3e-38   
emb|CAN64371.1|  hypothetical protein VITISV_016844                     145   4e-38   
gb|AJD25200.1|  cytochrome P450 CYP82D70                                145   4e-38   
ref|XP_009599169.1|  PREDICTED: cytochrome P450 82C4-like               145   4e-38   
ref|XP_010028533.1|  PREDICTED: cytochrome P450 CYP82D47-like           145   4e-38   
emb|CBI32510.3|  unnamed protein product                                145   4e-38   
ref|XP_002284810.3|  PREDICTED: cytochrome P450 CYP82D47                145   4e-38   
ref|XP_003523888.1|  PREDICTED: cytochrome P450 82C4-like               145   5e-38   
ref|XP_006375022.1|  hypothetical protein POPTR_0014s03660g             145   5e-38   
gb|EYU23760.1|  hypothetical protein MIMGU_mgv1a026908mg                145   6e-38   
ref|XP_010664941.1|  PREDICTED: cytochrome P450 82A4-like               139   7e-38   
ref|XP_006342717.1|  PREDICTED: cytochrome P450 82C4-like               144   9e-38   
ref|XP_006856219.1|  hypothetical protein AMTR_s00059p00204120          144   9e-38   
gb|AFK38862.1|  unknown                                                 144   1e-37   
ref|XP_008464764.1|  PREDICTED: cytochrome P450 CYP82D47-like           144   1e-37   
ref|XP_006352674.1|  PREDICTED: cytochrome P450 82C4-like               144   1e-37   
ref|XP_008464768.1|  PREDICTED: cytochrome P450 CYP82D47-like           144   2e-37   
ref|XP_009374201.1|  PREDICTED: cytochrome P450 CYP82D47-like           144   2e-37   
ref|XP_006379221.1|  hypothetical protein POPTR_0009s11200g             137   2e-37   
emb|CDP15065.1|  unnamed protein product                                143   2e-37   
ref|XP_008466638.1|  PREDICTED: cytochrome P450 CYP82D47-like           143   2e-37   
gb|KCW67753.1|  hypothetical protein EUGRSUZ_F01486                     143   2e-37   
gb|ACO90217.1|  (S)-N-methylcoclaurine 3'-hydroxylase                   137   2e-37   
ref|XP_010060877.1|  PREDICTED: cytochrome P450 CYP82D47-like           143   2e-37   
ref|XP_011043845.1|  PREDICTED: cytochrome P450 CYP82H23-like           140   2e-37   
gb|ABB20912.1|  P450 mono-oxygenase                                     143   2e-37   
gb|KFK29808.1|  hypothetical protein AALP_AA7G181800                    135   3e-37   
ref|XP_004147801.1|  PREDICTED: cytochrome P450 82A4-like               143   3e-37   
ref|XP_009109920.1|  PREDICTED: cytochrome P450 82C4                    142   4e-37   
ref|XP_010106085.1|  Cytochrome P450 82C4                               142   4e-37   
emb|CDP03915.1|  unnamed protein product                                142   4e-37   
ref|XP_010028535.1|  PREDICTED: cytochrome P450 CYP82D47-like           142   5e-37   
emb|CAN74206.1|  hypothetical protein VITISV_031128                     139   5e-37   
emb|CDY53704.1|  BnaC03g67210D                                          141   9e-37   
ref|XP_004252778.1|  PREDICTED: cytochrome P450 82C4-like               141   9e-37   
gb|KCW60845.1|  hypothetical protein EUGRSUZ_H03582                     141   1e-36   
ref|XP_010526011.1|  PREDICTED: cytochrome P450 82C4-like isoform X2    141   1e-36   
ref|XP_010526010.1|  PREDICTED: cytochrome P450 82C4-like isoform X1    141   1e-36   
ref|XP_011040244.1|  PREDICTED: cytochrome P450 82C4-like               141   2e-36   
gb|EYU23761.1|  hypothetical protein MIMGU_mgv1a004606mg                140   2e-36   
ref|XP_004154897.1|  PREDICTED: cytochrome P450 82A3-like               138   2e-36   
ref|XP_004147821.1|  PREDICTED: cytochrome P450 82A3-like               140   2e-36   
ref|XP_004154900.1|  PREDICTED: cytochrome P450 82A3-like               140   2e-36   
emb|CDY23316.1|  BnaA08g12300D                                          140   2e-36   
ref|XP_008464770.1|  PREDICTED: cytochrome P450 CYP82D47-like           140   2e-36   
ref|XP_002323130.1|  hypothetical protein POPTR_0016s00980g             140   3e-36   
ref|XP_010040235.1|  PREDICTED: cytochrome P450 CYP82D47-like           140   3e-36   
ref|XP_010547840.1|  PREDICTED: cytochrome P450 82C4-like               140   3e-36   
ref|XP_002869302.1|  CYP82C4                                            140   3e-36   
gb|KFK29809.1|  hypothetical protein AALP_AA7G181800                    140   3e-36   
ref|XP_006427755.1|  hypothetical protein CICLE_v10025349mg             140   3e-36   
ref|XP_006465163.1|  PREDICTED: cytochrome P450 82C4-like               139   4e-36   
gb|KDP38435.1|  hypothetical protein JCGZ_04360                         133   5e-36   
gb|KDO39483.1|  hypothetical protein CISIN_1g009723mg                   139   5e-36   
ref|XP_010249368.1|  PREDICTED: cytochrome P450 CYP82D47-like           139   6e-36   
ref|XP_002264464.1|  PREDICTED: cytochrome P450 CYP82D47                139   1e-35   
ref|XP_004147824.1|  PREDICTED: cytochrome P450 82A3-like               139   1e-35   
ref|XP_003635525.2|  PREDICTED: cytochrome P450 CYP82D47-like           138   1e-35   
ref|XP_002274740.1|  PREDICTED: cytochrome P450 CYP82D47                138   1e-35   
emb|CAN61061.1|  hypothetical protein VITISV_018742                     138   1e-35   
ref|XP_010437977.1|  PREDICTED: cytochrome P450 82C4-like               138   1e-35   
emb|CBI36491.3|  unnamed protein product                                138   1e-35   
ref|XP_010447469.1|  PREDICTED: cytochrome P450 82C4-like               138   1e-35   
gb|KEH33015.1|  cytochrome P450 family 82 protein                       138   1e-35   
ref|XP_009365832.1|  PREDICTED: cytochrome P450 CYP82D47-like           138   2e-35   
ref|XP_008343493.1|  PREDICTED: cytochrome P450 82A3-like               138   2e-35   
sp|L7X3S1.1|MSH_PAPSO  RecName: Full=Methyltetrahydroprotoberberi...    138   2e-35   
gb|AFB74617.1|  cytochrome P450                                         138   2e-35   
ref|XP_006856214.1|  hypothetical protein AMTR_s00059p00201650          138   2e-35   
ref|XP_007151896.1|  hypothetical protein PHAVU_004G085000g             137   2e-35   
gb|KCW58034.1|  hypothetical protein EUGRSUZ_H00762                     137   3e-35   
ref|XP_010069626.1|  PREDICTED: cytochrome P450 CYP82D47-like           137   3e-35   
sp|F2Z9C1.1|P6H_ESCCA  RecName: Full=Protopine 6-monooxygenase; A...    137   3e-35   
ref|XP_002510306.1|  cytochrome P450, putative                          137   3e-35   
gb|KDP26346.1|  hypothetical protein JCGZ_17504                         137   3e-35   
gb|AAC39454.1|  (S)-N-methylcoclaurine 3'-hydroxylase                   137   4e-35   
gb|KCW52083.1|  hypothetical protein EUGRSUZ_J01518                     137   4e-35   
ref|XP_004147805.1|  PREDICTED: cytochrome P450 82A3-like               137   5e-35   
emb|CBI29738.3|  unnamed protein product                                138   5e-35   
ref|XP_010064547.1|  PREDICTED: cytochrome P450 CYP82D47-like           137   5e-35   
ref|XP_007225086.1|  hypothetical protein PRUPE_ppa017464mg             136   5e-35   
ref|XP_008464762.1|  PREDICTED: cytochrome P450 CYP82D47-like           136   6e-35   
ref|XP_007222623.1|  hypothetical protein PRUPE_ppa004179mg             136   7e-35   
ref|XP_002869304.1|  CYP82C4                                            136   7e-35   
gb|KGN59907.1|  hypothetical protein Csa_3G852560                       136   8e-35   
ref|XP_009348374.1|  PREDICTED: cytochrome P450 CYP82D47-like           136   8e-35   
ref|XP_010547839.1|  PREDICTED: cytochrome P450 82C4-like               136   8e-35   
ref|XP_006432715.1|  hypothetical protein CICLE_v10003834mg             131   9e-35   
ref|XP_007049681.1|  Cytochrome P450                                    136   9e-35   
ref|XP_004154823.1|  PREDICTED: cytochrome P450 82A3-like               135   1e-34   
ref|XP_010451089.1|  PREDICTED: cytochrome P450 82C4                    135   1e-34   
ref|NP_194922.1|  cytochrome P450, family 82, subfamily C, polype...    135   1e-34   
ref|XP_010436299.1|  PREDICTED: cytochrome P450 82C4-like               135   1e-34   
ref|XP_010686299.1|  PREDICTED: cytochrome P450 CYP82D47-like           135   1e-34   
ref|XP_006443548.1|  hypothetical protein CICLE_v10019706mg             134   1e-34   
ref|XP_010445016.1|  PREDICTED: cytochrome P450 82C4-like               135   2e-34   
gb|KDP38423.1|  hypothetical protein JCGZ_04348                         135   2e-34   
ref|XP_010432796.1|  PREDICTED: cytochrome P450 82C4-like               135   2e-34   
gb|ABC69375.1|  CYP82M1v4                                               135   2e-34   
emb|CDP00859.1|  unnamed protein product                                135   2e-34   
ref|XP_007201702.1|  hypothetical protein PRUPE_ppa004095mg             134   3e-34   
ref|XP_002510298.1|  cytochrome P450, putative                          134   3e-34   
gb|ABC69372.1|  CYP82M1v1                                               134   3e-34   
gb|ABC69374.1|  CYP82M1v3                                               134   3e-34   
gb|ABC69373.1|  CYP82M1v2                                               134   3e-34   
ref|XP_002274509.1|  PREDICTED: cytochrome P450 CYP82D47-like           134   3e-34   
ref|XP_009616319.1|  PREDICTED: cytochrome P450 CYP82D47-like           134   3e-34   
ref|XP_006443549.1|  hypothetical protein CICLE_v10019706mg             134   3e-34   
ref|XP_009801176.1|  PREDICTED: cytochrome P450 CYP82D47-like           134   3e-34   
ref|XP_006339196.1|  PREDICTED: cytochrome P450 82C4-like               134   3e-34   
ref|XP_010686308.1|  PREDICTED: cytochrome P450 CYP82D47-like           134   4e-34   
emb|CAN77159.1|  hypothetical protein VITISV_019026                     135   4e-34   
ref|XP_007222593.1|  hypothetical protein PRUPE_ppa004169mg             134   4e-34   
ref|XP_010069621.1|  PREDICTED: cytochrome P450 CYP82D47-like iso...    134   4e-34   
dbj|BAF98472.1|  cytochrome P450                                        134   5e-34   
ref|XP_009627979.1|  PREDICTED: cytochrome P450 82C4-like               134   5e-34   
gb|KDP46184.1|  hypothetical protein JCGZ_10024                         134   5e-34   
ref|XP_009619218.1|  PREDICTED: cytochrome P450 CYP82D47-like           134   5e-34   
ref|XP_006340061.1|  PREDICTED: cytochrome P450 82C4-like               133   6e-34   
ref|XP_008219217.1|  PREDICTED: cytochrome P450 82A3-like               134   6e-34   
dbj|BAM36726.1|  nicotine N-demethylase                                 133   6e-34   
ref|XP_007201144.1|  hypothetical protein PRUPE_ppa016050mg             133   7e-34   
ref|XP_006283535.1|  hypothetical protein CARUB_v10004585mg             133   8e-34   
ref|XP_010696627.1|  PREDICTED: cytochrome P450 CYP82D47-like           133   8e-34   
dbj|BAM36727.1|  nicotine N-demethylase                                 133   9e-34   
ref|XP_004247061.1|  PREDICTED: cytochrome P450 82C4-like               133   9e-34   
dbj|BAM36725.1|  nicotine N-demethylase                                 133   9e-34   
dbj|BAM36724.1|  nicotine N-demethylase                                 133   9e-34   
gb|ABC69371.1|  CYP82E5                                                 133   9e-34   
ref|XP_010069627.1|  PREDICTED: cytochrome P450 CYP82D47-like           133   9e-34   
gb|KCW58036.1|  hypothetical protein EUGRSUZ_H00764                     132   1e-33   
emb|CAN66023.1|  hypothetical protein VITISV_042713                     133   1e-33   
ref|XP_008235427.1|  PREDICTED: cytochrome P450 82G1-like               133   1e-33   
ref|XP_002264790.1|  PREDICTED: cytochrome P450 CYP82D47                133   1e-33   
gb|KDP45301.1|  hypothetical protein JCGZ_15166                         133   1e-33   
ref|XP_004147823.1|  PREDICTED: cytochrome P450 82A3-like               133   1e-33   
ref|XP_002510297.1|  cytochrome P450, putative                          132   1e-33   
gb|KDO36922.1|  hypothetical protein CISIN_1g041575mg                   129   1e-33   
gb|KGN59911.1|  hypothetical protein Csa_3G852600                       132   1e-33   
ref|XP_004147825.1|  PREDICTED: cytochrome P450 82C4-like               132   2e-33   
gb|KDP38431.1|  hypothetical protein JCGZ_04356                         132   2e-33   
ref|XP_009609539.1|  PREDICTED: cytochrome P450 82C4-like               132   2e-33   
ref|XP_004236938.1|  PREDICTED: cytochrome P450 82C4-like               132   2e-33   
gb|KDP38436.1|  hypothetical protein JCGZ_04361                         132   2e-33   
gb|ABD39479.1|  CYP82E4v8                                               132   2e-33   
gb|KHG01223.1|  Cytochrome P450 protein                                 132   2e-33   
gb|ABD39478.1|  CYP82E4v7                                               132   2e-33   
gb|ABD39482.1|  CYP82E4v12                                              132   2e-33   
gb|ABA07804.1|  cytochrome P450 monooxygenase CYP82E4v2                 132   2e-33   
gb|ABD39476.1|  CYP82E4v5                                               132   2e-33   
gb|ABA07805.1|  cytochrome P450 monooxygenase CYP82E4v1                 132   2e-33   
gb|ABD39480.1|  CYP82E4v10                                              132   2e-33   
gb|ABD39477.1|  CYP82E4v6                                               132   2e-33   
gb|ABD39474.1|  CYP82E4v3                                               132   2e-33   
gb|AGD93125.1|  CYP450 nicotine N-demethylase                           132   2e-33   
dbj|BAM36723.1|  nicotine N-demethylase                                 132   2e-33   
gb|KDP26344.1|  hypothetical protein JCGZ_17502                         132   2e-33   
gb|ADP65809.1|  nicotine N-demethylase                                  132   3e-33   
ref|XP_009757628.1|  PREDICTED: cytochrome P450 CYP82D47-like           132   3e-33   
gb|ABC69376.1|  CYP82M1v5                                               132   3e-33   
ref|XP_002281361.1|  PREDICTED: cytochrome P450 82C4                    132   3e-33   
ref|XP_010026403.1|  PREDICTED: cytochrome P450 82C4-like               131   3e-33   
emb|CAN65890.1|  hypothetical protein VITISV_018868                     133   3e-33   
gb|ABD39481.1|  CYP82E4v11                                              131   3e-33   
ref|XP_010647827.1|  PREDICTED: cytochrome P450 CYP82D47                131   3e-33   
emb|CDP21229.1|  unnamed protein product                                129   4e-33   
ref|XP_002281431.2|  PREDICTED: cytochrome P450 82C4                    131   4e-33   
gb|ABX56037.1|  CYP82E5v2                                               131   4e-33   
ref|XP_009609537.1|  PREDICTED: cytochrome P450 82C4-like               131   4e-33   
gb|KHG29587.1|  Cytochrome P450 protein                                 131   5e-33   
ref|XP_009780811.1|  PREDICTED: cytochrome P450 82C4-like               132   5e-33   
ref|XP_010686293.1|  PREDICTED: cytochrome P450 CYP82D47-like           131   5e-33   
sp|L7X0L7.1|P6H_PAPSO  RecName: Full=Protopine 6-monooxygenase; A...    131   5e-33   
gb|KDO36111.1|  hypothetical protein CISIN_1g046501mg                   123   6e-33   
ref|XP_006376421.1|  cytochrome P450 family protein                     130   6e-33   



>ref|XP_002282035.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=528

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            GK+++ PEA GAWPI+GHL+L  GS+LPHV LG MADKYG IFTIR+GVH+ LV+S  ++
Sbjct  38   GKRRIAPEAAGAWPIIGHLHLLGGSQLPHVTLGTMADKYGPIFTIRLGVHRALVVSSREV  97

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D  +S RPK  A +HLGYNY M +F+PY  YWRE+RK+ ++ELLSNRR+E L
Sbjct  98   AKECFTTNDSAVSGRPKLVAPEHLGYNYAMFAFSPYDAYWREVRKIVNTELLSNRRLELL  157

Query  66   KHIRVAEIETSVKEL  22
            K +R +E+ETS+KEL
Sbjct  158  KDVRASEVETSIKEL  172



>emb|CBI19610.3| unnamed protein product [Vitis vinifera]
Length=933

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            GK+++ PEA GAWPI+GHL+L  GS+LPHV LG MADKYG IFTIR+GVH+ LV+S  ++
Sbjct  477  GKRRIAPEAAGAWPIIGHLHLLGGSQLPHVTLGTMADKYGPIFTIRLGVHRALVVSSREV  536

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D  +S RPK  A +HLGYNY M +F+PY  YWRE+RK+ ++ELLSNRR+E L
Sbjct  537  AKECFTTNDSAVSGRPKLVAPEHLGYNYAMFAFSPYDAYWREVRKIVNTELLSNRRLELL  596

Query  66   KHIRVAEIETSVKEL  22
            K +R +E+ETS+KEL
Sbjct  597  KDVRASEVETSIKEL  611



>ref|XP_006473406.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
Length=523

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K PPEA G WP++GHL+L  G +LPH+ALG +ADKYG +F+IRIGVH  LV+S W++AKE
Sbjct  35   KKPPEAAGKWPMIGHLHLLAGPQLPHLALGALADKYGPLFSIRIGVHPALVVSSWEMAKE  94

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
            L T HDV ISSRPK    + LG+NY    F+PY  YWREMRK+T+SELLSNRR+E LKHI
Sbjct  95   LFTKHDVDISSRPKLTVGKLLGHNYANFGFSPYNAYWREMRKITASELLSNRRLELLKHI  154

Query  57   RVAEIETSVKEL  22
            R  E+E  +KEL
Sbjct  155  RATEVEGEIKEL  166



>ref|XP_010264712.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   181 bits (459),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K+K+ PEA GAWP++GHL L  G +LPH+ LG MADKYG  FTIR+GV + LV+SDW++A
Sbjct  36   KRKMAPEAAGAWPVIGHLPLLGGPELPHITLGAMADKYGPAFTIRLGVRRALVVSDWEVA  95

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T +D  +++RP   A +H+GYNY M +FAPYGPYWRE+RK+ + ELLSNRR+E LK
Sbjct  96   KECFTINDRALATRPSGVAMKHMGYNYAMFAFAPYGPYWREVRKIATLELLSNRRLEMLK  155

Query  63   HIRVAEIETSVKEL  22
            H+RV+E+  SV+EL
Sbjct  156  HVRVSEVNMSVREL  169



>gb|KHN16363.1| Cytochrome P450 82A4 [Glycine soja]
Length=522

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            +K  P   GAWPILGHL L  GS +PH ALGD+ADKYG IFTI++GV K LVIS+W++AK
Sbjct  35   KKEAPTVAGAWPILGHLPLLNGSDIPHRALGDLADKYGPIFTIKLGVKKALVISNWEIAK  94

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            E  T++D+ +SSRPK  A +++GYN  M+ FAPYGPYWRE+RK+ + E+LSNRR+EQL+ 
Sbjct  95   ECFTTNDIFVSSRPKLVAVEYMGYNQAMLGFAPYGPYWRELRKVATLEILSNRRVEQLQD  154

Query  60   IRVAEIETSVKEL  22
            +RV+E++ S+K+L
Sbjct  155  VRVSEVQHSIKDL  167



>ref|XP_007017405.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY14630.1| Cytochrome P450 [Theobroma cacao]
Length=540

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            ++   P A GAWPI+GHL+L RG KLPH+ LGDMA+KYG I+ IR+GVH  LV+S W++ 
Sbjct  90   RKNYAPLARGAWPIIGHLHLLRGPKLPHLTLGDMAEKYGPIYAIRLGVHPALVVSSWEIL  149

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE+ T+HDV ++SRPK  AA+HL Y+Y M  F+P GPYW EMRK+ + ELLSN R+E LK
Sbjct  150  KEIFTNHDVAVASRPKMTAAKHLAYDYAMFGFSPNGPYWCEMRKIVNLELLSNHRLELLK  209

Query  63   HIRVAEIETSVKEL  22
            H+RV+E+ETS+KEL
Sbjct  210  HVRVSEVETSLKEL  223



>ref|XP_007226343.1| hypothetical protein PRUPE_ppa022174mg [Prunus persica]
 gb|EMJ27542.1| hypothetical protein PRUPE_ppa022174mg [Prunus persica]
Length=522

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 102/132 (77%), Gaps = 1/132 (1%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            KLP  AGG WP+LGH  LFRGS+LPH+AL  + DKYG  FTI IG+H  LVIS W+ AK+
Sbjct  39   KLPKVAGG-WPLLGHFGLFRGSQLPHIALASLVDKYGPAFTINIGIHSALVISTWEAAKD  97

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
              T++D+ +SSRP    A+HLGYN+ M  F PYGPYWREMRKLTS ELLSNRR+E LK +
Sbjct  98   CFTTNDIVVSSRPATLGAKHLGYNFAMFGFGPYGPYWREMRKLTSLELLSNRRLELLKKV  157

Query  57   RVAEIETSVKEL  22
            RV+E+E S+KEL
Sbjct  158  RVSEVEMSLKEL  169



>ref|XP_011030924.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=521

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K KL PEAGGAWPI+GHL L  GS+LPH+ LGD+ADKYG IFTIRIG++  LV+S W+LA
Sbjct  30   KTKLAPEAGGAWPIIGHLPLLAGSELPHLRLGDLADKYGPIFTIRIGMYPALVVSSWELA  89

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KEL T +D  +SSR K  A++ LGYN+    F+PYG +WR +RK+ +SELLSNRR+E LK
Sbjct  90   KELFTINDAIVSSRSKLTASKILGYNFASFGFSPYGEFWRGIRKIVASELLSNRRLELLK  149

Query  63   HIRVAEIETSVKEL  22
            H+R +E+E SVKEL
Sbjct  150  HVRASEVEVSVKEL  163



>gb|KDO84377.1| hypothetical protein CISIN_1g009899mg [Citrus sinensis]
Length=523

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K PPEA G WP++GHL+L  G +LPH+ALG +ADKYG +F+IRIGVH  LV+S W++AKE
Sbjct  35   KKPPEAAGKWPMIGHLHLLAGPQLPHLALGALADKYGPLFSIRIGVHPALVVSSWEMAKE  94

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
            L T HDV ISSRPK    + LG+NY    F+PY  YWREMRK+T+SELLSNRR+E LKHI
Sbjct  95   LFTKHDVDISSRPKLTVGKLLGHNYANFGFSPYNAYWREMRKITASELLSNRRLELLKHI  154

Query  57   RVAEIETSVKEL  22
            R  E++  +KE+
Sbjct  155  RATEVDGEIKEI  166



>ref|XP_010106088.1| Cytochrome P450 82A4 [Morus notabilis]
 gb|EXC07358.1| Cytochrome P450 82A4 [Morus notabilis]
Length=525

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/130 (61%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPEA G WPI+GHL+L  GS+LPH+ L ++ADKYG IFTI IGVH  LVIS W+ AKE  
Sbjct  41   PPEAAGRWPIIGHLHLLGGSQLPHITLANLADKYGPIFTIHIGVHPTLVISSWESAKECF  100

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T+HD+ +S+RPK  +++ LG+NY    FAPYGPYWRE+RK+T+SELLSN+R+E+L+H+R 
Sbjct  101  TTHDLAVSTRPKLISSEILGWNYASFGFAPYGPYWREIRKITTSELLSNKRLEKLRHVRE  160

Query  51   AEIETSVKEL  22
            +E+E+ VK L
Sbjct  161  SEVESFVKNL  170



>ref|XP_006434891.1| hypothetical protein CICLE_v10000852mg [Citrus clementina]
 gb|ESR48131.1| hypothetical protein CICLE_v10000852mg [Citrus clementina]
Length=523

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K PPEA G WP++GHL+L  G +LPH+ALG +ADKYG +F+IRIGVH  LV+S W++AKE
Sbjct  35   KKPPEAAGKWPMIGHLHLLAGPQLPHLALGALADKYGPLFSIRIGVHPALVVSSWEMAKE  94

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
            L T HDV ISSRPK    + LG+NY    F+PY  YWREMRK+T+ ELLSNRR+E LKHI
Sbjct  95   LFTKHDVDISSRPKLTVGKLLGHNYANFGFSPYNAYWREMRKITALELLSNRRLELLKHI  154

Query  57   RVAEIETSVKEL  22
            R  E+E  +KEL
Sbjct  155  RATEVEGEIKEL  166



>ref|XP_007017404.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14629.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=527

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K + PPEA G WP++GHL++  GS+LP++ALGD+A+KYG IFTIRIG+H  +V+S  +LA
Sbjct  36   KGQKPPEAAGRWPLIGHLHVLAGSQLPYLALGDLANKYGPIFTIRIGLHPAVVVSSSELA  95

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE+ T++DV +SSRPK     +LGYN     F+PYG YWREMRK+T+SELLSNRR+E LK
Sbjct  96   KEIFTTYDVAVSSRPKLTVGNYLGYNCANFGFSPYGAYWREMRKITASELLSNRRLELLK  155

Query  63   HIRVAEIETSVKEL  22
            HI+ +E+E+SVKEL
Sbjct  156  HIKASEVESSVKEL  169



>ref|XP_007226598.1| hypothetical protein PRUPE_ppa023495mg [Prunus persica]
 gb|EMJ27797.1| hypothetical protein PRUPE_ppa023495mg [Prunus persica]
Length=522

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 102/132 (77%), Gaps = 1/132 (1%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            KLP  AGG WP+LGH  LFRGS+LPH+AL  + DKYG  FTI IG+H  LVIS W+ AK+
Sbjct  39   KLPKVAGG-WPLLGHFGLFRGSQLPHIALASLVDKYGPAFTINIGIHSALVISTWEAAKD  97

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
              T++D+ +SSRP    A+HLGYN+ M  F+PYG YWREMRKLTS ELLSNRR+E LK +
Sbjct  98   CFTTNDIVVSSRPATLGAKHLGYNFAMFGFSPYGSYWREMRKLTSLELLSNRRLELLKKV  157

Query  57   RVAEIETSVKEL  22
            RV+E+E S+KEL
Sbjct  158  RVSEVEMSLKEL  169



>ref|XP_003554857.2| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=866

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            +K  P   GAWPILGHL L  GS +PH ALGD+ADKYG IFTI++GV K LVIS+W++AK
Sbjct  35   KKEAPTVAGAWPILGHLPLLNGSHIPHRALGDLADKYGPIFTIKLGVKKALVISNWEIAK  94

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            E  T++D+ +SSRPK  A +++GYN  M+ FAPYGPYWRE+RK+ + E+LSNRR+EQL+ 
Sbjct  95   ECFTTNDIFVSSRPKLVAVEYMGYNQAMLGFAPYGPYWRELRKVATLEILSNRRVEQLQD  154

Query  60   IRVAEIETSVKEL  22
            +RV+E++ S+K+L
Sbjct  155  VRVSEVQHSIKDL  167



>ref|XP_003634362.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 111/136 (82%), Gaps = 1/136 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSK-LPHVALGDMADKYGLIFTIRIGVHKVLVISDWK  250
            GK ++ PEA GAWPI+GHL+L  GSK LPH+  G MADKYG +F+IR+G+ + +V+S W+
Sbjct  33   GKSRMAPEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWE  92

Query  249  LAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQ  70
            +AKE  T+HD+ ++SRP+  AA++LGYNY M +F+P+G YWRE+RK+ + ELLSNRR+E 
Sbjct  93   MAKECFTTHDLALASRPQLVAAKYLGYNYSMFAFSPHGAYWREVRKIATLELLSNRRLEL  152

Query  69   LKHIRVAEIETSVKEL  22
            LK++R++E+ET +KEL
Sbjct  153  LKNVRISEVETCMKEL  168



>ref|XP_002283952.2| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 111/136 (82%), Gaps = 1/136 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSK-LPHVALGDMADKYGLIFTIRIGVHKVLVISDWK  250
            GK ++ PEA GAWPI+GHL+L  GSK LPH+  G MADKYG +F+IR+G+ + +V++ W+
Sbjct  33   GKSRMAPEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVVVNSWE  92

Query  249  LAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQ  70
            +AKE  T+HD+ ++SRP+  AA++LGYNY M +F+P+G YWRE+RK+ + ELLSNRR+E 
Sbjct  93   MAKECFTTHDLALASRPEVEAAKYLGYNYAMFAFSPHGAYWREVRKIATLELLSNRRLEL  152

Query  69   LKHIRVAEIETSVKEL  22
            LK++R++E+ET +KEL
Sbjct  153  LKNVRISEVETCMKEL  168



>ref|XP_007223263.1| hypothetical protein PRUPE_ppa004464mg [Prunus persica]
 gb|EMJ24462.1| hypothetical protein PRUPE_ppa004464mg [Prunus persica]
Length=508

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PP+ GG WP+LGHLYLF GS+LPH+ L  + DKYG IFT+ IG+H  LVIS W+ AK+  
Sbjct  40   PPKVGGGWPLLGHLYLFGGSQLPHITLASLVDKYGPIFTVNIGIHSALVISTWEAAKDCF  99

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D  +SSRP     ++L YN+ M  F+PYGPYWREMRKLTS ELLSNRR+E L+++R 
Sbjct  100  TTNDKVVSSRPATLGCKYLSYNFAMFGFSPYGPYWREMRKLTSLELLSNRRLELLRNVRA  159

Query  51   AEIETSVKEL  22
            +E+E S+K+L
Sbjct  160  SEVEISLKQL  169



>emb|CAN74205.1| hypothetical protein VITISV_031127 [Vitis vinifera]
Length=525

 Score =   175 bits (444),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 110/136 (81%), Gaps = 1/136 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSK-LPHVALGDMADKYGLIFTIRIGVHKVLVISDWK  250
            GK ++ PEA GAWPI+GHL+L  GSK LPH+  G MADKYG +F+IR+G  + +V+S W+
Sbjct  33   GKSRMAPEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGXKRAVVVSSWE  92

Query  249  LAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQ  70
            +AKE  T+HD+ ++SRP+  AA++LGYNY M +F+P+G YWRE+RK+ + ELLSNRR+E 
Sbjct  93   MAKECFTTHDLALASRPEVVAAKYLGYNYAMFAFSPHGAYWREVRKIATLELLSNRRLEL  152

Query  69   LKHIRVAEIETSVKEL  22
            LK++R++E+ET +KEL
Sbjct  153  LKNVRISEVETCMKEL  168



>ref|XP_007207908.1| hypothetical protein PRUPE_ppa019731mg, partial [Prunus persica]
 gb|EMJ09107.1| hypothetical protein PRUPE_ppa019731mg, partial [Prunus persica]
Length=502

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++ PPEA GAWPI+GHL    G + PH++LG+MADKYG IFTI++GVH+ LV+S+W++A
Sbjct  1    KKRAPPEAPGAWPIIGHLPYIGGPRPPHISLGNMADKYGPIFTIKLGVHRALVVSNWEIA  60

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D + ++RPKF AA+ +GY+Y M  F+PYGPYWR+MRK+ + ELLSN R+E LK
Sbjct  61   KEFFTTNDKNFATRPKFLAAEIMGYDYAMFGFSPYGPYWRQMRKIATVELLSNHRLELLK  120

Query  63   HIRVAEIETSVKELQD  16
             +R  EI+T  K + D
Sbjct  121  RVREYEIQTCTKHIYD  136



>ref|XP_009364189.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPEA GAWPILGHL L  GS  PH+ LG MADKYG ++TIR+GV+  LVIS  ++AKE  
Sbjct  39   PPEAKGAWPILGHLPLLGGSTPPHITLGAMADKYGPLYTIRLGVYPSLVISSSEIAKECF  98

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D+ ++SRPK     H+GYNY M  FAP GPYWRE+RK+T+ ELLSNRR+E LKHIRV
Sbjct  99   TTNDLSVNSRPKMAVVDHIGYNYAMFGFAPSGPYWREIRKITTLELLSNRRVELLKHIRV  158

Query  51   AEIETSVKEL  22
            +E+ T +KEL
Sbjct  159  SEVTTFLKEL  168



>ref|XP_010106079.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07349.1| Cytochrome P450 82A3 [Morus notabilis]
Length=528

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            ++ PPEAGGAWPI+GHL+L  G + PH+ L  MADKYG IFTI++GVH+ LV+S W++AK
Sbjct  34   RRTPPEAGGAWPIIGHLHLLAGPQPPHITLAHMADKYGPIFTIKMGVHRALVVSSWEMAK  93

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            E  T++D   ++RPK  A +H+ YNY M  F+PYGPYWR++RK+ + ELLSN R+E L H
Sbjct  94   ECLTTNDKIFANRPKAAAPEHMTYNYAMFGFSPYGPYWRQVRKIATLELLSNHRLEMLSH  153

Query  60   IRVAEIETSVKE  25
            +RV+E+ T++KE
Sbjct  154  VRVSEVNTAIKE  165



>ref|XP_006375029.1| putative cytochrome P450 family protein [Populus trichocarpa]
 gb|ERP52826.1| putative cytochrome P450 family protein [Populus trichocarpa]
Length=525

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K KL PEA GAWPI+GHL L  G++LPH+ LG +ADKYG IFTIRIG++  LV+S W+LA
Sbjct  31   KTKLAPEASGAWPIIGHLPLLAGAELPHLRLGALADKYGPIFTIRIGMYPALVVSSWELA  90

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KEL T++D  +SSRPK  A++ LGYN+    F+PYG ++R +RK+ +SELLSNRR+E LK
Sbjct  91   KELFTTNDAIVSSRPKLTASKILGYNFASFGFSPYGEFFRGIRKIVASELLSNRRLELLK  150

Query  63   HIRVAEIETSVKEL  22
            H+R +E+E SVKEL
Sbjct  151  HVRASEVEVSVKEL  164



>gb|KDO42969.1| hypothetical protein CISIN_1g048689mg, partial [Citrus sinensis]
Length=239

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            PEAGGAWP++GHL++ RGS+  H  LG+MADKYG IFT+++GV + LV+S+W++AKE  T
Sbjct  47   PEAGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFT  106

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            ++D   + RPK  A + LGYN+L++ FAPYG YWR+ RK+ + ELLSNRR+E+LKH+R +
Sbjct  107  TNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRES  166

Query  48   EIETSVKEL  22
            E++ S++ L
Sbjct  167  EVKASIQRL  175



>ref|XP_011025653.1| PREDICTED: cytochrome P450 CYP82H23-like [Populus euphratica]
Length=324

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+AGGAWPI+GH++LF G +L H  LG MADKYG +FTI++G H+VLV++ W++A++  T
Sbjct  42   PQAGGAWPIIGHMHLFGGKQLTHKILGAMADKYGPVFTIKLGSHRVLVVNSWEMARDCFT  101

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   SSRP   A++ LGY+  M  FAPYGPYWREMRK+T+ ELLS+ RI+ L+HIR +
Sbjct  102  VHDRAFSSRPSIAASKLLGYDLAMFGFAPYGPYWREMRKITTIELLSSHRIDMLRHIRAS  161

Query  48   EIETSVKEL  22
            E+ET++++L
Sbjct  162  EVETAIRDL  170



>ref|XP_003618354.1| Cytochrome P450 [Medicago truncatula]
 gb|AES74572.1| cytochrome P450 family protein [Medicago truncatula]
Length=535

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K K  P A GAWPILGHL LF G++ PH  LG +ADKYG +FTI++G  + L++++W++A
Sbjct  37   KTKEAPIAEGAWPILGHLSLFSGTQSPHRVLGTLADKYGPLFTIKLGSKRALILNNWEMA  96

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T+HD+ +SSRPK  A +HLGYN  M  F PYGPYWR++RK+ + E+L+NRRIEQ +
Sbjct  97   KECFTTHDMVVSSRPKLVATKHLGYNGAMFGFGPYGPYWRQLRKIVTLEVLTNRRIEQQQ  156

Query  63   HIRVAEIETSVKELQD  16
            H+RV+E+  S+KEL D
Sbjct  157  HVRVSEVRASIKELFD  172



>gb|KHG16624.1| Cytochrome P450 [Gossypium arboreum]
Length=358

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+AGGA PI+GH++LFRG +L H  LG MADKYG +F++R+G H+VLV++ W++AKE  T
Sbjct  38   PQAGGALPIIGHMHLFRGQQLTHKTLGGMADKYGPVFSLRLGSHEVLVLNSWEMAKECFT  97

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   S+RP   A++ LGY++ M  FAPYGPYWRE+RK+T+ ELLSN RI+ LKHIRV+
Sbjct  98   VHDKVFSTRPIITASKILGYDFAMFGFAPYGPYWREIRKITTIELLSNHRIDMLKHIRVS  157

Query  48   EIETSVKEL  22
            E++++++EL
Sbjct  158  EVKSAIREL  166



>ref|XP_002282111.2| PREDICTED: cytochrome P450 82A3-like [Vitis vinifera]
Length=525

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 109/136 (80%), Gaps = 1/136 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSK-LPHVALGDMADKYGLIFTIRIGVHKVLVISDWK  250
            GK ++ PEA GAWPI+GHL+L  GSK LPH+  G MADKYG +F+IR+G+ + +V+S W+
Sbjct  33   GKSRMAPEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWE  92

Query  249  LAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQ  70
            +AKE  T+HD+ ++SRP+  AA++LGYNY M   +P+G YWRE+RK+ + ELLSNRR+E 
Sbjct  93   MAKECFTTHDLALASRPELVAAKYLGYNYAMFGLSPHGAYWREVRKIATLELLSNRRLEL  152

Query  69   LKHIRVAEIETSVKEL  22
            LK++R++E+ET +KEL
Sbjct  153  LKNVRISEVETCMKEL  168



>gb|KDP38426.1| hypothetical protein JCGZ_04351 [Jatropha curcas]
Length=514

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K +  PEAG +WPI+GHL+L  G +LPH  L  +ADKYG IFTIRIG++  LV+S W+LA
Sbjct  28   KARAAPEAGDSWPIIGHLHLLAGRELPHKVLAALADKYGPIFTIRIGIYPALVVSSWELA  87

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KEL T +D  +SSRPK   A+ LGYNY    F+PYG YWREMRK+T+ ELLSNR++E LK
Sbjct  88   KELFTVNDPTVSSRPKLTGAKLLGYNYANFGFSPYGEYWREMRKITALELLSNRKLELLK  147

Query  63   HIRVAEIETSVKEL  22
            HIR +E+E S+K+L
Sbjct  148  HIRASEVEGSIKDL  161



>ref|XP_002282085.3| PREDICTED: cytochrome P450 82A1-like [Vitis vinifera]
Length=1053

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 111/136 (82%), Gaps = 1/136 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSK-LPHVALGDMADKYGLIFTIRIGVHKVLVISDWK  250
            GK ++ PEA GAWPI+GHL+L  GSK LPH+  G MADKYG +F+IR+G+ + +V+S W+
Sbjct  561  GKSRMAPEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVVVSSWE  620

Query  249  LAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQ  70
            +AKE  T+HD+ ++SRP+  AA++LGYNY M +F+P+G YWRE+RK+ + ELLSNRR+E 
Sbjct  621  MAKECFTTHDLALASRPELVAAKYLGYNYAMFAFSPHGAYWREVRKIATLELLSNRRLEL  680

Query  69   LKHIRVAEIETSVKEL  22
            LK++R++E+ET +KEL
Sbjct  681  LKNVRISEVETCMKEL  696


 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 106/137 (77%), Gaps = 2/137 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGS--KLPHVALGDMADKYGLIFTIRIGVHKVLVISDW  253
            G +K+ PEA  AWPI+GHL+L  G   +LPH+ LG+MADKYG +FTIRIG+H+ +V+S W
Sbjct  33   GNKKIAPEAAAAWPIIGHLHLLAGGSHQLPHITLGNMADKYGPVFTIRIGLHRAVVVSSW  92

Query  252  KLAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIE  73
            ++AKE ST++D   SSRP+  A++ LGYNY M  F+PYG YWREMRK+ S ELLSN R+E
Sbjct  93   EMAKECSTANDQVSSSRPELLASKLLGYNYAMFGFSPYGSYWREMRKIISLELLSNSRLE  152

Query  72   QLKHIRVAEIETSVKEL  22
             LK +R +E+ TS+KEL
Sbjct  153  LLKDVRASEVVTSIKEL  169



>gb|AGN54072.1| cytochrome P450 monooxygenase [Artemisia annua]
Length=523

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLP-HVALGDMADKYGLIFTIRIGVHKVLVISDWK  250
            GK   PP A G WPI+GHL LF G   P H  LG MA KYG IFTI++GV +VLV++ W 
Sbjct  33   GKNNRPPVAAGTWPIVGHLNLFGGLSNPLHKILGSMAVKYGPIFTIQLGVRQVLVVNSWD  92

Query  249  LAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQ  70
            +AKE+ T+HD  +SSRPKF AA+ LGY+Y M   +PYGPYWREMRK+TS ELLS RR+EQ
Sbjct  93   IAKEIFTTHDAIVSSRPKFTAAKILGYDYAMFGVSPYGPYWREMRKITSLELLSARRLEQ  152

Query  69   LKHIRVAEIETSVKEL  22
            LK++RV+E++ S+K L
Sbjct  153  LKYVRVSELKNSIKNL  168



>ref|XP_007017406.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14631.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=1044

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P A GAWPI+GHL L RG KLPH+ LGDMA+KYG I+ IR+GVH  LV+S W++ KE+ T
Sbjct  558  PIARGAWPIIGHLPLLRGPKLPHLTLGDMAEKYGPIYAIRLGVHPALVVSSWEILKEIFT  617

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            +HDV ++SR K  +A+H+ Y+Y M  F+PYGPYWREMRK+ + ELLSN ++E LKH+RV+
Sbjct  618  NHDVAVASRLKVTSAKHMSYDYAMFGFSPYGPYWREMRKIVNLELLSNHKLELLKHVRVS  677

Query  48   EIETSVKEL  22
            E+ETS+KEL
Sbjct  678  EVETSLKEL  686


 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 44/56 (79%), Gaps = 0/56 (0%)
 Frame = -2

Query  189  AAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVAEIETSVKEL  22
            AA+HLG+NY M   APYG YWREMRK+ +  LLSNRR+E LK +RV+E + SVKEL
Sbjct  3    AAEHLGFNYAMAGVAPYGSYWREMRKIINFALLSNRRLEILKQVRVSEAQVSVKEL  58



>gb|KHN13272.1| Cytochrome P450 82A4 [Glycine soja]
Length=523

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            GKQ  P  AG AWPILGHL L  GS+ PH  LG +ADKYG IFTI+IGV K LVIS+W++
Sbjct  34   GKQDAPTVAG-AWPILGHLPLLSGSETPHRVLGALADKYGPIFTIKIGVKKALVISNWEI  92

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D+ +SSRPK  A + + YN  M  FAPYGPYWR++RK+ + E+LSNRR+EQL
Sbjct  93   AKECFTTNDIVVSSRPKLVAIELMCYNQAMFGFAPYGPYWRQLRKIVNLEILSNRRVEQL  152

Query  66   KHIRVAEIETSVKEL  22
            +H+ V+E+++S+KEL
Sbjct  153  QHVHVSEVQSSIKEL  167



>ref|XP_003543523.2| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=547

 Score =   172 bits (437),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            GKQ  P  AG AWPILGHL L  GS+ PH  LG +ADKYG IFTI+IGV K LVIS+W++
Sbjct  58   GKQDAPTVAG-AWPILGHLPLLSGSETPHRVLGALADKYGPIFTIKIGVKKALVISNWEI  116

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D+ +SSRPK  A + + YN  M  FAPYGPYWR++RK+ + E+LSNRR+EQL
Sbjct  117  AKECFTTNDIVVSSRPKLVAIELMCYNQAMFGFAPYGPYWRQLRKIVNLEILSNRRVEQL  176

Query  66   KHIRVAEIETSVKEL  22
            +H+ V+E+++S+KEL
Sbjct  177  QHVHVSEVQSSIKEL  191



>ref|XP_002282118.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=525

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 109/136 (80%), Gaps = 1/136 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSK-LPHVALGDMADKYGLIFTIRIGVHKVLVISDWK  250
            GK ++ PEA GAWPI+GHL+L  GSK LPH+ LG MADKYG +F++R+G+ + +V+S W+
Sbjct  33   GKGRMAPEAAGAWPIIGHLHLLGGSKNLPHLLLGTMADKYGAVFSVRLGLERAVVVSSWQ  92

Query  249  LAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQ  70
            +AKE  T+HD+ ++SRP+   ++ LGYN  M +F+P+G YWRE+RK+ + ELLSNRR+E 
Sbjct  93   MAKECFTTHDLALASRPQLVISKQLGYNDAMFAFSPHGAYWREVRKIATLELLSNRRLEL  152

Query  69   LKHIRVAEIETSVKEL  22
            LK++R++E+ET +KEL
Sbjct  153  LKNVRISEVETCMKEL  168



>ref|XP_002282133.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=525

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 109/136 (80%), Gaps = 1/136 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSK-LPHVALGDMADKYGLIFTIRIGVHKVLVISDWK  250
            GK ++ PEA GAWPI+GHL+L  GSK LPH+ LG MADKYG +F++R+G+ + +V+S W+
Sbjct  33   GKGRMAPEAAGAWPIIGHLHLLGGSKNLPHLLLGTMADKYGAVFSVRLGLKRAVVVSSWQ  92

Query  249  LAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQ  70
            +AKE  T+HD+ ++SRP+   ++ LGYN  M +F+P+G YWRE+RK+ + ELLSNRR+E 
Sbjct  93   MAKECFTTHDLALASRPQLVISKQLGYNDAMFAFSPHGAYWREVRKIATLELLSNRRLEL  152

Query  69   LKHIRVAEIETSVKEL  22
            LK++R++E+ET +KEL
Sbjct  153  LKNVRISEVETCMKEL  168



>ref|XP_007151145.1| hypothetical protein PHAVU_004G021600g [Phaseolus vulgaris]
 gb|ESW23139.1| hypothetical protein PHAVU_004G021600g [Phaseolus vulgaris]
Length=530

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            GK+K  P   GAWPILGHL L  GSK PH  LG +ADKYG IFTI++G  K L+I++W++
Sbjct  34   GKKKEAPTVAGAWPILGHLPLLSGSKTPHRTLGALADKYGPIFTIQLGSKKALIINNWEI  93

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T+ D+ +SSRPK  A++ +GYN+ M  FAPYGPYWRE+RK+T+ E+LS R +EQL
Sbjct  94   AKECFTTIDMVVSSRPKILASELMGYNHAMFGFAPYGPYWRELRKITTLEILSPRPVEQL  153

Query  66   KHIRVAEIETSVKELQD  16
            +H+RV+E++  +KEL D
Sbjct  154  QHVRVSELQNWIKELYD  170



>ref|XP_007217488.1| hypothetical protein PRUPE_ppa027160mg [Prunus persica]
 gb|EMJ18687.1| hypothetical protein PRUPE_ppa027160mg [Prunus persica]
Length=522

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PP+  G WP+LGHL LF GS+LPH+AL  +A KYG IFT++IG+H  LVIS W+ AK+  
Sbjct  40   PPKVEGGWPLLGHLDLFGGSQLPHIALASLAGKYGPIFTVKIGIHSALVISTWEAAKDCF  99

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D+ +SSRP     +HL YNY M  F+PYG YWRE+RKLTS ELLSNRR+E L+++R 
Sbjct  100  TTNDIAVSSRPARLGIKHLSYNYAMFGFSPYGTYWREIRKLTSLELLSNRRLELLRNVRA  159

Query  51   AEIETSVKEL  22
            +E+E S+KEL
Sbjct  160  SEVEMSLKEL  169



>gb|KCW45363.1| hypothetical protein EUGRSUZ_L00956 [Eucalyptus grandis]
Length=522

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            + KL PEA G WP+ GHL+L  G +LPH ALGD+ADKYG IF IR+GVH  LV+  W+ A
Sbjct  13   EAKLAPEAAGKWPLFGHLHLLAGPRLPHEALGDLADKYGPIFRIRVGVHPALVVCSWEAA  72

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T HDV +SSRPK  + + LGYNY    FAPYGP+WREMRK+T+ ELLSNRR+E L 
Sbjct  73   KECFTVHDVVVSSRPKLISGKLLGYNYANFGFAPYGPFWREMRKVTALELLSNRRLELLS  132

Query  63   HIRVAEIETSVKELQDR  13
            HIR +E+   +K +  R
Sbjct  133  HIRESEMGIWMKAMYRR  149



>ref|XP_003554859.1| PREDICTED: cytochrome P450 82A4-like [Glycine max]
 gb|KHN19616.1| Cytochrome P450 82A4 [Glycine soja]
Length=528

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            ++K  P   GAWPILGHL L   SK PH  LG +ADKYG IFTI++G  K LVIS+W++A
Sbjct  34   RKKEAPTVSGAWPILGHLLLLSSSKAPHRVLGALADKYGPIFTIKLGAKKALVISNWEIA  93

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D+ +SSRP+  AA+++GYN+ ++ F+PYGPYWRE+RK+T+ E+L++RR+EQL+
Sbjct  94   KECFTTNDIVVSSRPRLVAAENMGYNHAILGFSPYGPYWRELRKITTLEILTSRRVEQLQ  153

Query  63   HIRVAEIETSVKELQD  16
            H+RV+E+++S+KEL D
Sbjct  154  HVRVSEVQSSIKELFD  169



>ref|XP_010040234.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=543

 Score =   171 bits (432),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            + KL PEA G WP+ GHL+L  G +LPH ALGD+ADKYG IF IR+GVH  LV+  W+ A
Sbjct  34   EAKLAPEAAGKWPLFGHLHLLAGPRLPHEALGDLADKYGPIFRIRVGVHPALVVCSWEAA  93

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T HDV +SSRPK  + + LGYNY    FAPYGP+WREMRK+T+ ELLSNRR+E L 
Sbjct  94   KECFTVHDVVVSSRPKLISGKLLGYNYANFGFAPYGPFWREMRKVTALELLSNRRLELLS  153

Query  63   HIRVAEIETSVKELQDR  13
            HIR +E+   +K +  R
Sbjct  154  HIRESEMGIWMKAMYRR  170



>emb|CAN76287.1| hypothetical protein VITISV_027433 [Vitis vinifera]
Length=538

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 108/136 (79%), Gaps = 1/136 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSK-LPHVALGDMADKYGLIFTIRIGVHKVLVISDWK  250
            GK ++ PEA GAWPI+GHL+L  GSK LPH+  G MADKYG +F+IR+G+ + + +S W+
Sbjct  22   GKSRMAPEASGAWPIIGHLHLLGGSKNLPHLLFGTMADKYGPVFSIRLGLKRAVXVSSWE  81

Query  249  LAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQ  70
            +AKE  T+HD+ ++SRP+  AA++LGYNY M   +P+G YWRE+RK+ + ELLSNRR+E 
Sbjct  82   MAKECFTTHDLALASRPZLVAAKYLGYNYXMFXXSPHGAYWREVRKIATLELLSNRRLEL  141

Query  69   LKHIRVAEIETSVKEL  22
            LK++R++E+ET +KEL
Sbjct  142  LKNVRISEVETCMKEL  157



>gb|KDO40892.1| hypothetical protein CISIN_1g009347mg [Citrus sinensis]
Length=537

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 107/137 (78%), Gaps = 3/137 (2%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLP-HVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            K++ PPEAGGAWP++GHL+L    + P H  LGDMADKYG IFTIR+GVH+ LV+S+W++
Sbjct  37   KKRGPPEAGGAWPVIGHLHLL--GRFPLHRVLGDMADKYGPIFTIRMGVHRALVVSNWEM  94

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T+HD   +SRPK   A+ LG+N+ M  F+PYGP+WR++RK+ + ELLSN R+E+L
Sbjct  95   AKECLTTHDRVFASRPKALVAEILGFNFSMFGFSPYGPHWRQIRKIATLELLSNHRLEKL  154

Query  66   KHIRVAEIETSVKELQD  16
            KH+R  E++T +KEL D
Sbjct  155  KHVREGEVKTCLKELYD  171



>ref|XP_008228483.1| PREDICTED: cytochrome P450 CYP82D47-like [Prunus mume]
Length=522

 Score =   169 bits (429),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PP+  G WP+LGHL LF GS+LPH+AL  +  KYG IFT+ IG+H  LVIS W+ AK+  
Sbjct  40   PPKVEGGWPLLGHLDLFGGSQLPHIALASLVGKYGPIFTVNIGMHSALVISTWEAAKDCF  99

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D+ +SSRP     +HL YN+ M  F+PYGPYWRE+RKLTS ELLSNRR+E L+++R 
Sbjct  100  TTNDIAVSSRPARLGIKHLSYNFAMFGFSPYGPYWREIRKLTSLELLSNRRLELLRNVRA  159

Query  51   AEIETSVKEL  22
            +E+E S+KEL
Sbjct  160  SEVEMSLKEL  169



>ref|XP_009364178.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=524

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 99/130 (76%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPEA GAWPILGHL L  GS  PH+ LG MADKYG IFTIRIGV+  LVIS  ++AKE  
Sbjct  37   PPEAKGAWPILGHLSLLGGSTPPHITLGAMADKYGPIFTIRIGVYPSLVISSSEIAKECF  96

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D+ ++SRPK  A +H+GYNY M  F P GPYWRE+RK+ + ELLS R++E LKHIRV
Sbjct  97   TTNDLSLNSRPKMAAVEHIGYNYAMFGFGPSGPYWREIRKIVTLELLSIRKVELLKHIRV  156

Query  51   AEIETSVKEL  22
             E+ T ++EL
Sbjct  157  LEVTTFLEEL  166



>ref|XP_007151146.1| hypothetical protein PHAVU_004G021700g [Phaseolus vulgaris]
 gb|ESW23140.1| hypothetical protein PHAVU_004G021700g [Phaseolus vulgaris]
Length=524

 Score =   169 bits (428),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            + K  P   GAWPILGHL L  GSK PH  LG +ADKYG IFTI+IG  K L+I++W++A
Sbjct  33   QSKEAPTVAGAWPILGHLPLLSGSKTPHRTLGALADKYGPIFTIKIGSKKALIINNWEIA  92

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T+ D+ +SSRPK  A++ +GYN+ M  FAPYGPYWRE+RK+T+ E+L+ RR+EQL+
Sbjct  93   KECFTTIDMVVSSRPKLLASELMGYNHAMFGFAPYGPYWRELRKITTLEILTTRRVEQLQ  152

Query  63   HIRVAEIETSVKELQD  16
            H+RV+E++  +K+L +
Sbjct  153  HVRVSELQNWIKQLYN  168



>ref|XP_007017407.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY14632.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   169 bits (428),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+A GAWP++GHL L  G +LPHV LG +A+KYG +++IRIG+H  LV+S W++AKE+ T
Sbjct  38   PQAAGAWPVIGHLRLLGGPQLPHVTLGALAEKYGPVYSIRIGIHPGLVVSSWEIAKEIYT  97

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            ++DV +++RP+  AA+HLG+NY M   APYG YWREMRK+ +  LLSNRR+E LK +RV+
Sbjct  98   NYDVAVTNRPRMIAAEHLGFNYAMAGVAPYGSYWREMRKIINFALLSNRRLEILKQVRVS  157

Query  48   EIETSVKEL  22
            E + SVKEL
Sbjct  158  EAQVSVKEL  166



>ref|XP_011039260.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=528

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+AGGAWPI+GH++LF G +L H  LG MADKYG +FTI++G H+VLV++ W++A++  T
Sbjct  42   PQAGGAWPIIGHMHLFGGKQLTHKILGAMADKYGPVFTIKLGSHRVLVVNSWEMARDCFT  101

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   SSRP   A++ LGY+  M  FAPYGPYWREMRK+T+ ELLS+ RI+ L+HIR +
Sbjct  102  VHDRAFSSRPSIAASKLLGYDLAMFGFAPYGPYWREMRKITTIELLSSHRIDMLRHIRAS  161

Query  48   EIETSVKEL  22
            E+ET++++L
Sbjct  162  EVETAIRDL  170



>ref|XP_003618361.1| Cytochrome P450 [Medicago truncatula]
 gb|AES74579.1| cytochrome P450 family protein [Medicago truncatula]
Length=533

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K K  P A GAWPILGHL LFRG++ PH  LG +ADKYG +FTI++G    L++++W++A
Sbjct  36   KNKEAPIAEGAWPILGHLSLFRGTQSPHRVLGTLADKYGPLFTIKLGTKHALILNNWEMA  95

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D  +SSRPK  A +HLGYN  M   APYGPYWR++RK+ + E+L+NRR++Q +
Sbjct  96   KECFTTNDTVVSSRPKLVATEHLGYNGAMFGLAPYGPYWRQLRKIVTLEVLTNRRVKQQQ  155

Query  63   HIRVAEIETSVKEL  22
            H+RV E++ S+KEL
Sbjct  156  HVRVPEVQASIKEL  169



>ref|XP_003527704.1| PREDICTED: cytochrome P450 82A1-like [Glycine max]
Length=535

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K PPEA GAWP++GHL+LF  SK PHV LG+MADKYG IFT+R+GVHK LV+S+W++AK+
Sbjct  43   KSPPEASGAWPLIGHLHLFGASKPPHVTLGNMADKYGPIFTLRLGVHKTLVVSNWEMAKQ  102

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
              T +D   +SRPK  A + LGYN+ M+ F+PYG YWR +RK+ + ELLS+ RI+ +KH+
Sbjct  103  CFTVNDKAFASRPKSVAFEVLGYNFSMIGFSPYGSYWRHVRKIATLELLSSHRIDMIKHV  162

Query  57   RVAEIETSVKELQD  16
              +E++ +VKE+ D
Sbjct  163  MESEVKAAVKEIYD  176



>ref|XP_003618345.1| Cytochrome P450 [Medicago truncatula]
 gb|AES74563.1| cytochrome P450 family protein [Medicago truncatula]
Length=524

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K + PP A GAWPILGHL +  GSK PH  LG MA+KYG +FTI++G ++ LV+S+W++
Sbjct  34   NKGREPPMASGAWPILGHLLVLGGSKTPHKTLGTMANKYGPLFTIKLGTNRALVLSNWEM  93

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T +DV +SSR K  A +H+ YN     FAPYGPYWREMRK+ S   LSNRR+EQL
Sbjct  94   AKECYTINDVAVSSRSKLVAIEHIAYNQASFGFAPYGPYWREMRKIVSI-FLSNRRMEQL  152

Query  66   KHIRVAEIETSVKEL  22
             H+RV E++TS+KEL
Sbjct  153  SHVRVTEVKTSIKEL  167



>ref|XP_010106083.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07353.1| Cytochrome P450 82A3 [Morus notabilis]
Length=528

 Score =   168 bits (425),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            GK K PPEA G WP+ GHL L +G K  H+ LG MAD  G IFTIRIG H+ LV+S  ++
Sbjct  36   GKGKAPPEALGGWPLFGHLSLLKGPKPSHINLGAMADICGPIFTIRIGSHRGLVVSSSEM  95

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            A+E  T++D+ ++SRP   AA+H+GYNY M +FAP+GP+WRE+RK+ + ELLSNRR+E L
Sbjct  96   ARECFTTNDLALASRPNLLAAKHIGYNYAMFAFAPHGPFWREIRKIATVELLSNRRLELL  155

Query  66   KHIRVAEIETSVKEL  22
            KHIR++E+   VKEL
Sbjct  156  KHIRISEVAAFVKEL  170



>ref|XP_010092357.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXB51033.1| Cytochrome P450 82A3 [Morus notabilis]
Length=534

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            +K PPEA G WPI+GHL+L  GS+LPH+ L ++ADK G IFT+RIG H  LV+S  ++AK
Sbjct  38   RKSPPEAAGRWPIIGHLHLLGGSQLPHITLANLADKCGPIFTVRIGSHPGLVVSSSEMAK  97

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            E  T +D+ ++SRP   AA+H+GYNY M   AP+GP+WRE+RK+ + +LLSNRR+E LKH
Sbjct  98   ECFTINDLALASRPNLLAAKHMGYNYAMFGLAPHGPFWREIRKIATVQLLSNRRLELLKH  157

Query  60   IRVAEIETSVKEL  22
            IR++E+ + VKEL
Sbjct  158  IRISEVASFVKEL  170



>ref|XP_006432712.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
 ref|XP_006471502.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45952.1| hypothetical protein CICLE_v10000809mg [Citrus clementina]
Length=537

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 106/135 (79%), Gaps = 3/135 (2%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLP-HVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            K++ PPEAGGAWP++GHL+L    + P H  LGDMADKYG IFTIR+GVH+ LV+S+W++
Sbjct  37   KKRGPPEAGGAWPVIGHLHLL--GRFPLHRVLGDMADKYGPIFTIRMGVHRALVVSNWEM  94

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T+HD   +SRPK   A+ LG+N+ M  F+PYGP+WR++RK+ + ELLSN R+E+L
Sbjct  95   AKECLTTHDRVFASRPKALVAEILGFNFSMFGFSPYGPHWRQIRKIATLELLSNHRLEKL  154

Query  66   KHIRVAEIETSVKEL  22
            KH+R  E++T +KEL
Sbjct  155  KHVREGEVKTCLKEL  169



>gb|KHN34164.1| Cytochrome P450 82A4 [Glycine soja]
Length=525

 Score =   167 bits (424),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            +K  P+  GAWPILGHL L  GS+ PH  L  +ADKYG IFTI  GV K LVIS+W++AK
Sbjct  35   KKEAPKVAGAWPILGHLPLLSGSETPHKVLDALADKYGPIFTINYGVKKALVISNWEIAK  94

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            E  T +D+ +SSRPK  A + + YN  M  FAPYGPYWRE+RK+ + E+LSNRR+EQL++
Sbjct  95   ECFTKNDIVVSSRPKLLAIELMCYNQAMFGFAPYGPYWRELRKIVNLEILSNRRVEQLEN  154

Query  60   IRVAEIETSVKEL  22
            +RV+E+++S+KEL
Sbjct  155  VRVSEVQSSIKEL  167



>gb|KDP38427.1| hypothetical protein JCGZ_04352 [Jatropha curcas]
Length=520

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K+   P+AGGAWPI+GHL L  GSKL H+  G +AD+YG IFT++IG+H+ +V+S  +LA
Sbjct  36   KKTRAPKAGGAWPIIGHLPLLAGSKLLHITFGSLADRYGPIFTMQIGIHQAVVVSSGELA  95

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KEL T++D+ +S RP F A ++LGY+ +M +FAPYG YWREMRK+ S +LLSN +IE LK
Sbjct  96   KELFTTNDMAVSERPNFTAFKYLGYDGVMFAFAPYGDYWREMRKIISLKLLSNHQIELLK  155

Query  63   HIRVAEIETSVKEL  22
            H+R++EIET +KEL
Sbjct  156  HVRLSEIETLLKEL  169



>ref|NP_001240972.1| cytochrome P450 82A3 [Glycine max]
 sp|O49858.1|C82A3_SOYBN RecName: Full=Cytochrome P450 82A3; AltName: Full=Cytochrome 
P450 CP6 [Glycine max]
 emb|CAA71876.1| putative cytochrome P450 [Glycine max]
 gb|KHN13273.1| Cytochrome P450 82A3 [Glycine soja]
Length=527

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            + K  P   GAWPILGHL L  GS+ PH  LG +ADKYG +FTI++G+   LV+S+W+++
Sbjct  34   RGKDAPVVSGAWPILGHLSLLNGSQTPHKVLGALADKYGPLFTIKLGMKPALVLSNWEMS  93

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KEL T++D+ +SSRPK  A + + YN   V  APYGPYWRE+RK+ + E LSNRRIEQ  
Sbjct  94   KELFTTNDLAVSSRPKLVAVEVMSYNQAFVGLAPYGPYWRELRKIVTFEFLSNRRIEQRN  153

Query  63   HIRVAEIETSVKELQD  16
            HIRV+E+ TS+KEL D
Sbjct  154  HIRVSEVRTSIKELFD  169



>ref|XP_003554118.2| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=548

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            +K  P+  GAWPILGHL L  GS+ P   LG +ADKYG IFTI  GV K LVIS+W++AK
Sbjct  58   KKEAPKVAGAWPILGHLPLLSGSETPDRVLGALADKYGPIFTINYGVKKALVISNWEIAK  117

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            E  T +D+ +SSRPK  A + + YN  M  FAPYGPYWRE RK+T+ E+L++RR+EQL+H
Sbjct  118  ECFTKNDIVVSSRPKLLAIELMCYNQAMFGFAPYGPYWREQRKITTLEILTSRRVEQLQH  177

Query  60   IRVAEIETSVKEL  22
            +RV+E+++S+KEL
Sbjct  178  VRVSEVQSSIKEL  190



>ref|XP_007017417.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
 gb|EOY14642.1| Cytochrome P450 82A3, putative isoform 2 [Theobroma cacao]
Length=528

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            G ++  PEA GA P LGHL+L  GSK  HV LGD+AD YG IFTIR+GV   LV+S+W++
Sbjct  36   GMKRKAPEASGARPFLGHLHLLGGSKPAHVVLGDLADTYGPIFTIRLGVRLTLVVSNWEI  95

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D   ++RP+  AA+ LGYNY M  F+PYGPYWR++RK+ + E+LSN R+E+L
Sbjct  96   AKECFTTNDKAFANRPRTLAAELLGYNYAMFGFSPYGPYWRQIRKIVTLEVLSNHRLEKL  155

Query  66   KHIRVAEIETSVKEL  22
            KHIR +E+ TS+KEL
Sbjct  156  KHIRESEVRTSIKEL  170



>ref|XP_003554125.1| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=525

 Score =   167 bits (422),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            +K  P+  GAWPILGHL L  GS+ P   LG +ADKYG IFTI  GV KVLVIS+W++AK
Sbjct  35   KKEAPKVAGAWPILGHLPLLSGSETPDRVLGALADKYGPIFTINNGVKKVLVISNWEIAK  94

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            E  T +D+ +SSRPK    + + YN  M  FAPYGPYWRE+RK+ + E+LSNRR+EQL++
Sbjct  95   ECFTKNDIVVSSRPKLLGIELMCYNQAMFGFAPYGPYWRELRKIVNLEILSNRRVEQLEN  154

Query  60   IRVAEIETSVKEL  22
            +RV+E+++S+KEL
Sbjct  155  VRVSEVQSSIKEL  167



>gb|KHG08974.1| Cytochrome P450 [Gossypium arboreum]
Length=358

 Score =   163 bits (413),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 102/129 (79%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+AGGA PI+GH++LF G +L H  LG MA KYG +F++R+G H+VLV++ W++AKE  T
Sbjct  38   PQAGGALPIIGHMHLFGGQQLTHKTLGGMAAKYGPVFSLRLGSHEVLVLNSWEMAKECFT  97

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   S+RP   A++ LGY++ M  FAPYGPYWRE+RK+T+ ELLSN RI+ LKHIRV+
Sbjct  98   VHDKVFSTRPIITASKILGYDFAMFGFAPYGPYWREIRKITTIELLSNHRIDMLKHIRVS  157

Query  48   EIETSVKEL  22
            E++++++EL
Sbjct  158  EVKSAIREL  166



>ref|XP_007047111.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX91268.1| Cytochrome P450 [Theobroma cacao]
Length=529

 Score =   166 bits (421),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PP+AGGA P++GH++L  G +L H  LG MADKYG +F+IR+G H+VLV++ W++AKE  
Sbjct  40   PPQAGGALPVIGHMHLLGGQQLTHKTLGAMADKYGPVFSIRLGSHRVLVLNSWEMAKECF  99

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T HD   S+RP   A++HLGY++ M  FAPYG YWREMRK+ + ELLS+ RI+ LKHIR 
Sbjct  100  TVHDKVFSTRPSIAASKHLGYDFAMFGFAPYGSYWREMRKIATIELLSSHRIDMLKHIRA  159

Query  51   AEIETSVKEL  22
            +E++T+++EL
Sbjct  160  SEVKTAIREL  169



>ref|XP_006486179.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=528

 Score =   166 bits (421),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            PEAGGAWP++GHL++ RGS+  H  LG+MADKYG IFT+++GV + LV+S+W++AKE  T
Sbjct  47   PEAGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFT  106

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            ++D   + RPK  A + LGYN+L++ FAPYG YWR+ RK+ + ELLSNRR+E+LKH+R +
Sbjct  107  TNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRES  166

Query  48   EIETSVKEL  22
            E++ S++ L
Sbjct  167  EVKASIQRL  175



>ref|XP_007151148.1| hypothetical protein PHAVU_004G021900g [Phaseolus vulgaris]
 gb|ESW23142.1| hypothetical protein PHAVU_004G021900g [Phaseolus vulgaris]
Length=545

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/136 (54%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            + K  P   GAWPILGHL L  GSK PH  LG +ADKYG IFTI++G  + LVI++W+ A
Sbjct  50   QTKEAPTVAGAWPILGHLPLLTGSKRPHRTLGALADKYGPIFTIQLGSKRALVINNWETA  109

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D+ +SSRPK  AA+ +GYN+ M+ FAPYGPYWRE+RK+ + E+L+ RR+EQL+
Sbjct  110  KECFTTNDMAVSSRPKLVAAELMGYNHAMLVFAPYGPYWRELRKILTLEILTTRRVEQLQ  169

Query  63   HIRVAEIETSVKELQD  16
            H+RV+E++  +K+L +
Sbjct  170  HVRVSELQNWIKQLYN  185



>ref|XP_006435903.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
 gb|ESR49143.1| hypothetical protein CICLE_v10031215mg [Citrus clementina]
Length=528

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 103/129 (80%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            PEAGGAWP++GHL++ RGS+  H  LG+MADKYG IFT+++GV + LV+S+W++AKE  T
Sbjct  47   PEAGGAWPLIGHLHILRGSEPAHRVLGNMADKYGPIFTMKLGVKQALVVSNWEIAKECFT  106

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            ++D   + RPK  A + LGYN+L++ FAPYG YWR+ RK+ + ELLSNRR+E+LKH+R +
Sbjct  107  TNDKAFAGRPKTMATELLGYNFLVIGFAPYGNYWRQSRKIATIELLSNRRLEKLKHVRES  166

Query  48   EIETSVKEL  22
            E++ S++ L
Sbjct  167  EVKASIQRL  175



>ref|XP_007133366.1| hypothetical protein PHAVU_011G173200g [Phaseolus vulgaris]
 gb|ESW05360.1| hypothetical protein PHAVU_011G173200g [Phaseolus vulgaris]
Length=527

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 102/136 (75%), Gaps = 1/136 (1%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            + K  P   GAWP+LGHL L  GSK PH  LG +ADKYG IFTI++G  K LVI++W++A
Sbjct  33   QTKEAPTVAGAWPVLGHLPLLSGSKRPHRTLGALADKYGPIFTIQLGSKKALVINNWEMA  92

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D+ +SSRPK  A + +GYN  M  F PYGPYWRE+RK+ + E+L+ RR+EQL+
Sbjct  93   KECFTTNDMAVSSRPKLIAIELMGYNA-MFGFVPYGPYWRELRKIVTLEILTTRRVEQLQ  151

Query  63   HIRVAEIETSVKELQD  16
            H+RV+E++ S+KEL D
Sbjct  152  HVRVSELQNSIKELHD  167



>ref|XP_008236910.1| PREDICTED: cytochrome P450 CYP82D47-like [Prunus mume]
Length=540

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K++ PP+A GAWP++GHL    G + PH++LG+MADKYG IFTI++GVH+ LV+S+W+ 
Sbjct  38   AKKRAPPKAPGAWPLIGHLPYLGGPRPPHISLGNMADKYGPIFTIKLGVHRALVVSNWET  97

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D + ++RPKF AA+ +GY+Y M  F+PYGPYWR+MRK+ + ELLSN R+E L
Sbjct  98   AKEFFTTNDKNFATRPKFLAAEIMGYDYAMFGFSPYGPYWRQMRKIATVELLSNHRLELL  157

Query  66   KHIRVAEIETSVKELQD  16
            K +   E++   K + D
Sbjct  158  KRVLEYEVQACTKHIYD  174



>gb|AII31759.1| cytochrome P450 monooxygenase [Gossypium hirsutum]
Length=522

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K PP A GAWPI+GHL L  G K PH ALGD+ +KYG  + IRIGVH  LV++  ++AKE
Sbjct  36   KAPPVAAGAWPIIGHLPLLGGPKAPHEALGDLEEKYGPAYMIRIGVHPALVVNSSEVAKE  95

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
            + T +D+H+SSR +F AA+HLGYNY M  F+PYG YWREMRK+T  E+LSN RI+QLK +
Sbjct  96   IFTVNDMHVSSRSEFAAAEHLGYNYAMFGFSPYGQYWREMRKITMLEVLSNHRIDQLKKV  155

Query  57   RVAEIETSVKEL  22
             V+EIE S+K L
Sbjct  156  FVSEIEGSMKLL  167



>ref|XP_009336448.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPEA G WPI GHL+LF GS  PH+ LG MADKYG IFTIR+GVH  LVIS  ++AKE  
Sbjct  39   PPEAKGGWPIFGHLHLFGGSTPPHITLGAMADKYGPIFTIRLGVHPSLVISSSEIAKECY  98

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T+ D+ + SRPK     H+ YNY M  F P GPYWRE+RK+ + ELLS R++E LKH+RV
Sbjct  99   TTKDLSVLSRPKMVVVDHVSYNYAMFGFGPPGPYWREIRKIVTLELLSVRKVELLKHVRV  158

Query  51   AEIETSVKELQD  16
            +E+ T +KEL +
Sbjct  159  SEVATFLKELHE  170



>ref|XP_006375023.1| hypothetical protein POPTR_0014s03670g, partial [Populus trichocarpa]
 gb|ERP52820.1| hypothetical protein POPTR_0014s03670g, partial [Populus trichocarpa]
Length=216

 Score =   159 bits (401),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K++ PPEA GAWP++GHL+L  GS+ PH+ LG++ADKYG IFT+++GVH+ L++S+W++
Sbjct  27   SKKRAPPEAAGAWPLIGHLHLLGGSQPPHITLGNLADKYGPIFTVKLGVHRTLIVSNWEM  86

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE   ++D   ++RPK  A   LGYNY ++SF+PYG YWR +RK+ + E+LSN R+E L
Sbjct  87   AKECLRTNDKAFATRPKTLAMDILGYNYSILSFSPYGTYWRLIRKIVTLEVLSNHRLEML  146

Query  66   KHIRVAEIETSVKELQDRILG  4
            K++R  E+  +V  L  + +G
Sbjct  147  KNVREDEVRDAVGALYQQWIG  167



>ref|XP_006375031.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
 gb|ERP52828.1| hypothetical protein POPTR_0014s03760g [Populus trichocarpa]
Length=538

 Score =   166 bits (419),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            GK+K  P+AGGAWP++GHL+L  G++ PH  LG+MA+KYG IFTI++GVH+ LV+S+W+ 
Sbjct  40   GKKKAAPKAGGAWPVIGHLHLLGGAEPPHKVLGNMAEKYGPIFTIKMGVHRALVVSNWET  99

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T+HD   S RP+  A++ L Y+  MV F+PYGPYWR++RK+T+ ELLSN R+E+L
Sbjct  100  AKECFTTHDKAFSGRPRTLASELLTYDGAMVGFSPYGPYWRQVRKITTVELLSNYRLEKL  159

Query  66   KHIRVAEIETSVKEL  22
            K +R +E+   +KEL
Sbjct  160  KDVRESEVRAFLKEL  174



>ref|XP_007216265.1| hypothetical protein PRUPE_ppa017300mg [Prunus persica]
 gb|EMJ17464.1| hypothetical protein PRUPE_ppa017300mg [Prunus persica]
Length=522

 Score =   165 bits (418),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 97/130 (75%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            P +  G WP+LGHL LF GS+LPH+AL  +  KYG IFT+ IG+H  LVIS W+ AK+  
Sbjct  40   PSKVEGGWPLLGHLDLFGGSQLPHIALASLVGKYGPIFTVNIGIHSALVISTWEAAKDCF  99

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
             ++D+ +SSRP     +HL YN+ M  F+PYGPYWRE+RKLTS ELLSNRR+E L+++R 
Sbjct  100  ITNDIAVSSRPATLGIKHLSYNFAMFGFSPYGPYWREIRKLTSLELLSNRRLELLRNVRA  159

Query  51   AEIETSVKEL  22
            +E+E S+KEL
Sbjct  160  SEVEMSLKEL  169



>ref|XP_004489343.1| PREDICTED: cytochrome P450 82A3-like [Cicer arietinum]
Length=531

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K K  P A GAWPILGHL +F G + PH  LG +ADKYG IFTI++G    +V+++W+L
Sbjct  34   SKNKEAPIAKGAWPILGHLSIFSGKQPPHRVLGTLADKYGPIFTIKLGSKHAIVLNNWEL  93

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T +D+ +SSRP   + +HL Y   M +F PY PYWRE+RK+ + E+LSNRR+EQ 
Sbjct  94   AKECFTKNDMIVSSRPNLDSTEHLAYKGAMFAFGPYNPYWREIRKIATLEILSNRRVEQQ  153

Query  66   KHIRVAEIETSVKELQD  16
            +H+RV+E++TS+KEL D
Sbjct  154  QHVRVSEVQTSIKELFD  170



>ref|XP_007017416.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
 gb|EOY14641.1| Cytochrome P450 82A3, putative isoform 1 [Theobroma cacao]
Length=798

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 103/135 (76%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            G ++  PEA GA P LGHL+L  GSK  HV LGD+AD YG IFTIR+GV   LV+S+W++
Sbjct  306  GMKRKAPEASGARPFLGHLHLLGGSKPAHVVLGDLADTYGPIFTIRLGVRLTLVVSNWEI  365

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D   ++RP+  AA+ LGYNY M  F+PYGPYWR++RK+ + E+LSN R+E+L
Sbjct  366  AKECFTTNDKAFANRPRTLAAELLGYNYAMFGFSPYGPYWRQIRKIVTLEVLSNHRLEKL  425

Query  66   KHIRVAEIETSVKEL  22
            KHIR +E+ TS+KEL
Sbjct  426  KHIRESEVRTSIKEL  440


 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++  PEAG +WP++GHL+L  G + PH+ LGDMA+KYG IFTI++GV++ LV+++W+ A
Sbjct  181  KKRAAPEAGSSWPVIGHLHLLGGPQPPHIVLGDMAEKYGSIFTIKMGVYRALVVNNWETA  240

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFA  145
            KE  T++D   +SRPK  A + L + + MV F 
Sbjct  241  KECLTTNDKAFASRPKTLAMEFLSFEHTMVGFT  273


 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            PE  GA P LGHL L  GSK   V LGD+AD YG IFTIR+G+   LV+S+W++AKE  T
Sbjct  6    PEVSGARPFLGHLQLLGGSKPAQVVLGDLADTYGPIFTIRLGMQSTLVVSNWEMAKECFT  65

Query  228  SHDVHISSRPKFRAAQHLGYNYLMV  154
            ++     +RP+  AA+ LGYNY M+
Sbjct  66   TNHKAFVNRPRTLAAELLGYNYAMM  90



>gb|KHN16362.1| Cytochrome P450 82A3 [Glycine soja]
Length=527

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            + K  P   GAWPILGHL L  GS+ PH  +G +ADKYG +FTI++GV   LV+S+W+++
Sbjct  34   RGKDAPVVAGAWPILGHLSLLNGSQAPHKMMGTLADKYGPLFTIKLGVKPALVLSNWEMS  93

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KEL T++D+ +SSRPK  A + + YN   V  APYGPYWRE+RK+ + E LSNRRIEQ  
Sbjct  94   KELFTTNDLAVSSRPKLVAVEVMSYNQAFVGLAPYGPYWRELRKIVTFEFLSNRRIEQRS  153

Query  63   HIRVAEIETSVKEL  22
            HIRV+E+ TS++EL
Sbjct  154  HIRVSEVRTSIREL  167



>gb|KHG24650.1| Cytochrome P450 protein [Gossypium arboreum]
Length=509

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+AGGA PI+GH++LF G +L H  LG MADKYG +F IR+G H VLV++ W++AKE  T
Sbjct  21   PQAGGALPIIGHMHLFGGQQLTHKTLGGMADKYGPVFCIRLGSHDVLVLNSWEMAKECFT  80

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   S+RP   A++ LGY++ M  FAPYG YWREMRK+ + ELLS+ RI+ LKHIRV+
Sbjct  81   VHDKVFSTRPNIAASKLLGYDFAMFGFAPYGSYWREMRKIATIELLSSNRIDMLKHIRVS  140

Query  48   EIETSVKEL  22
            E++T+V+EL
Sbjct  141  EVKTAVREL  149



>ref|XP_003611841.1| Cytochrome P450 82A3 [Medicago truncatula]
 gb|AES94799.1| cytochrome P450 family protein [Medicago truncatula]
Length=320

 Score =   160 bits (406),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            + K  P+AGGAWPI+GHL+LF   +L H  LG MADK+G IFTI++G +KVLV+S  ++A
Sbjct  36   RHKTAPQAGGAWPIIGHLHLFGSKQLTHKTLGMMADKHGPIFTIKLGSYKVLVLSSSEMA  95

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T HD   S+RP   A++ +GYNY M  F PYGPYWRE+RKL + ELLSN R+E LK
Sbjct  96   KECFTLHDKTFSTRPLVAASKLMGYNYAMFGFTPYGPYWREIRKLATLELLSNHRLELLK  155

Query  63   HIRVAEIETSVKELQD--RILGC  1
              RV+EIE +V EL     I GC
Sbjct  156  DTRVSEIEAAVSELYRLWSIKGC  178



>ref|XP_004291926.1| PREDICTED: cytochrome P450 82A3-like [Fragaria vesca subsp. vesca]
Length=538

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
              +K  PEA GAWP++GHL L  GS  PH+ LG+MADKYG +FTI++GVH+ L++S W +
Sbjct  38   ATKKGAPEAAGAWPLVGHLPLLGGSLPPHITLGNMADKYGPVFTIKLGVHRSLIVSSWDM  97

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D   ++RPK   ++ +GYNY M  F+PYGPYWR+MRK+ + ELLSN R+E L
Sbjct  98   AKECLTTNDRVFANRPKLLVSEVMGYNYAMFGFSPYGPYWRQMRKVATLELLSNHRLESL  157

Query  66   KHIRVAEIETSVKELQD  16
             H+R +E++T +K + +
Sbjct  158  NHVRESEVKTCIKNIYN  174



>gb|KEH37856.1| cytochrome P450 family protein [Medicago truncatula]
Length=524

 Score =   164 bits (416),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 103/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLP-HVALGDMADKYGLIFTIRIGVHKVLVISDWK  250
             + KLPP A G WP++GHL+L   S  P ++ LGD+ADKYG IFT+R+GVH  +V+S W+
Sbjct  33   AQPKLPPLASGGWPLIGHLHLLGSSNQPPYITLGDLADKYGPIFTLRVGVHNAVVVSTWE  92

Query  249  LAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQ  70
            LAKE+ T+HDV ISSRPKF AA+ LG++Y    F+PYG YW+ MRK+T+SELLS RR E 
Sbjct  93   LAKEIFTTHDVIISSRPKFTAAKILGHDYANFGFSPYGDYWQMMRKVTASELLSTRRFET  152

Query  69   LKHIRVAEIETSVKEL  22
            L+ IR +E++ S+ EL
Sbjct  153  LRDIRDSEVKKSLMEL  168



>gb|KHN19614.1| Cytochrome P450 82A4 [Glycine soja]
Length=520

 Score =   164 bits (415),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            +K  P+  GAWPILGHL L  GS+ PH  L  +ADKYG IFTI  GV KVLVIS+W++AK
Sbjct  35   KKEAPKVAGAWPILGHLPLLSGSETPHKVLDALADKYGPIFTINNGVKKVLVISNWEIAK  94

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            E  T++D+ +SSRPK  A + + YN  M  FAPYGPYWRE+RK+ + E+LSNRR+EQL++
Sbjct  95   ECFTTNDIVVSSRPKLLAIELMCYNQAMFGFAPYGPYWRELRKIVNLEILSNRRVEQLEN  154

Query  60   IRVAEIETSVKEL  22
            +RV+E+++ +K L
Sbjct  155  VRVSEVQSLIKGL  167



>gb|KDP38432.1| hypothetical protein JCGZ_04357 [Jatropha curcas]
Length=529

 Score =   164 bits (416),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 74/137 (54%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++LPPEA GAWPI+GHL+L  GS+  H+ LG++ADKYG IFTI++GV++ LV+S   +A
Sbjct  35   KKRLPPEAAGAWPIIGHLHLLAGSQPAHITLGNLADKYGPIFTIKLGVYRTLVVSSRAMA  94

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D   +SRPK  A + LGY+Y M+ F+PYG YWR+MRK+ + ELLSN R+E LK
Sbjct  95   KECLTTNDRAFASRPKGLAMEILGYDYSMLGFSPYGEYWRQMRKIVTLELLSNHRLEMLK  154

Query  63   HIRVAEIETSVKELQDR  13
            H+R AE++ ++K L  +
Sbjct  155  HVREAEVKMAIKALYQK  171



>ref|XP_010106082.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07352.1| Cytochrome P450 82A3 [Morus notabilis]
Length=532

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPEA G WPI+GHL+L  GS+LPH+ L ++ADK+G IFTIRIG ++ LV+S  ++AKE  
Sbjct  41   PPEAAGRWPIIGHLHLLGGSQLPHITLANLADKWGPIFTIRIGSYRGLVVSSSEMAKECF  100

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T +D+  +SRP   AA+HLGY Y M   AP+GP+WRE+RK+ + +LLSNRR+E LKHIR+
Sbjct  101  TINDLASASRPNLLAAKHLGYKYAMFGLAPHGPFWREIRKIATVQLLSNRRLELLKHIRI  160

Query  51   AEIETSVKEL  22
            +E+ + VKEL
Sbjct  161  SEVASFVKEL  170



>ref|XP_011030967.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            GK+K  P+AGGAWP++GHL+L  G++ PH  LG MA+KYG IFTI++GVH+ LV+S+W+ 
Sbjct  40   GKKKAAPKAGGAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWET  99

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T+HD   S RPK  A++ L Y+  M+ F+PYGPYWR++RK+T+ ELLSN R+E+L
Sbjct  100  AKECFTTHDKAFSGRPKTLASELLTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKL  159

Query  66   KHIRVAEIETSVKEL  22
            K +R +E+   +KEL
Sbjct  160  KDVRESEVRAFLKEL  174



>ref|XP_007151147.1| hypothetical protein PHAVU_004G021800g [Phaseolus vulgaris]
 gb|ESW23141.1| hypothetical protein PHAVU_004G021800g [Phaseolus vulgaris]
Length=524

 Score =   164 bits (415),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K  P   GAWPILGHL L  GSK PH  LG +A+KYG IFTI++G  K L+I++W++AKE
Sbjct  35   KEAPTVAGAWPILGHLPLLSGSKSPHRTLGALAEKYGPIFTIQLGSKKALIINNWEIAKE  94

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
              T+ D+ +SSRPK  A++ +GYN+ M  FAPYGPYWRE+RK+T+ E+L+ RR+EQL+H+
Sbjct  95   CFTTIDMVVSSRPKILASELMGYNHAMFGFAPYGPYWREIRKITTLEILTTRRVEQLQHV  154

Query  57   RVAEIETSVKELQD  16
            RV+E++  +K+L +
Sbjct  155  RVSELQNWIKQLYN  168



>gb|KHG29695.1| Cytochrome P450 [Gossypium arboreum]
Length=522

 Score =   164 bits (414),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K PP A GAWPI+GHL L  G K PH ALGD+ +KYG  + IRIGVH  LV++  ++AKE
Sbjct  36   KAPPVAAGAWPIIGHLPLLGGPKAPHEALGDLEEKYGPAYMIRIGVHPALVVNSSEVAKE  95

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
            + T +D+++SSR +F AA+HLGYNY M  F+PYG YWREMRK+T  E+LSN RI+QLK +
Sbjct  96   IFTVNDMYVSSRSEFAAAEHLGYNYAMFGFSPYGQYWREMRKITMLEVLSNHRIDQLKKV  155

Query  57   RVAEIETSVKEL  22
             V+EIE S+K L
Sbjct  156  FVSEIEGSMKLL  167



>ref|XP_008391540.1| PREDICTED: cytochrome P450 82A4-like [Malus domestica]
Length=531

 Score =   164 bits (415),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPEA G WPI GHL+LF G   PH+ LG MADKYG IFTIR+GV + LVIS  ++AKE  
Sbjct  44   PPEAKGGWPIFGHLHLFGGPTPPHITLGAMADKYGPIFTIRLGVQQSLVISSSEIAKECY  103

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D+ I  RP+   A H+ YNY M +FAP GPYWRE+RK+ + E+LS R++E LKHIRV
Sbjct  104  TTNDLSILGRPEMVVADHVTYNYAMFAFAPPGPYWREIRKIVTLEMLSVRKVELLKHIRV  163

Query  51   AEIETSVKELQD  16
            +E+ T +KEL +
Sbjct  164  SEVATFLKELHE  175



>gb|KHN44000.1| Cytochrome P450 82A4 [Glycine soja]
Length=523

 Score =   164 bits (414),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 102/137 (74%), Gaps = 0/137 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            G  K  P  GGAWPI GHL L  GSK PH ALG +A+K+G +FTI++GV K LV+SDW++
Sbjct  35   GSSKEAPTVGGAWPIFGHLPLLIGSKSPHKALGALAEKHGPLFTIKLGVKKALVVSDWEM  94

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            A+E  T++DV +S+RPK   A+ + YN  M+  APYGPYWRE+RK+  +E+LS+ R+EQL
Sbjct  95   ARECFTTNDVAVSARPKLLVAELMCYNNAMLLVAPYGPYWRELRKIIVTEILSSSRVEQL  154

Query  66   KHIRVAEIETSVKELQD  16
            + +RV+E++ S+ EL D
Sbjct  155  QDVRVSEVQNSIVELYD  171



>ref|XP_008388170.1| PREDICTED: cytochrome P450 82A3-like [Malus domestica]
Length=526

 Score =   164 bits (414),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPEA G WPI GHL+LF G   PH+ LG MADKYG IFTIR+GV   LVIS  ++AKE  
Sbjct  39   PPEAKGGWPIFGHLHLFGGPTPPHITLGAMADKYGPIFTIRLGVQPSLVISSSEIAKECY  98

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D+ I  RPK   A H+ YNY M +F P GPYWR++RK+ + ELLS R++E LKHIRV
Sbjct  99   TTNDLSILGRPKMVVADHVTYNYAMFAFGPPGPYWRQIRKIVTLELLSVRKVELLKHIRV  158

Query  51   AEIETSVKELQD  16
            +E+ T +KEL D
Sbjct  159  SEVATFLKELHD  170



>ref|XP_007017415.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14640.1| Cytochrome P450, putative [Theobroma cacao]
Length=529

 Score =   164 bits (414),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            G ++  PE  GA P LGHL+L  GSK  HV LGD+AD  G IFTIR+G+H  LV+S+W++
Sbjct  36   GMKRKAPEVSGARPFLGHLHLLGGSKPAHVVLGDLADTNGPIFTIRLGMHPTLVVSNWEI  95

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D   ++RP+  AA+ LGYNY M  F+PYGPYWR++RK+ + E+LSN R+E+L
Sbjct  96   AKECFTTNDKAFANRPRTIAAELLGYNYAMFGFSPYGPYWRQIRKIATLEVLSNHRLEKL  155

Query  66   KHIRVAEIETSVKELQD  16
            KHIR +E+ TS+KEL +
Sbjct  156  KHIRESEVRTSIKELYE  172



>gb|KDO40894.1| hypothetical protein CISIN_1g009786mg [Citrus sinensis]
Length=525

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++  PEAGGAWP++GHL+L  G + PH  LG MADKYG IFTI++G+++ LV+S+W++A
Sbjct  41   KKRGAPEAGGAWPVIGHLHLLGGPEPPHRVLGCMADKYGPIFTIKMGINRALVVSNWEMA  100

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T+HD   +SRPK  A + LGYN+ M  F+PYG YWRE RK+ + ELLSN R+E+LK
Sbjct  101  KECLTTHDKVFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLEKLK  160

Query  63   HIRVAEIETSVKEL  22
             +R  E++T +KEL
Sbjct  161  QVREYELKTCLKEL  174



>ref|XP_009336429.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPEA G WPI+GHL LF GS  PH+ LG MADKYG IFTIR+GVH  LVIS  ++AKE  
Sbjct  44   PPEAKGGWPIIGHLPLFGGSTPPHITLGAMADKYGPIFTIRLGVHPSLVISSSEIAKECY  103

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T+ D+ I SRPK     H+ Y+Y M  F P GP+WRE+RKL + ELLS R++E LKHIRV
Sbjct  104  TTQDLSILSRPKMVVLDHVSYDYAMFGFGPGGPFWREIRKLVTLELLSVRKVELLKHIRV  163

Query  51   AEIETSVKELQD  16
            +E+ T +KEL +
Sbjct  164  SEVATFLKELHE  175



>ref|XP_006432714.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
 ref|XP_006471503.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45954.1| hypothetical protein CICLE_v10000845mg [Citrus clementina]
Length=525

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++  PEAGGAWP++GHL+L  G + PH  LG MADKYG IFTI++G+++ LV+S+W++A
Sbjct  41   KKRGAPEAGGAWPVIGHLHLLGGPEPPHRVLGCMADKYGPIFTIKMGINRALVVSNWEMA  100

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T+HD   +SRPK  A + LGYN+ M  F+PYG YWRE RK+ + ELLSN R+E+LK
Sbjct  101  KECLTTHDKVFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLEKLK  160

Query  63   HIRVAEIETSVKEL  22
             +R  E++T +KEL
Sbjct  161  QVREYELKTCLKEL  174



>ref|XP_009364774.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPEA G WPI+GHL LF GS  PH+ LG MADKYG IFTIR+GVH  LVIS  ++AKE  
Sbjct  44   PPEAKGGWPIIGHLPLFGGSTPPHITLGAMADKYGPIFTIRLGVHPSLVISSSEIAKECY  103

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T+ D+ I SRPK     H+ Y+Y M  F P GP+WRE+RKL + ELLS R++E LKHIRV
Sbjct  104  TTQDLSILSRPKMVVLDHVSYDYAMFGFGPGGPFWREIRKLVTLELLSVRKVELLKHIRV  163

Query  51   AEIETSVKELQD  16
            +E+ T +KEL +
Sbjct  164  SEVATFLKELHE  175



>ref|XP_006375030.1| hypothetical protein POPTR_0014s03750g [Populus trichocarpa]
 gb|ERP52827.1| hypothetical protein POPTR_0014s03750g [Populus trichocarpa]
Length=538

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            GK+K  P+AGGAWP++GHL+L  G++ PH  LG MA+KYG IFTI++GVH+ LV+S+W+ 
Sbjct  40   GKKKAAPKAGGAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWET  99

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T+HD   S RP+  A++ L Y+  M+ F+PYGPYWR++RK+T+ ELLSN R+E+L
Sbjct  100  AKECFTTHDKAFSGRPRTLASELLTYDGAMLGFSPYGPYWRQVRKITTVELLSNYRLEKL  159

Query  66   KHIRVAEIETSVKEL  22
            K +R +E+   +KEL
Sbjct  160  KDVRESEVRAFLKEL  174



>ref|XP_006375032.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
 gb|ERP52829.1| hypothetical protein POPTR_0014s03770g [Populus trichocarpa]
Length=538

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            GK+K  P+AGGAWP++GHL+L  G++ PH  LG MA+KYG IFTI++GVH+ LV+S+W+ 
Sbjct  40   GKKKAAPKAGGAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWET  99

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T+HD   S RP+  A++ L Y+  M+ F+PYGPYWR++RK+T+ ELLSN R+E+L
Sbjct  100  AKECFTTHDKAFSGRPRTLASELLTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKL  159

Query  66   KHIRVAEIETSVKEL  22
            K +R +E+   +KEL
Sbjct  160  KDVRESEVRAFLKEL  174



>ref|XP_011030916.1| PREDICTED: cytochrome P450 CYP82D47-like [Populus euphratica]
Length=538

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K+K  P+AGGAWP++GHL+L  G++ PH  LG MA+KYG IFTI++GVH+ LV+S W+ A
Sbjct  41   KKKAAPKAGGAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSRWETA  100

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T+HD   S RPK  A++ L Y+  M+ F+PYGPYWR++RK+T+ ELLSN R+E+LK
Sbjct  101  KECFTTHDKAFSGRPKTLASELLTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKLK  160

Query  63   HIRVAEIETSVKEL  22
             IR +E+ T +KEL
Sbjct  161  DIRESEVRTFLKEL  174



>ref|XP_007017411.1| Cytochrome P450, putative [Theobroma cacao]
 gb|EOY14636.1| Cytochrome P450, putative [Theobroma cacao]
Length=525

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K++   EA GAWPI+GH+ L  G + PH++L +MADK+G IFTI++GVH+ LV+S+W++
Sbjct  36   NKRRTATEASGAWPIIGHIPLLGGPRPPHLSLANMADKFGTIFTIKLGVHRALVVSNWEI  95

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D   ++RPK    + LGYNY M++FAPYGPYWR++R+  + +LLSN R++ L
Sbjct  96   AKECLTTNDKAFATRPKLAGMEILGYNYAMIAFAPYGPYWRQVRRFATVKLLSNHRLDML  155

Query  66   KHIRVAEIETSVKEL  22
            K +R +E+ETS+++L
Sbjct  156  KRVRESEVETSLQQL  170



>ref|XP_003618363.1| Cytochrome P450 [Medicago truncatula]
 gb|AES74581.1| cytochrome P450 family 82 protein [Medicago truncatula]
Length=531

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K K  P A GAWPILGHL +F G + PH  LG +ADKYG IFTI++G    L++++W++A
Sbjct  37   KNKEAPIAKGAWPILGHLPIFSGKQPPHRVLGPLADKYGPIFTIKLGSKHALILNNWEIA  96

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T+HD+ +SSRPK  + +HL Y   +  F PYGPYWRE+RK+ + E+L+NRRI Q +
Sbjct  97   KECFTTHDMVVSSRPKLISTEHLAYGGAVFGFGPYGPYWRELRKIVTLEILTNRRIIQQQ  156

Query  63   HIRVAEIETSVKELQD  16
            H+RV+E++TS+KEL D
Sbjct  157  HVRVSEVQTSIKELFD  172



>ref|XP_009364169.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=528

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PP+  G  P+LGHL LF GS+LPH+ LG + DKYG IFTI+IG+H  LVI+ W+ AKE  
Sbjct  40   PPKLAGGLPVLGHLDLFGGSQLPHITLGALVDKYGPIFTIKIGIHSALVINTWEAAKECF  99

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D  +SSRP     +HL Y++ M  F+PYG YWRE+RKL S E+LSNRR+E LK +RV
Sbjct  100  TTNDSIVSSRPATLGIKHLSYDFAMFGFSPYGSYWREIRKLISIEVLSNRRLELLKSVRV  159

Query  51   AEIETSVKELQDR  13
            +E+E S+KEL  R
Sbjct  160  SEVEMSLKELYKR  172



>ref|XP_006387541.1| hypothetical protein POPTR_0875s00200g [Populus trichocarpa]
 gb|ERP46455.1| hypothetical protein POPTR_0875s00200g [Populus trichocarpa]
Length=377

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K++ PPEA GAWP++GHL+L  GS+ PH+ LG++ADKYG IFT+++GVH+ L++S+W++
Sbjct  76   SKKRAPPEAAGAWPLIGHLHLLGGSQPPHITLGNLADKYGPIFTVKLGVHRTLIVSNWEM  135

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE   ++D   ++RPK  A   LGYNY ++SF+PYG YWR +RK+ + E+LSN R+E  
Sbjct  136  AKECLRTNDKAFATRPKTLAMDILGYNYSILSFSPYGTYWRLIRKIVTLEVLSNHRLEMF  195

Query  66   KHIRVAEIETSVKELQDRILG  4
            KH+R  E+  +V  L  + +G
Sbjct  196  KHVREDEVRDAVGALYQQWIG  216



>gb|KDP38434.1| hypothetical protein JCGZ_04359 [Jatropha curcas]
Length=558

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K+K  P+AGGAWP++GHL+L  G +  H+ LGDMADKYG IFTI++GVH+ LV+S+W++
Sbjct  27   SKKKAAPKAGGAWPLIGHLHLLGGPEPSHIVLGDMADKYGPIFTIKMGVHRNLVVSNWEI  86

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D   ++RPK  A + LGY+  M  F+PYG YWR++RK+ + ELLSN R+E L
Sbjct  87   AKECLTTNDKAFANRPKILAMELLGYDRSMFGFSPYGTYWRQLRKIATLELLSNHRLEML  146

Query  66   KHIRVAEIETSVKEL  22
            +H+R +E+ T++KEL
Sbjct  147  RHVRQSEVTTALKEL  161



>ref|XP_006375027.1| putative cytochrome P450 family protein, partial [Populus trichocarpa]
 gb|ERP52824.1| putative cytochrome P450 family protein, partial [Populus trichocarpa]
Length=183

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K++ PPEA GAWP++GHL+L  GS+ PH+ LG++ADKYG IFT+++ VH+ L++S+W++
Sbjct  34   NKKRAPPEAAGAWPLIGHLHLLGGSQPPHITLGNLADKYGPIFTVKLEVHRTLIVSNWEM  93

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE   ++D   ++RPK  A   LGYNY M+ F+PYG YWR +RK+ + E+LSN R+E  
Sbjct  94   AKECLRTNDKAFATRPKTLAMDILGYNYSMLGFSPYGTYWRLIRKIVTLEVLSNHRLEMF  153

Query  66   KHIRVAEIETSVKELQDRILG  4
             H+R  E+  ++  L  + +G
Sbjct  154  THVREDEVRDAIGALYQQWIG  174



>ref|XP_007151149.1| hypothetical protein PHAVU_004G022000g [Phaseolus vulgaris]
 gb|ESW23143.1| hypothetical protein PHAVU_004G022000g [Phaseolus vulgaris]
Length=544

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 100/134 (75%), Gaps = 1/134 (1%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K  P   GAWPILGHL L  GSK PH  LG +ADKYG IFTI++G  + LVI++W+ AKE
Sbjct  52   KEAPTVAGAWPILGHLPLLSGSKRPHRTLGALADKYGPIFTIQLGAKRALVINNWETAKE  111

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
              T++D+ +SSRPK  A + +GYN  M  F PYGPYWRE+RK+ + E+L+ RR+EQL+H+
Sbjct  112  CFTTNDMAVSSRPKLIAIELMGYN-AMFGFVPYGPYWRELRKIVTLEILTTRRVEQLQHV  170

Query  57   RVAEIETSVKELQD  16
            RV+E++ S+KEL +
Sbjct  171  RVSELQNSIKELHN  184



>gb|KHG07801.1| Cytochrome P450 [Gossypium arboreum]
Length=523

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K  P A GAWPI+GHL L  G K PH  LGD+ +KYG  + IRIGVH  LV++   +AKE
Sbjct  37   KAAPVAAGAWPIIGHLPLLGGPKAPHEMLGDLGEKYGPAYMIRIGVHPALVVNSSDVAKE  96

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
            + T++D+H+SSR +F AA+HLGYNY M  F+PYG YWREMRK+T  E+LSN RI+QLK +
Sbjct  97   IFTTNDLHVSSRSEFAAAKHLGYNYAMFGFSPYGQYWREMRKITMVEVLSNHRIDQLKKV  156

Query  57   RVAEIETSVKELQD  16
             V+EIE S+K L +
Sbjct  157  FVSEIEGSMKLLYN  170



>emb|CAN66846.1| hypothetical protein VITISV_002367 [Vitis vinifera]
Length=528

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K+   P AGGAWPI+GHL+LF   +L H  LG MADKYG +FTIR+G++++LV+S  ++
Sbjct  35   AKRCTAPRAGGAWPIIGHLHLFGAQQLTHKTLGAMADKYGPVFTIRLGLNEILVLSSSEM  94

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            A+E  T+HD   S+RP   A++ LGY++ M  FAPYG YWREMRK+ + ELLSN R++ L
Sbjct  95   ARECFTTHDRVFSTRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTIELLSNHRLDML  154

Query  66   KHIRVAEIETSVKEL  22
            KHIR +E+ TS++EL
Sbjct  155  KHIRASEVGTSIREL  169



>ref|XP_010106080.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXC07350.1| Cytochrome P450 82A3 [Morus notabilis]
Length=641

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            ++ PPEAGGAWPI+GHL+L  GS+ PH  LG MADKYG IF+I++GVH+ LV+S W++AK
Sbjct  85   RRTPPEAGGAWPIVGHLHLLAGSQAPHRTLGHMADKYGPIFSIKVGVHRALVVSSWEMAK  144

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            E  T++D   ++R K  A++ L YNY M  F+PYG YWR++RK+ + ELLSN R+E L H
Sbjct  145  EFLTTNDKVFANRSKGIASEILAYNYAMFGFSPYGSYWRQVRKIATLELLSNNRLEILSH  204

Query  60   IRVAEIETSVK  28
            +R +E++T++K
Sbjct  205  VRESEVKTAIK  215



>ref|XP_007222622.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
 gb|EMJ23821.1| hypothetical protein PRUPE_ppa004175mg [Prunus persica]
Length=525

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/131 (58%), Positives = 98/131 (75%), Gaps = 0/131 (0%)
 Frame = -2

Query  414  LPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKEL  235
            +P EA GAWPI GHL L  GS  PH+ L  MADKYG +FTIR+GV+  LVIS  ++AKE 
Sbjct  35   VPTEAKGAWPIFGHLPLLGGSTPPHIKLAAMADKYGPLFTIRLGVYPSLVISSSEIAKEC  94

Query  234  STSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIR  55
             T++D+ ++SRPK     H+GYN  M  FAP GP+WREMRK+T+ ELLSNRR+E L+HIR
Sbjct  95   FTTNDLVLNSRPKLAVVDHIGYNCAMFGFAPSGPFWREMRKITTLELLSNRRLELLRHIR  154

Query  54   VAEIETSVKEL  22
            V+E+ T ++EL
Sbjct  155  VSEVTTFLQEL  165



>gb|KHG01290.1| Cytochrome P450 [Gossypium arboreum]
Length=522

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 100/134 (75%), Gaps = 0/134 (0%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K PP A GAWPI+GHL L  G K PH +LGD+ +KYG  + IRIGVH  LV++   +AKE
Sbjct  36   KAPPVAAGAWPIIGHLPLLGGPKAPHESLGDLGEKYGPAYMIRIGVHPALVVNSSDVAKE  95

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
            + T +D+H+SSR +F AA+HLGYNY M  F+PYG +WREMRK+T  E+LSN RI+QLK +
Sbjct  96   IFTVNDMHVSSRSEFAAAEHLGYNYAMFGFSPYGQFWREMRKITMLEVLSNHRIDQLKKV  155

Query  57   RVAEIETSVKELQD  16
             ++EIE S+K L +
Sbjct  156  FLSEIEGSMKLLYN  169



>ref|XP_010253830.1| PREDICTED: cytochrome P450 CYP82D47-like [Nelumbo nucifera]
Length=529

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K +  P+  GAWPI+GHL+LFR S+L H  LG MADKYG  F +R+G+ + LV+S W  A
Sbjct  33   KARQAPQPSGAWPIIGHLHLFRASELLHPKLGAMADKYGPAFMLRLGMRRALVVSSWDAA  92

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            K+  T++D   S+RP+  A +H+GYNY +  FAPYGPYWREMRK+++ ELLS+RR++  K
Sbjct  93   KQCFTTNDKVFSTRPRTVAIKHMGYNYALPGFAPYGPYWREMRKISTVELLSHRRLDMFK  152

Query  63   HIRVAEIETSVKELQDR  13
            HIR +EI+ S+K+L  R
Sbjct  153  HIRTSEIDLSMKDLYTR  169



>ref|XP_003554074.1| PREDICTED: cytochrome P450 82A3-like [Glycine max]
Length=527

 Score =   162 bits (411),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            + K  P   GAWPILGHL    GS+ PH  +G +ADKYG +FTI++GV   LV+S+W+++
Sbjct  34   RGKDAPVVAGAWPILGHLSWLNGSQAPHKMMGTLADKYGPLFTIKLGVKPALVLSNWEMS  93

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KEL T++D+ +SSRPK  A + + YN   V  APYGPYWRE+RK+ + E LSNRRIEQ  
Sbjct  94   KELFTTNDLAVSSRPKLVAVEVMSYNQAFVGLAPYGPYWRELRKIVTFEFLSNRRIEQRS  153

Query  63   HIRVAEIETSVKEL  22
            HIRV+E+ TS++EL
Sbjct  154  HIRVSEVRTSIREL  167



>emb|CBI40977.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K+   P AGGAWPI+GHL+LF   +L H  LG MADKYG +FTIR+G++++LV+S  ++
Sbjct  64   AKRCTAPRAGGAWPIIGHLHLFGAQQLTHKTLGAMADKYGPVFTIRLGLNEILVLSSSEM  123

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            A+E  T+HD   S+RP   A++ LGY++ M  FAPYG YWREMRK+ + ELLSN R++ L
Sbjct  124  ARECFTTHDRVFSTRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTIELLSNHRLDML  183

Query  66   KHIRVAEIETSVKEL  22
            KHIR +E+ TS++EL
Sbjct  184  KHIRASEVGTSIREL  198



>ref|XP_009336438.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 95/130 (73%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPEA G WPI GHL+LF GS  PH+ LG MADKYG IFT+R+GV   LV+S  ++AKE  
Sbjct  44   PPEAKGGWPIFGHLHLFGGSTPPHIILGAMADKYGPIFTVRLGVQPSLVVSSSEIAKECY  103

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D+ I SRPK     H+ YNY M  F P GPYWRE+RK+ + ELLS R++E LKH+RV
Sbjct  104  TTNDLSILSRPKMVVVDHVSYNYAMFGFGPPGPYWREIRKIVTLELLSVRKVELLKHVRV  163

Query  51   AEIETSVKEL  22
            +E+ T +KEL
Sbjct  164  SEVATFLKEL  173



>ref|XP_009336944.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=526

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 94/132 (71%), Gaps = 0/132 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPEA G WPI GHL+LF GS  PH+ LG MADKYG IFTIR+G H  LVIS  + AKE  
Sbjct  39   PPEAKGGWPIFGHLHLFGGSTPPHIILGAMADKYGPIFTIRLGFHPSLVISSSESAKECY  98

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T+ D+ + SRPK     H+ YNY M  F P GPYWRE+RK+ + ELLS R++E LKHIRV
Sbjct  99   TTKDLSVLSRPKMAVVDHVSYNYAMFGFGPPGPYWREIRKIVTLELLSVRKVELLKHIRV  158

Query  51   AEIETSVKELQD  16
            +E+ T +KEL +
Sbjct  159  SEVATFLKELHE  170



>ref|XP_006486182.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
Length=358

 Score =   159 bits (403),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P AGGAWP++GHL+L RG +  H  LG++ADKYG IFT++ GV + LV+S+W++AKE  T
Sbjct  47   PVAGGAWPLIGHLHLLRGPEPAHRVLGNLADKYGTIFTMKWGVKQALVVSNWEIAKECFT  106

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            ++D   + RPK  A + +GYN+L++ FAPYG YWR+ RK+ + ELLSNRR+E+LKH+R +
Sbjct  107  TNDKAFAGRPKTMAVELMGYNFLVIGFAPYGNYWRQSRKIVTIELLSNRRLEKLKHVRES  166

Query  48   EIETSVKEL  22
            E++ S++ L
Sbjct  167  EVKASIQRL  175



>ref|XP_009364766.1| PREDICTED: cytochrome P450 82A3-like [Pyrus x bretschneideri]
Length=531

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 95/130 (73%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPEA G WPI GHL+LF GS  PH+ LG MADKYG IFT+R+GV   LV+S  ++AKE  
Sbjct  44   PPEAKGGWPIFGHLHLFGGSTPPHIILGAMADKYGPIFTVRLGVQPSLVVSSSEIAKECY  103

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D+ I SRPK     H+ YNY M  F P GPYWRE+RK+ + ELLS R++E LKH+RV
Sbjct  104  TTNDLSILSRPKMVVVDHVSYNYAMFGFGPPGPYWREIRKIVTLELLSVRKVELLKHVRV  163

Query  51   AEIETSVKEL  22
            +E+ T +KEL
Sbjct  164  SEVATFLKEL  173



>ref|XP_011042272.1| PREDICTED: cytochrome P450 82A4-like [Populus euphratica]
Length=318

 Score =   158 bits (400),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            GK+K  P+AGGAWP++GHL+L  G++ PH  LG MA+KYG IFTI++GVH+ LV+S+W+ 
Sbjct  28   GKKKAAPKAGGAWPVIGHLHLLGGAEPPHKVLGSMAEKYGPIFTIKMGVHRALVVSNWET  87

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            A E  T+HD   S RPK  A++ L Y+  M+ F+PYGPYWR++RK+T+ ELLSN R+E+L
Sbjct  88   A-ECFTTHDKAFSGRPKTLASELLTYDGAMMGFSPYGPYWRQVRKITTVELLSNYRLEKL  146

Query  66   KHIRVAEIETSVKEL  22
            K +R +E+   +KEL
Sbjct  147  KDVRESEVRAFLKEL  161



>ref|XP_006486513.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
Length=395

 Score =   160 bits (405),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P AGGAWP++GHL+L RG +  H  LG++ADKYG IFT+++GV + LV+S+W++AKE  T
Sbjct  47   PVAGGAWPLIGHLHLLRGPEPAHRVLGNLADKYGTIFTMKLGVKQALVVSNWEIAKECFT  106

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            ++D   +SRPK  A + +GYN+ ++ FAPYG YWR+ RK+ + ELLSNRR+E+LKH+R +
Sbjct  107  TNDKAFASRPKRMAVELMGYNFSVIGFAPYGNYWRQSRKIVTIELLSNRRLEKLKHVRES  166

Query  48   EIETSVKEL  22
            E++ S++ L
Sbjct  167  EVKASIQRL  175



>ref|XP_003528211.2| PREDICTED: cytochrome P450 82A1-like [Glycine max]
Length=541

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 101/139 (73%), Gaps = 0/139 (0%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            +K PPEA GAWP++GH++L  GSK PHV LG MADKYG +FT+R+G HK LV+S+W++AK
Sbjct  58   RKAPPEARGAWPLIGHIHLLGGSKPPHVTLGHMADKYGPVFTLRLGAHKTLVVSNWEMAK  117

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            +  T +D   +SRPK  + + LGYNY M+ F PYG YWR +RK+ + ELLS   I+ LKH
Sbjct  118  QCFTVNDKAFASRPKSVSFELLGYNYSMIGFIPYGSYWRHVRKIITLELLSTHCIDMLKH  177

Query  60   IRVAEIETSVKELQDRILG  4
            + VAE++ +VKE    + G
Sbjct  178  VMVAEVKAAVKETYKNLKG  196



>ref|XP_008388075.1| PREDICTED: cytochrome P450 82A3-like [Malus domestica]
Length=531

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 95/132 (72%), Gaps = 0/132 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPE  G WPI GHL+L  GS  PH+ LG MADKYG IFTIR+GV   LVIS  ++AKE  
Sbjct  44   PPEVKGGWPIFGHLHLLGGSTPPHITLGAMADKYGPIFTIRLGVQPSLVISSSEIAKECY  103

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D+ I SRPK     H+ YNY M +F P GPYWRE+RK+ + ELLS R++E LKHIRV
Sbjct  104  TTNDLSILSRPKMVVVDHVSYNYAMFAFGPPGPYWREIRKIVTLELLSVRKVELLKHIRV  163

Query  51   AEIETSVKELQD  16
            +E+ T +KEL +
Sbjct  164  SEVATFLKELHE  175



>ref|XP_008245476.1| PREDICTED: cytochrome P450 CYP82D47-like [Prunus mume]
Length=522

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            KLP  AGG WP+LGHL LF GS+LPH+AL  + DKYG  FTI IG+H  LVIS W++AK+
Sbjct  39   KLPKVAGG-WPLLGHLGLFGGSQLPHIALASLVDKYGPAFTINIGIHSALVISTWEVAKD  97

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
              T++D+ +SSRP    A+HLGYN+ M  F+PYGPYWREMRKLTS ELLSNRR+E LK +
Sbjct  98   CFTTNDIVVSSRPATLGAKHLGYNFAMFGFSPYGPYWREMRKLTSLELLSNRRLELLKKV  157

Query  57   RVAEIETSVKEL  22
            RV+E+E S+KEL
Sbjct  158  RVSEVEMSLKEL  169



>ref|XP_006432704.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
 ref|XP_006471494.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
 gb|ESR45944.1| hypothetical protein CICLE_v10000846mg [Citrus clementina]
Length=525

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 100/134 (75%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++  PEAGGAWP+ GHL+L  G + PH  LG MADK G IFTI++G+++ LV+S+W++A
Sbjct  41   KKRRAPEAGGAWPVTGHLHLLGGPEPPHRVLGAMADKCGPIFTIKMGINRALVVSNWEMA  100

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T+HD   +SRPK  A +  GYN+ M  F+PYG YWRE RK+ + ELLSN R+E+LK
Sbjct  101  KECLTTHDKVFASRPKTLAMEIFGYNFSMFGFSPYGSYWRETRKIATVELLSNHRLEKLK  160

Query  63   HIRVAEIETSVKEL  22
            H+R  E++T +KEL
Sbjct  161  HVRDYEVKTCLKEL  174



>sp|O49859.1|C82A4_SOYBN RecName: Full=Cytochrome P450 82A4; AltName: Full=Cytochrome 
P450 CP9 [Glycine max]
 emb|CAA71877.1| putative cytochrome P450 [Glycine max]
Length=525

 Score =   162 bits (410),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            G  K  P  GGAWPI GHL L  GSK PH ALG +A+K+G +FTI++G  K LV+SDW++
Sbjct  35   GSSKEAPTVGGAWPIFGHLPLLIGSKSPHKALGALAEKHGPLFTIKLGAKKALVVSDWEM  94

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            A+E  T++DV +S+RPK   A+ + YN  M+  APYGPYWRE+RK+  +E+LS+ R+EQL
Sbjct  95   ARECFTTNDVAVSARPKLLVAELMCYNNAMLLVAPYGPYWRELRKIIVTEILSSSRVEQL  154

Query  66   KHIRVAEIETSVKELQD  16
            + +RV+E++ S+ EL D
Sbjct  155  QDVRVSEVQNSIVELYD  171



>ref|XP_011030937.1| PREDICTED: cytochrome P450 CYP82H23-like [Populus euphratica]
Length=328

 Score =   158 bits (400),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K++ PPEA GAWP++GHL+L RGS+ PH+ LG++ADK+G IFT+++GVH+ L++S+W++
Sbjct  35   SKKRAPPEAAGAWPLIGHLHLLRGSQPPHITLGNLADKHGPIFTVKLGVHRALIVSNWEM  94

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE    +D   ++RPK  A   LGYNY ++SF+PYG YWR +RK+ + E+LSN R+E  
Sbjct  95   AKECLRINDKAFATRPKTLAMDILGYNYSILSFSPYGTYWRLIRKIVTLEVLSNHRLEMF  154

Query  66   KHIRVAEIETSVKEL  22
            KH+R  E+  +V  L
Sbjct  155  KHVREDEVRDAVGAL  169



>ref|XP_003517019.1| PREDICTED: cytochrome P450 82A4-like [Glycine max]
Length=526

 Score =   162 bits (409),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 72/137 (53%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            G  K  P  GGAWPI GHL L  GSK PH ALG +A+K+G +FTI++G  K LV+SDW++
Sbjct  35   GSSKEAPTVGGAWPIFGHLPLLIGSKSPHKALGALAEKHGPLFTIKLGAKKALVVSDWEM  94

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            A+E  T++DV +S+RPK   A+ + YN  M+  APYGPYWRE+RK+  +E+LS+ R+EQL
Sbjct  95   ARECFTTNDVAVSARPKLLVAELMCYNNAMLLVAPYGPYWRELRKIIVTEILSSSRVEQL  154

Query  66   KHIRVAEIETSVKELQD  16
            + +RV+E++ S+ EL D
Sbjct  155  QDVRVSEVQNSIVELYD  171



>ref|XP_007017414.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14639.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=755

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++  P+AG +WP++GHL+L  G + PH+ LGDMADKYG IFTI++G ++ LV+S+W+ A
Sbjct  39   KKRAAPQAGSSWPVIGHLHLLGGPQPPHIVLGDMADKYGPIFTIKMGAYRALVVSNWETA  98

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D   +SRPK  A   L Y++ M  FA YGPYWR+MRK+ + ELLSN R++ LK
Sbjct  99   KECLTTNDKAFASRPKTHAIDFLTYDHAMFGFASYGPYWRQMRKVATLELLSNYRLDMLK  158

Query  63   HIRVAEIETSVKEL  22
            H+R +EI+TS+KEL
Sbjct  159  HVRQSEIKTSLKEL  172


 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 63/93 (68%), Gaps = 1/93 (1%)
 Frame = -2

Query  405  EAGGAWPILGHLY-LFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            E  GA P+LGH++ L  G K  H+ LGD+ DKYG IFTI++G+   LVIS+ +LAKE  T
Sbjct  663  EVSGARPLLGHIHNLLEGPKPAHITLGDLVDKYGPIFTIKLGMKPALVISNSELAKECLT  722

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPY  130
            +++    +R K  AA+  GYNY M+ F+PYG Y
Sbjct  723  TNNEAFVNRLKSLAAEFFGYNYAMLRFSPYGSY  755



>ref|XP_006435895.1| hypothetical protein CICLE_v10031217mg [Citrus clementina]
 gb|ESR49135.1| hypothetical protein CICLE_v10031217mg [Citrus clementina]
Length=528

 Score =   162 bits (409),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            + K  P AGGAWP++GHL+L RG +  H  LG++ADKYG IFT+++GV + LV+S+W++A
Sbjct  42   QAKQAPVAGGAWPLIGHLHLLRGPEPAHRVLGNLADKYGTIFTMKLGVKQALVVSNWEIA  101

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D   + RPK  A + +GYN+L++ FAPYG YWR+ RK+ + ELLSNRR+E+LK
Sbjct  102  KECFTTNDKAFAGRPKTMAVELMGYNFLVIGFAPYGNYWRQSRKIVTIELLSNRRLEKLK  161

Query  63   HIRVAEIETSVKEL  22
            H+R +E++ S++ L
Sbjct  162  HVRESEVKASIQRL  175



>ref|XP_002510311.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52498.1| cytochrome P450, putative [Ricinus communis]
Length=521

 Score =   161 bits (408),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K++ PP+A GAWP++GHL+L  GS+ PH+ LG++ADKYG IFTI++GVH+ L++S+ ++
Sbjct  30   SKKREPPQAAGAWPVIGHLHLLSGSQPPHITLGNLADKYGPIFTIKLGVHRTLIVSNGEI  89

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D   +SRPK  A + LGY+Y M+ F+PYG YWR+MRK+ + ELLS  R+E L
Sbjct  90   AKECLTTNDKAFASRPKSLAMEILGYDYSMLGFSPYGEYWRQMRKIITLELLSKHRLEML  149

Query  66   KHIRVAEIETSVKEL  22
            K +R  E++T++K L
Sbjct  150  KRVREVEVKTAIKGL  164



>gb|AJD25201.1| cytochrome P450 CYP82D71 [Salvia miltiorrhiza]
Length=516

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 99/135 (73%), Gaps = 3/135 (2%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRG---SKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            + PPEAGGAWP LGHL+L  G   S LPHV LG +ADK+G IFTIRIGVH+  V+S W+L
Sbjct  33   RAPPEAGGAWPFLGHLHLISGGPSSGLPHVNLGALADKHGPIFTIRIGVHRAAVVSSWEL  92

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AK+  T++D  +SSRP  +A +HLGY Y M+ FA +G +WR++RKL S+EL S RR+EQ 
Sbjct  93   AKQAFTANDAAVSSRPSVKAGKHLGYGYAMLGFAEHGAHWRQLRKLASAELFSARRLEQQ  152

Query  66   KHIRVAEIETSVKEL  22
            + +RVAE    V EL
Sbjct  153  RRVRVAETLIFVGEL  167



>ref|XP_002510308.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52495.1| cytochrome P450, putative [Ricinus communis]
Length=521

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K++ PP+A GAWP++GHL+L  GS+ PH+ LG++ADKYG IF I++GVH+ L++S+ ++
Sbjct  30   SKKREPPQAAGAWPVIGHLHLLSGSQPPHITLGNLADKYGPIFAIKLGVHRTLIVSNGEI  89

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D   ++RPK  A + LGY+Y M+ F+PYG YWR+MRK+ + ELLS  R+E L
Sbjct  90   AKECLTTNDKAFANRPKSLAMEILGYDYSMLGFSPYGEYWRQMRKIITLELLSKHRLEML  149

Query  66   KHIRVAEIETSVKEL  22
            KH+R  E++T++K L
Sbjct  150  KHVREVEVKTAIKGL  164



>ref|XP_006471190.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
Length=240

 Score =   155 bits (392),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            +K  PE GGAWP++GHL+L  G K  +V LG++A+K G IF I++G+H+ L++S+W++AK
Sbjct  60   KKPVPEPGGAWPLIGHLHLLGGQKPAYVTLGNIAEKCGPIFMIKLGMHRALIVSNWEIAK  119

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            E  T++D   S+R K  A + LGYNY M  F+PYGPYWR++RK+ + E+LSN R+E LKH
Sbjct  120  ECFTTNDKVFSNRIKALAPEILGYNYAMFGFSPYGPYWRQIRKIATLEVLSNHRLEMLKH  179

Query  60   IRVAEIETSVKELQD  16
            +R +E+ TS+KEL D
Sbjct  180  VRESEVRTSMKELYD  194



>ref|XP_003523886.1| PREDICTED: cytochrome P450 82A1-like [Glycine max]
Length=526

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 100/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGS-KLPHVALGDMADKYGLIFTIRIGVHKVLVISDWK  250
            G  + PP AGG WP++GHL+L  GS + P++ LG +ADKYG IF++RIGVH  +V+S W+
Sbjct  31   GSARKPPAAGGGWPLIGHLHLLGGSTQPPYITLGSLADKYGPIFSMRIGVHHAVVVSSWE  90

Query  249  LAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQ  70
            LAKE  T+ DV ISSRPKF AA+ LGYNY    F PYG +WR MRK+ +SELLS  R E 
Sbjct  91   LAKECFTTLDVVISSRPKFTAAKILGYNYANFGFTPYGDFWRVMRKIAASELLSTARFEL  150

Query  69   LKHIRVAEIETSVKEL  22
            L+ IR +E++ S+KEL
Sbjct  151  LQRIRDSEMQISLKEL  166



>ref|XP_010089020.1| Cytochrome P450 82A3 [Morus notabilis]
 gb|EXB37247.1| Cytochrome P450 82A3 [Morus notabilis]
Length=515

 Score =   161 bits (407),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+AGGAWP++GHL+LF   +L H ALG MA+KYG +FT++ G+ +VLV+S W++A E  T
Sbjct  42   PQAGGAWPVIGHLHLFASQQLLHKALGAMAEKYGPVFTVKFGLERVLVVSSWEMAAECFT  101

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   S RP     + LGYNY M +F PYGPYWR++RK+  +ELLSN R+E LK +R +
Sbjct  102  VHDKAFSDRPNTATLKLLGYNYAMFAFTPYGPYWRQVRKIAVAELLSNHRLETLKRVRAS  161

Query  48   EIETSVKEL  22
            E+ET +KEL
Sbjct  162  EVETMIKEL  170



>ref|XP_011099743.1| PREDICTED: cytochrome P450 CYP82D47-like [Sesamum indicum]
Length=525

 Score =   161 bits (408),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 106/137 (77%), Gaps = 3/137 (2%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRG---SKLPHVALGDMADKYGLIFTIRIGVHKVLVISDW  253
            K K PPEAGGA P  GHL+L  G   + LPH+ L  +ADKYG +FTIR+GV +VLV+S W
Sbjct  33   KSKSPPEAGGARPFTGHLHLMNGGTSTGLPHINLAALADKYGPVFTIRLGVRRVLVVSSW  92

Query  252  KLAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIE  73
            +LAKEL T+ DV ISSRP FRAA+HL Y++ M +F+PYGPYWRE+RKLTS ELLS+RR+E
Sbjct  93   ELAKELFTTRDVAISSRPNFRAAKHLSYDFAMFAFSPYGPYWRELRKLTSVELLSSRRLE  152

Query  72   QLKHIRVAEIETSVKEL  22
             L H+RV+E   SV EL
Sbjct  153  LLSHVRVSETMQSVNEL  169



>ref|XP_010664625.1| PREDICTED: cytochrome P450 CYP82D47-like [Vitis vinifera]
Length=520

 Score =   161 bits (407),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            +++  PEA GAWP++GHL+L  GS+LPH  LG MADKYG IF I++G   VLV+S+W++A
Sbjct  33   RKRTAPEAAGAWPVIGHLHLLGGSELPHKTLGAMADKYGPIFFIKLGARPVLVVSNWEIA  92

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D   ++RPK  A + +GYN  M  F+PYG YWR+MRK+ ++ LLSNR +E LK
Sbjct  93   KECFTTNDKAFANRPKLIAVEVMGYNNAMFGFSPYGSYWRQMRKIVTTHLLSNRSLEMLK  152

Query  63   HIRVAEIETSVKELQD  16
             +R++E++ ++KEL +
Sbjct  153  LVRISEVKATIKELHE  168



>ref|XP_008343753.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=528

 Score =   161 bits (407),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 97/133 (73%), Gaps = 0/133 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PP+  G  P+LGHL LF GS+LPH+ LG + DKYG IFT  IG+H  LVI+ W+ AKE  
Sbjct  40   PPKLAGGLPLLGHLDLFGGSQLPHITLGALVDKYGPIFTFNIGIHSALVINTWEAAKECF  99

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D  +SSRP     +HL Y++ M  F+PYGPYWR++RKLTS ELLSNRR+E LK +RV
Sbjct  100  TTNDSIVSSRPATLGIKHLSYDFAMFGFSPYGPYWRKIRKLTSLELLSNRRLELLKSVRV  159

Query  51   AEIETSVKELQDR  13
            +E+E  +K+L  R
Sbjct  160  SEVEMRLKKLYKR  172



>ref|XP_009336967.1| PREDICTED: cytochrome P450 82A4-like [Pyrus x bretschneideri]
Length=526

 Score =   161 bits (407),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPEA G WPI GHL+L  GS  PH+ LG MADKYG IFTIR+GV   LVIS  ++AKE  
Sbjct  39   PPEAKGGWPIFGHLHLLGGSTPPHITLGAMADKYGPIFTIRLGVQPSLVISSSEIAKECY  98

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D+ I SRPK     H+ Y+Y M +F P GPYWRE+RK+ + ELLS R++E LKH+RV
Sbjct  99   TTNDLSILSRPKMVVVDHVSYDYAMFAFGPPGPYWREIRKIVTLELLSVRKVELLKHVRV  158

Query  51   AEIETSVKELQD  16
            +E+ T +KEL +
Sbjct  159  SEVATFLKELHE  170



>ref|XP_011030947.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X1 [Populus 
euphratica]
Length=528

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/141 (48%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K++ PPEA GAWP++GHL+L RGS+ PH+ LG++ADK+G IFT+++GVH+ L++S+W++
Sbjct  35   SKKRAPPEAAGAWPLIGHLHLLRGSQPPHITLGNLADKHGPIFTVKLGVHRALIVSNWEM  94

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE    +D   ++RPK  A   LG+NY M+ F+PYG YWR++RK+ + E+LSN R+E  
Sbjct  95   AKECLRINDKAFATRPKALATDILGFNYSMLGFSPYGTYWRQIRKIVTLEVLSNHRLEMF  154

Query  66   KHIRVAEIETSVKELQDRILG  4
            KH+R  E+  +V  L  + +G
Sbjct  155  KHVREDEVRDAVGALYQQWIG  175



>ref|XP_008378426.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=523

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+  G WP+LGH++L  G +LPH+ LG + DKYG +F+I +G++  LV++ W+ AKE  T
Sbjct  40   PKVVGGWPLLGHIHLLAGPELPHIVLGGLVDKYGPVFSINVGLNSALVVNCWEAAKECFT  99

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            ++D+ +SSRPK    +HL YN  +V+++PYGPYWRE+RK+T+ ELLSN R+E LKH+RV+
Sbjct  100  TNDLAVSSRPKIVGVEHLSYNGALVAYSPYGPYWREIRKITTHELLSNSRLELLKHVRVS  159

Query  48   EIETSVKEL  22
            E+E S+KEL
Sbjct  160  EVEMSLKEL  168



>ref|XP_007017413.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY14638.1| Cytochrome P450 [Theobroma cacao]
Length=522

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++  PEAG +WP++GHL+L  G +  H+ LGDMA+KYG IFTI++GV++ LV+++W+ A
Sbjct  39   KRRAAPEAGSSWPVIGHLHLLGGPQPAHIVLGDMAEKYGPIFTIKMGVYRALVVNNWETA  98

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D   +SRPK  A + L Y++ M  FAPYGPYWR+MRK+ + ELLS+ R+++LK
Sbjct  99   KECLTTNDKAFASRPKTLAMELLSYDHAMFGFAPYGPYWRQMRKVATLELLSSYRLDRLK  158

Query  63   HIRVAEIETSVKEL  22
            H+R +EI+TS+KEL
Sbjct  159  HVRQSEIKTSLKEL  172



>gb|KDO44281.1| hypothetical protein CISIN_1g037130mg, partial [Citrus sinensis]
Length=252

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P AGGAWP++GHL+L  G +  H  LGDMADKYG IFT+++GV + LV+S+W++AKE  T
Sbjct  45   PRAGGAWPLVGHLHLLGGPEPAHRVLGDMADKYGPIFTMKLGVKQALVVSNWEIAKECFT  104

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            ++D   +SRPK  A + LGYN+ ++SFAPYG YWR+ RK+   ELLS+ R+E+LKH+R +
Sbjct  105  TNDKAFASRPKTMAMELLGYNFSVISFAPYGNYWRQSRKIAIIELLSSHRLEKLKHVRES  164

Query  48   EIETSVKEL  22
            E++ S++ L
Sbjct  165  EVKASIQRL  173



>ref|XP_008351399.1| PREDICTED: cytochrome P450 82A4-like [Malus domestica]
Length=526

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPEA G WPI GHL+LF G   PH+ LG MADKYG IFTIR+GV   LVIS  ++AKE  
Sbjct  39   PPEAKGGWPIFGHLHLFGGPTPPHITLGAMADKYGPIFTIRLGVQXSLVISSSEIAKECY  98

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D+ I  RPK   A H+ YNY M +F P GPYWR++RK+ + E LS R++E LKHIRV
Sbjct  99   TTNDLSILGRPKMVVADHVTYNYAMFAFXPPGPYWRZIRKIVTLEXLSVRKVELLKHIRV  158

Query  51   AEIETSVKEL  22
            +E+ T +KEL
Sbjct  159  SEVATFLKEL  168



>ref|XP_008388076.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=497

 Score =   160 bits (405),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 99/137 (72%), Gaps = 1/137 (1%)
 Frame = -2

Query  423  KQKL-PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            K+KL PPEA G WPI GHL LF GS  PH+ LG MADKYG IFTIR+GVH  LVIS  ++
Sbjct  34   KRKLSPPEAKGGWPIFGHLPLFGGSIPPHLTLGAMADKYGPIFTIRLGVHPSLVISSSEI  93

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T+ D+ I SRP+     H+ Y+Y M  F P GP+WRE+RKL + ELLS R++E L
Sbjct  94   AKECFTTKDLSIISRPRMVVLDHVSYDYAMFGFGPGGPFWREIRKLVTLELLSVRKVELL  153

Query  66   KHIRVAEIETSVKELQD  16
            KHIRV+E+ T +KEL +
Sbjct  154  KHIRVSEVATFLKELHE  170



>ref|XP_011030954.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X2 [Populus 
euphratica]
Length=528

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++ PPEA GAWP++GHL+L RGS+ PH+ LG++ADK+G IFT+++GVH+ L++S+W++A
Sbjct  36   KKRAPPEAAGAWPLIGHLHLLRGSQPPHITLGNLADKHGPIFTVKLGVHRALIVSNWEMA  95

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE    +D   ++RPK  A   LG+NY M+ F+PYG YWR++RK+ + E+LSN R+E  K
Sbjct  96   KECLRINDKAFATRPKALATDILGFNYSMLGFSPYGTYWRQIRKIVTLEVLSNHRLEMFK  155

Query  63   HIRVAEIETSVKELQDRILG  4
            H+R  E+  +V  L  + +G
Sbjct  156  HVREDEVRDAVGALYQQWIG  175



>ref|XP_002268915.2| PREDICTED: cytochrome P450 82C2 [Vitis vinifera]
Length=744

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K+   P AGGAWPI+GHL+LF   +L H  LG MADKYG +FTIR+G++++LV+S  ++
Sbjct  251  AKRCTAPRAGGAWPIIGHLHLFGAQQLTHKTLGAMADKYGPVFTIRLGLNEILVLSSSEM  310

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            A+E  T+HD   S+RP   A++ LGY++ M  FAPYG YWREMRK+ + ELLSN R++ L
Sbjct  311  ARECFTTHDRVFSTRPSVTASKILGYDFAMFGFAPYGSYWREMRKIVTIELLSNHRLDML  370

Query  66   KHIRVAEIETSVKEL  22
            KHIR +E+ TS++EL
Sbjct  371  KHIRASEVGTSIREL  385



>ref|XP_006384481.1| hypothetical protein POPTR_0004s15460g, partial [Populus trichocarpa]
 gb|ERP62278.1| hypothetical protein POPTR_0004s15460g, partial [Populus trichocarpa]
Length=176

 Score =   152 bits (385),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 101/138 (73%), Gaps = 1/138 (1%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGS-KLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            K K+PPE  G+WPI+GHL+L  G+ +L H   G MADKYG IF++  G+ +VLV+S+W++
Sbjct  31   KGKMPPEPAGSWPIIGHLHLLGGANQLLHRTFGVMADKYGPIFSVCHGIRRVLVVSNWEI  90

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
             KE   ++D+  ++RPK+ A + +GY++ M+ FAPYG YWR+MRKLT  ELLSN R+E L
Sbjct  91   VKECLATNDMVFAARPKYLAVKIMGYDHAMLGFAPYGQYWRDMRKLTMVELLSNSRLEML  150

Query  66   KHIRVAEIETSVKELQDR  13
            KH+R  E +  +K+L DR
Sbjct  151  KHVRDTETKLLLKDLHDR  168



>gb|KCW59278.1| hypothetical protein EUGRSUZ_H01953 [Eucalyptus grandis]
Length=426

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            PEA G WPI GHL LF    L H  LG MADKYG IFTIR+G H+ +++S W++AKE ST
Sbjct  36   PEAKGGWPIFGHLLLFGSKDLMHKKLGSMADKYGPIFTIRLGFHRAIIVSSWEVAKEFST  95

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   + RP   A + +GYN  M  F PYG YWREMRK+ + ELLSN R++ LKHIRV 
Sbjct  96   IHDKAFADRPLITATRLMGYNGAMFGFTPYGEYWREMRKIVTIELLSNHRLDLLKHIRVL  155

Query  48   EIETSVKEL  22
            E+E ++KEL
Sbjct  156  EVEMAIKEL  164



>ref|XP_002522370.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF40054.1| cytochrome P450, putative [Ricinus communis]
Length=521

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+AGGAWP++GH++LF G +L H  LG MADK+G +FTI++G H+VL ++ W++A+E  T
Sbjct  35   PQAGGAWPVIGHMHLFGGHQLTHKTLGAMADKHGPVFTIKLGSHRVLTVNSWEMARECFT  94

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            SHD   SSRP   A++ LGY++ M  FAPYG YWREMRK+ + EL S  RI+ LKHIR +
Sbjct  95   SHDRVFSSRPIIAASKLLGYDFAMFGFAPYGDYWREMRKIATIELFSTHRIDMLKHIRTS  154

Query  48   EIETSVKELQDRILG  4
            E++ ++ +L ++ +G
Sbjct  155  EVQIAIGKLYEKWVG  169



>ref|NP_001240077.1| cytochrome P450 82A2 [Glycine max]
 sp|O81972.1|C82A2_SOYBN RecName: Full=Cytochrome P450 82A2; AltName: Full=Cytochrome 
P450 CP4 [Glycine max]
 emb|CAA71515.1| putative cytochrome P450 [Glycine max]
Length=522

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 95/130 (73%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PP   GAWPI+GHL L  GSK PH  LGD+ADKYG IF+I+IG    +V+S+W++AKE  
Sbjct  37   PPTVAGAWPIIGHLPLLLGSKTPHKTLGDLADKYGPIFSIKIGAKNAVVVSNWEMAKECY  96

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D+ +SS P   +A  L YN  M+  APYGPYWR++RK+  SE LS  R+EQL H+RV
Sbjct  97   TTNDIAVSSLPDLISANLLCYNRSMIVVAPYGPYWRQLRKILMSEFLSPSRVEQLHHVRV  156

Query  51   AEIETSVKEL  22
            +E+++S+ EL
Sbjct  157  SEVQSSITEL  166



>ref|NP_001236179.1| cytochrome P450 CYP82C1 [Glycine max]
 gb|AAB94590.1| CYP82C1p [Glycine max]
Length=532

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            GK    P+AGGAWPI+GHL+LF G +  H  LG MA+K+G IFTI++G +KVLV+S W++
Sbjct  37   GKICSAPQAGGAWPIIGHLHLFGGHQHTHKTLGIMAEKHGPIFTIKLGSYKVLVLSSWEM  96

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T HD   S+RP   A++ +GYNY M  F PYGPYWRE+RKLT+ +LLSN R+E L
Sbjct  97   AKECFTVHDKAFSTRPCVAASKLMGYNYAMFGFTPYGPYWREIRKLTTIQLLSNHRLELL  156

Query  66   KHIRVAEIETSVKEL  22
            K+ R +E E +++EL
Sbjct  157  KNTRTSESEVAIREL  171



>gb|KDO43361.1| hypothetical protein CISIN_1g0369161mg, partial [Citrus sinensis]
Length=328

 Score =   156 bits (395),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGSK-LPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            +K  PE GGAWP++GHL+L  G K   HV LG +ADK+G IF I++G+H+ L++S+W++A
Sbjct  39   KKTVPEPGGAWPLIGHLHLLGGQKPAAHVTLGSIADKHGPIFMIKLGMHRALIVSNWEIA  98

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D    +R K  A + LGYNY M  F+PYGPYWR++RK+ + E+LSN R+E LK
Sbjct  99   KECFTTNDKVFCNRIKALAPEILGYNYAMFGFSPYGPYWRQIRKIATLEILSNHRLEMLK  158

Query  63   HIRVAEIETSVKELQD  16
            H+R +E+ TS+KEL D
Sbjct  159  HVRESEVRTSMKELYD  174



>ref|XP_007227272.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
 gb|EMJ28471.1| hypothetical protein PRUPE_ppa017703mg, partial [Prunus persica]
Length=518

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 99/137 (72%), Gaps = 1/137 (1%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRG-SKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            K +  PE  GAWPI+GHL+L  G  +L +  LG MADKYG  F IR+G  +  V+S W++
Sbjct  22   KSREAPEPAGAWPIIGHLHLLGGGDQLLYRTLGAMADKYGSAFNIRLGSRRAFVVSSWEV  81

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T +D  ++SRP   AA+H+GYNY +  FAPY P+WREMRK+ + ELLSNRR+E L
Sbjct  82   AKECFTFNDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATIELLSNRRLEML  141

Query  66   KHIRVAEIETSVKELQD  16
            KH+R +E++T +KELQ+
Sbjct  142  KHVRTSELDTGIKELQN  158



>ref|XP_010664626.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=534

 Score =   160 bits (404),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 103/134 (77%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            +++  PEA GAWP++GHL+L  G +LPH  LG MADKYG +F I++GV +VL++S+W++A
Sbjct  46   RKRTAPEAAGAWPVIGHLHLLGGPELPHKTLGAMADKYGPVFLIKLGVQRVLMLSNWEMA  105

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D   ++RPK  A + LGYNY M  F PYG YWR++RK+ ++ LLSNRR+E +K
Sbjct  106  KECFTTNDKVFANRPKSIAVEVLGYNYAMFGFGPYGSYWRQVRKIVTTGLLSNRRLEIVK  165

Query  63   HIRVAEIETSVKEL  22
            H+ ++E++ S++EL
Sbjct  166  HVWISEVKASIREL  179



>ref|XP_006435899.1| hypothetical protein CICLE_v10031216mg [Citrus clementina]
 gb|ESR49139.1| hypothetical protein CICLE_v10031216mg [Citrus clementina]
Length=528

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/129 (53%), Positives = 101/129 (78%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P AGGAWP++GHL+L RG +  H  LG++ADKYG IFT+++GV + LV+S+W++AKE  T
Sbjct  47   PVAGGAWPLIGHLHLLRGPEPAHRVLGNLADKYGTIFTMKLGVKQALVVSNWEIAKECFT  106

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            ++D   +SRPK  A + +GYN+ ++ FAPYG YWR+ RK+ + ELLSNRR+E+LKH+R +
Sbjct  107  TNDKAFASRPKRMAVELMGYNFSVIGFAPYGKYWRQSRKIVTIELLSNRRLEKLKHVRES  166

Query  48   EIETSVKEL  22
            E++ S++ L
Sbjct  167  EVKASIQRL  175



>ref|XP_007151141.1| hypothetical protein PHAVU_004G021200g [Phaseolus vulgaris]
 gb|ESW23135.1| hypothetical protein PHAVU_004G021200g [Phaseolus vulgaris]
Length=529

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 100/137 (73%), Gaps = 2/137 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            GKQ   P   GAWPILGHL L   S+ PH  LG +AD YG +FTI+ GV + LV+S+W++
Sbjct  36   GKQ--APIVKGAWPILGHLSLLNASQTPHWTLGALADNYGPLFTIKFGVKEALVLSNWEM  93

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            ++EL T++D+ +SSRPK  A + + YN   V  +PYG YWRE+RK+ +SE LSNR+I QL
Sbjct  94   SRELFTTNDLAVSSRPKLVAVEVMSYNQAFVGLSPYGSYWRELRKIVTSEFLSNRKIAQL  153

Query  66   KHIRVAEIETSVKELQD  16
             HIRV+E++TS+KEL +
Sbjct  154  SHIRVSEVQTSMKELCN  170



>ref|XP_007017410.1| Cytochrome P450 82A3, putative [Theobroma cacao]
 gb|EOY14635.1| Cytochrome P450 82A3, putative [Theobroma cacao]
Length=628

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K+K  PEAG +WP+LGHL+L  G +  H+ L  MADKYG IFTI++GV + LV+S W+ 
Sbjct  140  NKKKAAPEAGNSWPVLGHLHLLAGRQPAHLTLSAMADKYGPIFTIKLGVRRALVVSSWET  199

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D   ++RPK  + + LGYN+ M  FAPYGPYWR MRK+T+ ELLSN R++ L
Sbjct  200  AKECLTTNDKAFATRPKNISMEVLGYNHAMFGFAPYGPYWRNMRKITTLELLSNHRLDML  259

Query  66   KHIRVAEIETSVKEL  22
            KH+R +E++ S++EL
Sbjct  260  KHVRESEMKVSLQEL  274


 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = -2

Query  321  ADKYGLIFTIRIGVHKVLVISDWKLAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAP  142
            A  YG IFTI++G+ + +++S+ +LAKE  +++D   ++RPK  A + LGYNY +  F+P
Sbjct  27   AGNYGPIFTIKLGLSQAVIVSNRELAKECLSTNDKVFATRPKSIAFEILGYNYAVFGFSP  86

Query  141  YGPYWREMRKLTS  103
            YG YW  +RKL +
Sbjct  87   YGSYWHHIRKLAT  99



>ref|XP_003546624.1| PREDICTED: cytochrome P450 82A2-like [Glycine max]
Length=521

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PP   GAWPI+GHL L  GSK PH  LGD+ADKYG IF+I++G    +VIS+W++AKE  
Sbjct  36   PPTVAGAWPIIGHLPLLLGSKTPHKTLGDLADKYGPIFSIKLGAKNAVVISNWEMAKECY  95

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D+ +SS P   +A  L YN  M+  APYGPYWR+MRK+  SE LS  R+EQL H+RV
Sbjct  96   TTNDIAVSSLPNLISANLLCYNRSMILVAPYGPYWRQMRKILMSEFLSPSRVEQLHHVRV  155

Query  51   AEIETSVKEL  22
            +E++ S+ +L
Sbjct  156  SEVQNSITDL  165



>ref|XP_006375025.1| hypothetical protein POPTR_0014s03700g [Populus trichocarpa]
 gb|ERP52822.1| hypothetical protein POPTR_0014s03700g [Populus trichocarpa]
Length=569

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K++ PPEA GAWP++GHL+L  GS+ PH+ LG++ADKYG IFT+++GVH+ L++S+W++
Sbjct  76   SKKRAPPEAAGAWPLIGHLHLLGGSQPPHITLGNLADKYGPIFTVKLGVHRTLIVSNWEM  135

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE   ++D   ++RPK  A   LGYNY M+ F+PYG YWR +RK+ + E+LSN R+E  
Sbjct  136  AKECLRTNDKAFATRPKTLAMDILGYNYSMLGFSPYGTYWRLIRKIVTLEVLSNHRLEMF  195

Query  66   KHIRVAEIETSVKELQDRILG  4
            KH+R  E+  +V  L  +  G
Sbjct  196  KHVREDEVRDAVGALYQQWTG  216



>emb|CDP07595.1| unnamed protein product [Coffea canephora]
Length=880

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 101/133 (76%), Gaps = 2/133 (2%)
 Frame = -2

Query  414  LPPEAGGAWPILGHLYLF-RG-SKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            +PPEAGGAWPI+GHL+L  RG  +LPH+ L  +A+KYG  FTIR+GVHK LV+S W+LAK
Sbjct  392  VPPEAGGAWPIIGHLHLLGRGPERLPHITLAALAEKYGPAFTIRLGVHKNLVVSSWELAK  451

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            E+ T+HD+  +SRP   A++ L Y Y    FAPYG YWREMRK+ S ELLS +R+E LKH
Sbjct  452  EIFTTHDLAAASRPNSLASELLSYGYASFGFAPYGDYWREMRKVISIELLSTKRLELLKH  511

Query  60   IRVAEIETSVKEL  22
            +R++E + S K+L
Sbjct  512  VRISETDLSTKDL  524



>ref|XP_007151144.1| hypothetical protein PHAVU_004G021500g [Phaseolus vulgaris]
 gb|ESW23138.1| hypothetical protein PHAVU_004G021500g [Phaseolus vulgaris]
Length=519

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K  P   GAWPILGHL L   SK PH  LG +ADKYG IFTI++G    LVI++W+ AKE
Sbjct  30   KEAPTVAGAWPILGHLPLLSASKRPHRTLGALADKYGPIFTIKLGAKSALVINNWETAKE  89

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
              T++D+ +SSRPK  AA+H+ YN  M   APYGPYWR++RK+T SE+LS  R++QL+H+
Sbjct  90   CFTTNDIVVSSRPKLVAAEHMSYNQAMFVVAPYGPYWRKIRKITVSEILSPLRVKQLRHV  149

Query  57   RVAEIETSVKELQD  16
              +E+E S+KEL D
Sbjct  150  FESEVEGSIKELFD  163



>gb|KCW68803.1| hypothetical protein EUGRSUZ_F02402, partial [Eucalyptus grandis]
Length=525

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PP A GAWPI GHL+L  G   PH+ LG MADKYG IF I++G H+ +V+S  +LAKE  
Sbjct  43   PPSAAGAWPITGHLHLLGGPDPPHITLGQMADKYGPIFAIKLGSHQAIVVSGSELAKECF  102

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D    +RPK+ AA+ LGYNY M+ F+PYGPYWR +RK+ + ELLSN  +E+L+H+R 
Sbjct  103  TTNDKAFCNRPKYLAAELLGYNYAMLGFSPYGPYWRHVRKIATLELLSNHTLEKLRHVRE  162

Query  51   AEIETSVKELQDR  13
            A +  S+KE  +R
Sbjct  163  AVVRASIKEAYER  175



>ref|XP_007136643.1| hypothetical protein PHAVU_009G061500g [Phaseolus vulgaris]
 gb|ESW08637.1| hypothetical protein PHAVU_009G061500g [Phaseolus vulgaris]
Length=520

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 104/136 (76%), Gaps = 1/136 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLP-HVALGDMADKYGLIFTIRIGVHKVLVISDWK  250
            G  + PPEA GAWP++GHL+LF  S  P + ALG +ADKYG IF+IRIGVH  +V+S W+
Sbjct  25   GSARKPPEAAGAWPLIGHLHLFGRSGQPLYEALGGLADKYGPIFSIRIGVHHAVVVSSWE  84

Query  249  LAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQ  70
            LAKE  T+ DV +SSRPKF AA+ L Y+Y   +F+PYG +WR+M K+T S+LLS RR E 
Sbjct  85   LAKECFTTLDVVVSSRPKFTAAKILTYDYASFAFSPYGDFWRDMHKITVSDLLSTRRGEL  144

Query  69   LKHIRVAEIETSVKEL  22
            L+ IRV+E+++S++EL
Sbjct  145  LRGIRVSEVQSSLREL  160



>ref|XP_010064743.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=526

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PP A GAWPI GHL+L  G   PH+ LG MADKYG IF I++G H+ +V+S  +LAKE  
Sbjct  43   PPSAAGAWPITGHLHLLGGPDPPHITLGQMADKYGPIFAIKLGSHQAIVVSGSELAKECF  102

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D    +RPK+ AA+ LGYNY M+ F+PYGPYWR +RK+ + ELLSN  +E+L+H+R 
Sbjct  103  TTNDKAFCNRPKYLAAELLGYNYAMLGFSPYGPYWRHVRKIATLELLSNHTLEKLRHVRE  162

Query  51   AEIETSVKELQDR  13
            A +  S+KE  +R
Sbjct  163  AVVRASIKEAYER  175



>emb|CDP16080.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 102/135 (76%), Gaps = 2/135 (1%)
 Frame = -2

Query  414  LPPEAGGAWPILGHLYLFRGS--KLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            +PPEAGGAWPI+GHL+L   +  KLPH+ L  +ADKYG  FTIR+GVHK L+IS+ +LAK
Sbjct  38   VPPEAGGAWPIIGHLHLLGRAPEKLPHITLAALADKYGPAFTIRLGVHKTLIISNRELAK  97

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            E+ T+HD+  + RP + A + L Y+   + FAPYG YWRE+RKLT++ELLS +R+E L+H
Sbjct  98   EIFTTHDLAAAGRPNYLAGKLLNYDNAALGFAPYGAYWREIRKLTATELLSTKRLELLRH  157

Query  60   IRVAEIETSVKELQD  16
            +RV+E E S + L +
Sbjct  158  LRVSETEISTRNLYN  172



>ref|XP_003619141.1| Cytochrome P450 [Medicago truncatula]
 gb|AES75359.1| cytochrome P450 family protein [Medicago truncatula]
Length=525

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 95/134 (71%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K K PP   GAWPI+GHL L   S+  H  LG MADKYG IFTI++G    LVI++W+ A
Sbjct  30   KTKQPPMVAGAWPIIGHLPLLSKSQATHHLLGAMADKYGPIFTIKLGTATTLVINNWETA  89

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D  +S RP   A +H+ YN+ M+ FAPYGP+WREMRK+ +   LSN RI+ L 
Sbjct  90   KECYTTNDTAVSYRPNLVAFKHMTYNHAMLGFAPYGPFWREMRKIVTLSFLSNHRIDLLT  149

Query  63   HIRVAEIETSVKEL  22
            H+RV+E++TS+KEL
Sbjct  150  HVRVSEVQTSIKEL  163



>ref|XP_010070482.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW59277.1| hypothetical protein EUGRSUZ_H01953 [Eucalyptus grandis]
Length=528

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            PEA G WPI GHL LF    L H  LG MADKYG IFTIR+G H+ +++S W++AKE ST
Sbjct  36   PEAKGGWPIFGHLLLFGSKDLMHKKLGSMADKYGPIFTIRLGFHRAIIVSSWEVAKEFST  95

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   + RP   A + +GYN  M  F PYG YWREMRK+ + ELLSN R++ LKHIRV 
Sbjct  96   IHDKAFADRPLITATRLMGYNGAMFGFTPYGEYWREMRKIVTIELLSNHRLDLLKHIRVL  155

Query  48   EIETSVKEL  22
            E+E ++KEL
Sbjct  156  EVEMAIKEL  164



>ref|XP_009365841.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=537

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLF-RGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKEL  235
            PPEA G+WP++GH+ +  RG + PHV LG+MADKYG IFTI +G HK L++S W++AK+ 
Sbjct  36   PPEAPGSWPVIGHIPVIGRGPQPPHVILGNMADKYGPIFTINLGQHKALIVSSWEMAKQC  95

Query  234  STSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIR  55
             T++D   ++RPK  A + LGYNY M  F+PYGPYWR +RK+ + ELLSN R+E L+H+R
Sbjct  96   FTTNDKVFATRPKHLAGKLLGYNYSMFGFSPYGPYWRHVRKIATVELLSNHRLELLRHVR  155

Query  54   VAEIETSVKELQDR  13
             +E+    K+L D+
Sbjct  156  ESEVNACTKDLYDK  169



>ref|XP_003619137.1| Cytochrome P450 [Medicago truncatula]
 gb|AES75355.1| cytochrome P450 family protein [Medicago truncatula]
Length=521

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/137 (52%), Positives = 94/137 (69%), Gaps = 0/137 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K K PP   G WPI+GHL LF  S+  H  LG MADKYG IFTI++G    L I++WK 
Sbjct  29   NKTKQPPMVAGTWPIIGHLPLFSKSQATHHLLGSMADKYGPIFTIKLGTATTLAINNWKT  88

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D+ ++ RP   A +H+ YNY M+ FAPYGP+WREMRK+ +   LSN +I  L
Sbjct  89   AKECYTTNDIAVAYRPNLVAFEHMTYNYAMLGFAPYGPFWREMRKIVTLNFLSNHQINLL  148

Query  66   KHIRVAEIETSVKELQD  16
             HI V+E++TS+KEL +
Sbjct  149  THICVSEVQTSIKELYN  165



>gb|KHG29694.1| Cytochrome P450 [Gossypium arboreum]
Length=522

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P A GAWPI+GHL L  G K PH  LGD+ +KYG  + IRIGVH  LV++  ++AKE+ T
Sbjct  39   PVAAGAWPIIGHLPLLGGPKTPHETLGDLGEKYGPAYMIRIGVHPALVVNSSEVAKEIFT  98

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             +D+++SSR +F AA+HLGYNY M  F+PYG YWREMRK+T  E+LSN RI+QLK + V+
Sbjct  99   VNDMYVSSRSEFAAAEHLGYNYAMFGFSPYGQYWREMRKITMLEVLSNHRIDQLKKVFVS  158

Query  48   EIETSVKEL  22
            EIE S+K L
Sbjct  159  EIEGSMKLL  167



>gb|AII31758.1| cytochrome P450 monooxygenase [Gossypium hirsutum]
Length=522

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/129 (58%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P A GAWPI+GHL L  G K PH  LGD+ +KYG  + IRIGVH  LV++  ++AKE+ T
Sbjct  39   PVAAGAWPIIGHLPLLGGPKTPHETLGDLGEKYGPAYMIRIGVHPALVVNSSEVAKEIFT  98

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             +D+++SSR +F AA+HLGYNY M  F+PYG YWREMRK+T  E+LSN RI+QLK + V+
Sbjct  99   VNDMYVSSRSEFAAAEHLGYNYAMFGFSPYGQYWREMRKITMLEVLSNHRIDQLKKVFVS  158

Query  48   EIETSVKEL  22
            EIE S+K L
Sbjct  159  EIEGSMKLL  167



>ref|XP_011030958.1| PREDICTED: cytochrome P450 CYP82D47-like isoform X3 [Populus 
euphratica]
Length=527

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K++ PPEA GAWP++GHL+L RGS+ PH+ LG++ADK+G IFT+++GVH+ L++S+W++
Sbjct  34   NKKRAPPEAAGAWPLIGHLHLLRGSQPPHITLGNLADKHGPIFTVKLGVHRALIVSNWEM  93

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE    +D   ++RPK  A   LGYNY ++SF+PYG YWR +RK+ + E+LSN R+E  
Sbjct  94   AKECLRINDKAFATRPKTLAMDILGYNYSILSFSPYGTYWRLIRKIVTLEVLSNHRLEMF  153

Query  66   KHIRVAEIETSVKEL  22
            KH+R  E+  +V  L
Sbjct  154  KHVREDEVRDAVGAL  168



>ref|XP_006435901.1| hypothetical protein CICLE_v10031635mg [Citrus clementina]
 gb|ESR49141.1| hypothetical protein CICLE_v10031635mg [Citrus clementina]
Length=423

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P A GAWP++GHL+L RG +  H  LG++ADKYG IFT+++GV   LV+S+W++AKE  T
Sbjct  47   PVAEGAWPLIGHLHLLRGPEPAHRVLGNLADKYGTIFTMKLGVKHALVVSNWEIAKECFT  106

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            ++D   + RPK  A + +GYN+L++ FAPYG YWR+ RK+ + ELLSNRR+E+LKH+R +
Sbjct  107  TNDKAFAGRPKTMAVELMGYNFLVIGFAPYGNYWRQSRKIVTIELLSNRRLEKLKHVRES  166

Query  48   EIETSVKEL  22
            E++ S++ L
Sbjct  167  EVKASIQRL  175



>ref|XP_003516592.1| PREDICTED: cytochrome P450 82A3-like isoform X1 [Glycine max]
Length=530

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+A GAWPI+GHL+LF G +L H  LG MA+K+G IFTI++G +KVLV+S W++AKE  T
Sbjct  40   PQAAGAWPIIGHLHLFNGHQLTHKTLGMMAEKHGPIFTIKLGSYKVLVLSSWEMAKECFT  99

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   S+RP   A++ +GYNY M  F PYG YWR++RKLT+ ELLSN R+E LK  R  
Sbjct  100  VHDKAFSTRPCVAASKLMGYNYAMFGFTPYGSYWRQVRKLTTIELLSNNRLEPLKETRTF  159

Query  48   EIETSVKEL  22
            E++ +VKEL
Sbjct  160  ELDAAVKEL  168



>ref|XP_006431672.1| hypothetical protein CICLE_v10001614mg [Citrus clementina]
 gb|ESR44912.1| hypothetical protein CICLE_v10001614mg [Citrus clementina]
Length=361

 Score =   156 bits (394),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            +K  PE GGAWP++GHL+L  G K  +V LG++A+K G IF I++G+H+ L++S+W++AK
Sbjct  60   KKPVPEPGGAWPLIGHLHLLGGQKPAYVTLGNIAEKCGPIFMIKLGMHRALIVSNWEIAK  119

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            E  T++D   S+R K  A + LGYNY M  F+PYGPYWR++RK+ + E+LSN R+E LKH
Sbjct  120  ECFTTNDKVFSNRIKALAPEILGYNYAMFGFSPYGPYWRQIRKIATLEVLSNHRLEMLKH  179

Query  60   IRVAEIETSVKELQD  16
            +R +E+ TS+KEL D
Sbjct  180  VRESEVRTSMKELYD  194



>ref|XP_004489342.1| PREDICTED: cytochrome P450 82A1-like [Cicer arietinum]
Length=539

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K+PP   G+WPILGHL L R ++ PH  LG +ADKYG IFTI++G    LV+S+W+LAKE
Sbjct  35   KVPPTISGSWPILGHLPLMRSTQTPHKTLGALADKYGPIFTIKLGAKHALVLSNWELAKE  94

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
              T +D  +SSRPK  A + + YN   + +APYG YWR++RK+ + E+LSNRRIE L HI
Sbjct  95   CFTKNDTVVSSRPKPIAVELMSYNQAFIGWAPYGTYWRQLRKIVTLEILSNRRIELLSHI  154

Query  57   RVAEIETSVKEL  22
            RV+E++ S+KEL
Sbjct  155  RVSEVQISIKEL  166



>ref|XP_008220885.1| PREDICTED: cytochrome P450 82A3-like [Prunus mume]
Length=1017

 Score =   162 bits (409),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            P EA GAWPI GHL L  GS  PH+ L  MADKYG +FTIR+GV+  LVIS  ++AKE  
Sbjct  528  PTEAKGAWPIFGHLPLLGGSTPPHIKLAAMADKYGPLFTIRLGVYPSLVISSSEIAKECF  587

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D+  SSRPK    +H+GYN+ M  FAP GP+WREMRK+T+ +LLSNRR+E L+HIRV
Sbjct  588  TTNDLASSSRPKLVVVEHVGYNHAMFGFAPSGPFWREMRKITTLKLLSNRRLELLRHIRV  647

Query  51   AEIETSVKEL  22
            +E+ T ++EL
Sbjct  648  SEVTTFLQEL  657


 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            KLP  AGG WP+LGHL LF GS+LPH+AL  + DKYG  FTI IG+H  LVIS W++AK+
Sbjct  50   KLPKVAGG-WPLLGHLGLFGGSQLPHIALASLVDKYGPAFTINIGIHSALVISTWEVAKD  108

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
              T++D+ +SSRP    A+HLGYN+ M  F+PYGPYWREMRKLTS ELLSNRR+E LK +
Sbjct  109  CFTTNDMVVSSRPATLGAKHLGYNFAMFGFSPYGPYWREMRKLTSLELLSNRRLELLKKV  168

Query  57   RVAEIETSVKEL  22
            RV+E+E S+KEL
Sbjct  169  RVSEVEMSLKEL  180



>gb|KHN36187.1| Cytochrome P450 82A3 [Glycine soja]
Length=530

 Score =   159 bits (401),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+A GAWPI+GHL+LF G +L H  LG MA+K+G IFTI++G +KVLV+S W++AKE  T
Sbjct  40   PQAAGAWPIIGHLHLFNGHQLTHKTLGMMAEKHGPIFTIKLGSYKVLVLSSWEMAKECFT  99

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   S+RP   A++ +GYNY M  F PYG YWR++RKLT+ ELLSN R+E LK  R  
Sbjct  100  VHDKAFSTRPCVAASKLMGYNYAMFGFTPYGSYWRQVRKLTTIELLSNNRLEPLKDTRTF  159

Query  48   EIETSVKEL  22
            E++ +VKEL
Sbjct  160  ELDAAVKEL  168



>ref|XP_007151142.1| hypothetical protein PHAVU_004G021300g [Phaseolus vulgaris]
 gb|ESW23136.1| hypothetical protein PHAVU_004G021300g [Phaseolus vulgaris]
Length=519

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K  P   GAWPILGHL L   SK PH  LG +ADKYG IFTI++G  K LVI++W+ AKE
Sbjct  30   KEAPTVAGAWPILGHLPLMSASKSPHRTLGALADKYGPIFTIKLGAKKALVINNWETAKE  89

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
              T++D+ +SSRPK  AA+H+ YN  M + AP GPYW+++RK+T SE+LS +R++QL+H+
Sbjct  90   CFTTNDIVVSSRPKLVAAEHMSYNKAMFALAPCGPYWQKIRKITVSEILSPQRVKQLRHV  149

Query  57   RVAEIETSVKELQD  16
              +E+E S+KEL +
Sbjct  150  FESEVEESIKELSN  163



>gb|KCW44328.1| hypothetical protein EUGRSUZ_L02217 [Eucalyptus grandis]
Length=499

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 91/129 (71%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            PEA G WPI+GHL LF    L H  LG MADKYG IFTIR+G H+ +V+S W++AKE  T
Sbjct  36   PEAEGGWPIVGHLPLFSSKDLMHKKLGSMADKYGPIFTIRLGSHRAIVVSSWEVAKECFT  95

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   + RP   A + +GYN  M  FAPYG YWREMRK+ + ELLSN R++ LKHIR  
Sbjct  96   VHDKTFADRPMITATKLMGYNGAMFGFAPYGEYWREMRKIATIELLSNHRLDSLKHIRAF  155

Query  48   EIETSVKEL  22
            E+ET++K+L
Sbjct  156  EVETAIKDL  164



>gb|KDP38429.1| hypothetical protein JCGZ_04354 [Jatropha curcas]
Length=498

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
              ++LPP+A G WP +GHL+L  GS+  H+ LG+MA+KYG IFTI++GVH  L++S  ++
Sbjct  4    NNKRLPPKADGGWPFIGHLHLLAGSQPAHITLGNMAEKYGPIFTIKLGVHPTLIVSSREM  63

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D   +SRPK  A + LGYNY MV F+PYG YWR MRK+ + ELLSN R+E L
Sbjct  64   AKECLTTNDKAFASRPKGLAMEILGYNYCMVGFSPYGDYWRHMRKIITLELLSNHRLEML  123

Query  66   KHIRVAEIETSVKEL  22
            K++R AE++ ++K L
Sbjct  124  KNVREAEVKMAIKGL  138



>gb|KGN59916.1| hypothetical protein Csa_3G853140 [Cucumis sativus]
Length=315

 Score =   154 bits (390),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            +++LPP+AGGAWP++GHL+L   S+  H+ L  MAD YG +FT R G+ + L++S+W LA
Sbjct  32   RKRLPPKAGGAWPVIGHLHLLNASEPTHITLAKMADAYGPMFTFRFGMKRALIVSNWDLA  91

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE+ T++D   +SRPK  A++ L Y+Y M+ F+PY P+WR +RK+ + ELL+N R++QL+
Sbjct  92   KEIFTTNDRIFASRPKLVASKILAYDYAMMGFSPYSPHWRYVRKIATLELLTNHRVDQLQ  151

Query  63   HIRVAEIETSVKELQD  16
            +IR  E+ET ++EL +
Sbjct  152  YIRAFEVETWMEELYE  167



>ref|XP_004489341.1| PREDICTED: cytochrome P450 82A3-like [Cicer arietinum]
Length=528

 Score =   158 bits (400),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
             K + PP A GAWPILGHL +  GSK PH  LG MA+KYG +FTI++G    LV+S+W++
Sbjct  35   NKGREPPMASGAWPILGHLLVLAGSKTPHKTLGTMANKYGPLFTIKLGSKCALVLSNWEM  94

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T +D+ +SSR K  A +H+ YN     FAPYGP+WREMRK+ +   LSNRR+E L
Sbjct  95   AKECYTINDLVVSSRSKLVAIEHIAYNQASFGFAPYGPFWREMRKIVTM-FLSNRRMELL  153

Query  66   KHIRVAEIETSVKEL  22
             H+RV E++TS+KEL
Sbjct  154  SHVRVIEVKTSIKEL  168



>ref|XP_008378401.1| PREDICTED: cytochrome P450 CYP82D47-like [Malus domestica]
Length=528

 Score =   158 bits (400),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 96/133 (72%), Gaps = 0/133 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PP+  G  P+LGHL LF GS+LPH+ LG + DK G IFT  IG+H  LVI+ W+ AKE  
Sbjct  40   PPKLAGGLPLLGHLDLFGGSQLPHITLGALVDKXGPIFTFNIGIHSALVINTWEAAKECF  99

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D  +SSRP     +HL Y++ M  F+PYGPYWR++RKLTS ELLSNRR+E LK +RV
Sbjct  100  TTNDSIVSSRPATLGIKHLSYDFAMFGFSPYGPYWRKIRKLTSLELLSNRRLELLKSVRV  159

Query  51   AEIETSVKELQDR  13
            +E+E  +K+L  R
Sbjct  160  SEVEMRLKKLYKR  172



>gb|KCW85809.1| hypothetical protein EUGRSUZ_B02554, partial [Eucalyptus grandis]
Length=487

 Score =   158 bits (399),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            PEAGGAWP++GHL+L  G   PH+ L  MADKYG IFTI+ GVH+ L++S W++AK+  T
Sbjct  3    PEAGGAWPLIGHLHLLGGPVPPHIILASMADKYGPIFTIKTGVHRALIVSKWQIAKQCLT  62

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             +D   +SRPK  +++ + YNY M   APYGPYWR++RK+T  ELLSN R+E LKH+R +
Sbjct  63   VNDRAFASRPKSVSSEVMAYNYAMFGLAPYGPYWRQVRKVTMLELLSNHRLELLKHVRHS  122

Query  48   EIETSVKELQDRIL  7
            E++ SV  L  R +
Sbjct  123  EVQASVTHLYKRCM  136



>ref|XP_002510313.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52500.1| cytochrome P450, putative [Ricinus communis]
Length=528

 Score =   158 bits (400),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K+K  PEAGGAWP++GHL+L RG +  H+  G+MADKYG IFTI++GVH  LV S+W++A
Sbjct  34   KKKAAPEAGGAWPLIGHLHLLRGPQPSHIVFGNMADKYGPIFTIKMGVHPTLVASNWEMA  93

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D   ++RP   A   LGY   M +F+PYG YWR++RK+++ ELLSN R++   
Sbjct  94   KECFTTNDKAFANRPNILAMDLLGYGRSMFAFSPYGNYWRQIRKISTLELLSNHRLQMFN  153

Query  63   HIRVAEIETSVKEL  22
            H+R +E+ T++KEL
Sbjct  154  HVRESEVGTALKEL  167



>ref|XP_009364154.1| PREDICTED: cytochrome P450 CYP82D47-like [Pyrus x bretschneideri]
Length=523

 Score =   158 bits (400),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 99/129 (77%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+  G WP+LGH++L  G +LPH+ LG + DKYG +F+I +G++  LV++ W+ AKE  T
Sbjct  40   PKVVGGWPLLGHIHLLAGPELPHILLGRLVDKYGPVFSINVGLNSALVVNCWEAAKECFT  99

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            ++D+ +SSRPK    +HL YN  +V+++PYGPYWRE+RK+ + ELLSN R+E LKH+RV+
Sbjct  100  TNDLAVSSRPKIVGVEHLSYNGALVAYSPYGPYWREIRKIATHELLSNSRLELLKHVRVS  159

Query  48   EIETSVKEL  22
            E+E S+KEL
Sbjct  160  EVEMSLKEL  168



>gb|KCW68807.1| hypothetical protein EUGRSUZ_F02406 [Eucalyptus grandis]
Length=502

 Score =   158 bits (399),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            PEAGGAWP++GHL+L  G   PH+ L  MADKYG IFTI+ GVH+ L++S+W++AK+  T
Sbjct  18   PEAGGAWPLIGHLHLLGGPVPPHIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLT  77

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             +D   +SRPK  +++ + YNY M   APYGPYWR +RK+T  ELLSN R+E LKH+R +
Sbjct  78   VNDRAFASRPKSVSSEVMAYNYAMFGLAPYGPYWRHVRKITMLELLSNHRLELLKHVRHS  137

Query  48   EIETSVKELQDRIL  7
            E++ SV  L  R +
Sbjct  138  EVQASVTHLYKRCM  151



>ref|XP_006471496.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=525

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++  PEAGG+WP++GHL+L  G + PH  LG MAD+YG IF I++G+++ LV+S+W++A
Sbjct  41   KKREAPEAGGSWPVIGHLHLLGGPEPPHRVLGKMADEYGPIFKIKMGINRALVVSNWEMA  100

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T+HD   +SRPK  A + LGYN+ M  F+PYG YWRE RK+ + ELLSN R+ +L+
Sbjct  101  KECLTTHDKVFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLGKLR  160

Query  63   HIRVAEIETSVKEL  22
            H+R  E++TS+K+L
Sbjct  161  HVREYELKTSLKDL  174



>emb|CBI19611.3| unnamed protein product [Vitis vinifera]
Length=929

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            +++  PEA GAWP++GHL+L  GS+LPH  LG MADKYG IF I++G   VLV+S+W++A
Sbjct  33   RKRTAPEAAGAWPVIGHLHLLGGSELPHKTLGAMADKYGPIFFIKLGARPVLVVSNWEIA  92

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D   ++RPK  A + +GYN  M  F+PYG YWR+MRK+ ++ LLSNR +E LK
Sbjct  93   KECFTTNDKAFANRPKLIAVEVMGYNNAMFGFSPYGSYWRQMRKIVTTHLLSNRSLEMLK  152

Query  63   HIRVAEIETSVKELQD  16
             +R++E++ ++KEL +
Sbjct  153  LVRISEVKATIKELHE  168



>ref|XP_006471495.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=525

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++  PEAGG+WP++GHL+L  G + PH  LG MAD+YG IF I++G+++ LV+S+W++A
Sbjct  41   KKREAPEAGGSWPVIGHLHLLGGPEPPHRVLGKMADEYGPIFKIKMGINRALVVSNWEMA  100

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T+HD   +SRPK  A + LGYN+ M  F+PYG YWRE RK+ + ELLSN R+ +L+
Sbjct  101  KECLTTHDKVFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLGKLR  160

Query  63   HIRVAEIETSVKEL  22
            H+R  E++TS+K+L
Sbjct  161  HVREYELKTSLKDL  174



>ref|XP_008464766.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=521

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 102/139 (73%), Gaps = 0/139 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            ++KLPPE  G WP++GHL+L   ++  H+ L  +AD YG IFT+++G+ K LV+S W++A
Sbjct  38   RKKLPPEPAGHWPVIGHLHLLSATEPAHITLAKLADTYGPIFTLKLGMSKALVVSSWEIA  97

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D   +SRPK  A++ LGYNY M+  +PYGPYWR +RKL + ELL+NRR+ Q +
Sbjct  98   KECFTTNDRIFASRPKLVASKLLGYNYNMLGLSPYGPYWRHIRKLATLELLTNRRLHQFQ  157

Query  63   HIRVAEIETSVKELQDRIL  7
            HIR  E++TS+K+L +  +
Sbjct  158  HIREFEVQTSIKKLYESCI  176



>gb|KDO38174.1| hypothetical protein CISIN_1g0106221mg, partial [Citrus sinensis]
Length=335

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPE  GAWP +GHL+L   ++L H  LG MADKYG  F IR+G+ + LVIS W++AKE  
Sbjct  40   PPEPEGAWPFIGHLHLLEKNQLLHQTLGKMADKYGKAFMIRLGIRQALVISSWEVAKECF  99

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D   SSRPKF A + +GY++ M+ FAPYGPYWR +RKL + ELLSN ++E +KH+R 
Sbjct  100  TTNDKLFSSRPKFLAVKLMGYDHAMLGFAPYGPYWRNIRKLATVELLSNHQLELIKHVRD  159

Query  51   AEIETSVKEL  22
             E +  +KEL
Sbjct  160  IETKIFIKEL  169



>ref|XP_006366471.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=521

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 99/135 (73%), Gaps = 3/135 (2%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSK---LPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            PEAGGAWPI+GHL+  RGSK   LPH  L  MADKYG IF +++GVH+V+V+SD KLAKE
Sbjct  37   PEAGGAWPIIGHLHFLRGSKTDQLPHRTLSRMADKYGSIFGMKLGVHQVVVVSDPKLAKE  96

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
              T++D+ ++ RPK   ++ +GY + M     YGPYWRE RK+ + ELLSNRRIE LKHI
Sbjct  97   CFTTNDLALAGRPKSMGSEIMGYKHAMFGLCSYGPYWRETRKIATVELLSNRRIEMLKHI  156

Query  57   RVAEIETSVKELQDR  13
            R  E+++ +KE+ + 
Sbjct  157  REFEVKSGIKEIYNN  171



>ref|XP_010064745.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=532

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            PEAGGAWP++GHL+L  G   PH+ L  MADKYG IFTI+ GVH+ L++S+W++AK+  T
Sbjct  48   PEAGGAWPLIGHLHLLGGPVPPHIILASMADKYGPIFTIKTGVHRALIVSNWQIAKQCLT  107

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             +D   +SRPK  +++ + YNY M   APYGPYWR +RK+T  ELLSN R+E LKH+R +
Sbjct  108  VNDRAFASRPKSVSSEVMAYNYAMFGLAPYGPYWRHVRKITMLELLSNHRLELLKHVRHS  167

Query  48   EIETSVKELQDRIL  7
            E++ SV  L  R +
Sbjct  168  EVQASVTHLYKRCM  181



>ref|XP_010046449.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
Length=532

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            PEAGGAWP++GHL+L  G   PH+ L  MADKYG IFTI+ GVH+ L++S W++AK+  T
Sbjct  48   PEAGGAWPLIGHLHLLGGPVPPHIILASMADKYGPIFTIKTGVHRALIVSKWQIAKQCLT  107

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             +D   +SRPK  +++ + YNY M   APYGPYWR++RK+T  ELLSN R+E LKH+R +
Sbjct  108  VNDRAFASRPKSVSSEVMAYNYAMFGLAPYGPYWRQVRKVTMLELLSNHRLELLKHVRHS  167

Query  48   EIETSVKELQDRIL  7
            E++ SV  L  R +
Sbjct  168  EVQASVTHLYKRCM  181



>gb|AII31760.1| cytochrome P450 monooxygenase [Gossypium hirsutum]
Length=522

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PP A GAWPI+GHL L  G K PH +LGD+ +KYG  +TIRIGVH  LV++   +AKE+ 
Sbjct  38   PPVAAGAWPIIGHLPLLGGPKAPHESLGDLGEKYGPAYTIRIGVHPALVVNSSDVAKEIF  97

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T +D+++SSR +F AA+HLGYNY M  F+PY  +WREMRK+T  E+LSN RI+QLK +  
Sbjct  98   TVNDMYVSSRSEFAAAEHLGYNYAMFGFSPYRQFWREMRKITMLEVLSNHRIDQLKKVFA  157

Query  51   AEIETSVKELQD  16
            +EIE S+K L +
Sbjct  158  SEIEGSMKLLYN  169



>ref|XP_006366435.1| PREDICTED: cytochrome P450 82A3-like [Solanum tuberosum]
Length=517

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 70/133 (53%), Positives = 99/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            + K  PEA GAWPI+GHL+L  G ++PH   G MA+KYG IF +++GV+ V+++SD K+A
Sbjct  30   QSKNVPEAAGAWPIIGHLHLLNGPQMPHKIFGQMAEKYGPIFRLKLGVNDVVIVSDHKIA  89

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D   ++RPK  A++ LGYNY M    PYGPYWRE+RK+ ++E LS RRIE LK
Sbjct  90   KECFTTNDKAFANRPKSIASEILGYNYAMFGLGPYGPYWREIRKIVTTEFLSARRIEMLK  149

Query  63   HIRVAEIETSVKE  25
            H+R  E++++VKE
Sbjct  150  HVREFEVKSAVKE  162



>gb|AAG09208.1|AF175278_1 wound-inducible P450 hydroxylase [Pisum sativum]
Length=540

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K PP   G+WP+LGHL L R ++ PH  LG + DKYG IFTI++G    LV+S+W+LAKE
Sbjct  35   KEPPIVSGSWPLLGHLPLMRNTQTPHKTLGALVDKYGPIFTIKLGATNALVLSNWELAKE  94

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
              T +D+ +SSRPK  A + + YN   + +APYG YWR++RK+ + E+LSNRRIE L HI
Sbjct  95   CFTKNDIVVSSRPKPVAVELMSYNQAFIGWAPYGTYWRQLRKIVTLEILSNRRIELLSHI  154

Query  57   RVAEIETSVKEL  22
            RV+E++TS+KEL
Sbjct  155  RVSEVQTSIKEL  166



>gb|KDO57198.1| hypothetical protein CISIN_1g044206mg, partial [Citrus sinensis]
Length=245

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++  PEA G+WP++GHL+L  G +  H  LG MAD+YG IF I++G+++ LV+S+W++A
Sbjct  41   KKREAPEARGSWPVIGHLHLLGGPEPSHWVLGKMADEYGPIFKIKMGINRALVVSNWEMA  100

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T+HD   +SRPK  A + LGYN+ M  F+PYG YWRE+RK+ + ELLSN R+ +L+
Sbjct  101  KECLTTHDKVFASRPKTLAMEILGYNFSMFGFSPYGSYWREIRKIATLELLSNHRLGKLR  160

Query  63   HIRVAEIETSVKELQD  16
            H+R  E++TS+K+L +
Sbjct  161  HVREYELKTSLKDLYE  176



>dbj|BAF98469.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=511

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K  PEA GAWPI+GHL+L  GS+L H  LG MADKYG IF IRIGV+  LV+S+  +AKE
Sbjct  23   KEAPEAPGAWPIIGHLHLLGGSELRHKTLGAMADKYGPIFKIRIGVNHALVVSNSDIAKE  82

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
              T++D   +SRP   A++ LGY+Y+M   APYG YW E+RK+T SELLSNRR+E LKH+
Sbjct  83   CFTTNDKAFASRPTSTASKILGYDYVMFGMAPYGQYWVELRKITMSELLSNRRLELLKHV  142

Query  57   RVAEIETSVKEL  22
            R +EI+ S+++L
Sbjct  143  RDSEIDASIQDL  154



>ref|XP_003537400.1| PREDICTED: cytochrome P450 82A3-like [Glycine max]
Length=538

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+A GAWPI+GHL+LF   +L H  LG MA+K+G IFTI++G +KVLV+S W++AKE  T
Sbjct  40   PQAAGAWPIIGHLHLFNAHQLTHKTLGKMAEKHGPIFTIKLGSYKVLVLSSWEMAKECFT  99

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            +HD   S+RP   A++ +GYNY M  F PYG YWR++RKLT+ ELLSN R+E LK  R  
Sbjct  100  AHDKAFSTRPCVAASKLMGYNYAMFGFTPYGSYWRQVRKLTTIELLSNNRLEPLKDTRTV  159

Query  48   EIETSVKEL  22
            E++ +++EL
Sbjct  160  ELDAAIREL  168



>ref|XP_006471473.1| PREDICTED: cytochrome P450 82A3-like [Citrus sinensis]
Length=525

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++  PEAGG+WP++GHL L  G + PH  LG +AD+YG IFTI++G+++ LV+S+W++A
Sbjct  41   KKREAPEAGGSWPVIGHLRLLGGPEPPHWVLGKLADEYGPIFTIKMGINRALVVSNWEMA  100

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T+HD   +SRPK  A + LGYN+ M  F+PYG YWRE RK+ + ELLSN R+ +L+
Sbjct  101  KECLTTHDKVFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLGKLR  160

Query  63   HIRVAEIETSVKEL  22
            H+R  E++TS+K+L
Sbjct  161  HVREYELKTSLKDL  174



>gb|KHN04536.1| Cytochrome P450 82A1, partial [Glycine soja]
Length=490

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGS-KLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            P A G WP++GHL+L  GS + P++ LG +ADKYG IF++RIGVH  +V+S W+LAKE  
Sbjct  1    PAASGGWPLIGHLHLLGGSTQPPYITLGSLADKYGPIFSMRIGVHHAVVVSSWELAKECF  60

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T+ DV ISSRPKF AA+ LGYNY    F PYG +WREMRK+ +SELLS  R E L+ IR 
Sbjct  61   TTLDVVISSRPKFTAAKILGYNYANFGFTPYGDFWREMRKIAASELLSTARFELLQRIRD  120

Query  51   AEIETSVKEL  22
            +E++ S+KEL
Sbjct  121  SEMQISLKEL  130



>gb|KDP34890.1| hypothetical protein JCGZ_09178 [Jatropha curcas]
Length=285

 Score =   153 bits (386),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 95/135 (70%), Gaps = 1/135 (1%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K   PP+ G AWP++GHL L  GS LPHVAL  +ADK G + TIRIG   VLV+S  ++A
Sbjct  35   KANPPPQPGSAWPLIGHLPLLTGSNLPHVALATLADKSGPVLTIRIGSQPVLVLSHSEMA  94

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPY-GPYWREMRKLTSSELLSNRRIEQL  67
            KEL T +D+ ++SRP   AA+ +GYNY    F P  GP WRE RKL++  LLSNRR+E L
Sbjct  95   KELFTVNDLAVTSRPALVAAKFMGYNYAFFPFTPAGGPCWRETRKLSTLGLLSNRRLELL  154

Query  66   KHIRVAEIETSVKEL  22
            KHIR+ E+E S+KEL
Sbjct  155  KHIRIQEVEASIKEL  169



>ref|XP_006432669.1| hypothetical protein CICLE_v10000844mg [Citrus clementina]
 gb|ESR45909.1| hypothetical protein CICLE_v10000844mg [Citrus clementina]
Length=525

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++  PEAGG+WP++GHL L  G + PH  LG +AD+YG IFTI++G+++ LV+S+W++A
Sbjct  41   KKREAPEAGGSWPVIGHLRLLGGPEPPHWVLGKLADEYGPIFTIKMGINRALVVSNWEMA  100

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T+HD   +SRPK  A + LGYN+ M  F+PYG YWRE RK+ + ELLSN R+ +L+
Sbjct  101  KECLTTHDKVFASRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLELLSNHRLGKLR  160

Query  63   HIRVAEIETSVKEL  22
            H+R  E++TS+K+L
Sbjct  161  HVREYELKTSLKDL  174



>ref|XP_004488195.1| PREDICTED: cytochrome P450 82A3-like [Cicer arietinum]
Length=510

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGS-KLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKEL  235
            PP A G WP +GHL+L   S + P++ LG++A+KYG IF++RIGVHK +V+S W+LAKEL
Sbjct  32   PPLASGGWPFIGHLHLLANSNEPPYITLGNLANKYGPIFSLRIGVHKAVVVSSWELAKEL  91

Query  234  STSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIR  55
             T+HD+ ISSRPKF AA+ LG++Y    F+PYG YW++MRK+T+SELLS RR E L+ +R
Sbjct  92   FTTHDLIISSRPKFTAAKILGHDYANFGFSPYGDYWQKMRKVTASELLSARRFEALRDVR  151

Query  54   VAEIETSVKELQDR  13
             +E++ S+ E+ ++
Sbjct  152  DSEVKRSLMEVYNK  165



>ref|XP_006581227.1| PREDICTED: cytochrome P450 82A1-like [Glycine max]
Length=531

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLP-HVALGDMADKYGLIFTIRIGVHKVLVISDWK  250
            G  + PP A G WP++GHL+L  GS  P +  LG +AD YG IF+IRIGVH  +V+S W+
Sbjct  28   GSARKPPAASGGWPLIGHLHLLGGSGQPLYETLGTLADMYGPIFSIRIGVHPAVVVSSWE  87

Query  249  LAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQ  70
            LAKE  T+ DV +SSRPKF AA+ L YNY   +FAPYG +WR+M K+T SELLS R+ E 
Sbjct  88   LAKECFTTLDVTVSSRPKFTAAKILTYNYASFAFAPYGDFWRDMHKITVSELLSTRQAEM  147

Query  69   LKHIRVAEIETSVKELQ  19
            L+ IR +E+++S++ELQ
Sbjct  148  LRGIRDSEVKSSLRELQ  164



>ref|XP_002510312.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF52499.1| cytochrome P450, putative [Ricinus communis]
Length=522

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K+++PP+  GAWP+LGHL L  G   PHV LG+MADKYG IFTI++GVH+ L IS W+L 
Sbjct  28   KKRVPPQPKGAWPVLGHLPLLGGPLEPHVILGNMADKYGPIFTIKMGVHQSLTISSWELV  87

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T +D   ++RP F AA+ +GYN  M  F+PYG YWR+MRK+T+ ELLSN R++  K
Sbjct  88   KECFTINDKIFANRPNFLAAELMGYNSAMFGFSPYGQYWRQMRKITTLELLSNHRLQTFK  147

Query  63   HIRVAEIETSVKEL  22
            H+R +E+   + ++
Sbjct  148  HVRESEVRAGIIDI  161



>sp|Q43068.2|C82A1_PEA RecName: Full=Cytochrome P450 82A1; AltName: Full=CYPLXXXII, 
partial [Pisum sativum]
 gb|AAC49188.2| cytochrome P450 monooxygenase [Pisum sativum]
Length=544

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K PP   G+WP+LGHL L R ++ PH  LG + DKYG IFTI++G    LV+S+W+LAKE
Sbjct  33   KEPPIISGSWPLLGHLPLMRNTQTPHKTLGALVDKYGPIFTIKLGATNALVLSNWELAKE  92

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
              T +D+ +SSRPK  A + + YN   + +APYG YWR++RK+ + E+LSNRRIE L HI
Sbjct  93   CFTKNDIVVSSRPKPVAVELMSYNQAFIGWAPYGAYWRQLRKIVTLEILSNRRIELLSHI  152

Query  57   RVAEIETSVKEL  22
            RV+E++TS+KEL
Sbjct  153  RVSEVQTSIKEL  164



>gb|EYU45077.1| hypothetical protein MIMGU_mgv1a023617mg [Erythranthe guttata]
Length=528

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K+KLPPEA G WPI+GHL L  G +LPH+ L ++ADKYG IFTIR+GVH  L++S W++A
Sbjct  36   KKKLPPEAEGGWPIIGHLSLLSGPELPHIVLSNLADKYGPIFTIRLGVHGALIVSSWEIA  95

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D+   +RP+  A QH+ YN+ M  F+ YGPYWRE+RK++   LLSNR++ +L 
Sbjct  96   KECFTTNDLIFCNRPQTAAIQHMCYNFAMFGFSDYGPYWRELRKISMHTLLSNRKVAKLG  155

Query  63   HIRVAEIETSVKEL  22
            ++   E+   ++ L
Sbjct  156  NLYETEVTAMMRSL  169



>gb|KCW59285.1| hypothetical protein EUGRSUZ_H01963 [Eucalyptus grandis]
Length=417

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            PEA G WPI+GHL LF    L H  LG MADKYG IFTIR+G H+ +V+S W++AKE  T
Sbjct  36   PEAEGGWPIVGHLPLFSSKDLMHKKLGSMADKYGPIFTIRLGSHRAIVVSSWEVAKECFT  95

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   + RP   A + +GYN  M  FAPYG  WREMRK+ + ELLSN R++ LKHIR  
Sbjct  96   VHDKAFADRPMITATKLMGYNGAMFGFAPYGENWREMRKIATIELLSNHRLDSLKHIRAF  155

Query  48   EIETSVKEL  22
            E+ET++K+L
Sbjct  156  EVETAIKDL  164



>gb|KDO42181.1| hypothetical protein CISIN_1g009844mg [Citrus sinensis]
Length=524

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++  PEAGGAWP++GHL+L RG K P+     MADKYG IF IR+G +  L++S+W++A
Sbjct  41   KKRGAPEAGGAWPVIGHLHLLRGPKPPYRVFDKMADKYGPIFIIRMGKNPALIVSNWEIA  100

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T+HD   ++RPK  A + LGYN+ M  F+PYG YWRE RK+ +  LLSN R+E+LK
Sbjct  101  KECLTTHDKVFANRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLGLLSNHRLEKLK  160

Query  63   HIRVAEIETSVKEL  22
            H+R  E++T +KEL
Sbjct  161  HVREYEVKTCLKEL  174



>ref|XP_006432710.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
 ref|XP_006471501.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR45950.1| hypothetical protein CICLE_v10000851mg [Citrus clementina]
Length=524

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++  PEAGGAWP++GHL+L RG K P+     MADKYG IF IR+G +  L++S+W++A
Sbjct  41   KKRGAPEAGGAWPVIGHLHLLRGPKPPYRVFDKMADKYGPIFIIRMGKNPALIVSNWEIA  100

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T+HD   ++RPK  A + LGYN+ M  F+PYG YWRE RK+ +  LLSN R+E+LK
Sbjct  101  KECLTTHDKVFANRPKTLAMEILGYNFSMFGFSPYGSYWRETRKIATLGLLSNHRLEKLK  160

Query  63   HIRVAEIETSVKEL  22
            H+R  E++T +KEL
Sbjct  161  HVREYEVKTCLKEL  174



>ref|XP_004154898.1| PREDICTED: cytochrome P450 82A3-like [Cucumis sativus]
Length=501

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            + KLPPE  G WP++GHL+L   ++  H+ L   AD YG IFT+++G++K LV+S W++A
Sbjct  38   RNKLPPELPGRWPVIGHLHLLNATEPAHITLAKFADTYGPIFTLKLGMNKALVVSSWEIA  97

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D   +SRPK  A++ LGYNY M+  +PYG YWR +RKL + ELL+NRR+ QL+
Sbjct  98   KECFTTNDRIFASRPKLVASKLLGYNYTMLGLSPYGSYWRHIRKLATLELLTNRRLHQLQ  157

Query  63   HIRVAEIETSVKEL  22
            HIR  E++TS+K+L
Sbjct  158  HIREFEVQTSIKKL  171



>ref|XP_011083776.1| PREDICTED: cytochrome P450 CYP82D47-like [Sesamum indicum]
Length=525

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 95/139 (68%), Gaps = 0/139 (0%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            + LPP A G WP++GHL L  G +LPH+ L DMADKYG IF IR+GVH  +V+S W++AK
Sbjct  37   KNLPPLAAGGWPVIGHLRLLSGPELPHIILSDMADKYGPIFRIRLGVHTAMVVSSWEIAK  96

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            E  T++D+    RPK  A QH+ Y+Y M +   YGPYWRE+RK++  +LLSN +IE L H
Sbjct  97   ECFTTNDMIFCDRPKTSATQHMSYDYAMSALGKYGPYWRELRKISVQKLLSNSKIEALGH  156

Query  60   IRVAEIETSVKELQDRILG  4
            + VAEI   ++ L +  + 
Sbjct  157  LYVAEIRALMRSLYNSCVN  175



>ref|XP_010070483.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW59279.1| hypothetical protein EUGRSUZ_H01954 [Eucalyptus grandis]
Length=517

 Score =   156 bits (395),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 93/129 (72%), Gaps = 1/129 (1%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            PEA G WPI GHL LF GS+L H  LG MA+KYG IF IR+G H+ +V+S W++AKE  T
Sbjct  34   PEAKGGWPIFGHLLLF-GSELMHKKLGSMAEKYGPIFAIRLGSHQAIVVSSWEVAKECFT  92

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   + RP   A + +GYN  M+ F PYG YWREMRK+  +ELLSN R++ LKHIRV 
Sbjct  93   VHDKAFADRPVITATRLMGYNGAMLGFGPYGEYWREMRKIVMTELLSNHRLDSLKHIRVF  152

Query  48   EIETSVKEL  22
            E+ET++K+L
Sbjct  153  EVETAIKDL  161



>ref|XP_011099742.1| PREDICTED: cytochrome P450 CYP82D47-like [Sesamum indicum]
Length=525

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 104/137 (76%), Gaps = 3/137 (2%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRG---SKLPHVALGDMADKYGLIFTIRIGVHKVLVISDW  253
            K K PPEAGGA P  GHL+L  G   + LPH+ L  +ADKYG +FTIR+GV +VL++S W
Sbjct  33   KSKSPPEAGGARPFTGHLHLMNGGTSAGLPHINLAALADKYGPVFTIRLGVRRVLIVSSW  92

Query  252  KLAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIE  73
            +LAKEL T+ DV ISSRP FRAA+HL Y++ M  F+PYG YWRE+RKLTS ELLS+RR+E
Sbjct  93   ELAKELFTTRDVAISSRPNFRAAKHLSYDFAMFGFSPYGSYWRELRKLTSVELLSSRRLE  152

Query  72   QLKHIRVAEIETSVKEL  22
             L H+RV+E   SV EL
Sbjct  153  LLSHVRVSETLQSVNEL  169



>ref|XP_011099830.1| PREDICTED: cytochrome P450 CYP82D47-like [Sesamum indicum]
Length=523

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 95/134 (71%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            ++ LPP+A G WP++GHL L  G +LPH+ L DMADKYG IF+IR+GVH  L++S W++ 
Sbjct  37   EKNLPPQAAGGWPVIGHLRLLSGPELPHIILSDMADKYGPIFSIRLGVHSALIVSSWEIT  96

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D+    RP+  A QH+ Y++ M     YGPYWRE+RK++  +LLSNR+IE L 
Sbjct  97   KECFTTNDMIFCDRPRTAAIQHMSYDFAMFGLGKYGPYWRELRKISVQKLLSNRKIETLG  156

Query  63   HIRVAEIETSVKEL  22
            H+ V+EI   ++ L
Sbjct  157  HLYVSEIRALMRSL  170



>ref|XP_009606708.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana tomentosiformis]
Length=523

 Score =   156 bits (394),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 104/137 (76%), Gaps = 3/137 (2%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGS---KLPHVALGDMADKYGLIFTIRIGVHKVLVISD  256
            G++K  PEA GAWPI+GHL+L  GS   +LPH  L  MA+KYG IF +++GV+K +V+SD
Sbjct  32   GQRKRVPEAAGAWPIIGHLHLLSGSESDQLPHKVLARMAEKYGPIFGLKLGVYKAVVVSD  91

Query  255  WKLAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRI  76
             K+AKE  T++D+ +++RPK  A++ +GYN+ M   APYGPYWRE+RK+ + E LS RRI
Sbjct  92   PKIAKECFTTNDLALANRPKSLASEIIGYNHAMFGVAPYGPYWREIRKIATIEFLSTRRI  151

Query  75   EQLKHIRVAEIETSVKE  25
            E LKHIR  E+++++KE
Sbjct  152  EVLKHIREFEVKSAIKE  168



>gb|EYU23763.1| hypothetical protein MIMGU_mgv1a023100mg [Erythranthe guttata]
Length=529

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 100/137 (73%), Gaps = 4/137 (3%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRG----SKLPHVALGDMADKYGLIFTIRIGVHKVLVISDW  253
             K PP AGGA P  GHL+L  G    S+LPH+ L  +ADK+G IFTIR+G+ +  V+S  
Sbjct  32   SKAPPAAGGARPFTGHLHLMGGGGGGSQLPHIKLAALADKHGPIFTIRLGLRRAAVVSSP  91

Query  252  KLAKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIE  73
            +LAKEL T+ D  +S RP+ RAA+HLGYN+ M +F PYG YWR +RK+ ++ELLSNRR++
Sbjct  92   ELAKELFTACDAAVSGRPQLRAAKHLGYNFAMFAFCPYGAYWRGVRKIVAAELLSNRRVD  151

Query  72   QLKHIRVAEIETSVKEL  22
             L H+RV+EIE S+ EL
Sbjct  152  LLGHVRVSEIEISIDEL  168



>gb|KDO42182.1| hypothetical protein CISIN_1g046041mg [Citrus sinensis]
Length=531

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 100/134 (75%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++  PEAGGAWP++GHL++  G +  H  LG MADKYG IFTI+IG+++ LV+S W++A
Sbjct  48   KKRGAPEAGGAWPVIGHLHILGGPEPLHRVLGSMADKYGPIFTIKIGINRALVVSSWEMA  107

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D   +SRPK  A + LGYN+ M  F+PYG YW E RK+ + ELLSN R+E+L+
Sbjct  108  KECLTTNDKIFASRPKTLAMEILGYNFSMFGFSPYGSYWCETRKIATLELLSNHRLEKLR  167

Query  63   HIRVAEIETSVKEL  22
            H+R  E++T +KEL
Sbjct  168  HVRDYEVKTCLKEL  181



>ref|XP_007224171.1| hypothetical protein PRUPE_ppa016912mg, partial [Prunus persica]
 gb|EMJ25370.1| hypothetical protein PRUPE_ppa016912mg, partial [Prunus persica]
Length=517

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            G++K PP+AGGAWPI+GHL+L  GSK PH+ LG MA++YG IFT+ IGV K L++S  ++
Sbjct  15   GERKSPPKAGGAWPIIGHLHLLGGSKPPHLVLGKMAERYGPIFTVNIGVQKALIVSSSEI  74

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D   +SRPKF AA+ + YNY +  F+PY  Y R++RK+   E+LSN R+E L
Sbjct  75   AKECFTTNDKVFASRPKFMAAEIMAYNYALFPFSPYSHYSRQVRKIVLLEVLSNSRLEML  134

Query  66   KHIRVAEIETSVKELQDRIL  7
            KH+R +E++ S+K + +R +
Sbjct  135  KHVRESEVKASMKGIYERCV  154



>ref|XP_010106089.1| Cytochrome P450 82C4 [Morus notabilis]
 gb|EXC07359.1| Cytochrome P450 82C4 [Morus notabilis]
Length=528

 Score =   156 bits (394),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRG-SKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PE  GAWPI+GHL+L  G  +L +  LG MAD YG  F IR+G  +  V++ W +AK+  
Sbjct  42   PEPEGAWPIIGHLHLLGGGDQLLYRTLGAMADNYGPAFNIRLGSRRAFVVNSWDVAKDCF  101

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D  ++SRP   AA+H+GYNY +  FAPY P+WREMRK+ + ELLSNRR+E LKH+R+
Sbjct  102  TANDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEMLKHVRI  161

Query  51   AEIETSVKELQDRI  10
            +EI+T +++L DR+
Sbjct  162  SEIDTGIQDLYDRV  175



>ref|XP_007017403.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
 gb|EOY14628.1| Cytochrome P450, family 82, subfamily C, polypeptide 4 [Theobroma 
cacao]
Length=527

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/135 (53%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGS-KLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            K +  P+  GAWPILGHL+L  GS +L +  LG MAD+YG  FTIR+G     V+S W+L
Sbjct  34   KTRTAPQPKGAWPILGHLHLLGGSDQLLYRTLGAMADEYGPAFTIRLGSRCAFVVSSWEL  93

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T +D  ++SRP   AA+H+GYNY +  FAPY P+WREMRK+ + ELLSNRR+E L
Sbjct  94   AKECFTINDKALASRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEML  153

Query  66   KHIRVAEIETSVKEL  22
            KH+R++E++  ++EL
Sbjct  154  KHVRISEVDMGIREL  168



>ref|XP_006471191.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=538

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGSK-LPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            +K  PE GGAWP++GHL+L  G K   HV LG +ADK+G IF I++G+H+ L++S+W++A
Sbjct  39   KKTVPEPGGAWPLIGHLHLLGGQKPAAHVTLGSIADKHGPIFMIKLGLHRALIVSNWEIA  98

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D    +R K  A + LGYNY M  F+PYGPYWR++RK+ + E+LSN R+E LK
Sbjct  99   KECFTTNDKVFCNRIKALAPEILGYNYAMFGFSPYGPYWRQIRKIATLEILSNHRLEMLK  158

Query  63   HIRVAEIETSVKELQD  16
            H+R +E+ TS+KEL D
Sbjct  159  HVRESEVRTSMKELYD  174



>ref|XP_004154825.1| PREDICTED: cytochrome P450 82C4-like isoform 2 [Cucumis sativus]
Length=242

 Score =   150 bits (379),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 97/135 (72%), Gaps = 0/135 (0%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            ++LPPE  GAWP++GHL+L   S+  H+ L  MAD YG IFT R G  + L++S+W++AK
Sbjct  34   KRLPPEPDGAWPVIGHLHLLNASEPIHITLAKMADVYGPIFTFRFGTKRALIVSNWEIAK  93

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            E  T++D   +SRPK  A++ L Y+Y M++F+PY P+WR +RKL    L +N+RIEQL+H
Sbjct  94   ECFTTNDRIFASRPKQLASKLLAYDYAMMAFSPYNPHWRYVRKLAMLGLFTNQRIEQLEH  153

Query  60   IRVAEIETSVKELQD  16
            +RV E+ + +KEL D
Sbjct  154  VRVVEVHSWMKELYD  168



>gb|KGN59915.1| Cytochrome P450 [Cucumis sativus]
Length=521

 Score =   155 bits (393),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            + KLPPE  G WP++GHL+L   ++  H+ L   AD YG IFT+++G++K LV+S W++A
Sbjct  38   RNKLPPELPGRWPVIGHLHLLNATEPAHITLAKFADTYGPIFTLKLGMNKALVVSSWEIA  97

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D   +SRPK  A++ LGYNY M   +PYG YWR +RKL + ELL+NRR+ QL+
Sbjct  98   KECFTTNDRIFASRPKLVASKLLGYNYTMFGLSPYGSYWRHIRKLATLELLTNRRLHQLQ  157

Query  63   HIRVAEIETSVKEL  22
            HIR  E++TS+K+L
Sbjct  158  HIREFEVQTSIKKL  171



>ref|XP_006471151.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
Length=558

 Score =   155 bits (393),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            PE GGAWP++GHL+L  G K  +V LG++A+K G IF I++G+H+ L++S+W++AKE  T
Sbjct  64   PEPGGAWPLIGHLHLLGGQKPAYVTLGNIAEKCGPIFMIKLGMHRALIVSNWEIAKECFT  123

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            ++D   S+R K  A + LGYNY M  F+PYGPYWR++RK+ + E+LSN R+E LKH+R +
Sbjct  124  TNDKVFSNRIKALAPEILGYNYAMFGFSPYGPYWRQIRKIATLEVLSNHRLEMLKHVRES  183

Query  48   EIETSVKELQDR  13
            E+ TS+KEL D 
Sbjct  184  EVRTSMKELYDE  195



>emb|CAN81092.1| hypothetical protein VITISV_004720 [Vitis vinifera]
Length=496

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 96/130 (74%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            P E  G WPI+GHL+L    KLPH  LGDMADKYG IF I +G+ K LV+S W++AKE  
Sbjct  40   PQEPSGRWPIIGHLHLLGADKLPHRTLGDMADKYGPIFCIHLGLRKALVVSSWEVAKECY  99

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D   ++RP+  A + +GY++ M+ FAPYGPYWR++RKL   ELLSNR++E LKH++ 
Sbjct  100  TTNDKVFATRPRSLAVKLMGYDHAMLGFAPYGPYWRDVRKLAMVELLSNRQLEMLKHVQD  159

Query  51   AEIETSVKEL  22
            +E+E  +KEL
Sbjct  160  SEVEFLIKEL  169



>ref|XP_006423130.1| hypothetical protein CICLE_v10030016mg [Citrus clementina]
 ref|XP_006479372.1| PREDICTED: cytochrome P450 82C4-like isoform X1 [Citrus sinensis]
 ref|XP_006479373.1| PREDICTED: cytochrome P450 82C4-like isoform X2 [Citrus sinensis]
 ref|XP_006479374.1| PREDICTED: cytochrome P450 82C4-like isoform X3 [Citrus sinensis]
 gb|ESR36370.1| hypothetical protein CICLE_v10030016mg [Citrus clementina]
Length=524

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 99/134 (74%), Gaps = 1/134 (1%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGS-KLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKEL  235
            PPEA GAWP +GHL+L  GS +L H  LG+MADKYG  F I +G+H+ LVIS W++ KE 
Sbjct  40   PPEAAGAWPCVGHLHLLAGSNQLIHQTLGEMADKYGKAFLIHLGIHRALVISSWEVTKEC  99

Query  234  STSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIR  55
             T++D   S+RPK  A + +GY++ M+ FAPYG YWRE+RKL++ +LLSN R+E LKH+R
Sbjct  100  FTTNDKLFSTRPKSLAVKLMGYDHAMIGFAPYGSYWREVRKLSTVQLLSNHRLELLKHVR  159

Query  54   VAEIETSVKELQDR  13
              E++  +KEL ++
Sbjct  160  DTEVKVFIKELHEQ  173



>ref|XP_007047112.1| Cytochrome P450 [Theobroma cacao]
 gb|EOX91269.1| Cytochrome P450 [Theobroma cacao]
Length=691

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+AGGA P++GH++L  G +L H  LG MADKYG +F+IR+G H  LV++ W++A+E  T
Sbjct  199  PQAGGALPVIGHMHLLGGHQLTHKTLGAMADKYGPVFSIRLGSHSALVLNSWEMARECFT  258

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   S+RP   A++ LGYNY M  FAPYG YWRE+R++ + ELLS+ RI+ LKHIR +
Sbjct  259  VHDKVFSTRPVLTASKVLGYNYAMFGFAPYGSYWREIRRIATIELLSSHRIDMLKHIRAS  318

Query  48   EIETSVKEL  22
            E++T+V+EL
Sbjct  319  EVKTAVREL  327



>ref|XP_010070486.1| PREDICTED: cytochrome P450 CYP82D47-like [Eucalyptus grandis]
 gb|KCW59284.1| hypothetical protein EUGRSUZ_H01963 [Eucalyptus grandis]
Length=525

 Score =   155 bits (392),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 90/129 (70%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            PEA G WPI+GHL LF    L H  LG MADKYG IFTIR+G H+ +V+S W++AKE  T
Sbjct  36   PEAEGGWPIVGHLPLFSSKDLMHKKLGSMADKYGPIFTIRLGSHRAIVVSSWEVAKECFT  95

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   + RP   A + +GYN  M  FAPYG  WREMRK+ + ELLSN R++ LKHIR  
Sbjct  96   VHDKAFADRPMITATKLMGYNGAMFGFAPYGENWREMRKIATIELLSNHRLDSLKHIRAF  155

Query  48   EIETSVKEL  22
            E+ET++K+L
Sbjct  156  EVETAIKDL  164



>ref|XP_002284806.1| PREDICTED: cytochrome P450 CYP82D47 [Vitis vinifera]
Length=527

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 96/130 (74%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            P E  G WPI+GHL+L    KLPH  LGDMADKYG IF I +G+ K LV+S W++AKE  
Sbjct  40   PQEPSGRWPIIGHLHLLGADKLPHRTLGDMADKYGPIFCIHLGLRKALVVSSWEVAKECY  99

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D   ++RP+  A + +GY++ M+ FAPYGPYWR++RKL   ELLSNR++E LKH++ 
Sbjct  100  TTNDKVFATRPRSLAVKLMGYDHAMLGFAPYGPYWRDVRKLAMVELLSNRQLEMLKHVQD  159

Query  51   AEIETSVKEL  22
            +E+E  +KEL
Sbjct  160  SEVEFLIKEL  169



>gb|KDP38438.1| hypothetical protein JCGZ_04363 [Jatropha curcas]
Length=526

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 98/129 (76%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            PEAGGAWP++GHL+LFRGSK  H+ LG MADK G IF I++G+H  LV+S+W++AK+  T
Sbjct  42   PEAGGAWPLIGHLHLFRGSKPLHIILGKMADKMGPIFKIKLGMHPTLVVSNWEMAKQCLT  101

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            ++D   ++RPK  A+  +GYN  M+ F+PYGPYWR+MRK+   ELLSN+RI+    +R +
Sbjct  102  TNDQVFATRPKTLASVLVGYNRAMLPFSPYGPYWRQMRKIAILELLSNQRIQTQSRVRES  161

Query  48   EIETSVKEL  22
            E+ T +KEL
Sbjct  162  EVRTFLKEL  170



>ref|XP_003604789.1| Cytochrome P450 [Medicago truncatula]
 gb|AES86986.1| cytochrome P450 family protein [Medicago truncatula]
Length=532

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 100/134 (75%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K K  P A GAWPILGHL +F G++ PH  LG + DK+G IFTI++G    LV+++W++A
Sbjct  35   KNKEAPIAKGAWPILGHLPIFCGTQAPHRILGALGDKHGPIFTIKLGPKHALVLNNWEMA  94

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D+ +SSRPK  A +HL Y   M  FA YGPYWR +RK+++ E+L++RR+E  +
Sbjct  95   KECFTTNDMIVSSRPKLVATEHLAYKGAMFGFAAYGPYWRHLRKISNLEILTSRRVEHHQ  154

Query  63   HIRVAEIETSVKEL  22
            HIRV+E++TS+KEL
Sbjct  155  HIRVSEVQTSIKEL  168



>ref|XP_006423133.1| hypothetical protein CICLE_v10028201mg [Citrus clementina]
 ref|XP_006479370.1| PREDICTED: cytochrome P450 82C4-like [Citrus sinensis]
 gb|ESR36373.1| hypothetical protein CICLE_v10028201mg [Citrus clementina]
Length=524

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 94/130 (72%), Gaps = 0/130 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPE  GAWP +GHL+L   ++L H  LG MADKYG  F IR+G+ + LVIS W++AKE  
Sbjct  40   PPEPEGAWPFIGHLHLLEKNQLLHQTLGKMADKYGKAFMIRLGIRQALVISSWEVAKECF  99

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D   SSRPKF A + +GY++ M+ FAPYGPYWR +RKL + ELLSN ++E +KH+R 
Sbjct  100  TTNDKLFSSRPKFLAVKLMGYDHAMLGFAPYGPYWRNIRKLATVELLSNHQLELIKHVRD  159

Query  51   AEIETSVKEL  22
             E +  +KEL
Sbjct  160  IETKIFIKEL  169



>ref|XP_007151140.1| hypothetical protein PHAVU_004G021100g [Phaseolus vulgaris]
 gb|ESW23134.1| hypothetical protein PHAVU_004G021100g [Phaseolus vulgaris]
Length=501

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 92/130 (71%), Gaps = 1/130 (1%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PP A  AWPILGHL L  GS  PH  LG MADKYG +FTI++G  + LV+S+WK+AKE  
Sbjct  42   PPMASRAWPILGHLMLLGGSPTPHKTLGAMADKYGPLFTIKLGSKRALVLSNWKMAKECY  101

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D  +SSR K  A +H+ YN     FAPYGPYWRE+RK+ +   LSNR+ E L  +RV
Sbjct  102  TTNDAVVSSRSKLVAIEHVAYNQASFGFAPYGPYWREIRKIVTV-FLSNRKTELLSRVRV  160

Query  51   AEIETSVKEL  22
            +EI +SVKEL
Sbjct  161  SEIRSSVKEL  170



>ref|XP_004291927.1| PREDICTED: cytochrome P450 82A3-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 98/135 (73%), Gaps = 1/135 (1%)
 Frame = -2

Query  423  KQKLP-PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            + +LP P+A GAWPILGHL L  GS  P + LG MADKYG +FT+R+GV+  LV+S  ++
Sbjct  35   RSRLPAPQAKGAWPILGHLPLLGGSTPPQIILGAMADKYGPLFTVRLGVYPTLVVSSSEV  94

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T HD+  SSRPK  A + +GYNY M    P GPYWRE+RKL + +LLSNR+++ L
Sbjct  95   AKECFTIHDMAASSRPKMAAVELIGYNYAMFGMGPSGPYWREVRKLATLKLLSNRQMQLL  154

Query  66   KHIRVAEIETSVKEL  22
            K IRV+E+ T +KEL
Sbjct  155  KDIRVSEVATFLKEL  169



>ref|XP_009804510.1| PREDICTED: cytochrome P450 CYP82D47-like [Nicotiana sylvestris]
Length=525

 Score =   154 bits (388),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 101/131 (77%), Gaps = 3/131 (2%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGS---KLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            PEA GAWPI GHL+L  G+   +LPH  L  MA+KYG IF +++GV+KV+V+SD K+AKE
Sbjct  39   PEAAGAWPIFGHLHLLTGTESDQLPHKVLARMAEKYGPIFGLKLGVYKVVVVSDPKVAKE  98

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
              T++D+ +++RPK  A++ +GYN+ M   APYGPYWRE+RK+ + E LS+RRIE LKHI
Sbjct  99   CFTTNDLALANRPKSLASEIIGYNHAMFGVAPYGPYWREIRKIATIEFLSSRRIEMLKHI  158

Query  57   RVAEIETSVKE  25
            R  E+++++KE
Sbjct  159  REFEVKSAIKE  169



>ref|XP_006432711.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
 gb|ESR45951.1| hypothetical protein CICLE_v10003589mg, partial [Citrus clementina]
Length=473

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            K++  PEAGGAWP++GHL++  G +  H  LG MADKYG IFTI+IG+++ LV+S W++A
Sbjct  2    KKRGAPEAGGAWPVIGHLHILGGPEPLHRVLGSMADKYGPIFTIKIGINRALVVSSWEMA  61

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D   +SRPK  A + LGYN+ M   +PYG YWRE RK+ + ELLS  R+E+L+
Sbjct  62   KECLTTNDKIFASRPKTLAMEILGYNFSMFGSSPYGSYWRETRKIATLELLSKHRLEKLR  121

Query  63   HIRVAEIETSVKEL  22
            H+R  E++T +KEL
Sbjct  122  HVRDYEVKTCLKEL  135



>ref|XP_002284031.1| PREDICTED: cytochrome P450 82C4 [Vitis vinifera]
 emb|CBI19595.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 97/135 (72%), Gaps = 1/135 (1%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRG-SKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            K +  PE GGAWPI+GHL+L  G  +L +  LG MADKYG  F IR+G  +  V+S W++
Sbjct  34   KSRDAPEPGGAWPIIGHLHLLGGGDQLLYRTLGAMADKYGPAFNIRLGSRRAFVVSSWEV  93

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T +D  +++RP   AA+H+GYNY +  FAPY P+WREMRK+ + ELLSNRR+E L
Sbjct  94   AKECFTINDKALATRPTTVAAKHMGYNYAVFGFAPYSPFWREMRKIATLELLSNRRLEIL  153

Query  66   KHIRVAEIETSVKEL  22
            KH+R +E++  ++EL
Sbjct  154  KHVRTSEVDMGIREL  168



>gb|KHG26594.1| Cytochrome P450 [Gossypium arboreum]
Length=526

 Score =   154 bits (388),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = -2

Query  411  PPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELS  232
            PPE GGA P LGHL+L  G K  H+ +G+ AD YG IFT R+G+H  LV+S+W++AKE  
Sbjct  41   PPEIGGARPFLGHLHLLGGPKPAHITMGNFADAYGPIFTFRLGMHPTLVVSNWEMAKECF  100

Query  231  TSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRV  52
            T++D   +SRP+  AA+ LGYN+ M  F+ YGPYWR +RK+ + E+LSN R+E+L+H+R 
Sbjct  101  TTNDKAFASRPRTLAAELLGYNFAMFGFSSYGPYWRHVRKIATLEVLSNYRLEKLRHVRE  160

Query  51   AEIETSVKELQDRI  10
            +EI  S+K L + +
Sbjct  161  SEIRASIKRLYELV  174



>ref|XP_008464769.1| PREDICTED: cytochrome P450 CYP82D47-like [Cucumis melo]
Length=518

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            +++LPP+AGGAWP++GHL+L   S+  H+    MAD YG +FT R G+++ L++S+W+LA
Sbjct  32   RKRLPPKAGGAWPVIGHLHLLNASEPTHITFAKMADAYGPMFTFRFGMNEALIVSNWELA  91

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D   +SRPK  A++ L Y+Y M+ F+PY P+WR +RK+ + ELL+N R+ QL+
Sbjct  92   KEFFTTNDRIFASRPKLVASKLLAYDYAMMGFSPYSPHWRHVRKIATLELLTNHRVAQLQ  151

Query  63   HIRVAEIETSVKELQD  16
            +IR  EI+T +KEL +
Sbjct  152  YIRAFEIKTWMKELYE  167



>gb|AGF30366.1| CYP450 monooxygenase CYP82D62 [Mentha x piperita]
Length=516

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 98/133 (74%), Gaps = 1/133 (1%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRG-SKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAK  241
            + PPEAGGAWP LGHL +  G + LPHV+LG++ADK+G IF IRIGVH+ +V+S  ++ K
Sbjct  31   QAPPEAGGAWPFLGHLNIISGHTGLPHVSLGNLADKHGPIFGIRIGVHRAVVVSSSEVIK  90

Query  240  ELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKH  61
            EL T++D  +SSRP  +A +HL Y+Y M+ F+ YG YWR+MRKL S EL S RR+E  ++
Sbjct  91   ELFTTNDAAVSSRPSVKAGKHLAYDYAMLGFSSYGTYWRQMRKLVSLELFSARRVELQRN  150

Query  60   IRVAEIETSVKEL  22
            +RV+E    + EL
Sbjct  151  VRVSETAHFINEL  163



>ref|XP_007224041.1| hypothetical protein PRUPE_ppa015200mg, partial [Prunus persica]
 gb|EMJ25240.1| hypothetical protein PRUPE_ppa015200mg, partial [Prunus persica]
Length=517

 Score =   153 bits (387),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/140 (51%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -2

Query  426  GKQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            G++K PP+AGGA PI+GHL+L  GSK PH+ LG MA++YG IFT+ IGVHK L++S  ++
Sbjct  15   GERKSPPKAGGARPIIGHLHLLGGSKPPHLVLGKMAERYGPIFTVNIGVHKALIVSSSEI  74

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKE  T++D   +SRPKF AA+ + YNY  + F+PY  Y R++RK+   E+LSN R+E L
Sbjct  75   AKECFTTNDKVFASRPKFMAAEIMAYNYAFLPFSPYSHYSRQVRKIVLLEVLSNSRLEML  134

Query  66   KHIRVAEIETSVKELQDRIL  7
            KH+R +E++ S+K + +R +
Sbjct  135  KHVRESEVKASMKGIYERCV  154



>gb|EYU23762.1| hypothetical protein MIMGU_mgv1a004588mg [Erythranthe guttata]
Length=519

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/135 (55%), Positives = 99/135 (73%), Gaps = 2/135 (1%)
 Frame = -2

Query  420  QKLPPEAGGAWPILGHLYLFRGS--KLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKL  247
            +K PP AGGA P +GHL+L  G+   LPH  L  +ADKYG IFTIR+G+ + +++S  +L
Sbjct  31   KKSPPAAGGARPFIGHLHLMGGAGGSLPHFNLSALADKYGPIFTIRLGIRRAVIVSSAQL  90

Query  246  AKELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQL  67
            AKEL T+ DV ISSRP  ++A +L Y++ M  F PYG YWRE+RKLT+ ELLS+RRIE L
Sbjct  91   AKELYTACDVAISSRPNLKSAIYLSYDFAMFGFTPYGAYWREIRKLTAMELLSSRRIELL  150

Query  66   KHIRVAEIETSVKEL  22
            K +R +EI+ S+ EL
Sbjct  151  KEVRGSEIDKSINEL  165



>ref|XP_006573615.1| PREDICTED: cytochrome P450 82A3-like isoform X2 [Glycine max]
Length=530

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+AGGAWPI+GHL+LF   +L H  LG MADK+G IFTI++G +KVLV+S W++A+E  T
Sbjct  43   PQAGGAWPIVGHLHLFGAHQLTHKTLGTMADKHGPIFTIKLGSYKVLVLSSWEMAEECFT  102

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   S+RP   A++ + YN  M  FAP+GPYWREMRK  + ELLSN+R+E LK IR +
Sbjct  103  VHDKAFSTRPCVAASKLMTYNSAMFGFAPHGPYWREMRKFATIELLSNQRLELLKDIRTS  162

Query  48   EIETSVKE  25
            E+E +  +
Sbjct  163  ELEAATTK  170



>ref|XP_006573616.1| PREDICTED: cytochrome P450 82A3-like isoform X3 [Glycine max]
Length=530

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+AGGAWPI+GHL+LF   +L H  LG MADK+G IFTI++G +KVLV+S W++A+E  T
Sbjct  43   PQAGGAWPIVGHLHLFGAHQLTHKTLGTMADKHGPIFTIKLGSYKVLVLSSWEMAEECFT  102

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   S+RP   A++ + YN  M  FAP+GPYWREMRK  + ELLSN+R+E LK IR +
Sbjct  103  VHDKAFSTRPCVAASKLMTYNSAMFGFAPHGPYWREMRKFATIELLSNQRLELLKDIRTS  162

Query  48   EIETSVKE  25
            E+E +  +
Sbjct  163  ELEAATTK  170



>gb|KHN42044.1| Cytochrome P450 82A3 [Glycine soja]
Length=538

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+A GAWPI+GHL+LF   +L H  LG MA+K+G IFTI++G +KVLV+S W++AKE  T
Sbjct  40   PQAAGAWPIIGHLHLFNAHQLTHKTLGKMAEKHGPIFTIKLGSYKVLVLSSWEMAKECFT  99

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
            +HD   S+RP   A++ +GYNY M  F PYG YWR + KLT+ ELLSN R+E LK  R  
Sbjct  100  AHDKAFSTRPCVAASKLMGYNYAMFGFTPYGSYWRPVPKLTTIELLSNNRLEPLKDTRTV  159

Query  48   EIETSVKEL  22
            E++ +++EL
Sbjct  160  ELDAAIREL  168



>prf||2209439B cytochrome P450 monooxygenase
Length=543

 Score =   153 bits (386),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 96/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  417  KLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKE  238
            K PP   G+WP+LG + L R ++ PH  LG + DKYG IFTI++G    LV+S+W+LAKE
Sbjct  33   KEPPIISGSWPLLGSIPLMRNTQTPHKTLGALVDKYGPIFTIKLGATNALVLSNWELAKE  92

Query  237  LSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHI  58
              T +D+ +SSRPK  A + + YN   + +APYG YWR++RK+ + E+LSNRRIE L HI
Sbjct  93   CFTKNDIVVSSRPKPVAVELMSYNQAFIGWAPYGEYWRQLRKIVTLEILSNRRIELLSHI  152

Query  57   RVAEIETSVKEL  22
            RV+E++TS+KEL
Sbjct  153  RVSEVQTSIKEL  164



>ref|XP_007033359.1| Cytochrome P450 [Theobroma cacao]
 gb|EOY04285.1| Cytochrome P450 [Theobroma cacao]
Length=505

 Score =   152 bits (385),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 88/121 (73%), Gaps = 0/121 (0%)
 Frame = -2

Query  408  PEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLAKELST  229
            P+AGGA PI+GH++ F G +L H  LG MADKYG +F +R+G HKVLV++ W+ AKE  T
Sbjct  41   PQAGGALPIIGHMHYFGGQQLTHKILGAMADKYGPVFALRLGSHKVLVLNSWEAAKESFT  100

Query  228  SHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLKHIRVA  49
             HD   SSRP F A++ LGYNY M   APYG YWREMRK+ + ELLS  RI+ LKHIR +
Sbjct  101  VHDKVFSSRPSFTASELLGYNYAMFGLAPYGSYWREMRKIATIELLSTHRIDMLKHIRAS  160

Query  48   E  46
            E
Sbjct  161  E  161



>ref|XP_004147822.1| PREDICTED: uncharacterized protein LOC101212976 [Cucumis sativus]
Length=1051

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 98/134 (73%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            + KLPPE  G WP++GHL+L   ++  H+ L   AD YG IFT+++G++K LV+S W++A
Sbjct  38   RNKLPPELPGRWPVIGHLHLLNATEPAHITLAKFADTYGPIFTLKLGMNKALVVSSWEIA  97

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE  T++D   +SRPK  A++ LGYNY M   +PYG YWR +RKL + ELL+NRR+ QL+
Sbjct  98   KECFTTNDRIFASRPKLVASKLLGYNYTMFGLSPYGSYWRHIRKLATLELLTNRRLHQLQ  157

Query  63   HIRVAEIETSVKEL  22
            HIR  E++TS+K+L
Sbjct  158  HIREFEVQTSIKKL  171


 Score =   154 bits (389),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 101/134 (75%), Gaps = 0/134 (0%)
 Frame = -2

Query  423  KQKLPPEAGGAWPILGHLYLFRGSKLPHVALGDMADKYGLIFTIRIGVHKVLVISDWKLA  244
            +++LPP+AGGAWP++GHL+L   S+  H+ L  MAD YG +FT R G+ + L++S+W LA
Sbjct  565  RKRLPPKAGGAWPVIGHLHLLNASEPTHITLAKMADAYGPMFTFRFGMKRALIVSNWDLA  624

Query  243  KELSTSHDVHISSRPKFRAAQHLGYNYLMVSFAPYGPYWREMRKLTSSELLSNRRIEQLK  64
            KE+ T++D   +SRPK  A++ L Y+Y M+ F+PY P+WR +RK+ + ELL+N R++QL+
Sbjct  625  KEIFTTNDRIFASRPKLVASKILAYDYAMMGFSPYSPHWRYVRKIATLELLTNHRVDQLQ  684

Query  63   HIRVAEIETSVKEL  22
            +IR  E+ET ++EL
Sbjct  685  YIRAFEVETWMEEL  698



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509248079690