BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16639_g1_i1 len=1287 path=[4787:0-1286]

Length=1287
                                                                      Score     E

ref|XP_004239304.1|  PREDICTED: bidirectional sugar transporter N3      355   8e-117   
ref|XP_009612477.1|  PREDICTED: bidirectional sugar transporter N...    352   3e-115   
ref|XP_009777590.1|  PREDICTED: bidirectional sugar transporter N...    349   4e-114   
gb|EYU42078.1|  hypothetical protein MIMGU_mgv1a010705mg                333   4e-108   
ref|XP_011071246.1|  PREDICTED: bidirectional sugar transporter N3      327   1e-105   
ref|XP_007222479.1|  hypothetical protein PRUPE_ppa009789mg             304   3e-97    
ref|XP_004310113.1|  PREDICTED: bidirectional sugar transporter S...    300   4e-95    
gb|KHG20984.1|  Bidirectional sugar transporter SWEET15 -like pro...    299   6e-95    
ref|XP_010249453.1|  PREDICTED: bidirectional sugar transporter S...    297   3e-94    
ref|XP_007043874.1|  Senescence-associated gene 29                      297   4e-94    
ref|XP_010090683.1|  Bidirectional sugar transporter N3                 296   9e-94    
ref|XP_010250599.1|  PREDICTED: bidirectional sugar transporter S...    296   1e-93    
ref|XP_008222221.1|  PREDICTED: bidirectional sugar transporter N3      293   1e-92    
ref|XP_006844581.1|  hypothetical protein AMTR_s00016p00202420          292   2e-92    
ref|XP_004145146.1|  PREDICTED: bidirectional sugar transporter S...    291   7e-92    
ref|XP_011020821.1|  PREDICTED: bidirectional sugar transporter N...    290   1e-91    
ref|XP_008440025.1|  PREDICTED: bidirectional sugar transporter S...    289   3e-91    
ref|XP_008392763.1|  PREDICTED: bidirectional sugar transporter S...    287   5e-91    
gb|KHN24976.1|  Bidirectional sugar transporter N3                      288   6e-91    
ref|XP_003530901.1|  PREDICTED: bidirectional sugar transporter N...    288   7e-91    
ref|XP_004161953.1|  PREDICTED: bidirectional sugar transporter S...    287   2e-90    
ref|XP_009337539.1|  PREDICTED: bidirectional sugar transporter N3      288   2e-90    
ref|XP_004490502.1|  PREDICTED: bidirectional sugar transporter N...    286   3e-90    
ref|XP_010027258.1|  PREDICTED: bidirectional sugar transporter N...    286   9e-90    
ref|NP_001239695.1|  uncharacterized protein LOC100777741               285   1e-89    
ref|XP_003551863.1|  PREDICTED: bidirectional sugar transporter N...    285   1e-89    
ref|XP_002873602.1|  nodulin MtN3 family protein                        285   1e-89    
ref|XP_011036129.1|  PREDICTED: bidirectional sugar transporter S...    285   1e-89    
ref|XP_006347346.1|  PREDICTED: bidirectional sugar transporter S...    284   3e-89    
gb|KHN03192.1|  Bidirectional sugar transporter N3                      283   3e-89    
ref|XP_004241452.1|  PREDICTED: bidirectional sugar transporter S...    283   5e-89    
ref|XP_009614916.1|  PREDICTED: bidirectional sugar transporter S...    284   5e-89    
ref|XP_004235339.1|  PREDICTED: bidirectional sugar transporter S...    283   6e-89    
ref|XP_008389921.1|  PREDICTED: bidirectional sugar transporter N...    283   1e-88    
ref|XP_010093935.1|  Bidirectional sugar transporter SWEET12            283   1e-88    
ref|XP_010929602.1|  PREDICTED: bidirectional sugar transporter S...    283   2e-88    
ref|XP_009605549.1|  PREDICTED: bidirectional sugar transporter S...    282   2e-88    
ref|NP_197755.1|  bidirectional sugar transporter SWEET12               281   3e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009758166.1|  PREDICTED: bidirectional sugar transporter S...    281   4e-88    
ref|XP_002299333.2|  hypothetical protein POPTR_0001s13410g             281   4e-88    Populus trichocarpa [western balsam poplar]
emb|CAN71371.1|  hypothetical protein VITISV_023352                     281   4e-88    Vitis vinifera
ref|XP_009758167.1|  PREDICTED: bidirectional sugar transporter S...    281   1e-87    
gb|KFK25541.1|  hypothetical protein AALP_AA8G128400                    280   1e-87    
ref|XP_010492063.1|  PREDICTED: bidirectional sugar transporter S...    280   1e-87    
gb|KDP26857.1|  hypothetical protein JCGZ_18015                         280   1e-87    
ref|XP_008374287.1|  PREDICTED: bidirectional sugar transporter N...    280   2e-87    
emb|CDP13388.1|  unnamed protein product                                280   2e-87    
ref|XP_009597195.1|  PREDICTED: bidirectional sugar transporter S...    280   2e-87    
ref|XP_002264875.1|  PREDICTED: bidirectional sugar transporter N3      280   2e-87    Vitis vinifera
ref|XP_010453373.1|  PREDICTED: bidirectional sugar transporter S...    280   2e-87    
ref|XP_006347635.1|  PREDICTED: bidirectional sugar transporter S...    279   2e-87    
ref|XP_009758165.1|  PREDICTED: bidirectional sugar transporter S...    280   3e-87    
ref|XP_010419882.1|  PREDICTED: bidirectional sugar transporter S...    279   3e-87    
ref|XP_004297511.1|  PREDICTED: bidirectional sugar transporter S...    280   4e-87    
ref|XP_002877428.1|  hypothetical protein ARALYDRAFT_484952             279   4e-87    
ref|XP_007038077.1|  Medicago truncatula MTN3, putative                 279   4e-87    
ref|XP_009802194.1|  PREDICTED: bidirectional sugar transporter S...    279   5e-87    
ref|XP_002303766.2|  hypothetical protein POPTR_0003s16520g             278   6e-87    Populus trichocarpa [western balsam poplar]
ref|XP_011023930.1|  PREDICTED: bidirectional sugar transporter S...    278   6e-87    
ref|XP_009336454.1|  PREDICTED: bidirectional sugar transporter N...    279   6e-87    
ref|XP_002284244.1|  PREDICTED: bidirectional sugar transporter S...    278   6e-87    Vitis vinifera
ref|XP_003576036.1|  PREDICTED: bidirectional sugar transporter S...    278   7e-87    
ref|XP_009347840.1|  PREDICTED: bidirectional sugar transporter N...    280   7e-87    
ref|XP_009614915.1|  PREDICTED: bidirectional sugar transporter S...    278   9e-87    
ref|XP_009794695.1|  PREDICTED: bidirectional sugar transporter N...    278   1e-86    
ref|XP_009605550.1|  PREDICTED: bidirectional sugar transporter S...    278   1e-86    
gb|KHG03157.1|  Bidirectional sugar transporter SWEET15 -like pro...    277   1e-86    
ref|XP_010027262.1|  PREDICTED: bidirectional sugar transporter N...    277   1e-86    
ref|NP_196821.1|  senescence-associated protein 29                      277   2e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009587580.1|  PREDICTED: bidirectional sugar transporter S...    277   2e-86    
gb|AAM65389.1|  senescence-associated protein (SAG29)                   277   2e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006347347.1|  PREDICTED: bidirectional sugar transporter S...    277   2e-86    
emb|CDX77928.1|  BnaC03g52910D                                          276   2e-86    
ref|XP_009591687.1|  PREDICTED: bidirectional sugar transporter N...    277   3e-86    
emb|CDX91144.1|  BnaC02g04530D                                          277   3e-86    
ref|XP_010235464.1|  PREDICTED: bidirectional sugar transporter S...    277   3e-86    
emb|CDY53626.1|  BnaC03g71480D                                          276   3e-86    
sp|A2X5B4.1|SWT15_ORYSI  RecName: Full=Bidirectional sugar transp...    277   3e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_006399805.1|  hypothetical protein EUTSA_v10014234mg             276   4e-86    
ref|XP_009762335.1|  PREDICTED: bidirectional sugar transporter S...    276   4e-86    
ref|NP_001046944.1|  Os02g0513100                                       277   4e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006288378.1|  hypothetical protein CARUB_v10001629mg             276   5e-86    
ref|XP_010534707.1|  PREDICTED: bidirectional sugar transporter S...    276   5e-86    
ref|XP_002514863.1|  conserved hypothetical protein                     275   5e-86    Ricinus communis
ref|XP_003620983.1|  Protein RUPTURED POLLEN GRAIN                      275   7e-86    
ref|XP_002511126.1|  conserved hypothetical protein                     276   7e-86    Ricinus communis
emb|CDX69663.1|  BnaA10g20120D                                          276   8e-86    
emb|CDX87161.1|  BnaC09g04760D                                          275   8e-86    
ref|XP_007159040.1|  hypothetical protein PHAVU_002G203600g             275   8e-86    
ref|XP_003531061.1|  PREDICTED: bidirectional sugar transporter N...    275   8e-86    
gb|KHN39181.1|  Bidirectional sugar transporter N3                      275   9e-86    
ref|XP_009125890.1|  PREDICTED: bidirectional sugar transporter S...    276   9e-86    
ref|XP_006438820.1|  hypothetical protein CICLE_v10032218mg             276   1e-85    
gb|KEH21447.1|  sugar efflux transporter for intercellular exchan...    275   1e-85    
ref|XP_006647263.1|  PREDICTED: bidirectional sugar transporter S...    276   1e-85    
ref|XP_003524088.1|  PREDICTED: bidirectional sugar transporter N...    275   1e-85    
ref|XP_006347633.1|  PREDICTED: bidirectional sugar transporter S...    275   2e-85    
ref|XP_009149800.1|  PREDICTED: bidirectional sugar transporter S...    275   2e-85    
emb|CDY08093.1|  BnaA06g16330D                                          275   2e-85    
gb|EMS46194.1|  Bidirectional sugar transporter SWEET15                 276   2e-85    
ref|XP_009141677.1|  PREDICTED: bidirectional sugar transporter S...    274   2e-85    
dbj|BAJ94651.1|  predicted protein                                      275   2e-85    
ref|XP_006578712.1|  PREDICTED: bidirectional sugar transporter S...    274   2e-85    
ref|XP_006436901.1|  hypothetical protein CICLE_v10032313mg             274   3e-85    
ref|XP_009150178.1|  PREDICTED: bidirectional sugar transporter S...    274   3e-85    
emb|CDX85668.1|  BnaA02g01450D                                          274   3e-85    
ref|XP_009421186.1|  PREDICTED: bidirectional sugar transporter S...    274   3e-85    
emb|CDX83046.1|  BnaA01g20460D                                          274   3e-85    
emb|CDX97233.1|  BnaC09g43920D                                          274   4e-85    
emb|CDY16863.1|  BnaA09g05190D                                          273   5e-85    
ref|XP_008340254.1|  PREDICTED: bidirectional sugar transporter N...    274   5e-85    
ref|XP_009393865.1|  PREDICTED: bidirectional sugar transporter S...    273   5e-85    
ref|XP_004491680.1|  PREDICTED: bidirectional sugar transporter N...    272   5e-85    
gb|EMT09236.1|  Protein RUPTURED POLLEN GRAIN 1                         274   6e-85    
ref|XP_009787633.1|  PREDICTED: bidirectional sugar transporter N...    273   6e-85    
emb|CDY05867.1|  BnaC08g20440D                                          273   6e-85    
ref|XP_004235340.1|  PREDICTED: bidirectional sugar transporter S...    273   7e-85    
ref|XP_009601079.1|  PREDICTED: bidirectional sugar transporter S...    272   7e-85    
ref|XP_004235334.1|  PREDICTED: bidirectional sugar transporter S...    273   8e-85    
ref|XP_010025273.1|  PREDICTED: bidirectional sugar transporter N...    273   9e-85    
emb|CDX68492.1|  BnaC01g25700D                                          272   1e-84    
ref|XP_004491681.1|  PREDICTED: bidirectional sugar transporter N...    271   2e-84    
ref|XP_004979336.1|  PREDICTED: bidirectional sugar transporter S...    272   2e-84    
ref|XP_008392764.1|  PREDICTED: bidirectional sugar transporter S...    272   2e-84    
ref|XP_010454652.1|  PREDICTED: bidirectional sugar transporter S...    272   2e-84    
ref|XP_008239523.1|  PREDICTED: bidirectional sugar transporter N3      272   2e-84    
ref|XP_010493487.1|  PREDICTED: bidirectional sugar transporter S...    271   3e-84    
ref|XP_010421173.1|  PREDICTED: bidirectional sugar transporter S...    271   3e-84    
ref|XP_006366912.1|  PREDICTED: bidirectional sugar transporter S...    271   4e-84    
ref|XP_006347653.1|  PREDICTED: bidirectional sugar transporter S...    271   4e-84    
gb|KFK27668.1|  hypothetical protein AALP_AA8G413300                    271   4e-84    
ref|XP_004235470.1|  PREDICTED: bidirectional sugar transporter S...    271   4e-84    
ref|XP_004235326.1|  PREDICTED: bidirectional sugar transporter N3      271   4e-84    
ref|XP_006289174.1|  hypothetical protein CARUB_v10002612mg             271   4e-84    
emb|CDX78511.1|  BnaA03g04230D                                          271   5e-84    
ref|XP_009796436.1|  PREDICTED: bidirectional sugar transporter S...    271   5e-84    
ref|XP_006664549.1|  PREDICTED: bidirectional sugar transporter S...    270   6e-84    
ref|NP_001237418.1|  N3 protein                                         270   6e-84    
ref|XP_006363981.1|  PREDICTED: bidirectional sugar transporter S...    271   6e-84    
gb|KHN23963.1|  Bidirectional sugar transporter SWEET14                 269   7e-84    
ref|NP_001067955.1|  Os11g0508600                                       271   7e-84    Oryza sativa Japonica Group [Japonica rice]
sp|B8BKP4.1|SWT14_ORYSI  RecName: Full=Bidirectional sugar transp...    271   7e-84    Oryza sativa Indica Group [Indian rice]
gb|EMT20480.1|  Protein RUPTURED POLLEN GRAIN 1                         270   9e-84    
ref|XP_006366913.1|  PREDICTED: bidirectional sugar transporter S...    272   1e-83    
ref|XP_003615405.1|  Protein RUPTURED POLLEN GRAIN                      269   1e-83    
ref|XP_006347634.1|  PREDICTED: bidirectional sugar transporter S...    270   1e-83    
ref|XP_004297512.1|  PREDICTED: bidirectional sugar transporter S...    270   1e-83    
ref|XP_009765830.1|  PREDICTED: bidirectional sugar transporter N...    270   1e-83    
ref|XP_003576225.1|  PREDICTED: bidirectional sugar transporter S...    270   1e-83    
ref|XP_009121791.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    270   2e-83    
ref|XP_006493253.1|  PREDICTED: bidirectional sugar transporter S...    269   2e-83    
ref|XP_010025272.1|  PREDICTED: bidirectional sugar transporter N...    270   2e-83    
ref|XP_004161952.1|  PREDICTED: bidirectional sugar transporter S...    270   2e-83    
ref|XP_002442119.1|  hypothetical protein SORBIDRAFT_08g014040          270   2e-83    Sorghum bicolor [broomcorn]
ref|XP_006404221.1|  hypothetical protein EUTSA_v10010591mg             269   3e-83    
ref|XP_009599477.1|  PREDICTED: bidirectional sugar transporter S...    268   3e-83    
ref|XP_006394628.1|  hypothetical protein EUTSA_v10004719mg             269   3e-83    
ref|XP_010027260.1|  PREDICTED: bidirectional sugar transporter N...    268   4e-83    
ref|XP_004235333.1|  PREDICTED: bidirectional sugar transporter S...    269   4e-83    
ref|XP_010027261.1|  PREDICTED: bidirectional sugar transporter N...    268   5e-83    
ref|XP_009385515.1|  PREDICTED: bidirectional sugar transporter S...    268   5e-83    
ref|XP_010556111.1|  PREDICTED: bidirectional sugar transporter S...    269   5e-83    
ref|XP_009412768.1|  PREDICTED: bidirectional sugar transporter S...    268   7e-83    
ref|XP_004153501.1|  PREDICTED: bidirectional sugar transporter S...    268   7e-83    
ref|XP_007139099.1|  hypothetical protein PHAVU_008G001100g             267   8e-83    
gb|KEH21448.1|  bidirectional sugar transporter                         267   1e-82    
ref|XP_002443167.1|  hypothetical protein SORBIDRAFT_08g013840          268   1e-82    Sorghum bicolor [broomcorn]
dbj|BAJ85621.1|  predicted protein                                      267   1e-82    
ref|XP_004235342.2|  PREDICTED: uncharacterized protein LOC101265905    277   1e-82    
gb|ACV71016.1|  UPA16                                                   268   1e-82    Capsicum annuum
ref|XP_010042796.1|  PREDICTED: bidirectional sugar transporter N...    267   1e-82    
gb|KHN24975.1|  Bidirectional sugar transporter N3                      266   2e-82    
ref|XP_004952573.1|  PREDICTED: bidirectional sugar transporter S...    268   2e-82    
ref|XP_009150896.1|  PREDICTED: bidirectional sugar transporter S...    267   2e-82    
emb|CDX88041.1|  BnaA06g26320D                                          267   2e-82    
gb|EMT11081.1|  Protein RUPTURED POLLEN GRAIN 1                         266   3e-82    
ref|XP_009609628.1|  PREDICTED: bidirectional sugar transporter N...    266   3e-82    
ref|NP_190443.1|  bidirectional sugar transporter SWEET11               266   3e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003532319.1|  PREDICTED: bidirectional sugar transporter N...    266   3e-82    
ref|XP_010037373.1|  PREDICTED: bidirectional sugar transporter S...    265   3e-82    
ref|XP_006663471.1|  PREDICTED: bidirectional sugar transporter S...    267   4e-82    
ref|XP_007137870.1|  hypothetical protein PHAVU_009G162700g             265   4e-82    
ref|XP_004145147.1|  PREDICTED: bidirectional sugar transporter S...    266   4e-82    
gb|EMT22394.1|  Protein RUPTURED POLLEN GRAIN 1                         266   4e-82    
ref|XP_010036837.1|  PREDICTED: bidirectional sugar transporter N...    264   5e-82    
ref|XP_006347632.1|  PREDICTED: bidirectional sugar transporter S...    266   5e-82    
gb|KCW61894.1|  hypothetical protein EUGRSUZ_H04587                     264   6e-82    
emb|CDX80379.1|  BnaC07g30650D                                          265   6e-82    
ref|NP_001242732.1|  uncharacterized protein LOC100810962               264   9e-82    
ref|XP_002322282.2|  hypothetical protein POPTR_0015s11380g             265   9e-82    Populus trichocarpa [western balsam poplar]
ref|XP_009614917.1|  PREDICTED: bidirectional sugar transporter S...    265   1e-81    
ref|XP_010027259.1|  PREDICTED: bidirectional sugar transporter N...    265   1e-81    
ref|XP_009801964.1|  PREDICTED: bidirectional sugar transporter S...    265   1e-81    
ref|XP_002877629.1|  nodulin MtN3 family protein                        265   1e-81    
ref|XP_004962649.1|  PREDICTED: bidirectional sugar transporter S...    265   1e-81    
ref|XP_007139100.1|  hypothetical protein PHAVU_008G001200g             264   1e-81    
ref|XP_003523161.1|  PREDICTED: bidirectional sugar transporter S...    263   1e-81    
ref|XP_010037379.1|  PREDICTED: bidirectional sugar transporter S...    263   1e-81    
ref|XP_006347652.1|  PREDICTED: bidirectional sugar transporter S...    271   2e-81    
gb|EMS53876.1|  Bidirectional sugar transporter SWEET14                 271   2e-81    
emb|CDP03543.1|  unnamed protein product                                263   2e-81    
ref|XP_009349481.1|  PREDICTED: bidirectional sugar transporter N...    264   3e-81    
ref|XP_009405955.1|  PREDICTED: bidirectional sugar transporter S...    263   3e-81    
ref|XP_006436900.1|  hypothetical protein CICLE_v10033645mg             263   3e-81    
ref|XP_009802195.1|  PREDICTED: bidirectional sugar transporter S...    264   4e-81    
ref|XP_009802608.1|  PREDICTED: bidirectional sugar transporter S...    263   4e-81    
ref|XP_002520679.1|  conserved hypothetical protein                     263   4e-81    Ricinus communis
ref|XP_010242697.1|  PREDICTED: bidirectional sugar transporter S...    263   4e-81    
ref|XP_009605548.1|  PREDICTED: bidirectional sugar transporter S...    263   5e-81    
ref|XP_009779208.1|  PREDICTED: bidirectional sugar transporter S...    262   5e-81    
ref|NP_001149087.1|  MTN3                                               263   5e-81    Zea mays [maize]
gb|KFK34174.1|  hypothetical protein AALP_AA5G110100                    263   6e-81    
gb|EMT03611.1|  Protein RUPTURED POLLEN GRAIN 1                         263   7e-81    
ref|XP_008791098.1|  PREDICTED: bidirectional sugar transporter S...    263   8e-81    
ref|XP_009803865.1|  PREDICTED: bidirectional sugar transporter S...    262   9e-81    
sp|Q2QR07.1|SWT13_ORYSJ  RecName: Full=Bidirectional sugar transp...    263   9e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002453892.1|  hypothetical protein SORBIDRAFT_04g021000          264   9e-81    Sorghum bicolor [broomcorn]
gb|EMT20808.1|  Protein RUPTURED POLLEN GRAIN 1                         262   1e-80    
ref|NP_001141654.1|  hypothetical protein                               263   1e-80    Zea mays [maize]
ref|NP_001141106.1|  uncharacterized protein LOC100273190               262   1e-80    Zea mays [maize]
ref|XP_004980522.1|  PREDICTED: bidirectional sugar transporter S...    262   1e-80    
gb|ACU23483.1|  unknown                                                 261   1e-80    Glycine max [soybeans]
ref|XP_004242139.1|  PREDICTED: bidirectional sugar transporter S...    262   1e-80    
gb|AFK39311.1|  unknown                                                 261   2e-80    
gb|AHB08882.1|  bidirectional sugar transporter SWEET14-like protein    263   2e-80    
gb|ACG28570.1|  MTN3                                                    262   2e-80    Zea mays [maize]
sp|P93332.1|NOD3_MEDTR  RecName: Full=Bidirectional sugar transpo...    261   2e-80    Medicago truncatula
ref|NP_001131289.1|  mtN3-like protein                                  261   3e-80    Zea mays [maize]
gb|KDP22572.1|  hypothetical protein JCGZ_26403                         261   3e-80    
ref|XP_002443163.1|  hypothetical protein SORBIDRAFT_08g013620          261   4e-80    Sorghum bicolor [broomcorn]
gb|EMS51422.1|  Bidirectional sugar transporter SWEET13                 261   4e-80    
ref|XP_009403777.1|  PREDICTED: bidirectional sugar transporter S...    260   5e-80    
ref|XP_008459891.1|  PREDICTED: bidirectional sugar transporter N3      260   5e-80    
ref|XP_007148462.1|  hypothetical protein PHAVU_006G210800g             260   6e-80    
ref|XP_011083538.1|  PREDICTED: bidirectional sugar transporter S...    260   6e-80    
ref|XP_010039121.1|  PREDICTED: bidirectional sugar transporter S...    260   8e-80    
gb|EMT20481.1|  Protein RUPTURED POLLEN GRAIN 1                         260   8e-80    
ref|XP_010037381.1|  PREDICTED: bidirectional sugar transporter S...    259   1e-79    
ref|XP_002270131.1|  PREDICTED: bidirectional sugar transporter S...    259   1e-79    Vitis vinifera
ref|XP_002511125.1|  conserved hypothetical protein                     259   2e-79    Ricinus communis
gb|EMS48886.1|  Bidirectional sugar transporter SWEET13                 263   2e-79    
gb|EAY83053.1|  hypothetical protein OsI_38270                          259   2e-79    Oryza sativa Indica Group [Indian rice]
gb|EPS72542.1|  hypothetical protein M569_02215                         256   2e-79    
dbj|BAK04274.1|  predicted protein                                      260   2e-79    
ref|XP_007038075.1|  Nodulin MtN3 family protein, putative isoform 1    259   2e-79    
gb|KCW61897.1|  hypothetical protein EUGRSUZ_H04592                     258   2e-79    
ref|XP_002450786.1|  hypothetical protein SORBIDRAFT_05g018110          258   3e-79    Sorghum bicolor [broomcorn]
emb|CBI32263.3|  unnamed protein product                                260   4e-79    
ref|XP_004138250.1|  PREDICTED: bidirectional sugar transporter S...    258   4e-79    
ref|XP_008356571.1|  PREDICTED: bidirectional sugar transporter S...    258   4e-79    
ref|XP_008464392.1|  PREDICTED: bidirectional sugar transporter S...    258   5e-79    
ref|XP_010678288.1|  PREDICTED: bidirectional sugar transporter N3      259   6e-79    
gb|KCW61896.1|  hypothetical protein EUGRSUZ_H04589                     257   6e-79    
gb|EYU43030.1|  hypothetical protein MIMGU_mgv1a011435mg                256   1e-78    
ref|XP_010550745.1|  PREDICTED: bidirectional sugar transporter S...    257   1e-78    
ref|XP_010093933.1|  Bidirectional sugar transporter SWEET10            257   1e-78    
gb|AFW71563.1|  hypothetical protein ZEAMMB73_472818                    258   2e-78    
ref|XP_004157602.1|  PREDICTED: bidirectional sugar transporter S...    256   2e-78    
gb|KGN61326.1|  hypothetical protein Csa_2G083730                       255   2e-78    
ref|XP_010426372.1|  PREDICTED: bidirectional sugar transporter S...    256   2e-78    
ref|XP_010503515.1|  PREDICTED: bidirectional sugar transporter S...    256   2e-78    
ref|XP_004138032.1|  PREDICTED: bidirectional sugar transporter S...    256   2e-78    
ref|XP_010037364.1|  PREDICTED: bidirectional sugar transporter S...    256   3e-78    
ref|XP_004140547.1|  PREDICTED: bidirectional sugar transporter S...    255   3e-78    
ref|NP_001132836.1|  hypothetical protein                               258   3e-78    Zea mays [maize]
gb|EYU43031.1|  hypothetical protein MIMGU_mgv1a011488mg                255   3e-78    
gb|EMT20483.1|  Protein RUPTURED POLLEN GRAIN 1                         256   4e-78    
ref|XP_002865824.1|  nodulin MtN3 family protein                        256   5e-78    
gb|EYU23059.1|  hypothetical protein MIMGU_mgv1a019104mg                255   6e-78    
ref|XP_010039123.1|  PREDICTED: bidirectional sugar transporter S...    253   7e-78    
ref|XP_008441813.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    254   8e-78    
gb|KFK26707.1|  hypothetical protein AALP_AA8G282900                    254   8e-78    
ref|XP_006281748.1|  hypothetical protein CARUB_v10027907mg             254   1e-77    
ref|XP_007038076.1|  Nodulin MtN3 family protein, putative isoform 2    254   1e-77    
ref|XP_010519500.1|  PREDICTED: bidirectional sugar transporter S...    254   2e-77    
ref|XP_010442559.1|  PREDICTED: bidirectional sugar transporter S...    254   2e-77    
ref|XP_010482381.1|  PREDICTED: bidirectional sugar transporter S...    254   2e-77    
gb|AHL43546.1|  nodule-specific sucrose transporter                     253   3e-77    
gb|AFK48645.1|  unknown                                                 252   3e-77    
gb|KHG27148.1|  Bidirectional sugar transporter SWEET10 -like pro...    253   3e-77    
ref|XP_004247459.1|  PREDICTED: bidirectional sugar transporter NEC1    253   3e-77    
ref|XP_002862913.1|  nodulin MtN3 family protein                        253   3e-77    
ref|XP_006291603.1|  hypothetical protein CARUB_v10017757mg             253   3e-77    
ref|XP_010442358.1|  PREDICTED: bidirectional sugar transporter S...    253   3e-77    
ref|XP_011079737.1|  PREDICTED: bidirectional sugar transporter N...    253   3e-77    
ref|XP_010545940.1|  PREDICTED: bidirectional sugar transporter S...    253   4e-77    
ref|XP_009411801.1|  PREDICTED: bidirectional sugar transporter S...    253   5e-77    
ref|XP_006493252.1|  PREDICTED: bidirectional sugar transporter S...    253   5e-77    
ref|XP_010037362.1|  PREDICTED: bidirectional sugar transporter S...    252   6e-77    
ref|XP_007137872.1|  hypothetical protein PHAVU_009G162900g             253   6e-77    
ref|XP_004962650.1|  PREDICTED: bidirectional sugar transporter S...    252   6e-77    
ref|NP_001149028.1|  LOC100282648                                       253   6e-77    
ref|XP_011073577.1|  PREDICTED: bidirectional sugar transporter S...    251   9e-77    
gb|AAM65058.1|  MtN3-like protein                                       252   1e-76    
ref|XP_007209422.1|  hypothetical protein PRUPE_ppa009422mg             252   1e-76    
gb|EYU43032.1|  hypothetical protein MIMGU_mgv1a010677mg                252   1e-76    
gb|KCW49071.1|  hypothetical protein EUGRSUZ_K02671                     250   2e-76    
ref|XP_008441812.1|  PREDICTED: bidirectional sugar transporter N...    250   2e-76    
ref|XP_002321730.2|  N3 like family protein                             251   2e-76    
ref|NP_199893.1|  bidirectional sugar transporter SWEET13               251   2e-76    
ref|XP_004155149.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    250   2e-76    
ref|XP_003602780.1|  Protein RUPTURED POLLEN GRAIN                      250   2e-76    
ref|XP_003532478.1|  PREDICTED: bidirectional sugar transporter S...    250   2e-76    
emb|CDX84877.1|  BnaA03g13530D                                          250   2e-76    
ref|XP_008677256.1|  PREDICTED: LOC100282648 isoform X1                 251   3e-76    
ref|XP_009794853.1|  PREDICTED: bidirectional sugar transporter S...    250   3e-76    
gb|KDO64483.1|  hypothetical protein CISIN_1g020739mg                   250   5e-76    
ref|XP_008464393.1|  PREDICTED: bidirectional sugar transporter S...    250   5e-76    
ref|XP_011073105.1|  PREDICTED: bidirectional sugar transporter N...    250   7e-76    
ref|XP_002321731.1|  N3 like family protein                             249   9e-76    
ref|XP_007038078.1|  Medicago truncatula MTN3, putative                 249   9e-76    
ref|XP_007200238.1|  hypothetical protein PRUPE_ppa015264mg             249   1e-75    
ref|XP_008239633.1|  PREDICTED: bidirectional sugar transporter S...    249   1e-75    
ref|XP_007050795.1|  Medicago truncatula MTN3                           249   1e-75    
ref|XP_003593107.1|  Protein RUPTURED POLLEN GRAIN                      249   1e-75    
ref|XP_009132693.1|  PREDICTED: bidirectional sugar transporter S...    249   1e-75    
ref|XP_006402061.1|  hypothetical protein EUTSA_v10014268mg             249   2e-75    
ref|XP_004138979.1|  PREDICTED: bidirectional sugar transporter N...    248   2e-75    
ref|XP_002511128.1|  conserved hypothetical protein                     248   2e-75    
gb|EPS64389.1|  hypothetical protein M569_10392                         247   2e-75    
ref|XP_007159993.1|  hypothetical protein PHAVU_002G283900g             248   2e-75    
ref|NP_001241307.1|  uncharacterized protein LOC100810946               248   2e-75    
gb|KCW61900.1|  hypothetical protein EUGRSUZ_H04596                     248   2e-75    
gb|KDP28088.1|  hypothetical protein JCGZ_13859                         248   2e-75    
emb|CDX71659.1|  BnaC09g27000D                                          249   2e-75    
gb|KDP22573.1|  hypothetical protein JCGZ_26404                         248   3e-75    
ref|XP_009123765.1|  PREDICTED: bidirectional sugar transporter S...    248   3e-75    
ref|XP_006402062.1|  hypothetical protein EUTSA_v10014273mg             248   4e-75    
ref|XP_002322281.2|  N3 like family protein                             248   4e-75    
gb|KHG02402.1|  Bidirectional sugar transporter SWEET10 -like pro...    247   4e-75    
ref|XP_010442555.1|  PREDICTED: bidirectional sugar transporter S...    247   6e-75    
ref|XP_008392727.1|  PREDICTED: bidirectional sugar transporter S...    247   8e-75    
ref|XP_010482380.1|  PREDICTED: bidirectional sugar transporter S...    247   8e-75    
ref|XP_004503778.1|  PREDICTED: bidirectional sugar transporter S...    246   8e-75    
ref|XP_010442345.1|  PREDICTED: bidirectional sugar transporter S...    247   1e-74    
ref|XP_004957300.1|  PREDICTED: bidirectional sugar transporter S...    246   1e-74    
ref|XP_011023933.1|  PREDICTED: bidirectional sugar transporter S...    246   1e-74    
ref|XP_006282018.1|  hypothetical protein CARUB_v10028257mg             247   1e-74    
ref|NP_199892.1|  bidirectional sugar transporter SWEET10               246   1e-74    
ref|XP_008235079.1|  PREDICTED: bidirectional sugar transporter S...    246   1e-74    
ref|XP_009783143.1|  PREDICTED: bidirectional sugar transporter N...    246   1e-74    
ref|XP_011023934.1|  PREDICTED: bidirectional sugar transporter S...    246   1e-74    
ref|XP_010039124.1|  PREDICTED: bidirectional sugar transporter S...    244   1e-74    
ref|XP_004301046.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    246   2e-74    
ref|XP_011023931.1|  PREDICTED: bidirectional sugar transporter S...    245   2e-74    
ref|XP_002865823.1|  nodulin MtN3 family protein                        246   2e-74    
ref|XP_010943754.1|  PREDICTED: bidirectional sugar transporter S...    246   2e-74    
ref|XP_011015361.1|  PREDICTED: bidirectional sugar transporter S...    245   2e-74    
ref|XP_011085139.1|  PREDICTED: bidirectional sugar transporter N...    245   2e-74    
emb|CDY69440.1|  BnaCnng63490D                                          243   3e-74    
sp|Q9FPN0.1|NEC1_PETHY  RecName: Full=Bidirectional sugar transpo...    244   4e-74    
ref|XP_010678287.1|  PREDICTED: bidirectional sugar transporter S...    245   6e-74    
ref|XP_003602778.1|  Protein RUPTURED POLLEN GRAIN                      245   8e-74    
ref|XP_006479044.1|  PREDICTED: bidirectional sugar transporter S...    243   9e-74    
ref|XP_006285021.1|  hypothetical protein CARUB_v10006328mg             244   1e-73    
ref|XP_010027132.1|  PREDICTED: bidirectional sugar transporter N...    243   1e-73    
gb|KHN33482.1|  Bidirectional sugar transporter SWEET15                 243   1e-73    
ref|NP_001240121.1|  uncharacterized protein LOC100800347               243   2e-73    
ref|XP_010037372.1|  PREDICTED: bidirectional sugar transporter S...    242   2e-73    
ref|XP_010045482.1|  PREDICTED: bidirectional sugar transporter S...    243   3e-73    
gb|KGN63457.1|  hypothetical protein Csa_1G001290                       242   4e-73    
emb|CDP21121.1|  unnamed protein product                                242   6e-73    
emb|CDP21120.1|  unnamed protein product                                241   7e-73    
ref|XP_002280599.1|  PREDICTED: bidirectional sugar transporter S...    242   8e-73    
ref|XP_009109231.1|  PREDICTED: bidirectional sugar transporter S...    241   9e-73    
ref|XP_010243612.1|  PREDICTED: bidirectional sugar transporter S...    241   1e-72    
gb|AGL98401.1|  sucrose transporter SWEET9                              241   1e-72    
gb|EMS51423.1|  Bidirectional sugar transporter SWEET13                 242   1e-72    
gb|EMS45810.1|  Bidirectional sugar transporter SWEET11                 241   1e-72    
ref|XP_002511127.1|  conserved hypothetical protein                     241   2e-72    
emb|CDP09549.1|  unnamed protein product                                241   2e-72    
ref|XP_003578398.1|  PREDICTED: bidirectional sugar transporter S...    241   2e-72    
ref|NP_194231.1|  bidirectional sugar transporter SWEET14               240   3e-72    
emb|CDY24854.1|  BnaA08g14560D                                          240   3e-72    
ref|XP_002867630.1|  nodulin MtN3 family protein                        239   4e-72    
gb|EYU46728.1|  hypothetical protein MIMGU_mgv1a011381mg                239   5e-72    
emb|CAC44123.1|  N3 like protein                                        239   5e-72    
gb|KEH20983.1|  bidirectional sugar transporter                         238   6e-72    
ref|XP_006413354.1|  hypothetical protein EUTSA_v10025975mg             239   7e-72    
ref|XP_007205793.1|  hypothetical protein PRUPE_ppa010594mg             238   8e-72    
ref|XP_008386620.1|  PREDICTED: bidirectional sugar transporter S...    239   9e-72    
gb|KHG13555.1|  Bidirectional sugar transporter SWEET15                 238   2e-71    
ref|XP_004302124.1|  PREDICTED: bidirectional sugar transporter N...    237   2e-71    
gb|EMT23597.1|  Protein RUPTURED POLLEN GRAIN 1                         238   2e-71    
gb|AFK35161.1|  unknown                                                 237   3e-71    
emb|CDY34333.1|  BnaA01g14360D                                          237   3e-71    
dbj|BAK07340.1|  predicted protein                                      237   4e-71    
emb|CDY03395.1|  BnaC01g16870D                                          237   4e-71    
emb|CBI15715.3|  unnamed protein product                                237   6e-71    
ref|XP_008802109.1|  PREDICTED: bidirectional sugar transporter S...    236   7e-71    
ref|XP_004503779.1|  PREDICTED: bidirectional sugar transporter S...    236   7e-71    
ref|XP_009379704.1|  PREDICTED: bidirectional sugar transporter N...    236   8e-71    
ref|XP_009137488.1|  PREDICTED: bidirectional sugar transporter S...    236   9e-71    
emb|CDX92666.1|  BnaC07g39240D                                          236   9e-71    
gb|KDO64482.1|  hypothetical protein CISIN_1g047365mg                   235   1e-70    
ref|XP_010438942.1|  PREDICTED: bidirectional sugar transporter S...    236   1e-70    
gb|EMS49335.1|  Bidirectional sugar transporter SWEET14                 238   2e-70    
gb|KFK26708.1|  hypothetical protein AALP_AA8G283000                    236   2e-70    
ref|XP_004138978.1|  PREDICTED: bidirectional sugar transporter N...    234   2e-70    
ref|XP_010448490.1|  PREDICTED: bidirectional sugar transporter S...    236   2e-70    
ref|XP_004501816.1|  PREDICTED: bidirectional sugar transporter S...    234   2e-70    
ref|XP_010112742.1|  Bidirectional sugar transporter NEC1               234   2e-70    
ref|XP_010926783.1|  PREDICTED: bidirectional sugar transporter S...    234   4e-70    
ref|XP_008370771.1|  PREDICTED: bidirectional sugar transporter N...    234   5e-70    
ref|XP_003532471.1|  PREDICTED: bidirectional sugar transporter S...    235   5e-70    
ref|XP_010696414.1|  PREDICTED: bidirectional sugar transporter S...    236   5e-70    
gb|EYU30738.1|  hypothetical protein MIMGU_mgv1a012552mg                233   5e-70    
emb|CDP21733.1|  unnamed protein product                                233   7e-70    
ref|XP_009337540.1|  PREDICTED: bidirectional sugar transporter NEC1    234   7e-70    
gb|KCW49087.1|  hypothetical protein EUGRSUZ_K02694                     234   9e-70    
ref|XP_009337947.1|  PREDICTED: bidirectional sugar transporter N...    233   1e-69    
ref|XP_007030240.1|  Nodulin MtN3 family protein isoform 1              234   1e-69    
ref|XP_010039128.1|  PREDICTED: bidirectional sugar transporter S...    234   1e-69    
ref|XP_009586714.1|  PREDICTED: bidirectional sugar transporter N...    233   1e-69    
ref|XP_006444236.1|  hypothetical protein CICLE_v10023774mg             233   1e-69    
ref|XP_009138751.1|  PREDICTED: bidirectional sugar transporter S...    233   1e-69    
gb|KDO87388.1|  hypothetical protein CISIN_1g036251mg                   233   2e-69    
ref|XP_007159991.1|  hypothetical protein PHAVU_002G283800g             234   2e-69    
ref|NP_001149496.1|  MTN3                                               233   2e-69    
gb|EMT20482.1|  Protein RUPTURED POLLEN GRAIN 1                         234   2e-69    
gb|AFW71562.1|  hypothetical protein ZEAMMB73_472818                    233   2e-69    
emb|CDY70861.1|  BnaCnng70080D                                          229   3e-69    
ref|XP_003552719.1|  PREDICTED: bidirectional sugar transporter N...    232   3e-69    
gb|KDO64484.1|  hypothetical protein CISIN_1g020739mg                   233   3e-69    
ref|XP_007139174.1|  hypothetical protein PHAVU_008G007600g             231   3e-69    
ref|XP_003526939.1|  PREDICTED: bidirectional sugar transporter S...    233   5e-69    
gb|KHN17298.1|  Bidirectional sugar transporter NEC1                    230   1e-68    
gb|KHN23961.1|  Bidirectional sugar transporter SWEET12                 230   4e-68    
gb|KHN31280.1|  Bidirectional sugar transporter SWEET14-like protein    230   5e-68    
ref|NP_001136928.1|  hypothetical protein                               229   7e-68    
ref|XP_010041902.1|  PREDICTED: bidirectional sugar transporter S...    228   1e-67    
ref|XP_010536596.1|  PREDICTED: bidirectional sugar transporter S...    229   1e-67    
ref|XP_004501726.1|  PREDICTED: bidirectional sugar transporter S...    228   1e-67    
ref|XP_006480106.1|  PREDICTED: bidirectional sugar transporter S...    228   1e-67    
gb|KDP22571.1|  hypothetical protein JCGZ_26402                         227   2e-67    
ref|XP_009391576.1|  PREDICTED: bidirectional sugar transporter S...    227   2e-67    
ref|XP_002462642.1|  hypothetical protein SORBIDRAFT_02g029430          226   6e-67    
emb|CDP14988.1|  unnamed protein product                                226   8e-67    
gb|AGV54262.1|  bidirectional sugar transporter SWEET12                 228   8e-67    
gb|AFK36312.1|  unknown                                                 226   8e-67    
ref|XP_011042931.1|  PREDICTED: LOW QUALITY PROTEIN: bidirectiona...    226   9e-67    
ref|XP_002465280.1|  hypothetical protein SORBIDRAFT_01g035490          227   1e-66    
gb|AFK47472.1|  unknown                                                 224   1e-66    
ref|XP_010674202.1|  PREDICTED: bidirectional sugar transporter N...    224   2e-66    
ref|XP_004489106.1|  PREDICTED: bidirectional sugar transporter S...    224   2e-66    
ref|XP_011084749.1|  PREDICTED: bidirectional sugar transporter N...    225   3e-66    
ref|XP_010926782.1|  PREDICTED: bidirectional sugar transporter S...    224   4e-66    
gb|KCW61425.1|  hypothetical protein EUGRSUZ_H04154                     223   6e-66    
gb|ACJ84828.1|  unknown                                                 223   9e-66    
ref|XP_006661417.1|  PREDICTED: bidirectional sugar transporter S...    220   2e-65    
ref|XP_010999465.1|  PREDICTED: bidirectional sugar transporter S...    221   2e-65    
gb|KEH21559.1|  bidirectional sugar transporter                         220   5e-65    
ref|XP_009383909.1|  PREDICTED: bidirectional sugar transporter N...    222   1e-64    
gb|KCW49075.1|  hypothetical protein EUGRSUZ_K026741                    219   2e-64    
gb|EAZ09693.1|  hypothetical protein OsI_31976                          219   3e-64    
gb|EAZ45313.1|  hypothetical protein OsJ_29956                          219   4e-64    
ref|XP_007030241.1|  Nodulin MtN3 family protein isoform 2              219   4e-64    
ref|XP_008234052.1|  PREDICTED: bidirectional sugar transporter N...    216   6e-64    
ref|XP_008389034.1|  PREDICTED: bidirectional sugar transporter N...    218   8e-64    
ref|XP_010528779.1|  PREDICTED: bidirectional sugar transporter S...    217   1e-63    
ref|XP_004984398.1|  PREDICTED: bidirectional sugar transporter S...    218   1e-63    
ref|XP_009103141.1|  PREDICTED: bidirectional sugar transporter S...    216   1e-63    
ref|XP_010045483.1|  PREDICTED: bidirectional sugar transporter S...    218   2e-63    
ref|XP_004174114.1|  PREDICTED: bidirectional sugar transporter S...    214   2e-63    
ref|XP_003518628.1|  PREDICTED: bidirectional sugar transporter NEC1    216   3e-63    
ref|XP_006376915.1|  hypothetical protein POPTR_0012s10500g             216   4e-63    
ref|XP_007137871.1|  hypothetical protein PHAVU_009G162800g             213   5e-63    
ref|XP_011069431.1|  PREDICTED: bidirectional sugar transporter N...    214   5e-63    
ref|XP_010682692.1|  PREDICTED: bidirectional sugar transporter S...    215   8e-63    
gb|EYU34244.1|  hypothetical protein MIMGU_mgv1a022710mg                214   9e-63    
gb|AES73031.2|  sugar efflux transporter for intercellular exchan...    213   9e-63    
ref|XP_002881628.1|  nodulin MtN3 family protein                        214   1e-62    
ref|XP_009417933.1|  PREDICTED: bidirectional sugar transporter S...    213   3e-62    
gb|AAM63257.1|  similar to MtN3 protein                                 213   4e-62    
ref|NP_181439.1|  bidirectional sugar transporter SWEET9                213   5e-62    
ref|XP_006296061.1|  hypothetical protein CARUB_v10025211mg             213   5e-62    
gb|EMT31030.1|  Protein RUPTURED POLLEN GRAIN 1                         212   6e-62    
ref|XP_006411131.1|  hypothetical protein EUTSA_v10017080mg             213   7e-62    
ref|XP_010517242.1|  PREDICTED: bidirectional sugar transporter S...    211   1e-61    
ref|NP_001148964.1|  LOC100282584                                       213   1e-61    
dbj|BAJ99068.1|  predicted protein                                      213   2e-61    
gb|KHN17480.1|  Bidirectional sugar transporter SWEET15                 211   4e-61    
tpg|DAA48249.1|  TPA: MTN3                                              212   4e-61    
gb|EMT31640.1|  Protein RUPTURED POLLEN GRAIN 1                         211   4e-61    
gb|KCW49089.1|  hypothetical protein EUGRSUZ_K02696                     210   4e-61    
gb|KFK36797.1|  hypothetical protein AALP_AA4G172400                    209   1e-60    
ref|XP_004974017.1|  PREDICTED: bidirectional sugar transporter S...    211   1e-60    
ref|XP_003617528.1|  Protein RUPTURED POLLEN GRAIN                      208   2e-60    
ref|XP_010509074.1|  PREDICTED: bidirectional sugar transporter S...    209   2e-60    
ref|XP_006347482.1|  PREDICTED: bidirectional sugar transporter S...    209   3e-60    
gb|EMS67211.1|  Bidirectional sugar transporter SWEET12                 210   3e-60    
gb|EYU43027.1|  hypothetical protein MIMGU_mgv1a022177mg                207   4e-60    
ref|XP_010505570.1|  PREDICTED: bidirectional sugar transporter S...    207   6e-60    
ref|XP_006651370.1|  PREDICTED: bidirectional sugar transporter S...    209   7e-60    
ref|XP_003561640.1|  PREDICTED: bidirectional sugar transporter S...    207   1e-59    
gb|ABD78942.1|  disease resistant allele xa13                           207   2e-59    
ref|NP_001062354.1|  Os08g0535200                                       207   2e-59    
ref|XP_006371147.1|  hypothetical protein POPTR_0019s04590g             205   2e-59    
gb|KDP32879.1|  hypothetical protein JCGZ_12171                         206   2e-59    
ref|XP_006388397.1|  hypothetical protein POPTR_0198s00220g             205   2e-59    



>ref|XP_004239304.1| PREDICTED: bidirectional sugar transporter N3 [Solanum lycopersicum]
Length=295

 Score =   355 bits (911),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 173/262 (66%), Positives = 215/262 (82%), Gaps = 3/262 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MALFDLHHPW+FVFGVLGN++S+LVFLAPVP F RI K KST+GYQSVPYVV+LFS+MLW
Sbjct  1     MALFDLHHPWLFVFGVLGNVISILVFLAPVPAFRRICKEKSTMGYQSVPYVVALFSSMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             MYYAF+KK+A LL+SINS GC++ET+YI+IF+ YASK ARRQT+++L+LL+GGLY++I L
Sbjct  61    MYYAFIKKNAILLVSINSFGCIVETIYITIFILYASKEARRQTVQLLVLLIGGLYTLIFL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+FP  G LRV +VGWICV  +V VFAAPLSIVF+VV+T++VEFMPF LSFFLTL+A+M
Sbjct  121   ITLFPLNGVLRVQVVGWICVTVAVGVFAAPLSIVFQVVRTRTVEFMPFTLSFFLTLSAIM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W GYGLLLKD+CIALPNVLGF LG++QM+LYGIYRN KP  +  EKK  V E  +N   +
Sbjct  181   WFGYGLLLKDLCIALPNVLGFFLGMIQMLLYGIYRNAKP-AIDLEKK--VCEHAVNSEQI  237

Query  432   GELLHSSVEDSKTTAITVSDAV  367
               +    V  + T  I ++  V
Sbjct  238   YPVDSEDVNFNDTEEINMAAIV  259



>ref|XP_009612477.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
tomentosiformis]
Length=314

 Score =   352 bits (903),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 178/262 (68%), Positives = 215/262 (82%), Gaps = 5/262 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+FDLHHPW+FVFGVLGNI+S+ VFLAPVPTF RIYK KST+G+QSVPYVV+LFS+MLW
Sbjct  1     MAIFDLHHPWLFVFGVLGNIISIFVFLAPVPTFRRIYKEKSTMGFQSVPYVVALFSSMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             MYYAF+KK+A LLISINS GC++ET+YISIFL YASK ARRQT+K+L+ L+GGLY++I L
Sbjct  61    MYYAFIKKNATLLISINSFGCIVETIYISIFLLYASKEARRQTVKLLVSLIGGLYTLIFL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+FP  G LRV +VGWICVA +V VFAAPLSIV +VV+TKSVEF+PF LSFFLTL+A+M
Sbjct  121   VTLFPLNGALRVQVVGWICVAVAVAVFAAPLSIVCQVVRTKSVEFLPFTLSFFLTLSAIM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W GYGLL KD+CIALPNVLGF LG++QM+LYG+YRN KP   A E +  VPE V+N+  L
Sbjct  181   WFGYGLLQKDLCIALPNVLGFFLGMIQMLLYGLYRNVKP---AAELEKKVPEHVVNIVVL  237

Query  432   G--ELLHSSVEDSKTTAITVSD  373
             G  E +H    +     I   D
Sbjct  238   GNSEQIHPVKSEKNEDMIKKLD  259



>ref|XP_009777590.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=315

 Score =   349 bits (896),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 176/269 (65%), Positives = 215/269 (80%), Gaps = 5/269 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+FDLHHPW+FVFG LGNI+S+ VFLAPVPTF RIYK KST+G+QSVPYVV+LFS+MLW
Sbjct  1     MAIFDLHHPWLFVFGALGNIISIFVFLAPVPTFRRIYKEKSTMGFQSVPYVVALFSSMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             MYYAF+KK+A LLISINS GC++ET+YISIFL YASK ARRQT+K+L+ L+GGLY++I L
Sbjct  61    MYYAFIKKNAILLISINSFGCIVETIYISIFLLYASKEARRQTVKLLVSLIGGLYTLIFL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+FP  G LRV +VGWICVA +V VFAAPLSIVF+VV+TKSVEF+PF LSFFLTL+A+M
Sbjct  121   VTLFPLNGALRVQVVGWICVAVAVAVFAAPLSIVFQVVRTKSVEFLPFTLSFFLTLSAIM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVIN--VA  439
             W GYGLL KD+CIALPNVLGF LG++QM+LYG+YR  KP   A E +  VPE ++N  V 
Sbjct  181   WFGYGLLQKDLCIALPNVLGFFLGMIQMLLYGLYRKVKP---AAELEKKVPEHIVNIVVV  237

Query  438   GLGELLHSSVEDSKTTAITVSDAVTEEKA  352
             G  E +H    +     I   D     ++
Sbjct  238   GNSEQIHPVKSEKNEDMIKKLDEEENRES  266



>gb|EYU42078.1| hypothetical protein MIMGU_mgv1a010705mg [Erythranthe guttata]
Length=304

 Score =   333 bits (855),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 164/273 (60%), Positives = 212/273 (78%), Gaps = 7/273 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+FD+HHPW F FGVLGNI+S+ V+LAP+PTF RI+K KST+G+ S+PY V+LFSAMLW
Sbjct  1     MAIFDIHHPWAFTFGVLGNIISIFVYLAPLPTFRRIFKEKSTMGFDSLPYAVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFLK +A LLISIN+ GC++ET+YIS+FL YASK AR +T K+L ++  G+ S+I +
Sbjct  61    LYYAFLKTNAVLLISINTFGCIVETIYISMFLFYASKKARGRTAKLLGVVNVGVLSLIFV  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F FKG  RV++VGWICVA SVCVFAAPLSIVF+VV+T+SVEFMPF LSFFLTL+AVM
Sbjct  121   VTFFIFKGQNRVHVVGWICVAVSVCVFAAPLSIVFQVVRTRSVEFMPFPLSFFLTLSAVM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPL---EVAEEKKGAV----PEL  454
             W GYGL  KD+C+A+PNVLGF+LG++QMVLYGI+RN K     +V +EKK  V     + 
Sbjct  181   WFGYGLFEKDLCVAVPNVLGFILGVLQMVLYGIFRNVKAEAINDVDDEKKMGVITTDHDH  240

Query  453   VINVAGLGELLHSSVEDSKTTAITVSDAVTEEK  355
             VIN+  LG     S   S+   +T+   V+++ 
Sbjct  241   VINIMVLGTPHKKSSSTSQYDDVTIKAQVSDDD  273



>ref|XP_011071246.1| PREDICTED: bidirectional sugar transporter N3 [Sesamum indicum]
Length=297

 Score =   327 bits (838),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/241 (66%), Positives = 195/241 (81%), Gaps = 4/241 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+FD+HHPW F FGVLGNI+S+ V+LAP+PTF RIYK +ST+G+ S+PYVV+LFSAMLW
Sbjct  1     MAVFDIHHPWAFTFGVLGNIISVFVYLAPLPTFFRIYKERSTMGFDSLPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             MYYAFLK +A LLISIN  GCVIE +YI I+L YASK AR  T K+L L+  GL ++I L
Sbjct  61    MYYAFLKTNAILLISINLFGCVIEAIYIFIYLFYASKKARTHTAKLLSLINVGLLALIFL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F FKG +RV++VGWICVA SV VFAAPL+IVF+VV+T+SVEFMPF LSFFLTL+AVM
Sbjct  121   LTFFIFKGPIRVHVVGWICVAVSVSVFAAPLTIVFQVVRTRSVEFMPFPLSFFLTLSAVM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W  YGL  KD+C+ALPNVLGF LG++QM+LYGI+RN KP    E +   +PE VIN+  L
Sbjct  181   WFAYGLFQKDLCVALPNVLGFFLGLLQMLLYGIFRNVKP----ENEDKKLPEHVINIMVL  236

Query  432   G  430
             G
Sbjct  237   G  237



>ref|XP_007222479.1| hypothetical protein PRUPE_ppa009789mg [Prunus persica]
 gb|EMJ23678.1| hypothetical protein PRUPE_ppa009789mg [Prunus persica]
Length=277

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/248 (61%), Positives = 190/248 (77%), Gaps = 0/248 (0%)
 Frame = -1

Query  1149  ALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWM  970
             AL D HHPW F FG+LGN++S LV+LAPVPTF  IYK KST G+QSVPY+V+LFS MLW 
Sbjct  3     ALADSHHPWAFTFGILGNVISFLVYLAPVPTFYGIYKKKSTQGFQSVPYLVALFSGMLWF  62

Query  969   YYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLA  790
             YYA LKK+A LLI+INS G VIET+YI +F+ YA K AR+ T+K+   +  GL+  I++ 
Sbjct  63    YYALLKKNAMLLITINSFGTVIETIYIVMFIFYAPKDARKFTLKLFGFMNVGLFCSILVL  122

Query  789   TMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMW  610
             + F  +   RV ++GWI VA SV VFAAPLSIV +V++T+SVEFMPF+LSFFLTL+AVMW
Sbjct  123   SHFAVRSEYRVPVLGWINVAISVIVFAAPLSIVAQVIRTRSVEFMPFSLSFFLTLSAVMW  182

Query  609   LGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLG  430
               YGL LKD+CIA+PNVLGF+LG++QM+LY IYRN+KP+E  E+K  A  + V NV GL 
Sbjct  183   FSYGLFLKDICIAIPNVLGFILGLLQMLLYAIYRNRKPIEDDEKKIPAADQHVKNVVGLT  242

Query  429   ELLHSSVE  406
              L  S V 
Sbjct  243   TLATSEVH  250



>ref|XP_004310113.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Fragaria 
vesca subsp. vesca]
Length=305

 Score =   300 bits (768),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 147/253 (58%), Positives = 195/253 (77%), Gaps = 2/253 (1%)
 Frame = -1

Query  1149  ALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWM  970
             A+ D HHPW F FG+LGN++S +V+LAPVPTF RI+K KST G+QSVPY+V+LFSA LW+
Sbjct  3     AVADAHHPWAFTFGILGNLISFMVYLAPVPTFYRIFKKKSTEGFQSVPYLVALFSATLWL  62

Query  969   YYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLA  790
             YYA LK++A LLI+IN+ G VIETLYI++++ YA+K +R+ T+K+L  +  GL+S+I++ 
Sbjct  63    YYAMLKQNAVLLITINTFGSVIETLYIAMYIVYATKASRKFTIKLLGFMNLGLFSLILVI  122

Query  789   TMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMW  610
               + F    R  ++GWI VA SVCVFAAPLSIV  V++TKSVEFMPF+LSFFLTL+AVMW
Sbjct  123   LQYAFHSEYRAPVLGWINVAISVCVFAAPLSIVAHVIRTKSVEFMPFSLSFFLTLSAVMW  182

Query  609   LGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLG  430
               YGL LKD+CIALPNVLGF+LG++QM+LY IYRN+KP+    E K   PE + ++  L 
Sbjct  183   FAYGLFLKDICIALPNVLGFILGLLQMLLYAIYRNRKPVIFDPEDKLRAPEQMKSIVILS  242

Query  429   ELLHSSVE--DSK  397
              +  S V   D+K
Sbjct  243   TIPTSEVHPVDAK  255



>gb|KHG20984.1| Bidirectional sugar transporter SWEET15 -like protein [Gossypium 
arboreum]
Length=289

 Score =   299 bits (765),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 150/269 (56%), Positives = 194/269 (72%), Gaps = 5/269 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+   HH    VFG+LGNI+S+LVFLAPVPTF RIYK KST  +QS+PY V+LFS MLW
Sbjct  1     MAVMADHHSLAVVFGILGNIISVLVFLAPVPTFCRIYKKKSTESFQSLPYQVALFSCMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA +KK A LLI+INS GCV+ET+YIS+FL YASK +R   MK+ + +  GL+S I++
Sbjct  61    LYYALIKKGAFLLITINSFGCVVETIYISMFLAYASKNSRMSAMKLFISMNLGLFSFILI  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F  K ++R+ ++GWICVA SV VFAAPL+I+ +V++TKSVEFMPF LSFFLTL+AVM
Sbjct  121   LTHFLLKSSIRIQVLGWICVAISVSVFAAPLNIMARVIRTKSVEFMPFTLSFFLTLSAVM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVA--  439
             W  YGL +KD+C+ALPNVLGF+LG++QM+LY IYR+ + + + E+K  A     INV   
Sbjct  181   WFAYGLFIKDLCVALPNVLGFILGMLQMLLYAIYRHSEKVNIEEKKLPAEQMKSINVVLT  240

Query  438   --GLGELLHSSVEDSKTTAITVSDAVTEE  358
               G  E +H  V D  T      D    E
Sbjct  241   TLGASE-VHPVVLDIHTDDTKEEDNKNNE  268



>ref|XP_010249453.1| PREDICTED: bidirectional sugar transporter SWEET12 [Nelumbo nucifera]
Length=292

 Score =   297 bits (761),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 191/243 (79%), Gaps = 1/243 (0%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+FD+HHPW F FG+LGNI+SL+V+LAPVPTFIRIYK KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAMFDVHHPWTFAFGLLGNIISLMVYLAPVPTFIRIYKKKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YY  LK  A LLI+INS+GCVIET YI++F+ YA K AR   +K+LLLL  G +  I+L
Sbjct  61    IYYGLLKPDAHLLITINSVGCVIETSYITMFMVYAPKKARVLAIKLLLLLNVGTFCSILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+F  KG+ RV ++G ICVAFSV VFAAPLSI+  V+++KSVEFMPF+LSFFLTL+AVM
Sbjct  121   FTLFLAKGSNRVRVLGSICVAFSVSVFAAPLSIMRLVIRSKSVEFMPFSLSFFLTLSAVM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W  YG LLKD  IALPN+LGF+ G+ QMVLY IY++     + EE++  V E VI+V  L
Sbjct  181   WFSYGFLLKDFYIALPNILGFIFGVAQMVLYAIYKDANRSNI-EEQQQKVNEHVIDVIKL  239

Query  432   GEL  424
               +
Sbjct  240   NSV  242



>ref|XP_007043874.1| Senescence-associated gene 29 [Theobroma cacao]
 gb|EOX99705.1| Senescence-associated gene 29 [Theobroma cacao]
Length=287

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 198/270 (73%), Gaps = 9/270 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+   HH W   FGV GNI+S+LV+LAPVPTF RIY+ KST  +QS+PY V+LFS+MLW
Sbjct  1     MAVMGDHHSWAVAFGVFGNIISVLVYLAPVPTFYRIYRKKSTESFQSLPYQVALFSSMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA +KK A LLI+INS GC++ET+YISI++ YASK +R   MK+ + +  GL+S+I++
Sbjct  61    LYYALIKKDAFLLITINSFGCIVETMYISIYIAYASKNSRMSAMKLFVGMNVGLFSLILI  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F  K ++R+ ++GWICVA SV VFAAPL+IV +V++T SVEFMPFNLSFFLTL+A+M
Sbjct  121   LTRFLVKSSIRIQLLGWICVAISVSVFAAPLNIVARVIRTGSVEFMPFNLSFFLTLSAIM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPE-----LVI  448
             W  YGL +KD+C+ALPNVLGF+LG++QM+LY +YRN K  +  EEKK   PE     +V+
Sbjct  181   WFAYGLFIKDICVALPNVLGFVLGMLQMLLYAVYRNTK--KAIEEKKP--PEQLKTVVVL  236

Query  447   NVAGLGELLHSSVEDSKTTAITVSDAVTEE  358
             +  G  E+    ++    +  T  +  T E
Sbjct  237   STIGASEVYPVDIQPDANSNKTKENEQTGE  266



>ref|XP_010090683.1| Bidirectional sugar transporter N3 [Morus notabilis]
 gb|EXB40347.1| Bidirectional sugar transporter N3 [Morus notabilis]
Length=286

 Score =   296 bits (757),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 144/266 (54%), Positives = 196/266 (74%), Gaps = 5/266 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F++ HPW F FG+LGNI+S+LV+LAPV TF R+Y+ KST  + S+PY+V+LFS+MLW
Sbjct  1     MAIFNIQHPWTFTFGILGNIISVLVYLAPVTTFYRVYRKKSTEDFHSLPYLVALFSSMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK  A LLI+INS GCVIE +YI++F+ YA   A++ T+K   L+  G++S+I L
Sbjct  61    LYYALLKTDAMLLITINSFGCVIEMIYITMFIVYAPSHAKKLTIKFFALMNVGMFSLIFL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F    + RV ++GWICVA SV VFAAPLSIV +V++T+SVEFMPF LSFFLTL+A+ 
Sbjct  121   VTQFAVGHSYRVQVLGWICVAISVSVFAAPLSIVAQVIRTRSVEFMPFTLSFFLTLSAIT  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W  YGLLLKD+CIA+PNVLGF+LG++QM+LY IYRN K  E  E+K   + E + N    
Sbjct  181   WFAYGLLLKDICIAVPNVLGFVLGLLQMLLYAIYRNYKTEEDQEKK---LSEHMRNTLAT  237

Query  432   GELLHSSVEDSKTTAITVSDAVTEEK  355
              + +H  V+++K       D V++E 
Sbjct  238   SDQVH-PVDNAKYNG-DHDDKVSKEH  261



>ref|XP_010250599.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nelumbo 
nucifera]
Length=287

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/241 (62%), Positives = 191/241 (79%), Gaps = 2/241 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MALF++HHPW F FG+LGN++S +V+LAP+PTF RIYK KST G+QSVPYVV+LFSAMLW
Sbjct  1     MALFNIHHPWTFTFGLLGNLISFMVYLAPLPTFFRIYKKKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFLK  A LLI+INS GC IET+YI +F+ YASK  R +T+K+LLLL  G + +I+L
Sbjct  61    IYYAFLKPDAHLLITINSFGCFIETVYIVMFMIYASKKVRIETIKLLLLLNVGTFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+F   GT R  IVGW+CVAFSV VFAAPLSI+  V++TKSVEFMPF+LSFFLTL+AVM
Sbjct  121   LTLFLAHGTKRAQIVGWLCVAFSVSVFAAPLSIMRLVIRTKSVEFMPFSLSFFLTLSAVM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W  YG L KD+ +ALPN+LGF+ GI+QM+LY IY++ K + + E+K     E +I+V  L
Sbjct  181   WFSYGFLQKDLYVALPNILGFIFGILQMLLYVIYKDSKKVIIEEQKVNN--EHIIDVRKL  238

Query  432   G  430
              
Sbjct  239   N  239



>ref|XP_008222221.1| PREDICTED: bidirectional sugar transporter N3 [Prunus mume]
Length=282

 Score =   293 bits (750),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/253 (58%), Positives = 190/253 (75%), Gaps = 5/253 (2%)
 Frame = -1

Query  1149  ALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWM  970
             AL D HHPW F FG+LGN++S LV+LAP+PTF  IYK KST G+QSVPY+V+LFS MLW 
Sbjct  3     ALADSHHPWAFTFGILGNVISFLVYLAPMPTFYGIYKKKSTQGFQSVPYLVALFSGMLWF  62

Query  969   YYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLA  790
             YYA LKK+A LLI+INS G VIET+YI +F+ YA K AR+ T+K+   +  GL+  I++ 
Sbjct  63    YYALLKKNAMLLITINSFGTVIETIYIVMFIFYAPKDARKFTLKLFGFMNVGLFCSILVL  122

Query  789   TMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMW  610
             + F  +   RV ++GWI VA SV VFAAPLSIV +V++T+SVEFMPF+LSFFLTL+AVMW
Sbjct  123   SHFAVRSEYRVPVLGWINVAISVIVFAAPLSIVAQVIRTRSVEFMPFSLSFFLTLSAVMW  182

Query  609   LGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK-----GAVPELVIN  445
               YGL LKD+CIA+PNVLGF+LG++QM+LY IYRN++ + + +++K      A  + V N
Sbjct  183   FSYGLFLKDICIAIPNVLGFILGLLQMLLYAIYRNREQVIIEDDEKKIPAAAAADQHVKN  242

Query  444   VAGLGELLHSSVE  406
             V GL  L  S V 
Sbjct  243   VVGLTTLATSEVH  255



>ref|XP_006844581.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
 gb|ERN06256.1| hypothetical protein AMTR_s00016p00202420 [Amborella trichopoda]
Length=282

 Score =   292 bits (748),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/282 (53%), Positives = 201/282 (71%), Gaps = 21/282 (7%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   +HHPW F FG+LGNI+S +V+L+P+PTF R+YK KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAFLSVHHPWAFTFGLLGNIISFMVYLSPLPTFHRVYKKKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK    LLI+IN++GC+IE++YI++++ YA K A+  T K+++LL  G++ +I+L
Sbjct  61    IYYALLKTDGYLLITINTLGCIIESIYITMYIIYAPKKAKIATAKLVVLLNLGVFCMILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+F  +G  RV ++GW+CV FSVCVFAAPLSI+  V++TKSVEFMPF+LSF LTL+AVM
Sbjct  121   LTLFFVQGPKRVRVLGWVCVTFSVCVFAAPLSIMRLVIQTKSVEFMPFSLSFSLTLSAVM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W  YGLL KD  IALPNVLGF+ GI+QMVLY IY+  K   +  +KK  +PE V+N+  +
Sbjct  181   WFSYGLLTKDFYIALPNVLGFIFGIIQMVLYIIYKGTKKAFI--DKK--LPEQVVNIVKI  236

Query  432   -----------------GELLHSSVEDSKTTAITVSDAVTEE  358
                              GE +  SVE S    + V+  VTE 
Sbjct  237   STLGSSDVFPINGQAVSGECVTDSVEKSLEQVVIVAHTVTEN  278



>ref|XP_004145146.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 ref|XP_004153502.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=291

 Score =   291 bits (745),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 192/258 (74%), Gaps = 8/258 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MALFD HHP VF FG+LGNI+S +VFLAPVPTF+RIYK KST G+QSVPYVV+LFSAMLW
Sbjct  1     MALFDTHHPGVFAFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA    +  LLI+INS+GC+IETLYI+IF+ +A K  R  T++ +LLL  G + +I+L
Sbjct  61    LYYASFNSNETLLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F   G+ +V +VGWICVAFSV VFAAPL+I+  V++TKSVEFMPF+LSFFLTL+A+ 
Sbjct  121   VTHFLVHGSNQVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAIT  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             WL YG+ LKD+ +ALPNVLGF+ G+ QM+LY IYR     E+A  K+  +PE        
Sbjct  181   WLLYGVFLKDIYVALPNVLGFIFGVAQMILYLIYRKY---EIAIAKEMKLPE-----QTT  232

Query  432   GELLHSSVEDSKTTAITV  379
              +++    +DS   AI V
Sbjct  233   VDIVMKQKQDSSVEAIEV  250



>ref|XP_011020821.1| PREDICTED: bidirectional sugar transporter N3-like [Populus euphratica]
Length=285

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 187/227 (82%), Gaps = 3/227 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+  + H   F FG+LGNI+S +VFLAPVPTFIRI+K KST  +QS+PY+++LFS+MLW
Sbjct  1     MAVTSILH-LAFTFGILGNIISTMVFLAPVPTFIRIFKKKSTEDFQSLPYLMALFSSMLW  59

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LKK   LL++INS GC+IET YI+I++ YA++ +R  T+K+L+ +  GL+S+I+L
Sbjct  60    LYYAMLKKDTILLVTINSFGCLIETTYIAIYIVYATRESRVSTIKLLISMNMGLFSLILL  119

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F   G++RV ++GW+CVA SVCVFAAPL+I+ +V++TKSVEFMPF LSFFLTL+AVM
Sbjct  120   LAHFLVSGSVRVKVLGWLCVALSVCVFAAPLNILKQVIRTKSVEFMPFTLSFFLTLSAVM  179

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK  472
             W  YGLLLKD+C+ALPN+LGF+LG++QMVLYGIYRN + +E  E+KK
Sbjct  180   WFAYGLLLKDLCVALPNILGFILGLLQMVLYGIYRNAQKVE--EKKK  224



>ref|XP_008440025.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
melo]
Length=291

 Score =   289 bits (740),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 191/258 (74%), Gaps = 7/258 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MALFD HHP VF FG+LGNI+S +VFLAPVPTF+RI K KST G+QSVPYVV+LFSAMLW
Sbjct  1     MALFDTHHPGVFAFGLLGNIISFIVFLAPVPTFMRICKKKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA    +  LLI+INS+GC+IETLYI+IF+ +A K  R  T++ +LLL  G + +I+L
Sbjct  61    LYYASFNSNETLLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F   G+ +V +VGWICVAFSV VFAAPL+I+  V++TKSVEFMPF+LSFFLTL+A+ 
Sbjct  121   VTHFLVHGSNQVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAIT  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             WL YG+ LKD+ +ALPNVLGF+ G+ QM+LY IYR     E+A  K+  +PE       +
Sbjct  181   WLLYGVFLKDIYVALPNVLGFIFGVAQMILYLIYRK---YEIAIAKEMKLPEQ----TKM  233

Query  432   GELLHSSVEDSKTTAITV  379
              ++     +DS   AI V
Sbjct  234   DDIAMKQKQDSSVEAIEV  251



>ref|XP_008392763.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=248

 Score =   287 bits (735),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 145/243 (60%), Positives = 186/243 (77%), Gaps = 5/243 (2%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HHP  F FG+LGNIVS +VFLAP+PTF R+YK KST G+QSVPYV +LFSAM+W+YYAFL
Sbjct  7     HHPLAFAFGILGNIVSFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFSAMIWIYYAFL  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K    LLI+INS GCVIET+YI+I+L YA+K AR  T+++LLL+  G + +I+L + F  
Sbjct  67    KSHVILLITINSFGCVIETIYIAIYLTYATKHARVSTLRLLLLVNFGGFCLILLLSHFLS  126

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
             +G  RV ++GW+CV FSV VFAAPLS++  V++TKSVEFMPFNLSFFLTL+AVMWL YGL
Sbjct  127   QGPTRVEVLGWVCVTFSVSVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWLCYGL  186

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLHS  415
             LLKD+ +A PN+LGF  G+VQM LY  YRN K   + EEK   +PE   +V    ++L +
Sbjct  187   LLKDLYVATPNILGFSFGVVQMALYAKYRNTK--TIVEEK---LPEHKADVVKQIKILTT  241

Query  414   SVE  406
             + E
Sbjct  242   TPE  244



>gb|KHN24976.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=272

 Score =   288 bits (737),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 190/265 (72%), Gaps = 6/265 (2%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH   F FG+LGN++S LVFLAPVPTF RIYK KST  +QS+PY+V+LFS+MLW+YYA L
Sbjct  5     HHTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYYALL  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K+ A LLI+INS GCVIE +YI +++ YA++ AR  T+K+   +    ++VI+L T F  
Sbjct  65    KRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMTSFAVILLVTHFGV  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G LRV ++GWICV+ SV VFAAPLSIV +VV+TKSVEFMPFNLSF LTL+A+MW GYGL
Sbjct  125   HGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL----VINVAGLGE  427
              LKD+CIALPNVLGF+LG++QM+LY IYR         EK  +V  L    V+N  G GE
Sbjct  185   FLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTNTNEKSLSVKPLKNIAVVNPLGTGE  244

Query  426   LLHSSVEDSKTTAITVSDAVTEEKA  352
             +    VE+ +  A        ++KA
Sbjct  245   VF--PVEEDEQAAKKSQGDGEDKKA  267



>ref|XP_003530901.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=272

 Score =   288 bits (737),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 148/265 (56%), Positives = 190/265 (72%), Gaps = 6/265 (2%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH   F FG+LGN++S LVFLAPVPTF RIYK KST  +QS+PY+V+LFS+MLW+YYA L
Sbjct  5     HHTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYYALL  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K+ A LLI+INS GCVIE +YI +++ YA++ AR  T+K+   +    ++VI+L T F  
Sbjct  65    KRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMTSFAVILLVTHFGV  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G LRV ++GWICV+ SV VFAAPLSIV +VV+TKSVEFMPFNLSF LTL+A+MW GYGL
Sbjct  125   HGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL----VINVAGLGE  427
              LKD+CIALPNVLGF+LG++QM+LY IYR         EK  +V  L    V+N  G GE
Sbjct  185   FLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTNTNEKSLSVKPLKNIAVVNPLGTGE  244

Query  426   LLHSSVEDSKTTAITVSDAVTEEKA  352
             +    VE+ +  A        ++KA
Sbjct  245   VF--PVEEDEQAAKKSQGDGEDKKA  267



>ref|XP_004161953.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64434.1| hypothetical protein Csa_1G051720 [Cucumis sativus]
Length=291

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 191/258 (74%), Gaps = 8/258 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MALFD HHP VF FG+LGNI+S +VFLAPVPTF+RI K KST G+QSVPYVV+LFSAMLW
Sbjct  1     MALFDTHHPGVFAFGLLGNIISFIVFLAPVPTFMRICKKKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA    +  LLI+INS+GC+IETLYI+IF+ +A K  R  T++ +LLL  G + +I+L
Sbjct  61    LYYASFNSNETLLITINSVGCLIETLYIAIFIVFAPKQIRVSTLRFVLLLNFGGFCIILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F   G+ +V +VGWICVAFSV VFAAPL+I+  V++TKSVEFMPF+LSFFLTL+A+ 
Sbjct  121   VTHFLVHGSNQVKVVGWICVAFSVSVFAAPLTIMRLVIRTKSVEFMPFSLSFFLTLSAIT  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             WL YG+ LKD+ +ALPNVLGF+ G+ QM+LY IYR     E+A  K+  +PE        
Sbjct  181   WLLYGVFLKDIYVALPNVLGFIFGVAQMILYLIYRKY---EIAIAKEMKLPE-----QTT  232

Query  432   GELLHSSVEDSKTTAITV  379
              +++    +DS   AI V
Sbjct  233   VDIVMKQKQDSSVEAIEV  250



>ref|XP_009337539.1| PREDICTED: bidirectional sugar transporter N3 [Pyrus x bretschneideri]
Length=298

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/256 (58%), Positives = 191/256 (75%), Gaps = 6/256 (2%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HHP  F FG+LGNIVS +VFLAP+PTF R+YK KST G+QSVPYV +LFSAM+W+YYAFL
Sbjct  7     HHPLAFAFGILGNIVSFIVFLAPLPTFWRVYKRKSTEGFQSVPYVFALFSAMIWIYYAFL  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K    LLI+INS GCVIET+YI+I+L YA+K AR  T+++LLL+  G + +I+L + F  
Sbjct  67    KSHVILLITINSFGCVIETIYIAIYLTYATKQARVSTLRLLLLVNFGGFCLILLLSRFLS  126

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
             +G  RV ++GW+CV FSV VFAAPLS++  V++TKSVEFMPFNLSFFLTL+AVMWL YGL
Sbjct  127   QGPTRVEVLGWVCVTFSVGVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWLCYGL  186

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLHS  415
             LLKD+ +A PN++GF  G+VQM LY  YRN K   + EEK   +PE   +V     +L +
Sbjct  187   LLKDLYVATPNIIGFSFGVVQMALYTKYRNTK--TIGEEK---LPEHKADVVKQITILTT  241

Query  414   SVE-DSKTTAITVSDA  370
             + E + +  A   SDA
Sbjct  242   TPEVEVQVQAPVTSDA  257



>ref|XP_004490502.1| PREDICTED: bidirectional sugar transporter N3-like [Cicer arietinum]
Length=270

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 142/260 (55%), Positives = 188/260 (72%), Gaps = 0/260 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H    FVFG+LGNI+S +VFLAP+PTF RI+K KST G+QS+PY+V+LFS+MLW+YYA +
Sbjct  4     HIHLAFVFGILGNIISFMVFLAPLPTFYRIWKKKSTQGFQSLPYLVALFSSMLWLYYAIV  63

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K +A LLI+INS GCVIET+YI I+  YA+K AR  T+K+ +++  G +++I   T F  
Sbjct  64    KTNARLLITINSFGCVIETIYIVIYTIYATKDARILTVKLFMVMNVGSFALIFFTTQFGM  123

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G+LRV ++GWICV+F+VCVFAAPL IV KV++TKSVEFMPFNLSFFLTL+A+MW  YGL
Sbjct  124   HGSLRVQVLGWICVSFAVCVFAAPLCIVAKVIRTKSVEFMPFNLSFFLTLSAIMWFAYGL  183

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLHS  415
             LLKD+CIALPNVLGF LG++QM+LY IY     + + E+        V+ V  LG     
Sbjct  184   LLKDICIALPNVLGFTLGLLQMLLYAIYNKGSKVSIKEDYALNPMTNVVVVNPLGTCEVV  243

Query  414   SVEDSKTTAITVSDAVTEEK  355
             ++ D         D   E++
Sbjct  244   TIPDIDIVTTQGKDGAEEKE  263



>ref|XP_010027258.1| PREDICTED: bidirectional sugar transporter N3-like [Eucalyptus 
grandis]
Length=294

 Score =   286 bits (731),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 140/250 (56%), Positives = 183/250 (73%), Gaps = 8/250 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA FD HH W   FG+LGNIVS  VFLAP PTF RIYK KST G+QS+PY+V+LFS+MLW
Sbjct  1     MAFFDHHHFWTLTFGILGNIVSFFVFLAPAPTFYRIYKEKSTEGFQSIPYLVALFSSMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFLK  + LLI+INS GCVIE +YI+I++ YA + AR  T+K+  L+  GL+S+++L
Sbjct  61    LYYAFLKGHSFLLITINSFGCVIEMVYIAIYIAYALRAARSSTIKLFALMNVGLFSLLIL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F   G  R  + GWIC   SV VFAAPL IV +VV+TKSVEFMPF+LSFFLTL+A+M
Sbjct  121   IIHFIPNGDARTTVFGWICTTISVSVFAAPLGIVARVVRTKSVEFMPFSLSFFLTLSAIM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPL----EVAEEKKGAVPELVIN  445
             W GYG   KD CI +PN++GF+LG+ QMVLYG YRN+  +    E+ +EK   +P+ V++
Sbjct  181   WFGYGFFQKDWCIMIPNIVGFVLGLSQMVLYGYYRNKGVIIIKDEIMDEK---LPQHVVH  237

Query  444   -VAGLGELLH  418
               +G   ++H
Sbjct  238   PTSGRASVVH  247



>ref|NP_001239695.1| uncharacterized protein LOC100777741 [Glycine max]
 gb|ACU24541.1| unknown [Glycine max]
 gb|KHN03191.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=268

 Score =   285 bits (728),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/257 (55%), Positives = 186/257 (72%), Gaps = 3/257 (1%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H    F FG+LGN++S LVFLAP+ TF RI+K KST G+QS+PY+V+LFS+MLW+YYA L
Sbjct  5     HSTLAFAFGMLGNVISFLVFLAPITTFYRIFKKKSTEGFQSLPYLVALFSSMLWLYYALL  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK A LL++INS GCVIE +YI +++ YA++ AR  T+K+   +  G +++I+L T F  
Sbjct  65    KKDAMLLLTINSFGCVIEVIYIILYITYATRDARNLTLKLFFAMNVGAFALILLVTHFAV  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G+LRV ++GWICV+ S+ VFAAPLSIV +VV+TKSVEFMPFNLSF LTL+A+MW GYGL
Sbjct  125   HGSLRVQVLGWICVSLSISVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRN-QKPLEVAEEKKGAVPEL--VINVAGLGEL  424
              LKD+CIALPNVLGF LG++QM+LY IYRN  K ++   EKK  +  L  V+   GL E 
Sbjct  185   FLKDICIALPNVLGFALGLLQMLLYAIYRNGNKKVDKIMEKKAPLEPLKTVVIETGLEEK  244

Query  423   LHSSVEDSKTTAITVSD  373
                      +     SD
Sbjct  245   QQGKKSKENSEEKEKSD  261



>ref|XP_003551863.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=271

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 144/252 (57%), Positives = 184/252 (73%), Gaps = 5/252 (2%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH   F FG+LGN++S LVFLAPVPTF RIYK KST  +QS+PY+V+LFS+MLW+YYA L
Sbjct  5     HHTLAFTFGMLGNLISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYYAML  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K+ A LLI+INS GCVIE +YI +++ YA++ AR  T+K+   +    +++I+L T F  
Sbjct  65    KRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMSSFALILLVTHFAV  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G LRV ++GWICV+ SV VFAAPLSIV +VV+TKSVEFMPFNLSF LTL+A+MW GYGL
Sbjct  125   HGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPE---LVINVAGLGEL  424
              LKD+CIALPNVLGF+LG++QM+LY IYR         EK    P     V+N  G GE+
Sbjct  185   FLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTKTNEKSPVEPLKSIAVVNPLGTGEV  244

Query  423   LHSSVEDSKTTA  388
                 VE+ +  A
Sbjct  245   F--PVEEDEQAA  254



>ref|XP_002873602.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49861.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=295

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 190/262 (73%), Gaps = 2/262 (1%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH   F+FG+LGN++S LVFLAPVPTF RIYK KST  +QS+PY VSLFS MLW+YYA +
Sbjct  7     HHLLAFIFGILGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYYALI  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK A LLI+INS GCV+ETLYI++F  YA+K  R   +K+ + +    +S+I++ T F  
Sbjct  67    KKDAFLLITINSFGCVVETLYIAMFFAYATKDKRISALKLFIAMNVAFFSLILMVTHFVV  126

Query  774   KG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
             +  TL+V+++GWICVA SV VFAAPL IV +V+KTKSVEFMPF LSFFLT++AVMW  YG
Sbjct  127   ETPTLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYG  186

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLH  418
             L L D+CIA+PNV+GF+LG++QMVLYG+YRN       E+K  +  + + ++  +  L  
Sbjct  187   LFLNDICIAIPNVVGFVLGLLQMVLYGVYRNSNEKPEMEKKINSSEQQLKSIVVMSPLGV  246

Query  417   SSVEDSKTTAIT-VSDAVTEEK  355
             S V    T ++  +SDAV  E 
Sbjct  247   SEVHPVVTESVDPLSDAVHHED  268



>ref|XP_011036129.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Populus 
euphratica]
Length=282

 Score =   285 bits (729),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/278 (53%), Positives = 206/278 (74%), Gaps = 17/278 (6%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+ ++ HP  F FG+LGNI+S +V+LAPVPTFIRI + KST  +QS+PY+V+LFS+MLW
Sbjct  1     MAVMNMQHPLAFTFGILGNIISFMVYLAPVPTFIRILRKKSTEDFQSLPYLVALFSSMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK  A LL++INS GCVIE++YI+I++ YA++ +R  T+K+L+ +  GL+S+I+L
Sbjct  61    LYYAMLKNDAILLVTINSFGCVIESIYIAIYIAYATRESRVSTIKLLVSMNMGLFSLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F   G+ RV  +GW+CVAFSVCVFAAPLSIV ++++TKSVEFMPF LSFFLTL+AVM
Sbjct  121   LTHFLASGSTRVKALGWLCVAFSVCVFAAPLSIVKQIIRTKSVEFMPFTLSFFLTLSAVM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEV-AEEKKGAVPELVINVAG  436
             W  YGL +KD+C+ALPN+LGF+LG++QM+LYGIYRN K  ++ AE  K +V   +++  G
Sbjct  181   WFAYGLFIKDLCVALPNILGFVLGLLQMLLYGIYRNAKKKKIPAEILKSSV---ILSTLG  237

Query  435   LGELL------------HSSVEDSKTTAITVSDAVTEE  358
               E+             H   E+SK    + +DA  ++
Sbjct  238   ASEVYPVDAQPDVSAAEHDQTEESKENEKS-TDASHDD  274



>ref|XP_006347346.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=287

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 154/283 (54%), Positives = 194/283 (69%), Gaps = 20/283 (7%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA F  H  W F FGVLGNI+S  VFL+P+PTF  IYK KST GYQS+PYVV+LFSAMLW
Sbjct  1     MAGFSDH--WTFAFGVLGNIISFFVFLSPLPTFYNIYKKKSTEGYQSIPYVVALFSAMLW  58

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFLK +  LL++IN+ GC IETLY+  +L YA K AR QT+K+LLLLV G +  IVL
Sbjct  59    IYYAFLKTNTTLLVTINTFGCFIETLYVGFYLFYAPKKARVQTIKLLLLLVVGGFGAIVL  118

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F FKG +R  IVGWIC+ FS+CVF APL IV +V+KTKSVE+MPF LS FLTL+AVM
Sbjct  119   VTQFLFKGAIRAQIVGWICLVFSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVM  178

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVA--------------EEK  475
             W  YGLLLKD  IA+PNVLGF+ GI+QM+LY +Y  ++ + +               E+ 
Sbjct  179   WFFYGLLLKDFNIAIPNVLGFIFGILQMILYVMYNKKEEVVIKEQNLPELKDHVIILEDD  238

Query  474   KGAVPEL----VINVAGLGELLHSSVEDSKTTAITVSDAVTEE  358
             K  +PEL    +IN+  LG L++S         +  +D V  +
Sbjct  239   KKKLPELSEEQIINIMKLGSLVYSEKNYGNLNEVAKNDKVVSK  281



>gb|KHN03192.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=271

 Score =   283 bits (725),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/252 (57%), Positives = 184/252 (73%), Gaps = 5/252 (2%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH   F FG+LGN++S LVFLAPVPTF RIYK KST  +QS+PY+V+LFS+MLW+YYA L
Sbjct  5     HHTLAFTFGMLGNLISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYYAML  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K+ A LLI+INS GCVIE +YI +++ YA++ AR  T+K+   +    +++I+L T F  
Sbjct  65    KRDAVLLITINSFGCVIEIIYIVLYITYATRDARNLTIKLFSAMNMSSFALILLVTHFAV  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G LRV ++GWICV+ SV VFAAPLSIV +VV+TKSVEFMPFNLSF LTL+A+MW GYGL
Sbjct  125   HGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPE---LVINVAGLGEL  424
              LKD+CIALPNVLGF+LG++QM+LY IYR         +K    P     V+N  G GE+
Sbjct  185   FLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKTKTNDKSPVEPLKSIAVVNPLGTGEV  244

Query  423   LHSSVEDSKTTA  388
                 VE+ +  A
Sbjct  245   F--PVEEDEQAA  254



>ref|XP_004241452.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Solanum 
lycopersicum]
Length=287

 Score =   283 bits (725),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 153/278 (55%), Positives = 193/278 (69%), Gaps = 20/278 (7%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA F  H  W F FGVLGNI+S  VFL+P+PTF  IYK KST GYQS+PYVV+LFSAMLW
Sbjct  1     MAGFSDH--WTFAFGVLGNIISFFVFLSPLPTFYNIYKKKSTEGYQSIPYVVALFSAMLW  58

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFLK +  LL++IN+ GC IETLY+  +L YA K AR QT+K+LLLLV G +  I+L
Sbjct  59    IYYAFLKTNTTLLVTINTFGCFIETLYVGFYLFYAPKKARVQTIKLLLLLVVGGFGAIIL  118

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F FKG +R  IVGWIC+ FS+CVF APL IV +V+KTKSVE+MPF LS FLTL+AVM
Sbjct  119   ITQFLFKGAIRAQIVGWICLVFSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVM  178

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVA--------------EEK  475
             W  YGLLLKD  IA+PNVLGF+ GI+QM+LY +Y  ++ + +               E+ 
Sbjct  179   WFFYGLLLKDFNIAIPNVLGFIFGILQMILYVMYNKKEKVVIKEQNLPELKDHVIIIEDD  238

Query  474   KGAVPEL----VINVAGLGELLHSSVEDSKTTAITVSD  373
             K  +PEL    +IN+  LG L++S       T +  +D
Sbjct  239   KKKLPELSEEQIINIIKLGSLVYSDKNYGNLTEVAKND  276



>ref|XP_009614916.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X2 [Nicotiana tomentosiformis]
Length=298

 Score =   284 bits (726),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 148/253 (58%), Positives = 183/253 (72%), Gaps = 5/253 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA F  H  W F FGVLGNIVS  VFL+P+PTF +IY+ KST GYQS+PYVV+LFSAMLW
Sbjct  1     MADFSGH--WAFTFGVLGNIVSFFVFLSPLPTFYKIYRKKSTEGYQSIPYVVALFSAMLW  58

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFLK +  LLI+INS GC +ET+Y+  +L YA K AR QT+K+LLL V   +  IVL
Sbjct  59    IYYAFLKSNTTLLITINSFGCFVETIYVGFYLFYAPKKARVQTVKLLLLSVFAGFGAIVL  118

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F FKG +RV +VGWIC+ FS+CVF +PL I+ +V+KTKS E+MPF LS FLTL+AVM
Sbjct  119   VTQFLFKGVVRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSAEYMPFFLSVFLTLSAVM  178

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVI---NV  442
             W  YGLLLKD  IA+PNVLGF+LGI+QMVLY +Y  ++ + V E K   +   VI   N 
Sbjct  179   WFFYGLLLKDFNIAIPNVLGFILGILQMVLYVMYNKKEEVIVKEHKFPELQNHVIILHND  238

Query  441   AGLGELLHSSVED  403
               L EL    + D
Sbjct  239   KNLPELTEEQIID  251



>ref|XP_004235339.1| PREDICTED: bidirectional sugar transporter SWEET10 [Solanum lycopersicum]
Length=282

 Score =   283 bits (725),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 148/273 (54%), Positives = 195/273 (71%), Gaps = 18/273 (7%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W FVFGVLGNI+S +VFL+P+PTF +IYK KST GYQS+PYV++LFS MLW+YYAFLK +
Sbjct  7     WAFVFGVLGNIISFIVFLSPIPTFNKIYKKKSTEGYQSIPYVIALFSCMLWIYYAFLKTN  66

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
               LLI+INS G +IET+Y+S+FL YA K AR  T+KMLLL V G +  I+L T F FKG 
Sbjct  67    TTLLITINSFGMLIETIYVSLFLYYAPKKARVNTVKMLLLTVVGGFGAIILVTQFLFKGV  126

Query  765   LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLK  586
             +R  IVGWIC+ FS+CVF APL IV +V+KTKSVE+MP  LS FLT++AVMW  YGLLLK
Sbjct  127   VRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPILLSVFLTISAVMWFFYGLLLK  186

Query  585   DMCIALPNVLGFLLGIVQMVLYGIYRN------------QKPLEVAEEKKGAVPEL----  454
             D+ IA PN+LGF+ GI+QM+LY +YR             Q P+ + ++ K  +PEL    
Sbjct  187   DVNIAAPNILGFIFGILQMILYAMYRKKHKPIVNVNVEVQNPVIILDDNK-KIPELTEEQ  245

Query  453   VINVAGLGELLHS-SVEDSKTTAITVSDAVTEE  358
             +I++  LG+L+ S  ++ + T     S  V ++
Sbjct  246   IIDIVKLGKLVCSGKIQMASTLNQNASKEVKQQ  278



>ref|XP_008389921.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=305

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/273 (52%), Positives = 193/273 (71%), Gaps = 11/273 (4%)
 Frame = -1

Query  1140  DLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYA  961
             D HHP  F FGVLGN+VS +V+LAPVPTF RIY+ KST G+ SVPY+V++FS+MLW+YYA
Sbjct  6     DSHHPLAFTFGVLGNLVSTMVYLAPVPTFYRIYRKKSTEGFHSVPYLVAMFSSMLWLYYA  65

Query  960   FLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMF  781
              LKK+A LLI+INS G   E +YI IF+ YA K AR+ T+K+  ++  GL+++I++ + F
Sbjct  66    SLKKNAMLLITINSFGSFAEMIYIVIFVVYAPKDARKLTVKLFGIMNVGLFTLILVVSHF  125

Query  780   PFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGY  601
                   RV ++GWI VA S  VFAAPLSIV +V++T+SVEFMPF LSFFLTL+A+MW  Y
Sbjct  126   LVSRAYRVPVLGWINVAISTSVFAAPLSIVSQVIRTRSVEFMPFRLSFFLTLSAIMWFAY  185

Query  600   GLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK---GAVPELVINVAGLG  430
             GL LKD+C+A+PNVLGF+LG++QM+LY +YRN+K + + + +K    A P+ V N+  + 
Sbjct  186   GLFLKDICVAIPNVLGFVLGLLQMLLYAMYRNRKQVIIEDHEKKLPAATPDHVKNIVIIA  245

Query  429   ELLHSSVEDSKTTAITVSD--------AVTEEK  355
              L  S V  +       +D        AVTE K
Sbjct  246   TLAASEVHPADAQPNNRNDDGDVNNNAAVTEAK  278



>ref|XP_010093935.1| Bidirectional sugar transporter SWEET12 [Morus notabilis]
 gb|EXB54898.1| Bidirectional sugar transporter SWEET12 [Morus notabilis]
Length=304

 Score =   283 bits (725),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 181/226 (80%), Gaps = 0/226 (0%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA F   +  VF+FG+LGN+ SL+VFLAPVPTF R+YK KST G+QSVPYVV+LFSAM+W
Sbjct  1     MAAFATDNLGVFIFGLLGNVTSLIVFLAPVPTFYRVYKKKSTEGFQSVPYVVALFSAMMW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK    LLI+INS+GCVIET+YI++++ YA+K AR  T++++LLL  G + +I+L
Sbjct  61    LYYATLKSDLILLITINSVGCVIETIYIALYIAYATKQARIFTLRLILLLNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              + F  KG+LR  ++GW+C +F+V VFAAPLSI+  V++TKSVEFMP  LSFFLTL+A M
Sbjct  121   LSHFLAKGSLRATVLGWVCTSFAVSVFAAPLSIIRVVIRTKSVEFMPLPLSFFLTLSATM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEK  475
             WL YGL+LKD+C+A+PNV+G + G++QMVLY IYR  K + V E+K
Sbjct  181   WLMYGLMLKDLCVAIPNVMGLIFGVLQMVLYVIYRKNKTVLVEEQK  226



>ref|XP_010929602.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis 
guineensis]
 ref|XP_010929603.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Elaeis 
guineensis]
Length=295

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 183/241 (76%), Gaps = 3/241 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGNI+S +V+LAP+PTF R+YK KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLDHPWAFTFGILGNIISFMVYLAPLPTFYRVYKKKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAF+K  A LL++INSIGCVIET+YI ++L YA K AR  T ++LLLL  GL+ +IVL
Sbjct  61    IYYAFIKADAYLLVTINSIGCVIETMYIVMYLSYAPKKARIFTAQVLLLLNVGLFGLIVL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+   KG  RV+++GW+CV+FS+ VF APLSI+  V++TKSVEFMPF LSFFLT++A+ 
Sbjct  121   VTLMVAKGPERVHVLGWVCVSFSISVFVAPLSIIRLVIRTKSVEFMPFWLSFFLTMSAIA  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W  YGLL KD+ +ALPN+LGF+ G+VQM +Y  Y+  + +    +K   V E +I +  +
Sbjct  181   WFSYGLLTKDIYVALPNILGFIFGVVQMGIYIAYKGTEKVAYDHQK---VAEHIITITKV  237

Query  432   G  430
             G
Sbjct  238   G  238



>ref|XP_009605549.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 146/236 (62%), Positives = 178/236 (75%), Gaps = 5/236 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA    H  W F FGVLGNIVS +VFL+P+PTF +IYK KST GYQS+PYVV+LFS+MLW
Sbjct  1     MAAISGH--WAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLW  58

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFLK +  L+I+INS GC IET+Y+  +L YA K AR QT+KMLLL V G + VIVL
Sbjct  59    IYYAFLKTNTTLIITINSFGCFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGVIVL  118

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F FKG  R   VGWIC+ FS+CVF APL IV +V+KTKSVE+MP  LS FLTL+AVM
Sbjct  119   VTQFLFKGAARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVM  178

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVIN  445
             W  YGLL+KD+ IA+PNVLGF+LGI QMVLY IY  ++   + E+K   +PE + N
Sbjct  179   WFFYGLLVKDINIAIPNVLGFILGIFQMVLYIIYNKKEKANLKEQK---LPEKIQN  231



>ref|NP_197755.1| bidirectional sugar transporter SWEET12 [Arabidopsis thaliana]
 sp|O82587.1|SWT12_ARATH RecName: Full=Bidirectional sugar transporter SWEET12; Short=AtSWEET12; 
AltName: Full=MtN3-like protein [Arabidopsis thaliana]
 gb|AAC64192.1| MTN3 homolog [Arabidopsis thaliana]
 dbj|BAA97235.1| MtN3-like protein [Arabidopsis thaliana]
 gb|AAL09814.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AAL15214.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AAM47150.1| putative MtN3 protein [Arabidopsis thaliana]
 gb|AED93195.1| bidirectional sugar transporter SWEET12 [Arabidopsis thaliana]
Length=285

 Score =   281 bits (720),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 144/246 (59%), Positives = 189/246 (77%), Gaps = 3/246 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MALFD H+ W FVFG+LGN++S  VFL+PVPTF RI K K+T G+QS+PYVV+LFSAMLW
Sbjct  1     MALFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GC IET+YISIF+ +ASK AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCFIETIYISIFVAFASKKARMLTVKLLLLMNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KGT R  I+G ICV FSVCVFAAPLSI+  V+KTKSVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVI  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGA--VPELVINV  442
             WL YGL LKD+ +A PNV+GF+LG +QM+LY +Y+  K P ++ E++  A  +PE+ I++
Sbjct  181   WLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSDLVEKELEAAKLPEVSIDM  240

Query  441   AGLGEL  424
               LG L
Sbjct  241   VKLGTL  246



>ref|XP_009758166.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 152/258 (59%), Positives = 183/258 (71%), Gaps = 20/258 (8%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W F FGVLGNIVS +VFL+P+PTF +IYK KST GYQS+PYVV+LFS+MLW+YYAFLK +
Sbjct  8     WAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTN  67

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
               L+I+INS GC IET+Y+  +L YA K AR QT+KMLLL V G + VIVL T F FKG 
Sbjct  68    TTLIITINSFGCFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGVIVLVTQFLFKGA  127

Query  765   LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLK  586
              R   VGWIC+ FS+CVF APL IV KV+KTKSVE+MP  LS FLTL+AVMW  YGLL+K
Sbjct  128   ARGQAVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLVK  187

Query  585   DMCIALPNVLGFLLGIVQMVLYGIY--------RNQKPLE--------VAEEKKGAVPEL  454
             D+ IA+PNVLGF+LGI QMVLY IY        + QK  E        V E     +PEL
Sbjct  188   DINIAIPNVLGFILGIFQMVLYIIYNKKEKAILKEQKLSEKIQNHVIIVDENNNQKLPEL  247

Query  453   ----VINVAGLGELLHSS  412
                 +I++  LG L+ S 
Sbjct  248   TEEQIIDIVKLGSLISSG  265



>ref|XP_002299333.2| hypothetical protein POPTR_0001s13410g [Populus trichocarpa]
 gb|EEE84138.2| hypothetical protein POPTR_0001s13410g [Populus trichocarpa]
Length=282

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/264 (53%), Positives = 197/264 (75%), Gaps = 14/264 (5%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+ ++ HP  F FG+LGNI+S +V+LAPVPTFIRI + KST  +QS+PY+V+LFS+MLW
Sbjct  1     MAVMNMQHPLAFTFGILGNIISFMVYLAPVPTFIRILRKKSTEDFQSLPYLVALFSSMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK    LL++INS GCVIET+YI+I++ YA++ ++  T+K+LL +  GL+S+I+L
Sbjct  61    LYYAMLKNDEILLVTINSFGCVIETIYIAIYIAYATRESKVSTIKLLLSMNMGLFSLIIL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F   G+ RV  +GW+CVAFSVCVFAAPL+IV ++++TKSVEFMPF LSFFLTL+AV+
Sbjct  121   LTHFLASGSTRVKALGWLCVAFSVCVFAAPLNIVKQIIRTKSVEFMPFTLSFFLTLSAVI  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W  YGL +KDMC+ALPN+LGF+LG++QM+LYGIYRN +  ++  E   ++  +++   G 
Sbjct  181   WFAYGLFIKDMCVALPNILGFVLGLLQMLLYGIYRNAEKKKIPAENLKSI--VILGTLGA  238

Query  432   GELL------------HSSVEDSK  397
              E+             H   E+SK
Sbjct  239   SEVYPVDPQPDVSAAEHDQTEESK  262



>emb|CAN71371.1| hypothetical protein VITISV_023352 [Vitis vinifera]
Length=273

 Score =   281 bits (718),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 194/267 (73%), Gaps = 1/267 (0%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MALF +HHP VF+FG+LGN++S +V+LAP+PTF +IYK KST G+QSVPYVV+LFSAMLW
Sbjct  1     MALFPIHHPLVFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFL   A LLI+INS+GCVIET YI +FL YA K AR  T+K++ L+    +  I+L
Sbjct  61    IYYAFLNTDASLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+   +G  RV I+GW+C+ FS+ VF APL I+ +V++TKSVE+MPF LSFFLTL+AVM
Sbjct  121   LTLLLAEGANRVRILGWVCLVFSLSVFLAPLCIMRQVIRTKSVEYMPFLLSFFLTLSAVM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W  YGL+LKD  IA PN+LGF+ GIVQMVLY IYRN+K + +  EK   + E +I+V  L
Sbjct  181   WFFYGLMLKDFYIAGPNILGFVFGIVQMVLYLIYRNRKKV-LENEKLPELSEQIIDVVKL  239

Query  432   GELLHSSVEDSKTTAITVSDAVTEEKA  352
               ++ S V  +           TE++ 
Sbjct  240   STMVCSEVNLTNQQHSNEGHGTTEKQG  266



>ref|XP_009758167.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/236 (62%), Positives = 179/236 (76%), Gaps = 5/236 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA    H  W F FGVLGNIVS +VFL+P+PTF +IYK KST GYQS+PYVV+LFS+MLW
Sbjct  1     MAAISGH--WAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLW  58

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFLK +  L+I+INS GC IET+Y+  +L YA K AR QT+KML+L V G + VIVL
Sbjct  59    VYYAFLKTNTTLIITINSFGCFIETIYVGFYLFYAPKKARIQTVKMLVLSVVGGFGVIVL  118

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F FKG  R   VGWIC+ FS+CVF APL IV +V+KTKSVE+MP  LS FLTL+AVM
Sbjct  119   VTQFLFKGAARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVM  178

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVIN  445
             W  YGLL+KD+ IA+PNVLGF+LGI+Q+VLY IY  ++   + EEK   VPE + N
Sbjct  179   WFFYGLLVKDINIAIPNVLGFVLGILQIVLYVIYNKKEKAILKEEK---VPEKIQN  231



>gb|KFK25541.1| hypothetical protein AALP_AA8G128400 [Arabis alpina]
Length=299

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 190/269 (71%), Gaps = 9/269 (3%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH    +FG+LGN +S  VFLAPVPTF RI+K KST  +QS+PY VSLFS MLW+YYA L
Sbjct  7     HHLLANIFGILGNFISFCVFLAPVPTFYRIFKKKSTESFQSLPYQVSLFSCMLWLYYALL  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK A LLI+IN  GCV+ET+YI++FL YA+K  +   MK+ + +    +S I+L T F  
Sbjct  67    KKGAFLLITINCFGCVVETIYIAMFLTYATKDKKTSAMKLFMAMNVAFFSSILLMTHFFV  126

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
             K  L+V+++GWICVA SV VFAAPL +V +V+KTKSVEFMPF+LSFFLT++AVMW  YGL
Sbjct  127   KSPLKVSVLGWICVAISVSVFAAPLMVVARVIKTKSVEFMPFSLSFFLTISAVMWGAYGL  186

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGAVPE--------LVINV  442
              L D+CIA+PNV+GFLLG+VQMVLYGIY+N K   E+ E+K  +           +V++ 
Sbjct  187   FLHDICIAIPNVVGFLLGMVQMVLYGIYKNSKGEFEINEKKVNSSTSSEQQLKSVVVMSP  246

Query  441   AGLGELLHSSVEDSKTTAITVSDAVTEEK  355
              G+ E+    V  ++T  + +SD   EE 
Sbjct  247   LGVSEVHPVDVTVTETVEVPLSDHDHEED  275



>ref|XP_010492063.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Camelina 
sativa]
Length=297

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 143/268 (53%), Positives = 191/268 (71%), Gaps = 2/268 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+   HH   F+FG+LGN +S LVFLAPVPTF RIYK KST  +QS+PY VSLFS MLW
Sbjct  1     MAVMIDHHLLAFIFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA +K+ A LLI+INS GCV+ET+YI++F  YA++  R   MK+ + +   ++S+I++
Sbjct  61    LYYALIKQDAFLLITINSFGCVVETIYIAMFFAYATRDKRISAMKLFITINVAVFSLILM  120

Query  792   ATMFPFKG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
              T F  K  TL+V+++GWICVA SV VFAAPL IV +V+KT+SVEFMPF LSFFLT++AV
Sbjct  121   VTHFVVKTPTLQVSVLGWICVAISVSVFAAPLMIVARVIKTRSVEFMPFTLSFFLTISAV  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAG  436
             MW  YGL L D+CIA+PNV+GF+LG++QMVLYG+YRN       E+K     + + ++  
Sbjct  181   MWFAYGLFLHDICIAIPNVVGFVLGMLQMVLYGVYRNSSEKPEMEKKIHLSEQQLKSIVV  240

Query  435   LGELLHSSVEDSKTTAI-TVSDAVTEEK  355
             +  L  S V    T  +  +SDAV  E 
Sbjct  241   MSPLGVSEVHPVVTEPVGPLSDAVHHED  268



>gb|KDP26857.1| hypothetical protein JCGZ_18015 [Jatropha curcas]
Length=293

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 135/226 (60%), Positives = 177/226 (78%), Gaps = 1/226 (0%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+   H P  F FG+LGNI+S+LV+LAPVPTF+RIY+ KST G+ S+PY+V+LFS+MLW
Sbjct  1     MAVLSTHQPLAFAFGLLGNIISVLVYLAPVPTFLRIYRKKSTEGFHSLPYLVALFSSMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA LKK   LL++IN  GC IET+YI +++ YASK  R  T ++L+ +   L+S IVL
Sbjct  61    LHYAMLKKDVFLLVTINVFGCAIETIYIFLYMFYASKEIRVSTFRLLVSMNIALFSSIVL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F  KG++RV ++GWICVA SV VFA+PLSIV +VV+T+SVEFMPF LSFFLTL+AVM
Sbjct  121   FTHFLMKGSIRVQVLGWICVAVSVSVFASPLSIVAQVVRTRSVEFMPFTLSFFLTLSAVM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEK  475
             W  YG   K+MC+ALPN+LGF+LG++QM+LY IYR  K + V EEK
Sbjct  181   WFAYGFTTKNMCVALPNILGFILGLLQMLLYAIYRKAKVV-VIEEK  225



>ref|XP_008374287.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=298

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 175/232 (75%), Gaps = 3/232 (1%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HHP  F FGVLGNI S +VFLAP+PTF R+YK KST G+QSVPYV +LF+A +W+YYAFL
Sbjct  7     HHPLAFAFGVLGNIASFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFTATIWIYYAFL  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K +  LLI+INS GCVIET+YI+I+L YA+K AR  T+ +L L+  G + +I+L   F  
Sbjct  67    KSNEILLITINSFGCVIETIYIAIYLTYATKQARVSTLTLLFLVNFGGFCLILLLAHFLS  126

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
             +G  RV ++GW+CV FSV VFAAPLS +  V++TKSVEFMPFNLSFFLTL+AVMWL YGL
Sbjct  127   QGPTRVAVLGWVCVTFSVSVFAAPLSAMKMVIRTKSVEFMPFNLSFFLTLSAVMWLSYGL  186

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK---PLEVAEEKKGAVPELVI  448
             LLKD+ +A PN++GF  G+VQM LY  YRN K     ++ E+K   V ++ I
Sbjct  187   LLKDLYVATPNIVGFSFGLVQMALYAKYRNNKTNVEEKLPEQKADVVKQMTI  238



>emb|CDP13388.1| unnamed protein product [Coffea canephora]
Length=302

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 187/249 (75%), Gaps = 6/249 (2%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH WVF FGVLGN+VS++ +L P+PTF RIY+ KST+GY+++PYVV+L SAMLWMYYA L
Sbjct  8     HHRWVFAFGVLGNLVSVIAYLGPLPTFYRIYREKSTMGYEALPYVVALSSAMLWMYYALL  67

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K  A LLISINS+GC+IETLYI  ++ YASK AR+ T+K++ +L  GL   I +   F  
Sbjct  68    KP-ATLLISINSLGCIIETLYILFYILYASKQARKHTIKLVGMLNVGLICAIFVVANFAL  126

Query  774   KG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
             K  ++R+ +VGWICVAFSV VFAAPLSIVF+VV+T++ EFMP  LS  LTL+AVMW  YG
Sbjct  127   KEVSVRIMVVGWICVAFSVSVFAAPLSIVFQVVRTRNAEFMPVALSATLTLSAVMWFFYG  186

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLH  418
              L  DMC+ +PN++GF LG++QM+LY IYR  KPL VAE+K   VPE VIN+  L     
Sbjct  187   FLKADMCVTVPNIMGFFLGVLQMMLYVIYRKPKPL-VAEKK---VPEHVINIVMLCNSDV  242

Query  417   SSVEDSKTT  391
               V DS+T+
Sbjct  243   HPVVDSQTS  251



>ref|XP_009597195.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=291

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 172/224 (77%), Gaps = 3/224 (1%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W F FGVLGNIVS +VFL+P+PTF RIYK KST GYQS+PYVV+LFS+MLW+YYAFLK +
Sbjct  5     WAFAFGVLGNIVSFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTN  64

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
               LLI+INS G  IET+Y+  +L YA K AR QTMKMLLL V G +  IVL T F FKG 
Sbjct  65    TTLLITINSFGVFIETIYVGFYLFYAPKKARVQTMKMLLLSVVGGFGAIVLVTQFLFKGA  124

Query  765   LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLK  586
             +R  +VGWIC+ FS+CVF APL IV KV+KTKSVE+MP  LS FLTL+AVMW  YGLLLK
Sbjct  125   VRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  184

Query  585   DMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL  454
             D+ IA PNVLGF+ GIVQ+VLY IY  +   E A  K+  +PE+
Sbjct  185   DINIAAPNVLGFIFGIVQIVLYVIYSKK---EKANLKEPKLPEI  225



>ref|XP_002264875.1| PREDICTED: bidirectional sugar transporter N3 [Vitis vinifera]
 emb|CBI38167.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 180/243 (74%), Gaps = 4/243 (2%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH    +FG+LGNI+S LV+ AP PTF RIYK KS  G+ S+PY+V+LFSAMLW+YYA L
Sbjct  8     HHTLGLIFGILGNIISFLVYFAPAPTFYRIYKRKSAEGFHSLPYIVALFSAMLWLYYALL  67

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK A LLI+INS GC IE+ YI ++  YA   A++QT+K+++ L  G++S++V+   F  
Sbjct  68    KKDAFLLITINSFGCAIESFYILLYFFYAPMQAKKQTLKVVISLNVGVFSILVVLIQFLL  127

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
             KG+ R+N+ GWIC +FSV VFAAPLSIV KV++TKSVEFMPF+LSFFLTL+A+MW  YGL
Sbjct  128   KGSNRINVFGWICASFSVAVFAAPLSIVAKVIRTKSVEFMPFSLSFFLTLSAIMWFAYGL  187

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLHS  415
             L  D C+A+PN+LG +LG+VQMVLYG YRN       E+ +  +PE +I++  L  L  S
Sbjct  188   LKNDPCVAIPNILGVILGLVQMVLYGFYRNAG----KEKMEKKLPEHIIDMVMLSTLGTS  243

Query  414   SVE  406
              + 
Sbjct  244   DIH  246



>ref|XP_010453373.1| PREDICTED: bidirectional sugar transporter SWEET15 [Camelina 
sativa]
Length=296

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 190/268 (71%), Gaps = 2/268 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+   H    F+FG+LGN +S LVFLAPVPTF RIYK KST  +QS+PY VSLFS MLW
Sbjct  1     MAVMIDHQLLAFIFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA +K+ A LLI+INS GCV+ET+YI++F  YA++  R   MK+ + +    +S+I++
Sbjct  61    LYYALIKQDAFLLITINSFGCVVETIYIAMFFAYATREKRISAMKLFIAINVAFFSLILM  120

Query  792   ATMFPFKG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
              T F  K  TL+V+++GWICVA SV VFAAPL IV +V+KTKSVEFMPF LSFFLT++AV
Sbjct  121   VTHFVVKTPTLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAV  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAG  436
             MW  YGL L D+CIA+PNV+GF+LG++QMVLYGIYRN       E+K  +  + + ++  
Sbjct  181   MWFAYGLFLHDICIAIPNVVGFVLGMLQMVLYGIYRNSSEKPEMEKKINSSEQQLKSIVV  240

Query  435   LGELLHSSVEDSKTTAI-TVSDAVTEEK  355
             +  L  S V    T  +  +SDAV  E 
Sbjct  241   MSPLGVSEVHPVVTEPVGPLSDAVHHED  268



>ref|XP_006347635.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=286

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/280 (52%), Positives = 195/280 (70%), Gaps = 25/280 (9%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W FVFGVLGNI+S +VFL+P+PTF +IYK KST GYQS+PYV++LFS MLW+YYAFLK +
Sbjct  7     WAFVFGVLGNIISFIVFLSPIPTFNKIYKKKSTEGYQSIPYVIALFSCMLWIYYAFLKTN  66

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
               LLI+INS G +IET+Y+ +FL YA K AR  T+KMLLL V G +  I++ T F FKG 
Sbjct  67    TTLLITINSFGMLIETIYVGLFLYYAPKKARVNTVKMLLLTVVGGFGAIIVVTQFVFKGV  126

Query  765   LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLK  586
             +R  IVGWIC+ FS+CVF APL IV +V+KTKSVE+MP  LS FLT++AVMW  YGLLLK
Sbjct  127   VRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPILLSVFLTISAVMWFFYGLLLK  186

Query  585   DMCIALPNVLGFLLGIVQMVLYGIYRN-------------QKPLEVAEEKKGAVPEL---  454
             D+ IA PN+LGF+ GI+QM+LY +YR              Q P+ + ++ K  +PEL   
Sbjct  187   DVNIAAPNILGFIFGILQMILYAMYRKKDNKPIVNVNVEVQNPVIILDDNK-KIPELTEE  245

Query  453   -VINVAGLGEL-------LHSSVEDSKTTAITVSDAVTEE  358
              +I++  LG+L       + S++  +    + +++   EE
Sbjct  246   QIIDIVKLGKLVCSGKIQMASTLNQNAAKEVKLTNLQAEE  285



>ref|XP_009758165.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=296

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/227 (63%), Positives = 178/227 (78%), Gaps = 3/227 (1%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W F FGVLGNI+S +VFL+P+PTF +IYK KST GYQS+PYVV+LFS+MLW+YYAFLK +
Sbjct  8     WAFAFGVLGNIISFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTN  67

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
               L+I+INS GC IET+Y+  +L YA K AR QT+KMLLL V G + VIVL T F FKG 
Sbjct  68    TTLIITINSFGCFIETIYVGFYLFYAPKKARVQTLKMLLLSVVGGFGVIVLVTQFLFKGA  127

Query  765   LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLK  586
              R   VGWIC+ FS+CVF APL IV +V+KTKSVE+MP  LS FLTL+AVMW  YGLL+K
Sbjct  128   ARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLVK  187

Query  585   DMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVIN  445
             D+ IA+PN+LGF+LGI+Q+VLY IY N+K   + +E+K  +PE + N
Sbjct  188   DINIAIPNILGFILGILQIVLYIIY-NKKEKAILKEQK--LPEKIQN  231



>ref|XP_010419882.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Camelina 
sativa]
Length=297

 Score =   279 bits (714),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/268 (53%), Positives = 190/268 (71%), Gaps = 2/268 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+   HH   F+FG+LGN +S LVFLAPVPTF RIYK KST  +QS+PY VSLFS MLW
Sbjct  1     MAVIIDHHLLAFIFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA +K+ A LLI+INS GCV+ET+YI++F  YA++  R   MK+ + +    +S+I++
Sbjct  61    LYYALIKQDAFLLITINSFGCVVETIYIAMFFAYATRDKRISAMKLFIAINVAFFSMILM  120

Query  792   ATMFPFKG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
              T F  +  T++V+++GWICVA SV VFAAPL IV +V+KTKSVEFMPF LSFFLT++AV
Sbjct  121   VTHFVVRTPTIQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAV  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAG  436
             MW  YGL L D+CIA+PNV+GF+LG++QMVLYG+YRN       E+K     + + ++  
Sbjct  181   MWFAYGLFLHDICIAIPNVVGFVLGMLQMVLYGVYRNSSEKPEMEKKINLSEQQLKSIVV  240

Query  435   LGELLHSSVEDSKTTAI-TVSDAVTEEK  355
             +  L  S V    T  +  +SDAV  E 
Sbjct  241   MSPLGVSEVHPVVTEPVGPLSDAVHHED  268



>ref|XP_004297511.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Fragaria 
vesca subsp. vesca]
Length=310

 Score =   280 bits (715),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/226 (60%), Positives = 176/226 (78%), Gaps = 3/226 (1%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H P  F FG+LGNIVS +VFLAPVPTF R+YK KST G+QS+PY+ +LFSA +W+YYA L
Sbjct  5     HSPLAFAFGILGNIVSFIVFLAPVPTFYRVYKKKSTEGFQSIPYIFALFSATIWIYYASL  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K    LLI+IN  GCVIET+YI++++ YA K AR  T+++LLL+  G + +I+  + F  
Sbjct  65    KSDEMLLITINGFGCVIETIYIAMYITYAPKKARVNTLRLLLLVNFGGFCLILFLSHFLT  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
             +G  RV ++GW+CVAFSV VFAAPLSI+  V++TKSVEFMPF+LSFFLTL+A+MWL YGL
Sbjct  125   QGPTRVKVLGWVCVAFSVSVFAAPLSIMRLVIRTKSVEFMPFSLSFFLTLSAIMWLFYGL  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPE  457
             LLKD+ +A PN+LGF  G+VQM+LY  YRN+K + V EEK   VPE
Sbjct  185   LLKDLYVAAPNILGFSFGVVQMILYAAYRNKKTVLVDEEK---VPE  227



>ref|XP_002877428.1| hypothetical protein ARALYDRAFT_484952 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53687.1| hypothetical protein ARALYDRAFT_484952 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 143/246 (58%), Positives = 188/246 (76%), Gaps = 3/246 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MALFD H+ W FVFG+LGN++S  VFL+PVPTF RI K K+T G+QS+PYVV+LFSAMLW
Sbjct  1     MALFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GC IE +YISIF+ +ASK AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCFIEIIYISIFVAFASKKARMLTVKLLLLMNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KGT R  I+G ICV FSVCVFAAPLSI+  V+KTKSVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVI  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGA--VPELVINV  442
             WL YGL LKD+ +A PNV+GF+LG +QM+LY +Y+  K P ++ E++  A  +PE+ I++
Sbjct  181   WLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSDLVEKELEAAKLPEVSIDM  240

Query  441   AGLGEL  424
               LG L
Sbjct  241   LKLGTL  246



>ref|XP_007038077.1| Medicago truncatula MTN3, putative [Theobroma cacao]
 gb|EOY22578.1| Medicago truncatula MTN3, putative [Theobroma cacao]
Length=289

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 146/260 (56%), Positives = 195/260 (75%), Gaps = 4/260 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M +F   +PWVF+ G+LGNI S +VFLAP+PTFIR+ K KST G+QSVPYVV+LFSAMLW
Sbjct  1     MGVFATDNPWVFISGLLGNISSFVVFLAPLPTFIRVCKKKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             MYYAF+K  A LL++INS GCV+ET YI+I++ YA K AR  T+++LLL+  G +  I+L
Sbjct  61    MYYAFVKSGAFLLVTINSFGCVVETAYIAIYIAYAPKQARMFTLRILLLMNFGGFCSILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              + F  KG+ RV ++GWICVAF+  VFAAPLSI+ +V++TKSVEFMPF LSFFLTL+A+M
Sbjct  121   VSRFLAKGSNRVEVLGWICVAFATGVFAAPLSIIRQVIRTKSVEFMPFYLSFFLTLSAIM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             WL YG+ LKD+ IA+PNVLGF+ G++QMVLY IYRN K +     K+   PE  I++  L
Sbjct  181   WLLYGIFLKDLYIAIPNVLGFIFGLLQMVLYAIYRNSKTV----TKEVEAPEHSIDITKL  236

Query  432   GELLHSSVEDSKTTAITVSD  373
               +++S V++  +      D
Sbjct  237   STVMNSEVQEMSSEPDVAHD  256



>ref|XP_009802194.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X1 [Nicotiana sylvestris]
Length=298

 Score =   279 bits (713),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 146/253 (58%), Positives = 180/253 (71%), Gaps = 5/253 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA F  H  W F FGVLGNIVS  VFL+P+PTF +IYK KST  YQS+PYVV+LFSAM W
Sbjct  1     MADFSGH--WAFTFGVLGNIVSFFVFLSPLPTFYKIYKKKSTEDYQSIPYVVALFSAMFW  58

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFLK +  LLI+INS GC IET+Y+  +L YA K AR QT+K+LLL V G +  IVL
Sbjct  59    IYYAFLKSNTTLLITINSFGCFIETIYVGFYLFYAPKKARVQTVKLLLLSVFGGFGAIVL  118

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T   FKG +RV +VGWIC+ FS+CVF +PL I+ +V+KTKSVE+MPF +S FLTL+AV 
Sbjct  119   VTQLLFKGVVRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSVEYMPFFISVFLTLSAVT  178

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVI---NV  442
             W  YGLLLKD  IA+PNVLGF++GI+QMV Y IY  ++ + V E K   +   VI   N 
Sbjct  179   WFFYGLLLKDFNIAIPNVLGFIVGILQMVFYVIYYKKEEVIVKEHKFPEIQNHVIILHND  238

Query  441   AGLGELLHSSVED  403
               L EL    + D
Sbjct  239   KNLPELTEEQIID  251



>ref|XP_002303766.2| hypothetical protein POPTR_0003s16520g [Populus trichocarpa]
 gb|EEE78745.2| hypothetical protein POPTR_0003s16520g [Populus trichocarpa]
Length=287

 Score =   278 bits (712),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 187/227 (82%), Gaps = 3/227 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+  + H   F FG+LGNI+S +V+LAPVPTFIRI+K KST  +QS+PY+++LFS+MLW
Sbjct  1     MAVTSILH-LAFTFGILGNIISTMVYLAPVPTFIRIFKKKSTEDFQSLPYLMALFSSMLW  59

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LKK   LL++INS GCVIET YI+I++ YA++ +R  T+K+L+ +  GL+S+I+L
Sbjct  60    LYYAMLKKDTILLVTINSFGCVIETTYIAIYIVYATRESRVSTIKLLISMNLGLFSLILL  119

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F   G++RV ++GW+CVA SVCVFAAPL+I+ +V++TKSVEFMPF LSFFLTL+AVM
Sbjct  120   LAHFLVSGSVRVKVLGWLCVALSVCVFAAPLNILKQVIRTKSVEFMPFTLSFFLTLSAVM  179

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK  472
             W  YGLLLKD+CIALPN+LGF+LG++QM+LYGIYRN + +E  E+KK
Sbjct  180   WFAYGLLLKDLCIALPNILGFILGLLQMLLYGIYRNAQKVE--EKKK  224



>ref|XP_011023930.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Populus 
euphratica]
Length=276

 Score =   278 bits (711),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/275 (52%), Positives = 194/275 (71%), Gaps = 14/275 (5%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA F +H PW+F FG+LGN VS +VFLAP+PTF RI + KST G+QS+PYVV+LFSAM+W
Sbjct  1     MASFSIHCPWIFTFGLLGNFVSFVVFLAPIPTFSRICRKKSTEGFQSLPYVVALFSAMIW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK  A LLI+INS+GC IE +YI++++ YA K AR  T+++L+LL  G +  ++L
Sbjct  61    LYYASLKSDALLLITINSVGCFIEIIYIALYVAYAPKQARIATLRILILLNFGGFCAVLL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              + F  KG+ RV ++GW+CV FSV VFAAPLSI+  V++T+SVEFMPF LSFFLTL+A+M
Sbjct  121   LSHFFVKGSNRVKVLGWVCVIFSVSVFAAPLSIMRIVIRTRSVEFMPFTLSFFLTLSAIM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             WL YG+LLKD  IA+PN+LGF+ G++QMVLY IY+N K    A   +  +P+   ++A L
Sbjct  181   WLFYGVLLKDFYIAIPNILGFIFGVLQMVLYVIYKNSK---TAVPMEPTLPQNSNDIAKL  237

Query  432   GELL---------HSSVEDSKTTAITVSDAVTEEK  355
               +           S+ ED  T      D   +EK
Sbjct  238   SSISCEMKPAVCPQSNEEDDHTE--NSKDPSNQEK  270



>ref|XP_009336454.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=305

 Score =   279 bits (713),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 140/248 (56%), Positives = 183/248 (74%), Gaps = 3/248 (1%)
 Frame = -1

Query  1140  DLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYA  961
             D HHP  F FGVLGN+VS +V+LAPVPTF RIY+ KST G+ SVPY+V++FS+MLW YYA
Sbjct  6     DSHHPLAFTFGVLGNLVSTMVYLAPVPTFYRIYRKKSTEGFHSVPYLVAMFSSMLWFYYA  65

Query  960   FLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMF  781
              LKK+A LLI+INS G   E  YI IF+ YA + AR+ T+K+  ++  GL+++I++ + F
Sbjct  66    SLKKNAMLLITINSFGSFAEMTYIVIFVVYAPRDARKLTVKLFGIMNVGLFTLILVVSHF  125

Query  780   PFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGY  601
                   RV ++GWI VA S  VFAAPLSIV +V++T+SVEFMPF LSFFLTL+AVMW  Y
Sbjct  126   LVSRAYRVPVLGWINVAISTSVFAAPLSIVAQVIRTRSVEFMPFRLSFFLTLSAVMWFAY  185

Query  600   GLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKP--LEVAEEK-KGAVPELVINVAGLG  430
             GL LKD+CIA+PNVLGF+LG++QM+LY +YRN+K   LE  E+K   A P+ V N+  + 
Sbjct  186   GLFLKDICIAIPNVLGFVLGLLQMLLYAMYRNRKQEILEDHEKKLPAATPDHVNNIVIIA  245

Query  429   ELLHSSVE  406
              L  S V 
Sbjct  246   TLAASEVH  253



>ref|XP_002284244.1| PREDICTED: bidirectional sugar transporter SWEET14 [Vitis vinifera]
 emb|CBI15714.3| unnamed protein product [Vitis vinifera]
Length=270

 Score =   278 bits (710),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 189/249 (76%), Gaps = 1/249 (0%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MALF +HHP VF+FG+LGN++S +V+LAP+PTF +IYK KST G+QSVPYVV+LFSAMLW
Sbjct  1     MALFPIHHPLVFIFGILGNLISFMVYLAPLPTFYQIYKRKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFL   A LLI+INS+GCVIET YI +FL YA K AR  T+K++ L+    +  I+L
Sbjct  61    IYYAFLNTDASLLITINSVGCVIETSYIVMFLVYAPKKARITTVKLVFLMNICGFGSILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+   +G  RV I+GW+C+ FS+ VF APL I+ +V++TKSVE+MPF LSFFLTL+AVM
Sbjct  121   LTLLLAEGANRVRILGWVCLVFSLSVFLAPLCIMRQVIRTKSVEYMPFLLSFFLTLSAVM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W  YGL+LKD  IA PN+LGF+ GIVQMVLY IYRN+K + +  EK   + E +I+V  L
Sbjct  181   WFFYGLMLKDFYIAGPNILGFVFGIVQMVLYLIYRNRKKV-LENEKLPELSEQIIDVVKL  239

Query  432   GELLHSSVE  406
               ++ S V 
Sbjct  240   STMVCSEVN  248



>ref|XP_003576036.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Brachypodium 
distachyon]
Length=300

 Score =   278 bits (712),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 146/282 (52%), Positives = 192/282 (68%), Gaps = 16/282 (6%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGN++S + +LAP+ TF RIYK KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLQHPWAFAFGLLGNVISFMTYLAPLSTFYRIYKNKSTQGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK    LLI+IN+ GCVIET+YI ++L YA K A+  T K+LLLL  G++ +I+L
Sbjct  61    IYYALLKSDGCLLITINTAGCVIETIYIVVYLAYAPKQAKLFTAKILLLLNVGVFGMILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+   +G  RV ++GW+CV FSV VF APLS++  VV+T+SVEFMPFNLS  LTL+AV+
Sbjct  121   LTLLLSEGEKRVVMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFNLSLSLTLSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEV-----AEEKKGA---VPE  457
             W  YGLL+KD  +ALPN+LGF  G++QM LY +YRN  P  V     AE   GA   VPE
Sbjct  181   WFLYGLLIKDKYVALPNILGFAFGVIQMGLYALYRNSTPRPVTKEVDAESHDGAAPKVPE  240

Query  456   LVINVAGLGEL--------LHSSVEDSKTTAITVSDAVTEEK  355
              V+N+  LG +        +H ++E   T    V+    + +
Sbjct  241   HVVNIGKLGAVELKTTEVFIHPAIESPPTKENGVAHGAEQSR  282



>ref|XP_009347840.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=327

 Score =   280 bits (715),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 137/232 (59%), Positives = 175/232 (75%), Gaps = 3/232 (1%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HHP  F FGVLGNI S +VFLAP+PTF R+YK KST G+QSVPYV +LF+A +W+YYAFL
Sbjct  7     HHPLAFAFGVLGNIASFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFTATIWIYYAFL  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K +  LLI+INS GCVIET+YI+I+L YA+K AR  T+++L L+  G +  I+L   F  
Sbjct  67    KSNEILLITINSFGCVIETIYIAIYLTYATKQARVSTLRLLFLVNFGGFCFILLLAHFLS  126

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
             +G  RV ++GW+CV FSV VFAAPLS++  V+ TKSVEFMPFNLSFFLTL+AVMWL YGL
Sbjct  127   QGPTRVAVLGWVCVTFSVSVFAAPLSVMKMVIHTKSVEFMPFNLSFFLTLSAVMWLSYGL  186

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK---PLEVAEEKKGAVPELVI  448
             LLKD+ +A PN++GF  G+VQM LY  YRN K     ++ E+K   V ++ I
Sbjct  187   LLKDLYVATPNIVGFSFGLVQMALYAKYRNNKTNVEKKLPEQKADVVKQMTI  238



>ref|XP_009614915.1| PREDICTED: bidirectional sugar transporter SWEET12-like isoform 
X1 [Nicotiana tomentosiformis]
Length=302

 Score =   278 bits (712),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 148/257 (58%), Positives = 183/257 (71%), Gaps = 9/257 (4%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPV----PTFIRIYKAKSTLGYQSVPYVVSLFS  985
             MA F  H  W F FGVLGNIVS  VFL+P+    PTF +IY+ KST GYQS+PYVV+LFS
Sbjct  1     MADFSGH--WAFTFGVLGNIVSFFVFLSPLYVRRPTFYKIYRKKSTEGYQSIPYVVALFS  58

Query  984   AMLWMYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYS  805
             AMLW+YYAFLK +  LLI+INS GC +ET+Y+  +L YA K AR QT+K+LLL V   + 
Sbjct  59    AMLWIYYAFLKSNTTLLITINSFGCFVETIYVGFYLFYAPKKARVQTVKLLLLSVFAGFG  118

Query  804   VIVLATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTL  625
              IVL T F FKG +RV +VGWIC+ FS+CVF +PL I+ +V+KTKS E+MPF LS FLTL
Sbjct  119   AIVLVTQFLFKGVVRVQVVGWICLVFSLCVFVSPLCIMRQVIKTKSAEYMPFFLSVFLTL  178

Query  624   TAVMWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVI-  448
             +AVMW  YGLLLKD  IA+PNVLGF+LGI+QMVLY +Y  ++ + V E K   +   VI 
Sbjct  179   SAVMWFFYGLLLKDFNIAIPNVLGFILGILQMVLYVMYNKKEEVIVKEHKFPELQNHVII  238

Query  447   --NVAGLGELLHSSVED  403
               N   L EL    + D
Sbjct  239   LHNDKNLPELTEEQIID  255



>ref|XP_009794695.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=295

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 174/224 (78%), Gaps = 3/224 (1%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W F FGVLGNIVS +VFL+P+PTF RIYK KST GYQS+PYVV+LFS+MLW+YYAFLK +
Sbjct  8     WAFAFGVLGNIVSFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTN  67

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
               LLI+INS G  IET+Y+ ++L YA K AR QT+KMLLL V G +  IVL T F FKG 
Sbjct  68    TTLLITINSFGVFIETIYVGVYLFYAPKKARVQTVKMLLLSVVGGFGAIVLVTQFLFKGA  127

Query  765   LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLK  586
             +R  +VGWIC+ FS+CVF APL IV KV+KTKSVE+MP  LS FLTL+AVMW  YGLLLK
Sbjct  128   VRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  585   DMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL  454
             D+ IA PNVLGF+ GI+Q+VLY IY  ++   + E+K   +PE+
Sbjct  188   DINIAAPNVLGFIFGILQIVLYVIYSKKEKAILKEQK---LPEI  228



>ref|XP_009605550.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=296

 Score =   278 bits (711),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 147/257 (57%), Positives = 185/257 (72%), Gaps = 20/257 (8%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W F FGVLGNIVS +VFL+P+PTF +IYK KST GYQS+PYVV+LFS+MLW+YYAFLK +
Sbjct  8     WAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTN  67

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
               L+I+INS GC IET+Y+S +L YA K AR QT+KML+L V G +  IVL T F FKG 
Sbjct  68    TTLIITINSFGCFIETIYVSFYLFYAPKKARVQTVKMLVLSVVGGFGAIVLVTQFLFKGA  127

Query  765   LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLK  586
              R   VGWIC+ FS+CVF APL IV +V+KTKSVE+MP  LS FLTL+AVMW  YGLL+K
Sbjct  128   ARGQAVGWICLVFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLVK  187

Query  585   DMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGA----------------VPEL  454
             D+ IA+PNVLGF+LGI+Q+VLY IY  ++   + E+K  A                +PEL
Sbjct  188   DINIAIPNVLGFILGILQIVLYVIYNKKEKAILKEQKLPAKIQNHVIIVDENNNQKLPEL  247

Query  453   ----VINVAGLGELLHS  415
                 +I++  LG L+ S
Sbjct  248   TEEQIIDIVKLGSLISS  264



>gb|KHG03157.1| Bidirectional sugar transporter SWEET15 -like protein [Gossypium 
arboreum]
Length=286

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/248 (58%), Positives = 192/248 (77%), Gaps = 4/248 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MAL   HH     FGVLGNI+S+LV+LAP+PTF RIYK KST  +QS+PY V+LFS+MLW
Sbjct  1     MALMADHHSLAVAFGVLGNIISVLVYLAPLPTFYRIYKKKSTESFQSLPYQVALFSSMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA +KK A LLI+INS GCV+ET+YI+I++ YA+K +R   +K+ + +   L+S I++
Sbjct  61    LYYALMKKGAFLLITINSFGCVVETIYIAIYIAYATKNSRVSAIKLFVAMNVALFSFIII  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F  KG++RV ++GWICVA SV VFAAPL++V +V++TKSVEFMPFNLSFFLTL+AVM
Sbjct  121   LTHFLVKGSIRVQVLGWICVAISVSVFAAPLNVVARVIRTKSVEFMPFNLSFFLTLSAVM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W  YGL +KD+C+ALPNV+GF+LG++QM+LY IYRN +  +V EEKK  +PE +  V  L
Sbjct  181   WFAYGLFMKDLCVALPNVIGFVLGMLQMLLYAIYRNSE--KVIEEKK--IPEQMKGVVVL  236

Query  432   GELLHSSV  409
               L  S V
Sbjct  237   STLGPSEV  244



>ref|XP_010027262.1| PREDICTED: bidirectional sugar transporter N3-like [Eucalyptus 
grandis]
Length=274

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 167/220 (76%), Gaps = 0/220 (0%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA FD HH W F FG+LGNIVS  VFLAPVPTF RIY+ K T  +QS+PY+V+LFS+MLW
Sbjct  1     MAFFDHHHLWTFTFGILGNIVSFFVFLAPVPTFYRIYRNKKTEDFQSIPYLVALFSSMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK  + LLI+INS GCVIE +YI+I++ YA +  R  T+K+  L+  GL+S+++L
Sbjct  61    LYYALLKGHSFLLITINSFGCVIEMMYIAIYIAYALRSTRNSTIKLFALMNMGLFSLLIL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F   G  R  + GWIC   SV VFAAPLSIV +VV+T SVEFMPF+LSFFLTL+A+M
Sbjct  121   ITHFIPNGDARTTVFGWICTTISVSVFAAPLSIVARVVQTNSVEFMPFSLSFFLTLSAIM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPL  493
             W GYG  L D+ + +PN++GF+LG+ QMVLYG YRN++ L
Sbjct  181   WFGYGFFLLDLDMQIPNIVGFVLGLSQMVLYGYYRNREEL  220



>ref|NP_196821.1| senescence-associated protein 29 [Arabidopsis thaliana]
 sp|Q9FY94.1|SWT15_ARATH RecName: Full=Bidirectional sugar transporter SWEET15; Short=AtSWEET15; 
AltName: Full=Senescence-associated protein 29 [Arabidopsis 
thaliana]
 emb|CAC05445.1| senescence-associated protein (SAG29) [Arabidopsis thaliana]
 gb|AAK76623.1| putative senescence-associated protein SAG29 [Arabidopsis thaliana]
 gb|AAM44982.1| putative senescence-associated protein SAG29 [Arabidopsis thaliana]
 gb|AED91859.1| senescence-associated protein 29 [Arabidopsis thaliana]
Length=292

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 192/263 (73%), Gaps = 7/263 (3%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH   F+FG+LGN++S LVFLAPVPTF RIYK KST  +QS+PY VSLFS MLW+YYA +
Sbjct  7     HHFLAFIFGILGNVISFLVFLAPVPTFYRIYKRKSTESFQSLPYQVSLFSCMLWLYYALI  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK A LLI+INS GCV+ETLYI++F  YA++  R   MK+ + +    +S+I++ T F  
Sbjct  67    KKDAFLLITINSFGCVVETLYIAMFFAYATREKRISAMKLFIAMNVAFFSLILMVTHFVV  126

Query  774   KG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
             K   L+V+++GWICVA SV VFAAPL IV +V+KTKSVE+MPF LSFFLT++AVMW  YG
Sbjct  127   KTPPLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEYMPFTLSFFLTISAVMWFAYG  186

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYR--NQKPLEVAEEKKGAVPELVINVAGLGEL  424
             L L D+CIA+PNV+GF+LG++QMVLY +YR  N+KP ++   ++     +V++  G+ E 
Sbjct  187   LFLNDICIAIPNVVGFVLGLLQMVLYLVYRNSNEKPEKINSSEQQLKSIVVMSPLGVSE-  245

Query  423   LHSSVEDSKTTAITVSDAVTEEK  355
             +H  V +S      +S+AV  E 
Sbjct  246   VHPVVTESVD---PLSEAVHHED  265



>ref|XP_009587580.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
tomentosiformis]
Length=298

 Score =   277 bits (709),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 151/270 (56%), Positives = 189/270 (70%), Gaps = 9/270 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA F   H W F FGVLGNIVS +VFL+P+PTF +IYK KS  GYQS+PYV++LFS+MLW
Sbjct  1     MAGFSTDH-WAFAFGVLGNIVSFIVFLSPMPTFYKIYKKKSAEGYQSIPYVIALFSSMLW  59

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFLK +  LLI+INS G  IET+Y+  +L YA K AR QT+KMLLL V G +  IVL
Sbjct  60    IYYAFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGAIVL  119

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F FKG +R  +VGWIC+ FS+CVF APL IV KV+KTKSVE+MP  LS FLTL+AVM
Sbjct  120   VTQFLFKGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVM  179

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAV--PELVI---  448
             W  YGLLLKD+ IA PNVLGF+ GI+Q+VLY IY  ++   + E+K   +  P +++   
Sbjct  180   WFFYGLLLKDINIAAPNVLGFIFGILQIVLYVIYSKKEKAILKEQKLPEIQKPSVILLDE  239

Query  447   --NVAGLGELLHSSVED-SKTTAITVSDAV  367
               N   L EL    + D  K + +  SD V
Sbjct  240   NMNNKKLPELTQEQIIDIVKLSLLVCSDKV  269



>gb|AAM65389.1| senescence-associated protein (SAG29) [Arabidopsis thaliana]
Length=292

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 192/263 (73%), Gaps = 7/263 (3%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH   F+FG+LGN++S LVFLAPVPTF RIYK KST  +QS+PY VSLFS MLW+YYA +
Sbjct  7     HHFLAFIFGILGNVISFLVFLAPVPTFYRIYKRKSTESFQSLPYQVSLFSCMLWLYYALI  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK A LLI+INS GCV+ETLYI++F  YA++  R   MK+ + +    +S+I++ T F  
Sbjct  67    KKDAFLLITINSFGCVVETLYIAMFFAYATREKRISAMKLFIAMNVAFFSLILMVTHFVV  126

Query  774   KG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
             K   L+V+++GWICVA SV VFAAPL IV +V+KTKSVE+MPF LSFFLT++AVMW  YG
Sbjct  127   KTPPLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEYMPFTLSFFLTISAVMWFAYG  186

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYR--NQKPLEVAEEKKGAVPELVINVAGLGEL  424
             L L D+CIA+PNV+GF+LG++QMVLY +YR  N+KP ++   ++     +V++  G+ E 
Sbjct  187   LFLNDICIAIPNVVGFVLGLLQMVLYLVYRNSNEKPEKINSSEEQLKSIVVMSPLGVSE-  245

Query  423   LHSSVEDSKTTAITVSDAVTEEK  355
             +H  V +S      +S+AV  E 
Sbjct  246   VHPVVTESVD---PLSEAVHHED  265



>ref|XP_006347347.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Solanum 
tuberosum]
Length=289

 Score =   277 bits (708),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/233 (62%), Positives = 181/233 (78%), Gaps = 4/233 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA F +H  WVF FGVLGNIVS  VFL+P+PTF ++YK  ST GYQS+PYVV+LFSAMLW
Sbjct  1     MADFSVH--WVFAFGVLGNIVSFFVFLSPLPTFCKMYKKNSTEGYQSIPYVVALFSAMLW  58

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFLK +  LLI+IN+ GC +E +Y+  +L YASK AR QT+K+LLLLV G +  IVL
Sbjct  59    IYYAFLKTNTTLLITINTFGCFVEIIYVGFYLFYASKEARVQTIKLLLLLVVGGFGAIVL  118

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              + F F+G +RV +VGWIC+  S+CVF APL IV +V+KTKSVE+MPF LS FLTL+AVM
Sbjct  119   VSQFLFEGAVRVQVVGWICLVCSLCVFVAPLCIVKQVIKTKSVEYMPFLLSVFLTLSAVM  178

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL  454
             W  YGLLLKD  IA+PNVLGF+ GI+QMVLY +Y N+K  E  +E+   +PEL
Sbjct  179   WFFYGLLLKDFNIAIPNVLGFIFGILQMVLYVMYYNKKEEEFVKEQN--LPEL  229



>emb|CDX77928.1| BnaC03g52910D [Brassica napus]
Length=285

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/268 (54%), Positives = 193/268 (72%), Gaps = 5/268 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M LFD H+ W FVFG++GN++S  VFL+PVPTF R++K K+T G+QS+PYVV+LFSA LW
Sbjct  1     MPLFDTHNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GC IET+YISIFL YA K AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KGT R  I+G ICV FSVCVFAAPLSI+ KV+KT+SVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRKVIKTRSVEYMPFSLSLTLTISAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGA--VPELVINV  442
             WL YGL LKD+ +A PNVLGF LG +QM+LY +Y+  K P  + E++  A  +PE+ +++
Sbjct  181   WLLYGLALKDIYVAFPNVLGFALGALQMILYVVYKYCKTPPHLGEKEVEAAKLPEVSLDI  240

Query  441   AGLGELLHSSVEDSKTTAITVSDAVTEE  358
               LG +  SS E  +    T  +    E
Sbjct  241   LKLGTV--SSPEVRQANKCTCGNDRRPE  266



>ref|XP_009591687.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
tomentosiformis]
Length=297

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 148/262 (56%), Positives = 185/262 (71%), Gaps = 8/262 (3%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W F FGVLGNI+S +VFL+P+PTF RIYK KST GYQS+PYVV+LFS+MLW+YYA LK +
Sbjct  8     WAFAFGVLGNIISFIVFLSPLPTFYRIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKTN  67

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
               LLI+INS G  IET+Y+  +L YA K A+ QT+KMLLL V G +  IVL T F FKG 
Sbjct  68    TTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQFLFKGA  127

Query  765   LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLK  586
             +R  +VGWIC+ FS+CVF APL IV KV+KTKSVE+MP  LS FLTL+AVMW  YGLLLK
Sbjct  128   VRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  585   DMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAV--PELVI-----NVAGLGE  427
             D+ IA PNVLGF+ GI+Q+VLY IY  ++   + E+K   +  PE+++     N   L E
Sbjct  188   DINIAAPNVLGFIFGILQIVLYAIYSKKEKAILKEQKLPEIQKPEVIVVDENMNSKKLPE  247

Query  426   LLHSSVED-SKTTAITVSDAVT  364
             L    + D  K   +  SD V 
Sbjct  248   LTQEQIIDIVKLGLLVCSDKVN  269



>emb|CDX91144.1| BnaC02g04530D [Brassica napus]
Length=297

 Score =   277 bits (708),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 136/243 (56%), Positives = 181/243 (74%), Gaps = 6/243 (2%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH    +FG+LGN +S LVFLAPVPTF RIYK KST  +QS+PY VSLFS MLW+YYA  
Sbjct  7     HHLLAIIFGILGNAISFLVFLAPVPTFYRIYKNKSTESFQSLPYQVSLFSCMLWLYYALT  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K+ A LLI+INS GCV+ET+YI++F  YA+K  +   +K+ L +    +S+I++ T F  
Sbjct  67    KQDAFLLITINSFGCVVETIYIAMFFTYATKEKKMAAIKLFLTMNVAFFSLIIMVTHFAV  126

Query  774   KG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
             K  +L+V+++GWICVA SV VFAAPL IV +V+KTKSVEFMPF LSFFLT++AVMW  YG
Sbjct  127   KSPSLQVSVIGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYG  186

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQ-KPLEVAEEKKGAVPEL----VINVAGL  433
               L D+CIA+PNV+GF+LG+VQMVLYG+YRN    L++ ++K  +  +L    V++  GL
Sbjct  187   AFLHDICIAIPNVVGFILGLVQMVLYGVYRNSGDKLDIGKKKNSSSEQLKTIVVMSPLGL  246

Query  432   GEL  424
              E+
Sbjct  247   SEM  249



>ref|XP_010235464.1| PREDICTED: bidirectional sugar transporter SWEET15 [Brachypodium 
distachyon]
Length=309

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 176/238 (74%), Gaps = 1/238 (0%)
 Frame = -1

Query  1152  MALFDL-HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAML  976
             MA  ++  H W F FG+LGNI+SL+VFL+P+PTF R+Y+ KST G+QS PYVV+LFS +L
Sbjct  1     MAFLNMEQHTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCLL  60

Query  975   WMYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             WMYYAFLK  A LL++IN +GC IETLYI+++L YA K AR  T K+ L L  GL+ +I 
Sbjct  61    WMYYAFLKSGAELLLTINGVGCGIETLYIAMYLIYAPKSARLLTAKLFLGLDVGLFGLIA  120

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             L TM    GTLRV IVGWICVA ++ VFAAPLSI+  V++TKSVEFMP +LSFFL L+AV
Sbjct  121   LVTMLVSAGTLRVQIVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPISLSFFLVLSAV  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINV  442
             +W  YGLL KD+ +A+PNVLGF+ G+ QM LY  YRN+ P      ++  +PE V  V
Sbjct  181   IWFAYGLLKKDVFVAVPNVLGFVFGVAQMALYMAYRNKSPAITVVHQEMKLPEHVKEV  238



>emb|CDY53626.1| BnaC03g71480D [Brassica napus]
Length=291

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 137/261 (52%), Positives = 184/261 (70%), Gaps = 1/261 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH    +FG+LGN +S  VFLAP+PTF RIYK KST  +QS+PY VSLFS MLW+YYA +
Sbjct  7     HHLLAIIFGILGNAISFCVFLAPLPTFYRIYKNKSTESFQSLPYQVSLFSCMLWLYYALI  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K+ A LLI+INS GC++ET+YI++F  YA++  R   MK+   +    +S+I++ T F  
Sbjct  67    KQDAFLLITINSFGCIVETIYIALFFAYATRGKRIAAMKLFFTINVAFFSLILMVTHFAV  126

Query  774   KG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
             K  +L+V+I+GWICVA SV VFAAPL IV +V+KTKSVEFMPF LS FLT++AVMW  YG
Sbjct  127   KSPSLQVSIIGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSLFLTISAVMWFAYG  186

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLH  418
               L D+CIA+PNV+GF+LG++QMVLYG+YRN      AE+K  ++ + +  +  + +L  
Sbjct  187   AFLHDICIAIPNVVGFILGMLQMVLYGVYRNSGVKIDAEKKINSLDQQLKTIVVISQLGV  246

Query  417   SSVEDSKTTAITVSDAVTEEK  355
             S V     T   +SDAV  E 
Sbjct  247   SEVHPVDITVDPLSDAVHHED  267



>sp|A2X5B4.1|SWT15_ORYSI RecName: Full=Bidirectional sugar transporter SWEET15; Short=OsSWEET15 
[Oryza sativa Indica Group]
 gb|EAY86024.1| hypothetical protein OsI_07385 [Oryza sativa Indica Group]
Length=319

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 170/211 (81%), Gaps = 0/211 (0%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W F FG+LGN++SL+VFL+P+PTF R+Y+ KST G+QS PYVV+LFS MLWMYYAF+K  
Sbjct  11    WAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYAFVKSG  70

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
             A LL++IN +GCVIET+Y++++L YA K AR  T KMLL L  GL+ VI L T+   +G 
Sbjct  71    AELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIALVTLLLSRGE  130

Query  765   LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLK  586
             LRV+++GWICVA S+ VFAAPLSI+  V++TKSVEFMPF+LSFFL L+AV+W  YGLL K
Sbjct  131   LRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFLYGLLKK  190

Query  585   DMCIALPNVLGFLLGIVQMVLYGIYRNQKPL  493
             D+ +ALPNVLGF+ G+ QM LY  YR++KPL
Sbjct  191   DVFVALPNVLGFVFGVAQMALYMAYRSKKPL  221



>ref|XP_006399805.1| hypothetical protein EUTSA_v10014234mg [Eutrema salsugineum]
 gb|ESQ41258.1| hypothetical protein EUTSA_v10014234mg [Eutrema salsugineum]
Length=297

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 174/223 (78%), Gaps = 4/223 (2%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH    VFG LGN +S LVFLAPVPTF RIYK KST  +QS+PY VSLFS MLW+YYA +
Sbjct  7     HHLLAIVFGALGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYYALI  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K++A LLI+INS GCV+ETLYI++F  YA+K  R   MK+ + +    +S+I++ T F  
Sbjct  67    KQNAFLLITINSFGCVVETLYIAMFFAYATKDKRIAAMKLFITMNVAFFSLILMVTHFVV  126

Query  774   KG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
             K  TL+V+++GW+CVA SV VFAAPL IV +V+KTKSVEFMPF LSFFLT++AVMW  YG
Sbjct  127   KSPTLQVSVIGWVCVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYG  186

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQ-KPLEVAEEKK  472
             L L D+CIA+PNV+GF+LG+VQMVLYG+YRN  + L++  EKK
Sbjct  187   LFLHDICIAIPNVVGFILGMVQMVLYGVYRNSGEKLDI--EKK  227



>ref|XP_009762335.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Nicotiana 
sylvestris]
Length=299

 Score =   276 bits (707),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 176/233 (76%), Gaps = 4/233 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA F   H W F FGVLGNIVS +VFL+P+PTF +IYK KS  GYQS+PYV++LFS+MLW
Sbjct  1     MAGFSTDH-WAFAFGVLGNIVSFIVFLSPMPTFYKIYKKKSAEGYQSIPYVIALFSSMLW  59

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFLK +  LLI+INS G  IET+Y+  +L YA K AR QT+KMLLL V G +  IVL
Sbjct  60    IYYAFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLSVVGGFGAIVL  119

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F FKG +R  +VGWIC+ FS+CVF APL IV KV+KTKSVE+MP  LS FLTL+AVM
Sbjct  120   VTQFLFKGAVRGQVVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVM  179

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL  454
             W  YGLLLKD+ IA PNVLGF+ GI+Q+VLY IY  ++   + E+K   +PE+
Sbjct  180   WFFYGLLLKDINIAAPNVLGFIFGILQIVLYVIYSKKENAILKEQK---LPEI  229



>ref|NP_001046944.1| Os02g0513100 [Oryza sativa Japonica Group]
 sp|Q6K602.1|SWT15_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET15; Short=OsSWEET15 
[Oryza sativa Japonica Group]
 dbj|BAD23245.1| putative nodulin 3 [Oryza sativa Japonica Group]
 dbj|BAF08858.1| Os02g0513100 [Oryza sativa Japonica Group]
 dbj|BAG95984.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57067.1| hypothetical protein OsJ_06889 [Oryza sativa Japonica Group]
Length=319

 Score =   277 bits (709),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/211 (63%), Positives = 170/211 (81%), Gaps = 0/211 (0%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W F FG+LGN++SL+VFL+P+PTF R+Y+ KST G+QS PYVV+LFS MLWMYYAF+K  
Sbjct  11    WAFTFGILGNLISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYAFVKSG  70

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
             A LL++IN +GCVIET+Y++++L YA K AR  T KMLL L  GL+ VI L T+   +G 
Sbjct  71    AELLVTINGVGCVIETVYLAMYLAYAPKSARMLTAKMLLGLNIGLFGVIALVTLLLSRGE  130

Query  765   LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLK  586
             LRV+++GWICVA S+ VFAAPLSI+  V++TKSVEFMPF+LSFFL L+AV+W  YGLL K
Sbjct  131   LRVHVLGWICVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFLYGLLKK  190

Query  585   DMCIALPNVLGFLLGIVQMVLYGIYRNQKPL  493
             D+ +ALPNVLGF+ G+ QM LY  YR++KPL
Sbjct  191   DVFVALPNVLGFVFGVAQMALYMAYRSKKPL  221



>ref|XP_006288378.1| hypothetical protein CARUB_v10001629mg [Capsella rubella]
 gb|EOA21276.1| hypothetical protein CARUB_v10001629mg [Capsella rubella]
Length=287

 Score =   276 bits (705),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 141/244 (58%), Positives = 181/244 (74%), Gaps = 3/244 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MALFD H+ W FVFG+LGN++S  VFL+PVPTF RI K K+T G+QS+PYVV+LFSAMLW
Sbjct  1     MALFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSIPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GC IET+YISIFL +A+K AR  T+K+LLL+  G +  I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCFIETIYISIFLAFATKNARMLTVKLLLLMNVGGFCAILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KG  R  I+G ICV FSVCVFAAPLSI+  V+KTKSVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLAKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVI  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK---PLEVAEEKKGAVPELVINV  442
             WL YGL LKD+ +A PNV+GF LG +QM+LY +Y+  K    L   E +   +PE+ I++
Sbjct  181   WLLYGLALKDIYVAFPNVIGFALGALQMILYVVYKYCKTSSDLVEKELENAKLPEVSIDM  240

Query  441   AGLG  430
               LG
Sbjct  241   LKLG  244



>ref|XP_010534707.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Tarenaya 
hassleriana]
Length=300

 Score =   276 bits (707),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 137/221 (62%), Positives = 171/221 (77%), Gaps = 2/221 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MAL   HH     FGVLGN +S LVFLAP PTF RIYK KST  ++S+PY VSLFS MLW
Sbjct  1     MALMINHHFMAVTFGVLGNAISFLVFLAPAPTFYRIYKKKSTESFRSLPYQVSLFSCMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK++A LLI+INS GCVIETLYI++F  Y+SK  R   MK+ + +  GL+S+I+ 
Sbjct  61    LYYALLKRNAFLLITINSFGCVIETLYIALFFAYSSKDKRISAMKLFMAMNVGLFSLILS  120

Query  792   ATMFPFKG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
              T F  K    R+ ++GWICV+ SV VFAAPL++V +V++TKSVEFMPF LSFFLT++AV
Sbjct  121   VTHFLVKNPNSRIVVLGWICVSISVSVFAAPLTVVARVIRTKSVEFMPFTLSFFLTISAV  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRN-QKP  496
             MW  YGL L+D+CIA+PNVLGF LG+VQM+LYGIYRN +KP
Sbjct  181   MWFAYGLFLRDICIAIPNVLGFALGMVQMILYGIYRNSEKP  221



>ref|XP_002514863.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47417.1| conserved hypothetical protein [Ricinus communis]
Length=272

 Score =   275 bits (704),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 189/249 (76%), Gaps = 4/249 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+   H P  F FG+LGNI+S+LV+LAPVPTF RIY+ KST G+QS+PY+V+LFS+MLW
Sbjct  1     MAIISTHPPLAFAFGILGNIISILVYLAPVPTFYRIYRKKSTEGFQSLPYLVALFSSMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LKK   LL++IN+ GCVIET+YI +++ YA+K  R  T K+L  +  GL++ I+L
Sbjct  61    LYYAMLKKDVFLLVTINAFGCVIETIYIIMYIIYATKKNRVSTFKVLTSMNLGLFAFIIL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              + F  K ++R  ++GWICVA SVCVFAAPLSIV +V+KT+SVEFMPFNLSFFLTL+A+M
Sbjct  121   FSHFLVKSSVRAQVLGWICVAVSVCVFAAPLSIVAQVIKTRSVEFMPFNLSFFLTLSAIM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W  YGL  KD C+ALPNVLGF+LG++QMVLY IYR  K + + EEK   +PE +  +  L
Sbjct  181   WFAYGLSTKDTCVALPNVLGFILGLLQMVLYVIYRKAKKV-ILEEK---LPEHLKTIVVL  236

Query  432   GELLHSSVE  406
               L +S  +
Sbjct  237   STLGNSEQQ  245



>ref|XP_003620983.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
Length=268

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 186/246 (76%), Gaps = 4/246 (2%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H+   F FG+LGN++S +VFLAP+ TF RIYK KST G+QS+PY+V+LFS+MLW+YYAFL
Sbjct  5     HNTLAFAFGMLGNVISFMVFLAPMTTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYAFL  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK   LLI+INS GCV+E +YI +++ YA+K AR+ T+K+LL +  G + +I+L T +  
Sbjct  65    KKDEFLLITINSFGCVVELIYIILYIIYATKDARKLTIKLLLAMNIGSFGLILLVTKYAV  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G +RV ++GWICV+ SV VFAAPL+IV +VV+TKSVEFMPFNLSF LTL+A+MW GYGL
Sbjct  125   HGPIRVQVLGWICVSISVSVFAAPLTIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVI--NVAGLGELL  421
              LKD+CIALPNVLGF LG+VQM+LY IYRN    +     K A+  +VI  ++ G GE+ 
Sbjct  185   FLKDICIALPNVLGFALGLVQMILYCIYRNGDKKKA--NSKAALKSVVIESSLGGTGEVF  242

Query  420   HSSVED  403
                  D
Sbjct  243   QVEKND  248



>ref|XP_002511126.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51728.1| conserved hypothetical protein [Ricinus communis]
Length=297

 Score =   276 bits (705),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 149/251 (59%), Positives = 194/251 (77%), Gaps = 4/251 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F+ H+P VFVFG+LGNIVS +VFLAPVPTF+R+ K KST G+QS PYVVSLFSAMLW
Sbjct  1     MAIFNTHNPSVFVFGLLGNIVSFVVFLAPVPTFLRVCKKKSTEGFQSFPYVVSLFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK  A LLI+INS+GC+IET+YI++F+ YA K AR  T+K+LLLL  G + +I+L
Sbjct  61    LYYASLKSDAFLLITINSVGCLIETIYITLFITYAPKQARITTLKILLLLNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              + F  KG+ R  I+GW+CV FSV VFAAPLS++  V++TKSVEFMPF LSFFLTL+A+M
Sbjct  121   LSHFLAKGSERATILGWVCVIFSVSVFAAPLSVMRIVIRTKSVEFMPFYLSFFLTLSAIM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             WL YGLLLKD+ IA+PN+LG + G++QM+LY IY+N K   V EE K  +PE  ++   L
Sbjct  181   WLFYGLLLKDLYIAVPNILGLVFGVLQMILYVIYKNVK--TVVEEPK--LPEHNVDNVKL  236

Query  432   GELLHSSVEDS  400
               ++   V+  
Sbjct  237   SAVITCEVQQE  247



>emb|CDX69663.1| BnaA10g20120D [Brassica napus]
Length=298

 Score =   276 bits (705),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 191/269 (71%), Gaps = 13/269 (5%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH    VFG+LGN +S LVFLAPVPTF RIYK KST  +QS+PY VSLFS MLW+ YA +
Sbjct  7     HHLLAIVFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLCYALI  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K+ A LLI+INS GCV+ET+YI++F  YA+K  R   MK+ L +    +S+I++ T F  
Sbjct  67    KQDAFLLITINSFGCVVETIYIAMFFTYATKDKRIAAMKLFLTINVAFFSLILMVTHFAV  126

Query  774   KG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
             K  +L+V+++GWICVA SV VFAAPL IV +V+KTKSVEFMPF LSFFLT++AVMW  YG
Sbjct  127   KRPSLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYG  186

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPE-------LVINVA  439
             L L D+CIA+PNV+GF+LG+VQM+LYGIYRN  P E  + +K   P        +V++  
Sbjct  187   LFLHDICIAIPNVVGFILGMVQMLLYGIYRN--PGEKLDTEKKMNPSDQQLKSVVVMSPL  244

Query  438   GLGELLHSSVEDSKTTAIT-VSDAVTEEK  355
             G+ E+    ++D+ T  +   SDAV  + 
Sbjct  245   GVSEV--HPIDDNMTEPVDPFSDAVQHKD  271



>emb|CDX87161.1| BnaC09g04760D [Brassica napus]
Length=277

 Score =   275 bits (703),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 196/269 (73%), Gaps = 3/269 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F+ H+ W F FG+LGN++S  VFL+PVPTF RI K K+T G+QS+PYVV+LFSAMLW
Sbjct  1     MAIFNTHNTWAFAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GCVIET+YI+IF+ +A+K AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCVIETIYIAIFVAFATKEARMLTVKLLLLMNFGGFFLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KGT R  I+G ICV FSVCVFAAPLSI+  V+KTKSVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGA--VPELVINV  442
             WL YGL LKD+ +A PNV+GF+LG +QM+LY +++  K P ++ E++  A  +PE+ IN+
Sbjct  181   WLLYGLALKDIYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLVEKELEAAKLPEVSINM  240

Query  441   AGLGELLHSSVEDSKTTAITVSDAVTEEK  355
               LG L+ S      T    V   V  +K
Sbjct  241   LKLGTLVGSPELAVNTVVRPVRMCVCNDK  269



>ref|XP_007159040.1| hypothetical protein PHAVU_002G203600g [Phaseolus vulgaris]
 gb|ESW31034.1| hypothetical protein PHAVU_002G203600g [Phaseolus vulgaris]
Length=273

 Score =   275 bits (703),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 133/227 (59%), Positives = 176/227 (78%), Gaps = 1/227 (0%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+ + H+     FG+LGNI+S +V+LAP+PTF RIYK KST G+QS+PY+V+LFS+MLW
Sbjct  1     MAILNTHNHLALAFGLLGNIISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLW  60

Query  972   MYYAFLK-KSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             +YYA LK   A LLI+INS+G VIET+YI +F  YA+  AR+ T+K+ +++  G +++I 
Sbjct  61    LYYAVLKPADATLLITINSVGTVIETVYIVLFTVYATTDARKLTVKLFVVMNVGSFALIF  120

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             L T F   G LR+ +VGW+CVA SV VFAAPLSIV +V++TK+VEFMPFNLS FLTL+A+
Sbjct  121   LVTFFTMHGALRIQVVGWVCVAISVGVFAAPLSIVTQVIRTKNVEFMPFNLSLFLTLSAI  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEK  475
              W  YG  LKD+CIA+PNVLGF LG+VQM+LY +YRN K   V EE+
Sbjct  181   TWFSYGFFLKDICIAIPNVLGFTLGLVQMLLYAMYRNGKSKIVTEEE  227



>ref|XP_003531061.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=274

 Score =   275 bits (703),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 188/240 (78%), Gaps = 4/240 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MAL + H+     FG+LGN++S +V+LAP+PTF RIYK KST G+QS+PY+V+LFS+MLW
Sbjct  1     MAL-NSHNHLALAFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLW  59

Query  972   MYYAFLK-KSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             +YYA LK   A LLI+INS+GCVIE +YI +F  YA+K AR  T+K+ +++  G +++I 
Sbjct  60    LYYASLKPADATLLITINSLGCVIEIVYIVMFTIYATKDARNLTVKLFMVMNVGSFALIF  119

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             L T F   G+LRV +VGW+CV+ +V VFAAPLSIV +V++TK+VEFMPFNLS FLTL+AV
Sbjct  120   LVTYFAIHGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKNVEFMPFNLSLFLTLSAV  179

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKP--LEVAEEKKGAVPELVINV  442
             MW  YGLLLKD+CIA+PN+LGF LG++QM+LY IYRN K    EVA +++ A+  ++ NV
Sbjct  180   MWFFYGLLLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKEVATKEEKALEAIMKNV  239



>gb|KHN39181.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=274

 Score =   275 bits (703),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 187/240 (78%), Gaps = 4/240 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MAL + H+     FG+LGN++S +V+LAP+PTF RIYK KST G+QS+PY+V+LFS+MLW
Sbjct  1     MAL-NSHNHLALAFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLW  59

Query  972   MYYAFLK-KSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             +YYA LK   A LLI+INS+GCVIE +YI +F  YA+K AR  T+K+ +++  G +++I 
Sbjct  60    LYYASLKPADATLLITINSLGCVIEIVYIVMFTIYATKDARNLTVKLFMVMNVGSFALIF  119

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             L T F   G+LRV +VGW+CV+ +V VFAAPLSIV +V++TK VEFMPFNLS FLTL+AV
Sbjct  120   LVTYFAIHGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKDVEFMPFNLSLFLTLSAV  179

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKP--LEVAEEKKGAVPELVINV  442
             MW  YGLLLKD+CIA+PN+LGF LG++QM+LY IYRN K    EVA +++ A+  ++ NV
Sbjct  180   MWFFYGLLLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKEVATKEEKALEAIMKNV  239



>ref|XP_009125890.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Brassica 
rapa]
Length=297

 Score =   276 bits (705),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 181/243 (74%), Gaps = 6/243 (2%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH    +FG+LGN +S LVFLAPVPTF RIYK KST  +QS+PY VSLFS MLW+YYA  
Sbjct  7     HHLLAIIFGILGNAISFLVFLAPVPTFYRIYKNKSTESFQSLPYQVSLFSCMLWLYYALT  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K+ A LLI+INS GCV+ET+YI++F  YA+K  +   +K+ L +    +S+I++ T F  
Sbjct  67    KQDAFLLITINSFGCVVETIYIAMFFTYATKEKKMAAIKLFLTMNVAFFSLIIMVTHFAV  126

Query  774   KG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
             K  +L+V+++GWICVA SV VFAAPL IV +V+KTKSVEFMPF LSFFLT++AVMW  YG
Sbjct  127   KRPSLQVSVIGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYG  186

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQ-KPLEVAEEKKGAVPEL----VINVAGL  433
               L D+CIA+PNV+GF+LG+VQMVLYG+YRN  + L++ ++   +  +L    V++  GL
Sbjct  187   AFLHDICIAIPNVVGFILGLVQMVLYGVYRNSGEKLDIGKKNNSSSEQLKTIVVMSPLGL  246

Query  432   GEL  424
              E+
Sbjct  247   SEM  249



>ref|XP_006438820.1| hypothetical protein CICLE_v10032218mg [Citrus clementina]
 ref|XP_006483041.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Citrus 
sinensis]
 gb|ESR52060.1| hypothetical protein CICLE_v10032218mg [Citrus clementina]
Length=305

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/265 (53%), Positives = 194/265 (73%), Gaps = 11/265 (4%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+   HH W   FG+LGNI+S LV+LAPVPTF RIY+ KST  +QS+PY+V+LFS+MLW
Sbjct  1     MAIMFDHHQWGVAFGILGNIISFLVYLAPVPTFYRIYRKKSTESFQSLPYLVALFSSMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
              YYA +K++A LL++IN  GCVIET+YI +F+ YA K +R  T+K+ + +  G++S+I+L
Sbjct  61    FYYALVKQNAFLLVTINCFGCVIETIYIILFITYAPKGSRNSTVKLFVSMNVGVFSLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F    + R+ I+GWICVA SV VFAAPLSIV +V++TKSVEFMPF LSFFLTL+A+M
Sbjct  121   LTHFLATDSTRILILGWICVAVSVSVFAAPLSIVAQVIRTKSVEFMPFILSFFLTLSAIM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPE------LV  451
             W  YGL  KD+C+ALPN++GFLLG+ QM+LY IY+N   + + EEKK  +PE      +V
Sbjct  181   WFAYGLFQKDICVALPNIVGFLLGLTQMLLYVIYKNANKV-IIEEKK--LPEAQLKSIVV  237

Query  450   INVAGLGELLHSSV--EDSKTTAIT  382
             ++  G  E+    +  +D+ TT + 
Sbjct  238   LSNLGASEVYPVDIHPDDADTTDVN  262



>gb|KEH21447.1| sugar efflux transporter for intercellular exchange protein [Medicago 
truncatula]
Length=279

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 186/246 (76%), Gaps = 4/246 (2%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H+   F FG+LGN++S +VFLAP+ TF RIYK KST G+QS+PY+V+LFS+MLW+YYAFL
Sbjct  5     HNTLAFAFGMLGNVISFMVFLAPMTTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYAFL  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK   LLI+INS GCV+E +YI +++ YA+K AR+ T+K+LL +  G + +I+L T +  
Sbjct  65    KKDEFLLITINSFGCVVELIYIILYIIYATKDARKLTIKLLLAMNIGSFGLILLVTKYAV  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G +RV ++GWICV+ SV VFAAPL+IV +VV+TKSVEFMPFNLSF LTL+A+MW GYGL
Sbjct  125   HGPIRVQVLGWICVSISVSVFAAPLTIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVI--NVAGLGELL  421
              LKD+CIALPNVLGF LG+VQM+LY IYRN    +     K A+  +VI  ++ G GE+ 
Sbjct  185   FLKDICIALPNVLGFALGLVQMILYCIYRNGDKKKA--NSKAALKSVVIESSLGGTGEVF  242

Query  420   HSSVED  403
                  D
Sbjct  243   QVEKND  248



>ref|XP_006647263.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Oryza 
brachyantha]
Length=319

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 170/213 (80%), Gaps = 0/213 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
              + W F FG+LGNI+SL+VFL+P+PTF R+Y+ KST G+QS PYVV+LFS MLWMYYAF+
Sbjct  8     RNTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCMLWMYYAFV  67

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K  A LL++IN +GCVIET+Y++++L YA+K  R  T +MLL L  GL+ +I L T+   
Sbjct  68    KSGAELLVTINGVGCVIETVYLAMYLAYAAKSTRMLTTRMLLGLNVGLFGLIALVTLLLP  127

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
             +G LRV+++GW+CVA S+ VFAAPLSI+  V++TKSVEFMPF+LSFFL L+AV+W GYGL
Sbjct  128   QGALRVHVLGWVCVAVSLSVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVIWFGYGL  187

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKP  496
             L KD+ +ALPNVLGF+ G+ QM LY  YR +KP
Sbjct  188   LKKDVFVALPNVLGFVFGVAQMALYMAYRTKKP  220



>ref|XP_003524088.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
 gb|KHN22921.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=283

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/274 (52%), Positives = 198/274 (72%), Gaps = 7/274 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F+ H+     FG+LGN++S +V+LAP+PTF RIYK KST G+QS+PY+V+LFS+MLW
Sbjct  1     MAIFNGHNHLALGFGMLGNVISFMVYLAPLPTFYRIYKKKSTEGFQSLPYLVALFSSMLW  60

Query  972   MYYAFLK-KSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             +YYA LK   A LLI+INS+GCVIE +YI +F  YA+K AR  T+K+ +++  G +++I 
Sbjct  61    LYYASLKPADATLLITINSLGCVIEIVYIIMFTIYATKDARNLTVKLFMVMNVGSFALIF  120

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             L T F   G+LRV +VGW+CV+ +V VFAAPLSIV +V++TK+VEFMPFNLS FLT++AV
Sbjct  121   LVTYFAMHGSLRVQVVGWVCVSIAVGVFAAPLSIVAQVIRTKNVEFMPFNLSLFLTISAV  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKP--LEVAEEKKGAVPEL----  454
             MW  YGLLLKD+CIA+PN+LGF LG++QM+LY IYRN K    EV  +++ A+  +    
Sbjct  181   MWFFYGLLLKDICIAIPNILGFTLGLLQMLLYAIYRNGKTNNKEVVTKEEHALEAMKNVV  240

Query  453   VINVAGLGELLHSSVEDSKTTAITVSDAVTEEKA  352
             V+N  G  E+     ++       +  A  +EK 
Sbjct  241   VVNPLGTCEVYPVIGKEINNNGQGIEGAEEKEKG  274



>ref|XP_006347633.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=296

 Score =   275 bits (703),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/260 (56%), Positives = 188/260 (72%), Gaps = 8/260 (3%)
 Frame = -1

Query  1137  LHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAF  958
             + + W F FGVLGNIVS +VFL+P+PTF  IYK KST GYQS+PYVV+LFS+MLW+YYA 
Sbjct  4     ISNHWAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYAL  63

Query  957   LKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFP  778
             LK + PLLI+INS G  IET+Y+ ++L YA K AR QT+KML+L V G +  I+L T   
Sbjct  64    LKTNMPLLITINSFGMFIETIYVGLYLFYAPKKARVQTVKMLMLSVVGGFGAIILVTELL  123

Query  777   FKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
             FKG +R  +VGWIC+ FS+CVF APL IV KV+KTKSVE+MP  LS FLTL+AVMW  YG
Sbjct  124   FKGAIRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYG  183

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL---GE  427
             LLLKD+ IA PNVLGF+ GI+Q+VLY IY  ++ + + E+K   +PE  I   G+    E
Sbjct  184   LLLKDINIAAPNVLGFIFGILQIVLYAIYSKKEKVILKEQK---LPE--IQTPGVIVKDE  238

Query  426   LLHSSVEDSKTTAITVSDAV  367
              +H++ +  + T   + D V
Sbjct  239   NMHTNKKLPELTQEQIIDIV  258



>ref|XP_009149800.1| PREDICTED: bidirectional sugar transporter SWEET11 [Brassica 
rapa]
Length=289

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/244 (57%), Positives = 182/244 (75%), Gaps = 3/244 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M LFD H+ W FVFG++GN++S  VFL+PVPTF R++K K+T G+QS+PYVV+LFSA LW
Sbjct  1     MPLFDTHNTWAFVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GC IET+YISIFL YA K AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KGT R  I+G ICV FSVCVFAAPLSI+  V+KT+SVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKP---LEVAEEKKGAVPELVINV  442
             WL YGL LKD+ +A PNV+GF LG +QM+LY +Y+  K    LE  E +   +PE+ +++
Sbjct  181   WLLYGLALKDIYVAFPNVIGFALGALQMILYVVYKYCKTPPHLEEKEVEAAKLPEVTLDM  240

Query  441   AGLG  430
               LG
Sbjct  241   LKLG  244



>emb|CDY08093.1| BnaA06g16330D [Brassica napus]
Length=289

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 138/244 (57%), Positives = 182/244 (75%), Gaps = 3/244 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M LFD H+ W FVFG++GN++S  VFL+PVPTF R++K K+T G+QS+PYVV+LFSA LW
Sbjct  1     MPLFDTHNTWAFVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GC IET+YISIFL YA K AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KGT R  I+G ICV FSVCVFAAPLSI+  V+KT+SVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKP---LEVAEEKKGAVPELVINV  442
             WL YGL LKD+ +A PNV+GF LG +QM+LY +Y+  K    LE  E +   +PE+ +++
Sbjct  181   WLLYGLALKDIYVAFPNVIGFALGALQMILYVVYKYCKTPPHLEEKEVEAAKLPEVTLDM  240

Query  441   AGLG  430
               LG
Sbjct  241   LKLG  244



>gb|EMS46194.1| Bidirectional sugar transporter SWEET15 [Triticum urartu]
Length=345

 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 173/224 (77%), Gaps = 1/224 (0%)
 Frame = -1

Query  1152  MALFDL-HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAML  976
             MA  ++  H W F FG+LGNI+SL+VFL+P+PTF R+Y+ KST G+QS PY+V+LFS +L
Sbjct  1     MAFLNMEQHTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYLVTLFSCLL  60

Query  975   WMYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             WMYYAFLK  + LL++IN++GCVIE+LYI+++L YA K AR  T K+ + L  GL+ +I 
Sbjct  61    WMYYAFLKSGSELLLTINAVGCVIESLYIAMYLVYAPKSARLLTAKLFIGLDVGLFGLIA  120

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             L TM    G LRV +VGWICVA ++ VFAAPLSI+  V++TKSVEFMPF+LSFFL L+AV
Sbjct  121   LVTMLASHGPLRVQVVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAV  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVA  484
             +W  YG L KD+ +A+PNVLGFL G+ QM LY  YRN+KP  VA
Sbjct  181   IWFAYGALKKDIFVAMPNVLGFLFGVAQMALYMAYRNKKPATVA  224



>ref|XP_009141677.1| PREDICTED: bidirectional sugar transporter SWEET12 [Brassica 
rapa]
Length=277

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/269 (54%), Positives = 197/269 (73%), Gaps = 3/269 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F+ H+ W F FG+LGN++S  VFL+PVPTF RI K K+T G+QS+PYVV+LFSAMLW
Sbjct  1     MAIFNTHNTWAFAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GCVIET+YI+IF+ +A+K AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCVIETIYIAIFVAFATKEARMFTVKLLLLMNFGGFFLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KGT R  I+G ICV FSVCVFAAPLSI+  V+KTKSVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGA--VPELVINV  442
             WL YGL LKD+ +A PNV+GF+LG +QM+LY +++  K P ++ E++  A  +PE+ I++
Sbjct  181   WLLYGLALKDIYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLVEKELEAAKLPEVSIDM  240

Query  441   AGLGELLHSSVEDSKTTAITVSDAVTEEK  355
               LG L+ S      T    VS  V  +K
Sbjct  241   LKLGTLVASPEPAVITVVRPVSMCVCNDK  269



>dbj|BAJ94651.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=292

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 181/249 (73%), Gaps = 8/249 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M      HPW F FG+LGN++S + +LAP+PTF RIYK KST G+QSVPYVV+LFSAMLW
Sbjct  1     MGGLSAQHPWAFTFGLLGNVISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK    LLI+IN+ GCVIET+YI ++L YA K AR  T K+LLLL  G++ +I+L
Sbjct  61    IYYALLKSDEYLLITINTAGCVIETIYIVLYLAYAPKQARLFTAKILLLLNVGVFGLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+    G  RV ++GW+CV FSVCVF APLS++  VV+T+SVEFMPF+LS  LT +AV+
Sbjct  121   LTLLLTAGERRVVMLGWVCVGFSVCVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTASAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKP------LEVAEEKKGAV--PE  457
             W  YGLL+KD  +ALPN+LGF  G++QM LY +YRN  P      ++  E + GAV  PE
Sbjct  181   WFLYGLLIKDKYVALPNILGFAFGVIQMGLYALYRNATPIPAPKEMDAPESEDGAVKAPE  240

Query  456   LVINVAGLG  430
              V+N+A LG
Sbjct  241   HVVNIAKLG  249



>ref|XP_006578712.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31281.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=282

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/259 (55%), Positives = 192/259 (74%), Gaps = 8/259 (3%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H  W FVFG+LGN++S +VFLAP+PTF +IYK KS+ G+QS+PYVV+LFS+MLW+YYAF+
Sbjct  5     HETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIYYAFV  64

Query  954   KKSAPLL-ISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFP  778
             KK A LL I+INS GCVIET+Y++IFL YA    R  T+K+LL+L    +  ++L+T++ 
Sbjct  65    KKDASLLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYL  124

Query  777   FKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
               G+ R+ ++GWIC+ F++ VFAAPL I+ +V+KTKSVEFMPF+LSF LT+ AVMW  YG
Sbjct  125   TTGSKRLTVIGWICLVFNISVFAAPLCIMKRVIKTKSVEFMPFSLSFSLTINAVMWFFYG  184

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLH  418
             LLLKD  IALPN LGFL GI+QMVLY IYRN K     +++   + EL  ++  +G+L  
Sbjct  185   LLLKDYYIALPNTLGFLFGIIQMVLYLIYRNAK-----KDEPMKLEELNSHIINVGKL--  237

Query  417   SSVEDSKTTAITVSDAVTE  361
             S +E S+    T +  VTE
Sbjct  238   SRMEPSEPNHATKNGTVTE  256



>ref|XP_006436901.1| hypothetical protein CICLE_v10032313mg [Citrus clementina]
 gb|ESR50141.1| hypothetical protein CICLE_v10032313mg [Citrus clementina]
Length=285

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 147/268 (55%), Positives = 194/268 (72%), Gaps = 3/268 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M +F  H PWVF FG+LGNIVS +VFLAP+PTF R+ K KST G+QS+PYVV+LFSAMLW
Sbjct  1     MTMFSTHDPWVFAFGLLGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA +KK A LLI+IN+ GCVIET+Y+++++ +A K AR  T+++LLLL  G +  I+L
Sbjct  61    IYYAMMKKDAFLLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILL  120

Query  792   ATMFPFKGT-LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
              + F  KG+  R+ ++GWICV FSV VFAAPLSI+  VV+TKSVEFMPF LS FLTL AV
Sbjct  121   LSHFLAKGSAARLRLLGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAV  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAG  436
             MW  YGL LKD+ +A+PNVLGF+ G+VQM+LY IYRN + + V +  K  VPE  ++V  
Sbjct  181   MWFFYGLFLKDVYVAVPNVLGFIFGVVQMILYAIYRNYRRVVVEDVNK--VPEHTVDVVK  238

Query  435   LGELLHSSVEDSKTTAITVSDAVTEEKA  352
             L     ++ E+   +     D    E+A
Sbjct  239   LSTNNMTASEEQTNSRNNFDDKNEHEQA  266



>ref|XP_009150178.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Brassica 
rapa]
Length=285

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/268 (54%), Positives = 192/268 (72%), Gaps = 5/268 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M LFD H+ W FVFG++GN++S  VFL+PVPTF R++K K+T G+QS+PYVV+LFSA LW
Sbjct  1     MPLFDTHNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GC IET+YISIFL YA K AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KGT R  I+G ICV FSVCVFAAPLSI+  V+KT+SVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGA--VPELVINV  442
             WL YGL LKD+ +A PNVLGF LG +QM+LY +Y+  K P  + E++  A  +PE+ +++
Sbjct  181   WLLYGLALKDIYVAFPNVLGFALGALQMILYVVYKYCKTPPHLGEKEVEAAKLPEVSLDI  240

Query  441   AGLGELLHSSVEDSKTTAITVSDAVTEE  358
               LG +  SS E  +    T  +    E
Sbjct  241   LKLGTV--SSPEVRQANKCTCGNDRRPE  266



>emb|CDX85668.1| BnaA02g01450D [Brassica napus]
Length=297

 Score =   274 bits (701),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 180/243 (74%), Gaps = 6/243 (2%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH    +FG+LGN +S LVFLAPVPTF RIYK KST  +QS+PY VSLFS MLW+YYA  
Sbjct  7     HHLLAIIFGILGNAISFLVFLAPVPTFYRIYKNKSTESFQSLPYQVSLFSCMLWLYYALT  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K+ A LLI+INS GCV+ET+YI++F  YA+K  +   +K+ L +    +S+I++ T F  
Sbjct  67    KQDAFLLITINSFGCVVETIYIAMFFTYATKEKKMAAIKLFLTMNVAFFSLIIMVTHFAV  126

Query  774   KG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
             K  +L+V+++GWICVA SV VFAAPL IV +V+KTKSVEFMPF LSFFLT++AVMW  YG
Sbjct  127   KRPSLQVSVIGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYG  186

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQ-KPLEVAEEKKGAVPEL----VINVAGL  433
               L D+CIA+PNV+GF+LG+VQMVLYG+YRN  + L++ +    +  +L    V++  GL
Sbjct  187   AFLHDICIAIPNVVGFILGLVQMVLYGVYRNSGEKLDIGKRNNSSSEQLKTIVVMSPLGL  246

Query  432   GEL  424
              E+
Sbjct  247   SEM  249



>ref|XP_009421186.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=288

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 146/267 (55%), Positives = 192/267 (72%), Gaps = 6/267 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F  G+LGNI+SL+VFLAP+PTF R+Y  KST G+QSVPYVV+LFS MLW
Sbjct  1     MAGLSLDHPWAFTIGILGNIISLMVFLAPLPTFYRVYTRKSTEGFQSVPYVVALFSCMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
               YAFLK  A LLI+INSIGC IET+YI I+L YA K+A+  T K++L++  G++ +I+L
Sbjct  61    FCYAFLKTDAYLLITINSIGCAIETVYIVIYLTYAPKVAKIFTAKLVLVVNVGMFGLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+   +G+ RV   GWICV+FSV VF APLS++  V++TKSVEFMP +LSFFLTL+A++
Sbjct  121   LTLLLAEGSKRVGAFGWICVSFSVSVFVAPLSVIRLVMRTKSVEFMPVSLSFFLTLSAIV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W  YGLL KD+ + LPNV+GF+ GI+QMVLY  YR++    VA E K  +PE +I++A L
Sbjct  181   WFAYGLLTKDIYVGLPNVVGFIFGILQMVLYVAYRDKN--RVAIEHK--LPEHIISIAKL  236

Query  432   GELLHSSVE--DSKTTAITVSDAVTEE  358
                  S +   DS T  +   D V E+
Sbjct  237   SAEKASEIYPIDSATPVVHDQDTVQEQ  263



>emb|CDX83046.1| BnaA01g20460D [Brassica napus]
Length=286

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 139/244 (57%), Positives = 186/244 (76%), Gaps = 3/244 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M LFD H+ W FVFG++GN++S  VFL+PVPTF R++K K+T G+QS+PYVV+LFSA LW
Sbjct  1     MPLFDTHNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GC IET+YISIFL +A K AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCFIETIYISIFLAFAPKKARMLTVKLLLLMNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              + F  KGT R  I+G ICV FSVCVFAAPLSI+  V+KT+SVE+MPF+LS  LT++AV+
Sbjct  121   LSQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGA--VPELVINV  442
             WL YGL LKD+ +A PNVLGF LG +QM+LY +YR  K P ++ E++  A  +PE+ +++
Sbjct  181   WLLYGLALKDIYVAFPNVLGFALGALQMILYVVYRYCKTPPQLGEKEVEAAKLPEVSLDM  240

Query  441   AGLG  430
               LG
Sbjct  241   LKLG  244



>emb|CDX97233.1| BnaC09g43920D [Brassica napus]
Length=298

 Score =   274 bits (700),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 145/273 (53%), Positives = 187/273 (68%), Gaps = 13/273 (5%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH    VFG+LGN +S LVFLAPVPTF RIYK KST  +QS+PY VSLFS MLW+ YA +
Sbjct  7     HHLLAIVFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLCYALI  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K+ A LLI+INS GCV+ET+YI++F  YA+K  R   MK+ L +    +S+I++ T F  
Sbjct  67    KQDAFLLITINSFGCVVETIYIAMFFTYATKDKRVAAMKLFLTINVAFFSLILMVTHFAV  126

Query  774   KG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
             K  +L+V+++GWICVA SV VFAAPL IV +V+KTKSVEFMPF LSFFLT++AVMW  YG
Sbjct  127   KRPSLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYG  186

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLH  418
             L L D+CIA+PNV+GF+LG++QMVLYGIYRN       E+K     + + +V  +  L  
Sbjct  187   LFLHDICIAIPNVVGFILGMIQMVLYGIYRNSGEKLDTEKKMNPSEQQLKSVVVMSPLSV  246

Query  417   SSVE----------DSKTTAITVSD--AVTEEK  355
             S V           D  + A+   D   VT+EK
Sbjct  247   SEVHPIDVCVTEPVDPFSDAVQHKDPSKVTKEK  279



>emb|CDY16863.1| BnaA09g05190D [Brassica napus]
Length=277

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 144/269 (54%), Positives = 197/269 (73%), Gaps = 3/269 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F+ H+ W F FG+LGN++S  VFL+PVPTF RI K K+T G+QS+PYVV+LFSAMLW
Sbjct  1     MAIFNTHNTWAFAFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GCVIET+YI+IF+ +A+K AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCVIETIYIAIFVAFATKEARMLTVKLLLLMNFGGFFLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KGT R  I+G ICV FSVCVFAAPLSI+  V+KTKSV++MPF+LS  LT++AV+
Sbjct  121   LCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVKYMPFSLSLTLTISAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGA--VPELVINV  442
             WL YGL LKD+ +A PNV+GF+LG +QM+LY +++  K P ++ E++  A  +PE+ I++
Sbjct  181   WLLYGLALKDIYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLVEKELEAAKLPEVSIDM  240

Query  441   AGLGELLHSSVEDSKTTAITVSDAVTEEK  355
               LG L+ S      T    VS  V  +K
Sbjct  241   LKLGTLVGSPELAVNTVVRPVSMCVCNDK  269



>ref|XP_008340254.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
 ref|XP_008353052.1| PREDICTED: bidirectional sugar transporter N3-like [Malus domestica]
Length=305

 Score =   274 bits (701),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/248 (53%), Positives = 185/248 (75%), Gaps = 3/248 (1%)
 Frame = -1

Query  1140  DLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYA  961
             D HHP  F FG+LGN++S +V+L+PVPTF RIY+ KST G+ SVPY+V+LFS+MLW+YYA
Sbjct  6     DSHHPLAFTFGILGNLISTMVYLSPVPTFYRIYRKKSTEGFHSVPYLVALFSSMLWLYYA  65

Query  960   FLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMF  781
              +KK+A +LI+INS G  +E +YI +F  YA K AR+ T+K+  ++  GL+++I++ + F
Sbjct  66    LVKKNAMMLITINSFGSFVEIIYIVMFXVYAPKEARKLTVKLFGIMNVGLFTMILVVSHF  125

Query  780   PFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGY  601
                   RV I+GWI VA S  VF APLSIV +V++T+SVEFMPF LSFFLTL+AV+W  Y
Sbjct  126   LVGSAYRVPILGWINVAISTSVFVAPLSIVAQVIRTRSVEFMPFGLSFFLTLSAVIWFAY  185

Query  600   GLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK---GAVPELVINVAGLG  430
             G LLKD+C+A+PN LGF+LG++QM+LYGIYRN++ + + + +K   GA+ E V N+  + 
Sbjct  186   GYLLKDICVAIPNFLGFVLGLLQMLLYGIYRNREQVIIDDHEKKLPGAIHEDVKNIVIIA  245

Query  429   ELLHSSVE  406
              L  S V 
Sbjct  246   TLAASEVH  253



>ref|XP_009393865.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=281

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/275 (50%), Positives = 195/275 (71%), Gaps = 9/275 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGNI+S +V+LAP+PTF R+ + KST G+ SVPYVV+LFSA LW
Sbjct  1     MAGLSLDHPWAFTFGILGNIISFMVYLAPLPTFYRVCRRKSTEGFHSVPYVVALFSATLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YAFLK +A LLI+IN++GCVIET Y+ ++  YA K A+  T K++LL+  G++ +I++
Sbjct  61    IFYAFLKTNAGLLITINAVGCVIETAYVVVYFTYAPKAAKMFTAKLVLLVNVGMFGLILV  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+   +G  RV ++GWIC++FSV VF APLSI+  V++TKSVEFMPF+LSFFLT +AV+
Sbjct  121   LTLLFARGAKRVEVLGWICMSFSVSVFVAPLSIIRLVIRTKSVEFMPFSLSFFLTWSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEE------KKGAVPELV  451
             W GYGLL KD+ +ALPNVLGF+ G++QMVLY  YRN+    V ++       K    E V
Sbjct  181   WFGYGLLTKDLYVALPNVLGFIFGVLQMVLYVAYRNKDKAMVEQKLPEHIASKLGTAEKV  240

Query  450   INVAGLG---ELLHSSVEDSKTTAITVSDAVTEEK  355
             + +  +G   ++ + + E+ +     V+ A  E+K
Sbjct  241   LEIYAIGVEEKVPNRAQEEQEEDKQGVAAAPMEKK  275



>ref|XP_004491680.1| PREDICTED: bidirectional sugar transporter N3-like [Cicer arietinum]
Length=257

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H    F FG+LGN++S +VFLAP+ TF RIYK KST  +QS+PY+V+LFS+MLW+YYA +
Sbjct  5     HATLAFGFGMLGNVISFMVFLAPMTTFYRIYKKKSTEQFQSLPYLVALFSSMLWLYYALV  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K +  LLI+INS GC++E +YI +++ YA K AR+ T+K+LL +  G + +I+  T +  
Sbjct  65    KTNEFLLITINSFGCLVEIIYILLYITYAPKDARKLTLKLLLAMNMGSFGLILSVTHYAM  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G LRV ++GWICV+ SV VFAAPL+IV +VV+TKSVEFMPFNLSF LTL+A+MW GYGL
Sbjct  125   HGALRVQVLGWICVSISVSVFAAPLTIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRN  505
              LKD+CIALPNVLGF+LG+VQM+LYGIYRN
Sbjct  185   FLKDICIALPNVLGFVLGLVQMILYGIYRN  214



>gb|EMT09236.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=310

 Score =   274 bits (701),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 139/243 (57%), Positives = 179/243 (74%), Gaps = 6/243 (2%)
 Frame = -1

Query  1152  MALFDL-HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAML  976
             MA  ++  H W F FG+LGNI+SL+VFL+P+PTF R+Y+ KST G Q  PY+V+LFS +L
Sbjct  1     MAFLNMEQHTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGVQPTPYLVTLFSCLL  60

Query  975   WMYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             WMYYAFLK  + LL++IN++GCVIE+LYI+++L YA K AR  T K+ + L  GL+ +I 
Sbjct  61    WMYYAFLKSGSELLLTINAVGCVIESLYIAMYLVYAPKSARLLTAKLFIGLDVGLFGLIA  120

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             L TM    G LRV +VGWICVA ++ VFAAPLSI+  V++TKSVEFMPF+LSFFL L+AV
Sbjct  121   LVTMLASYGPLRVQVVGWICVAVALGVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAV  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVA---EEKKGAVPELVIN  445
             +W  YG L KD+ +A+PNVLG L G+ QM LY  YRN+KP  V    EE K  +PE V  
Sbjct  181   IWFAYGALKKDIFVAMPNVLGLLFGVAQMALYMAYRNKKPATVVLVHEEMK--LPEHVKE  238

Query  444   VAG  436
             VAG
Sbjct  239   VAG  241



>ref|XP_009787633.1| PREDICTED: bidirectional sugar transporter N3-like [Nicotiana 
sylvestris]
Length=295

 Score =   273 bits (699),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 173/224 (77%), Gaps = 3/224 (1%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W F FGVLGNIVS +VFL+P+PTF +IYK KST GYQS+PYVV+LFS+MLW+YYAFLK +
Sbjct  8     WAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTN  67

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
               LLI+INS G  IET+Y+  +L YA K A+ QT+KMLLL V G +  IVL T F FKG 
Sbjct  68    TTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQFLFKGA  127

Query  765   LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLK  586
             +R  +VGWIC+ FS+CVF APL IV KV+KTKSVE+MP  LS FLTL+AVMW  YGLLLK
Sbjct  128   VRGQVVGWICLVFSLCVFIAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  585   DMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL  454
             D+ IA PNVLGF+ GI+Q+VLY IY  ++   + E+K   +PE+
Sbjct  188   DINIAAPNVLGFIFGILQIVLYVIYSKKEKAILKEQK---LPEI  228



>emb|CDY05867.1| BnaC08g20440D [Brassica napus]
Length=289

 Score =   273 bits (699),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/244 (57%), Positives = 185/244 (76%), Gaps = 3/244 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M+LFD H+ W FVFG++GN++S  VFL+PVPTF R++K K+T G+QS+PYVV+LFSA LW
Sbjct  1     MSLFDTHNTWAFVFGLMGNVISFSVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GC IET+YISIFL YA K AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCFIETIYISIFLAYAPKKARMLTVKLLLLMNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KGT R  I+G ICV FSVCVFAAPLSI+  V+KT+SVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGA--VPELVINV  442
             WL YGL LKD+ +A PNV+GF LG +QM+LY +Y+  K P  + E++  A  +PE+ +++
Sbjct  181   WLLYGLALKDIYVAFPNVIGFALGALQMILYVVYKYCKTPPHLGEKEVEAAKLPEVTLDM  240

Query  441   AGLG  430
               LG
Sbjct  241   LKLG  244



>ref|XP_004235340.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
lycopersicum]
Length=295

 Score =   273 bits (699),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 149/256 (58%), Positives = 186/256 (73%), Gaps = 8/256 (3%)
 Frame = -1

Query  1119  FVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSAP  940
             FVFG+LGNIVS +V+LAPVPTF +IYK KST G+QSVPYVV LFSAMLW+YYAFLK    
Sbjct  7     FVFGLLGNIVSFMVYLAPVPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKPDTT  66

Query  939   LLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLL-VGGLYSVIVLATMFPFKGTL  763
             LLI+INS+GC I+T YI  FL YA+K A+  TMK+LL + V GL  +I+  T F  KG+ 
Sbjct  67    LLITINSVGCFIQTFYICFFLFYATKKAKMDTMKLLLSMNVVGL-GLIIFLTQFFAKGSN  125

Query  762   RVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKD  583
             R  IVGWIC+ FS CVF APL ++ +V++TKSVE+MPF LSFFLTL+AVMW  YGLL KD
Sbjct  126   RAQIVGWICLIFSFCVFVAPLGVLRQVIRTKSVEYMPFQLSFFLTLSAVMWFLYGLLRKD  185

Query  582   MCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLG---ELLHSS  412
               IA+PNVLGF LG++QM LY IY+N K  +V +E K  V E+V +   L    E+L   
Sbjct  186   YNIAIPNVLGFSLGVIQMTLYLIYKNAK--KVTKEVKLEVTEIVADDKELKLSEEILKDQ  243

Query  411   VED-SKTTAITVSDAV  367
             + D  K +AI  S+ +
Sbjct  244   IIDVVKLSAIVCSEII  259



>ref|XP_009601079.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Nicotiana 
tomentosiformis]
Length=272

 Score =   272 bits (696),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 173/221 (78%), Gaps = 1/221 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             +HP +F FG+LGNI S +VF++PVPTF  I K KS  G+QSVPYVV+LFS+MLW+YYA +
Sbjct  3     NHPLIFAFGILGNIFSFMVFISPVPTFYGIVKKKSAEGFQSVPYVVALFSSMLWIYYAMV  62

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K +  L+I+INS GC+ ET+Y++I+  YA+K AR QT++++LLL  G + +I+  T    
Sbjct  63    KTNETLIITINSFGCIAETIYVAIYFAYATKNARMQTLRLVLLLNFGGFGLILFLTQILC  122

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
             KG  R  +VGWIC+AFS+ VF APLSI+ +V++TKSVEFMPFNLS  LTL+AVMW  YGL
Sbjct  123   KGPKRAEVVGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLTLTLSAVMWFLYGL  182

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK  472
             LL+D+ + +PN+ G +LG++QMVLYGIYRN KP E AEEKK
Sbjct  183   LLRDIYVTVPNIAGIILGMLQMVLYGIYRNAKPNE-AEEKK  222



>ref|XP_004235334.1| PREDICTED: bidirectional sugar transporter SWEET12 [Solanum lycopersicum]
Length=298

 Score =   273 bits (698),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 139/226 (62%), Positives = 173/226 (77%), Gaps = 3/226 (1%)
 Frame = -1

Query  1131  HPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLK  952
             + W F FGVLGNIVS +VFL+P+PTF  IYK KST GYQS+PYVV+LFS+MLW+YYA LK
Sbjct  4     NHWAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYALLK  63

Query  951   KSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFK  772
              + PLLI+INS G  IET+Y+ ++L YA   AR  T+KML+L V G +  IVL T F FK
Sbjct  64    SNMPLLITINSFGMFIETIYVGLYLLYAPNKARVHTIKMLMLSVVGGFGAIVLITEFLFK  123

Query  771   GTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLL  592
             G +R  IVGWIC+ FS+CVF APL IV KV+KTKSVE+MP  LS FLTL+AVMW  YGLL
Sbjct  124   GVVRGQIVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLL  183

Query  591   LKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL  454
             LKD+ IA PNVLGF+ GI+Q+VLY IY  ++ + + E+K   +PE+
Sbjct  184   LKDINIAAPNVLGFIFGILQIVLYAIYSKKEKVILKEQK---LPEI  226



>ref|XP_010025273.1| PREDICTED: bidirectional sugar transporter N3-like [Eucalyptus 
grandis]
Length=291

 Score =   273 bits (698),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 169/226 (75%), Gaps = 3/226 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M     +H W+F FG+LGNIVS  VFLAPVPTF RI + KST  +QS+PY+V+LFS+MLW
Sbjct  1     MDFLAHYHLWIFAFGILGNIVSFFVFLAPVPTFYRICRNKSTEEFQSIPYLVALFSSMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFLK  + LLI+INS GCVIE +YI+I++ YA + AR  T+K+  L+  GL+S+++L
Sbjct  61    LYYAFLKGHSFLLITINSFGCVIEMVYIAIYIAYALRAARNSTIKLFALMNMGLFSLLIL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F      R  + GWIC   SV VFAAPLSIV +VV+TKSVEFMPF+LSFFLTL+A+M
Sbjct  121   ITHFIPNNDARATVFGWICTTISVSVFAAPLSIVARVVRTKSVEFMPFSLSFFLTLSAIM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEK  475
             W GYG   KD CI +PN++GF+LG+ QMV+YG YRN    EV +EK
Sbjct  181   WFGYGFFQKDWCIMIPNIVGFVLGLSQMVVYGYYRNN---EVMDEK  223



>emb|CDX68492.1| BnaC01g25700D [Brassica napus]
Length=286

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/244 (57%), Positives = 184/244 (75%), Gaps = 3/244 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M LFD H+ W FVFG++GN++S  VFL+PVPTF R++K K+T G+QS+PYVV+LFSA LW
Sbjct  1     MPLFDTHNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GC IET+YISIFL +A K AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCFIETIYISIFLAFAPKKARMLTVKLLLLMNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KG  R  I+G ICV FSVCVFAAPLSI+  V+KT+SVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLAKGITRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGA--VPELVINV  442
             WL YGL LKDM +A PNVLGF LG +QM+LY +YR  K P ++ E++  A  +PE+ +++
Sbjct  181   WLLYGLALKDMYVAFPNVLGFALGALQMILYVVYRYCKTPPQLGEKEVEAAKLPEVSLDM  240

Query  441   AGLG  430
               LG
Sbjct  241   LKLG  244



>ref|XP_004491681.1| PREDICTED: bidirectional sugar transporter N3-like [Cicer arietinum]
Length=259

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 178/227 (78%), Gaps = 0/227 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H+   F FG+LGN++S LVFLAP+ TF RIYK KST G+QS+PY+V+LFS+MLW+YYA L
Sbjct  5     HNTLAFTFGMLGNVISFLVFLAPISTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYALL  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK A LLI+INS GCVIE +YI +++ YA + AR+ T K+L  +  G  ++I+L T +  
Sbjct  65    KKDAFLLITINSFGCVIEIIYIILYIIYAPRDARKLTFKLLSAMNVGSLALILLVTQYAV  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G LRV ++GWICV+ SV VFAAPLSIV +VV+TKSVEFMPFNLSF LTL+AVMW GYGL
Sbjct  125   HGPLRVQVLGWICVSISVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAVMWFGYGL  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL  454
              LKD+CIALPNVLGF+LG++QM+LY IYRN+    + +EKK  +  L
Sbjct  185   FLKDICIALPNVLGFVLGLLQMLLYAIYRNRGEKTIQKEKKTPIEPL  231



>ref|XP_004979336.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Setaria 
italica]
Length=296

 Score =   272 bits (696),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/247 (58%), Positives = 185/247 (75%), Gaps = 6/247 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HP  F FG+LGNI+S + +LAP+PTF RIYK KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLQHPLAFAFGLLGNIISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK +  LLI+IN+ GCVIETLYI+++L YA K A+  T K+LLLL  G++ +I+L
Sbjct  61    IYYALLKSNECLLITINAAGCVIETLYIAMYLTYAPKKAKLFTAKILLLLNVGVFGLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+    G  R+ I+GW+CV FSV VF APLSI+ +VV+T+SVEFMPF+LS  LT++AV+
Sbjct  121   LTLLLSAGQNRLVILGWVCVGFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPL----EVAEEKKG--AVPELV  451
             W  YGLL+KD  +ALPNVLGF  G++QM LY +YRN  P     EVA++K+    VPE V
Sbjct  181   WFLYGLLIKDKYVALPNVLGFSFGVIQMGLYALYRNATPRVPAKEVADDKEDIIKVPEHV  240

Query  450   INVAGLG  430
             + +A LG
Sbjct  241   VTIAKLG  247



>ref|XP_008392764.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Malus 
domestica]
Length=283

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/249 (57%), Positives = 185/249 (74%), Gaps = 6/249 (2%)
 Frame = -1

Query  1101  GNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSAPLLISIN  922
             GNIVS +VFLAP+PTF R+YK KST G+QSVPYV +LFSAM+W+YYAFLK    LLI+IN
Sbjct  3     GNIVSFIVFLAPLPTFWRVYKKKSTEGFQSVPYVFALFSAMIWIYYAFLKSHVILLITIN  62

Query  921   SIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGTLRVNIVGW  742
             S GCVIET+YI+I+L YA+K AR  T+++LLL+  G + +I+L + F  +G  RV ++GW
Sbjct  63    SFGCVIETIYIAIYLTYATKHARVSTLRLLLLVNFGGFCLILLLSHFLSQGPTRVEVLGW  122

Query  741   ICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKDMCIALPN  562
             +CV FSV VFAAPLS++  V++TKSVEFMPFNLSFFLTL+AVMWL YGLLLKD+ +A PN
Sbjct  123   VCVTFSVSVFAAPLSVMRMVIRTKSVEFMPFNLSFFLTLSAVMWLCYGLLLKDLYVATPN  182

Query  561   VLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLHSSVE-DSKTTAI  385
             +LGF  G+VQM LY  YRN K   + EEK   +PE   +V    ++L ++ E + +  A 
Sbjct  183   ILGFSFGVVQMALYAKYRNTK--TIVEEK---LPEHKADVVKQIKILTTTPEVEVQVQAP  237

Query  384   TVSDAVTEE  358
               SD  + +
Sbjct  238   VTSDTNSTD  246



>ref|XP_010454652.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Camelina 
sativa]
Length=289

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 186/250 (74%), Gaps = 4/250 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MALFD H+ W FVFG+LGN++S  VFL+PVPTF RI K K+T G+QS+PYVV+LFSA LW
Sbjct  1     MALFDTHNTWAFVFGLLGNVISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++IN  GC IET+YISIF+ +A+K AR  T+K+LLL+  G +  I+L
Sbjct  61    LYYATQKKDVFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KG  R  I+G ICV FSVCVFAAPLSI+  V+KTKSVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLTKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVI  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEE--KKGAVP-ELVIN  445
             WL YGL LKD+ +A PNV+GF+LG +QM+LY +Y+  K P E+ E+  +   +P E+ I+
Sbjct  181   WLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSELVEKELETAKLPDEVSID  240

Query  444   VAGLGELLHS  415
             +  LG L+ S
Sbjct  241   MLKLGTLIAS  250



>ref|XP_008239523.1| PREDICTED: bidirectional sugar transporter N3 [Prunus mume]
Length=296

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 186/260 (72%), Gaps = 17/260 (7%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H P V  FG+LGN+VS +VFLAPVPTF RIYK KST G+QSVPYV +LFSAM+W+YYAFL
Sbjct  7     HSPLVIAFGILGNVVSFVVFLAPVPTFWRIYKKKSTEGFQSVPYVFALFSAMIWIYYAFL  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K    LLI+IN+ GC+IET+YIS+++ YA K AR   +++LLL+  G + +I+L + F  
Sbjct  67    KSDEFLLITINAFGCIIETIYISMYITYAPKQARVFALRLLLLVNFGGFCLILLLSHFLA  126

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
             +G  RV ++GW+CVAFSV VFAAPLSI+  V++TKS   MPF+LSFFLTL+AVMWL YGL
Sbjct  127   QGPTRVEVLGWVCVAFSVSVFAAPLSIMRVVIRTKS---MPFSLSFFLTLSAVMWLFYGL  183

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEK----KGAV----------PE  457
             LLKD+ +A PN+LGF  G+ QM+LY IYRN+K + V ++K    KG V          PE
Sbjct  184   LLKDLYVACPNILGFTFGVAQMILYAIYRNKKTVLVEDQKLPVHKGDVVKQIQILSTTPE  243

Query  456   LVINVAGLGELLHSSVEDSK  397
             + I V       H++ ++  
Sbjct  244   VEIQVQAAAVSSHANTDNEN  263



>ref|XP_010493487.1| PREDICTED: bidirectional sugar transporter SWEET12 [Camelina 
sativa]
Length=289

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 186/250 (74%), Gaps = 4/250 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MALFD H+ W FVFG+LGN++S  VFL+PVPTF RI K K+T G+QS+PYVV+LFSA LW
Sbjct  1     MALFDTHNTWAFVFGLLGNLISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++IN  GC IET+YISIF+ +A+K AR  T+K+LLL+  G +  I+L
Sbjct  61    LYYATQKKDVFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KG  R  I+G ICV FSVCVFAAPLSI+  V+KTKSVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLTKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVI  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEE--KKGAVP-ELVIN  445
             WL YGL LKD+ +A PNV+GF+LG +QM+LY +Y+  K P E+ E+  +   +P E+ I+
Sbjct  181   WLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSELVEKELETAKLPDEVSID  240

Query  444   VAGLGELLHS  415
             +  LG L+ S
Sbjct  241   MLKLGTLIAS  250



>ref|XP_010421173.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Camelina 
sativa]
Length=289

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 183/250 (73%), Gaps = 4/250 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MALFD H+ W FVFG+LGN++S  VFL+PVPTF RI K K+T G+QS+PYVV+LFSA LW
Sbjct  1     MALFDTHNTWAFVFGLLGNVISFAVFLSPVPTFYRICKKKTTEGFQSLPYVVALFSATLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++IN  GC IET+YISIF+ +A+K AR  T+K+LLL+  G +  I+L
Sbjct  61    LYYATQKKDVFLLVTINCFGCFIETIYISIFVAFATKKARMLTVKLLLLMNVGGFCAILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KG  R  I+G ICV FSVCVFAAPLSI+  V+KTKSVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLTKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVI  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAE---EKKGAVPELVIN  445
             WL YGL LKD+ +A PNV+GF+LG +QM+LY +Y+  K P E+ E   E      E+ I+
Sbjct  181   WLLYGLALKDIYVAFPNVIGFVLGALQMILYVVYKYCKTPSELVEKELETAKLHDEVSID  240

Query  444   VAGLGELLHS  415
             +  LG L+ S
Sbjct  241   MLKLGTLIAS  250



>ref|XP_006366912.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=276

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 173/220 (79%), Gaps = 0/220 (0%)
 Frame = -1

Query  1131  HPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLK  952
             HP VF FG+LGN+VS +VF+APVPTF RI K KS+ G+ S+PYVV LFSAMLW+YYA +K
Sbjct  8     HPLVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVK  67

Query  951   KSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFK  772
              +  LLI+INS GC+ ET+Y++I+  YA+K AR +T+ ++LLL  G++ +I+  T    +
Sbjct  68    TNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILCQ  127

Query  771   GTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLL  592
             GT R  ++GWIC+AFS+ VF APLSI+ +V++TKSVEFMPFNLS  LT++AVMW  YGLL
Sbjct  128   GTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGLL  187

Query  591   LKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK  472
             LKD+ +A+PN+ G +LG++QM+LYGIYRN K   VA EK+
Sbjct  188   LKDIYVAVPNIPGMILGVLQMILYGIYRNFKSNNVATEKE  227



>ref|XP_006347653.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=276

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 173/220 (79%), Gaps = 0/220 (0%)
 Frame = -1

Query  1131  HPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLK  952
             HP VF FG+LGN+VS +VF+APVPTF RI K KS+ G+ S+PYVV LFSAMLW+YYA +K
Sbjct  8     HPLVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVK  67

Query  951   KSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFK  772
              +  LLI+INS GC+ ET+Y++I+  YA+K AR +T+ ++LLL  G++ +I+  T    +
Sbjct  68    TNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILCQ  127

Query  771   GTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLL  592
             GT R  ++GWIC+AFS+ VF APLSI+ +V++TKSVEFMPFNLS  LT++AVMW  YGLL
Sbjct  128   GTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGLL  187

Query  591   LKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK  472
             LKD+ +A+PN+ G +LG++QM+LYGIYRN K   VA +K+
Sbjct  188   LKDVYVAVPNISGMILGVLQMILYGIYRNSKSNNVATKKE  227



>gb|KFK27668.1| hypothetical protein AALP_AA8G413300 [Arabis alpina]
Length=288

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 139/259 (54%), Positives = 191/259 (74%), Gaps = 5/259 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M +F+ H+ W FVFG+LGN++S  VFL+PVPTF RI+K K+T G+QS+PYVV+LFSAMLW
Sbjct  1     MPIFNTHNTWAFVFGMLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GC IET+YISIF+ +A+K AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCFIETIYISIFIAFANKKARMLTVKLLLLMNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KG+ R  I+G ICV FSVCVFAAPLSI+  V+KTKSVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLAKGSTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK---PLEVAEEKKGAVPELVINV  442
             W  YGL L+D+ +A PNVLGF+LG +QM+LY +Y+  K    L   E +   +PE+ I++
Sbjct  181   WFLYGLALRDIYVAFPNVLGFVLGALQMILYVVYKYCKTSSDLVEQELEAAKLPEVSIDM  240

Query  441   AGLGELLHSSVEDSKTTAI  385
               LG   H+S + ++ T +
Sbjct  241   LKLGT--HASPKPAEITVV  257



>ref|XP_004235470.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
lycopersicum]
Length=276

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 173/220 (79%), Gaps = 0/220 (0%)
 Frame = -1

Query  1131  HPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLK  952
             HP V+ FG+LGN+VS +VF+APVPTF RI K KS+ G+ S+PYVV LFSAMLW+YYA +K
Sbjct  8     HPLVYTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVK  67

Query  951   KSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFK  772
              +  LLI+INS GC+ ET+Y++I+  YA+K AR +T+ ++LLL  G++ +I+  T    +
Sbjct  68    TNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILCQ  127

Query  771   GTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLL  592
             GT R  ++GWIC+AFS+ VF APLSI+ +V++TKSVEFMPFNLS  LT++AVMW  YGLL
Sbjct  128   GTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGLL  187

Query  591   LKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK  472
             LKD+ +A+PN+ G +LG++QM+LYGIYRN K   VA EK+
Sbjct  188   LKDVYVAVPNIPGMILGVLQMILYGIYRNSKSNNVATEKE  227



>ref|XP_004235326.1| PREDICTED: bidirectional sugar transporter N3 [Solanum lycopersicum]
Length=300

 Score =   271 bits (694),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 173/229 (76%), Gaps = 4/229 (2%)
 Frame = -1

Query  1140  DLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYA  961
             D  H + F FGVLGNI+S +VFL+P+PTF  IYK KST GYQS+PYVV+LFS+MLW+YYA
Sbjct  4     DFGH-YAFAFGVLGNIISFIVFLSPIPTFYSIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  960   FLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMF  781
              LK + PLLI+INS G  IET+Y+  +L YA K AR  T+KML+L V G +  IVL T F
Sbjct  63    LLKSNMPLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLVTEF  122

Query  780   PFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGY  601
              FKG +R  IVGWIC+ FS+CVF APL IV +V+KTKSVE+MP  LS FLTL+AVMW  Y
Sbjct  123   LFKGVVRGQIVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFY  182

Query  600   GLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL  454
             GLLLKD+ IA PNVLGF+ GI+Q++LY IY  ++   + E+K   +PE+
Sbjct  183   GLLLKDINIAAPNVLGFIFGILQIILYAIYSKKEKSIIKEQK---LPEI  228



>ref|XP_006289174.1| hypothetical protein CARUB_v10002612mg [Capsella rubella]
 gb|EOA22072.1| hypothetical protein CARUB_v10002612mg [Capsella rubella]
Length=286

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 188/262 (72%), Gaps = 2/262 (1%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH    +FG+LGN VS LV +AP+PTF RIYK KST  +QS+PY VSLFS MLW+YYA +
Sbjct  7     HHLLTIIFGILGNAVSFLVLVAPLPTFYRIYKKKSTESFQSLPYQVSLFSCMLWLYYALI  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK+A LLI+INS GCV++T+YI++FL YA++  R   MK+ + +    +S+I+L T F  
Sbjct  67    KKNAFLLITINSFGCVVQTIYIAMFLAYATRDKRISAMKLFIAINVVFFSLILLVTHFVV  126

Query  774   KG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
             K  TL+V+++GWICVA SV VFAAPL IV +VVKTKSVE+MPF LSFFLT++AVMW GYG
Sbjct  127   KTPTLQVSVLGWICVAISVAVFAAPLMIVARVVKTKSVEYMPFTLSFFLTISAVMWFGYG  186

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLH  418
             L L D+CIA+PNV+GF+LG++QMVLY +YRN       E+K     + + ++  +  L  
Sbjct  187   LFLNDICIAIPNVVGFVLGMLQMVLYCVYRNASEKPEIEKKINLSEQQLKSIVVMSPLGV  246

Query  417   SSVEDSKTTAI-TVSDAVTEEK  355
             S V    T ++   SDAV  E+
Sbjct  247   SEVHPVVTASVGPPSDAVHHEE  268



>emb|CDX78511.1| BnaA03g04230D [Brassica napus]
Length=292

 Score =   271 bits (693),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 133/261 (51%), Positives = 182/261 (70%), Gaps = 1/261 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH    +FG+LGN +S  VFLAP+PTF RIYK KST  +QS+PY VSLFS MLW+YYA +
Sbjct  7     HHLLAIIFGILGNAISFCVFLAPLPTFYRIYKNKSTESFQSLPYQVSLFSCMLWLYYALI  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K+ A LLI+INS GC++ET+YI++F  YA++  R   MK+   +    +S+I++ T F  
Sbjct  67    KQDAFLLITINSFGCIVETIYIALFFAYATRDKRIAAMKLFFTINVAFFSLILMITHFAV  126

Query  774   KG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
             +  +L+V+++GWICV+ SV VFAAPL IV +V+KTKSVEFMPF LSFFLT++AVMW  YG
Sbjct  127   RSPSLQVSVIGWICVSISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYG  186

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLH  418
               L D+CIA+PNV+GF+LG++QMVLYGIYRN       E+K  +  + +  +  + +L  
Sbjct  187   AFLHDICIAIPNVVGFILGMLQMVLYGIYRNSGVKIDTEKKINSSEQQLKTIVVMSQLGV  246

Query  417   SSVEDSKTTAITVSDAVTEEK  355
             S V     T   +S+ V  E 
Sbjct  247   SEVHPVDITVDPLSETVHHED  267



>ref|XP_009796436.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=297

 Score =   271 bits (693),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 147/262 (56%), Positives = 183/262 (70%), Gaps = 8/262 (3%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W F FGVLGNIVS +VFL+P+PTF  I+K KST GYQS+PYVV+LFS+MLW+YYA LK +
Sbjct  8     WAFAFGVLGNIVSFIVFLSPLPTFYSIFKKKSTEGYQSIPYVVALFSSMLWIYYALLKTN  67

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
               LLI+INS G  IET+Y+  +L YA K A+ QT+KMLLL V G +  IVL T F FKG 
Sbjct  68    TTLLITINSFGVFIETIYVGFYLFYAPKKAKVQTVKMLLLSVVGGFGAIVLVTQFLFKGA  127

Query  765   LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLK  586
             +R  IVGWIC+ FS+CVF APL IV KV+KTKSVE+MP  LS FLTL+AVMW  YGLLLK
Sbjct  128   VRGQIVGWICLVFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  585   DMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAV--PELVI-----NVAGLGE  427
             D+ IA PNVLGF+ GI+Q+VLY IY  ++   + E+K   +  P +++     N   L E
Sbjct  188   DINIAAPNVLGFIFGILQIVLYAIYSKKEKAILKEQKLPEIQKPAVIVVDENMNSKKLPE  247

Query  426   LLHSSVED-SKTTAITVSDAVT  364
             L    + D  K   +  SD V 
Sbjct  248   LTQEQIIDIVKLGLLVCSDKVN  269



>ref|XP_006664549.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Oryza 
brachyantha]
Length=256

 Score =   270 bits (689),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 182/244 (75%), Gaps = 5/244 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGN++S   +LAP+PTF RIYK+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K +  LLI+IN+ GCVIET+YI I+L YASK A+  T K+LL L  G++ VI+L
Sbjct  61    IFYALIKSNEALLITINAAGCVIETIYIVIYLAYASKKAKVFTTKILLGLNVGVFGVILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+   KG  RV  +GW+CVAFSV VF APLSI+ +VV+T+SVE+MPF+LS  LTL+A++
Sbjct  121   LTLLLSKGENRVVSLGWVCVAFSVSVFVAPLSIIRRVVQTRSVEYMPFSLSLTLTLSAIV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAV----PELVIN  445
             W  YGLL+KD  +ALPNVLGF  G+VQM LY  Y N  P+   E K+G +    P++V+N
Sbjct  181   WFLYGLLIKDKYVALPNVLGFTFGVVQMGLYVFYMNATPV-AGEGKEGKLAAEEPQVVVN  239

Query  444   VAGL  433
             V  L
Sbjct  240   VGKL  243



>ref|NP_001237418.1| N3 protein [Glycine max]
 gb|ABT17358.1| N3 protein [Glycine max]
 gb|KHN23962.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=260

 Score =   270 bits (689),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 139/261 (53%), Positives = 191/261 (73%), Gaps = 7/261 (3%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H  W FVFG+LGN++S +VFLAP+PTF +IYK KST  +QS+PYVV+LFS+MLW+YYA +
Sbjct  5     HETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKSTEEFQSLPYVVALFSSMLWIYYALV  64

Query  954   KKSAPLL-ISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFP  778
             KK A LL I+INS GCVIET+Y++IFL YA    R  T+K+LL+L    +  ++L+T++ 
Sbjct  65    KKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYL  124

Query  777   FKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
               G+ R+ ++GWIC+ F++ VFAAPL I+ +V+KTKSVEFMPF+LSFFLT+ AVMW  YG
Sbjct  125   TTGSKRLTVIGWICLVFNISVFAAPLCIIKRVIKTKSVEFMPFSLSFFLTINAVMWFFYG  184

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLH  418
             LLLKD  +ALPN LGFL  I+QMVLY IYRN K  ++  +    + EL  +   +G+L  
Sbjct  185   LLLKDYYVALPNTLGFLFSIIQMVLYLIYRNAKTPDLPMK----LQELNSHTIDVGKL--  238

Query  417   SSVEDSKTTAITVSDAVTEEK  355
             S +E S+   +T +  +TE +
Sbjct  239   SRMEPSEPNHVTKNGTLTERE  259



>ref|XP_006363981.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=300

 Score =   271 bits (693),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 173/229 (76%), Gaps = 4/229 (2%)
 Frame = -1

Query  1140  DLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYA  961
             D  H + F FGVLGNIVS +VFL+P+PTF  IYK KST GYQS+PYVV+LFS+MLW+YYA
Sbjct  4     DFGH-YAFAFGVLGNIVSFIVFLSPIPTFYNIYKKKSTEGYQSIPYVVALFSSMLWIYYA  62

Query  960   FLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMF  781
              LK + PLLI+INS G  IET+Y+  +L YA K AR  T+KML+L V G +  IVL T F
Sbjct  63    LLKSNMPLLITINSFGMFIETIYVGFYLFYAPKKARVHTIKMLMLSVVGGFGAIVLVTEF  122

Query  780   PFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGY  601
              FKG +R  IVGW+C+ FS+CVF APL IV +V+KTKSVE+MP  LS FLTL+AVMW  Y
Sbjct  123   LFKGVVRGQIVGWVCLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFY  182

Query  600   GLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL  454
             GLLLKD+ IA PNVLGF+ GI+Q++LY IY  ++   + E+K   +PE+
Sbjct  183   GLLLKDINIAAPNVLGFIFGILQIILYAIYSKKEKSIIKEQK---LPEM  228



>gb|KHN23963.1| Bidirectional sugar transporter SWEET14 [Glycine soja]
Length=258

 Score =   269 bits (688),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 174/222 (78%), Gaps = 1/222 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H  W F+FG+LGN++S +VFLAP+PTF +IYK KST G+QS+PY+V+LFS+MLW+YYA +
Sbjct  5     HETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSTDGFQSLPYIVALFSSMLWIYYALV  64

Query  954   KKSAPLL-ISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFP  778
             KK A LL I+INS GCVIET+Y++IFL YA    R  T+K+LL+L    +  ++L+T++ 
Sbjct  65    KKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYL  124

Query  777   FKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
               G+ R++++GWIC+  ++ VFAAPL I+ +V+KTKSVEFMPF+LSFFLT+ AVMW  YG
Sbjct  125   TTGSKRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMWFFYG  184

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK  472
             LLLKD  IALPN LGFL GI+QMVLY IYRN KP  + E  K
Sbjct  185   LLLKDYYIALPNTLGFLFGIIQMVLYLIYRNAKPQGLEEPTK  226



>ref|NP_001067955.1| Os11g0508600 [Oryza sativa Japonica Group]
 sp|Q2R3P9.1|SWT14_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET14; Short=OsSWEET14 
[Oryza sativa Japonica Group]
 gb|ABA93969.1| nodulin MtN3 family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28318.1| Os11g0508600 [Oryza sativa Japonica Group]
 gb|EAZ18482.1| hypothetical protein OsJ_34008 [Oryza sativa Japonica Group]
 dbj|BAG95290.1| unnamed protein product [Oryza sativa Japonica Group]
Length=303

 Score =   271 bits (693),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 180/253 (71%), Gaps = 13/253 (5%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGNI+S + +LAP+PTF RIYK+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK    LLI+INS GCVIET+YI+++L YA K A+  T K+LLL+  G++ +I+L
Sbjct  61    IYYALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLLLLVNVGVFGLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+    G  R+ ++GW+CV FSV VF APLSI+  VV+TKSVEFMPF+LSF LT++AV+
Sbjct  121   LTLLLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEV-------------AEEKK  472
             W  YGLL+KD  +ALPNVLGF  G++QM LY +YRN  P  V              +   
Sbjct  181   WFLYGLLIKDKYVALPNVLGFSFGVIQMGLYAMYRNSTPKAVLTKEVEAATATGDDDHSA  240

Query  471   GAVPELVINVAGL  433
               V E V+N+A L
Sbjct  241   AGVKEHVVNIAKL  253



>sp|B8BKP4.1|SWT14_ORYSI RecName: Full=Bidirectional sugar transporter SWEET14; Short=OsSWEET14 
[Oryza sativa Indica Group]
 gb|EEC68230.1| hypothetical protein OsI_36230 [Oryza sativa Indica Group]
Length=303

 Score =   271 bits (692),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 180/253 (71%), Gaps = 13/253 (5%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGNI+S + +LAP+PTF RIYK+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK    LLI+INS GCVIET+YI+++L YA K A+  T K+LLL+  G++ +I+L
Sbjct  61    IYYALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMFTAKLLLLVNVGVFGLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+    G  R+ ++GW+CV FSV VF APLSI+  VV+TKSVEFMPF+LSF LT++AV+
Sbjct  121   LTLLLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRTKSVEFMPFSLSFSLTISAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEV-------------AEEKK  472
             W  YGLL+KD  +ALPNVLGF  G++QM LY +YRN  P  V              +   
Sbjct  181   WFLYGLLIKDKYVALPNVLGFSFGVIQMGLYAMYRNSTPKAVLTKEVEAATATGDDDHSA  240

Query  471   GAVPELVINVAGL  433
               V E V+N+A L
Sbjct  241   AGVKEHVVNIAKL  253



>gb|EMT20480.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=287

 Score =   270 bits (690),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 178/241 (74%), Gaps = 0/241 (0%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M    L HPW F FG+LGN++S + +LAP+PTF RIY++KST G+QSVPYVV+LFSAMLW
Sbjct  1     MGGLSLQHPWAFAFGLLGNVISFMTYLAPLPTFYRIYRSKSTQGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK    LLI+INS GC+IET+YI ++L YA K A+  T K+LLLL  G++ +I+L
Sbjct  61    IYYALLKSDELLLITINSAGCIIETIYIVMYLAYAPKQAKIFTAKILLLLNVGVFGLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+    G  RV ++GW+CV FSV VF APLSI+  VV+T+SVEFMPF+LS  LT++AV+
Sbjct  121   LTLLLAGGEKRVVMLGWVCVGFSVSVFVAPLSIIRLVVRTRSVEFMPFSLSLSLTVSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W  YGLL+KD  +ALPN+LGF  G++QM LY IY N  P    +E    +PE VINVA L
Sbjct  181   WFLYGLLIKDKYVALPNILGFAFGVIQMGLYAIYCNATPTLAPKEVDRPLPEHVINVAKL  240

Query  432   G  430
             G
Sbjct  241   G  241



>ref|XP_006366913.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=357

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 172/220 (78%), Gaps = 0/220 (0%)
 Frame = -1

Query  1131  HPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLK  952
             HP VF FG+LGN+VS +VF+APVPTF RI K KS+ G+ S+PYVV LFSAMLW+YYA +K
Sbjct  8     HPLVFTFGILGNLVSFMVFIAPVPTFYRIVKKKSSEGFHSLPYVVGLFSAMLWIYYAMVK  67

Query  951   KSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFK  772
              +  LLI+INS GC+ ET+Y++I+  YA+K AR +T+ ++LLL  G++ +I+  T    +
Sbjct  68    TNVTLLITINSFGCIAETIYVAIYFTYATKKARMKTLGLVLLLNFGVFGLILFLTQILCQ  127

Query  771   GTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLL  592
             GT R  ++GWIC+AFS+ VF APLSI+ +V++TKSVEFMPFNLS  LT++AVMW  YGLL
Sbjct  128   GTKRAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLALTVSAVMWFLYGLL  187

Query  591   LKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK  472
             LKD  +A+PN+ G +LG++QM+LYGIYRN K   VA EK+
Sbjct  188   LKDFYVAVPNISGMILGVLQMILYGIYRNSKSNNVATEKE  227



>ref|XP_003615405.1| Protein RUPTURED POLLEN GRAIN [Medicago truncatula]
 gb|AES98363.1| bidirectional sugar transporter [Medicago truncatula]
Length=269

 Score =   269 bits (688),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 171/219 (78%), Gaps = 0/219 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H    F+FG+LGNI+S +V+LAP+PTF RI+K KST G+QS+PY+V+LFS+MLW+YY F+
Sbjct  6     HDRLAFIFGILGNIISSMVYLAPLPTFYRIWKKKSTEGFQSLPYLVALFSSMLWLYYGFV  65

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK A LLI+INS GCVIET+YI  +L YA+K AR  T+K+ + +      +IVL T    
Sbjct  66    KKHAFLLITINSAGCVIETIYIVTYLIYATKDARILTIKLFMAMNVACSVLIVLTTQLAM  125

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G LRV+++GWIC +F++CVFAAPL+I+ KV++TKSVEFMP NLSFFLTL+A++W  YGL
Sbjct  126   HGKLRVHVLGWICTSFAICVFAAPLTIMAKVIRTKSVEFMPINLSFFLTLSAIVWFFYGL  185

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEE  478
             LL D+CIA+PNVLGF+LG++QM+LY IY      E A E
Sbjct  186   LLHDICIAIPNVLGFILGLLQMLLYAIYNKSVKEEYALE  224



>ref|XP_006347634.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
tuberosum]
Length=296

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 173/230 (75%), Gaps = 4/230 (2%)
 Frame = -1

Query  1143  FDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYY  964
             F   H W FVFGVLGNIVS +VFL+P+PTF  IYK K+  GYQS+PYVV+LFS+MLW+YY
Sbjct  3     FSADH-WAFVFGVLGNIVSFIVFLSPLPTFYTIYKKKTAEGYQSIPYVVALFSSMLWIYY  61

Query  963   AFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATM  784
             AFLK +  LLI+IN+ G  IET+Y+  +L YA K +R QT+KML L V G +  I+L T 
Sbjct  62    AFLKTNTTLLITINTFGVFIETIYVGFYLFYAPKKSRVQTIKMLSLFVVGGFGAIILVTE  121

Query  783   FPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLG  604
             F FKG +R  +VGWIC+ FS+CVF APL IV KV+KTKSVE+MP  LS FLTL+AVMW  
Sbjct  122   FLFKGAIRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFF  181

Query  603   YGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL  454
             YGLLLKD+ IA PN+LGF+ GI+QM+LY IY  ++   + E+K   +PE+
Sbjct  182   YGLLLKDINIAAPNILGFIFGILQMILYVIYSKKEKAILKEQK---LPEI  228



>ref|XP_004297512.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Fragaria 
vesca subsp. vesca]
Length=292

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 171/220 (78%), Gaps = 0/220 (0%)
 Frame = -1

Query  1137  LHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAF  958
             +HHP    FG+LGNI+S +VFLAP+PTF +IYK K+T G+Q++PY V+LFS MLW+YYA 
Sbjct  3     IHHPLTLAFGLLGNIISFMVFLAPMPTFYKIYKKKTTEGFQALPYAVALFSCMLWIYYAL  62

Query  957   LKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFP  778
             LK+ A  LI+INS+GCVIET+Y++IFL Y+ K AR  T+K LLLL    Y ++++ T+F 
Sbjct  63    LKQDATFLITINSVGCVIETVYLAIFLFYSPKKARISTVKFLLLLNVLGYGLMLVLTLFL  122

Query  777   FKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
              KG +R+ +VGWIC+ F++ VFAAPL I+ KV++TKSVEFMPF LSFFLTL AVMW  YG
Sbjct  123   AKGEIRLKVVGWICLVFNLTVFAAPLCILKKVIRTKSVEFMPFPLSFFLTLGAVMWFFYG  182

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEE  478
              LLKD  IA PN+LGF+ GI QMVLY +Y+N K + + EE
Sbjct  183   FLLKDYNIAFPNILGFMFGIAQMVLYIVYKNAKKVVLLEE  222



>ref|XP_009765830.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
sylvestris]
Length=278

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/268 (53%), Positives = 188/268 (70%), Gaps = 3/268 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F   H   FVFGVLGN VS LV+L+P+PTF RIYK KST G+QS+PY V+LFSAML+
Sbjct  1     MAIFTASH-LAFVFGVLGNGVSFLVYLSPIPTFYRIYKRKSTEGFQSIPYSVALFSAMLY  59

Query  972   MYYAFLK-KSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             +YYA+LK K+  LLI+INS G  IE +Y++IFL YA++ A+  T K++LLL  G +  IV
Sbjct  60    LYYAYLKEKNGILLITINSFGTAIEFIYLTIFLMYATREAKIYTTKLVLLLNIGSFGAIV  119

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
               T    K   RV IVGWIC  FSVCVFAAPLSI+ +V+KT+SVEFMPF LSFFLT+ AV
Sbjct  120   ALTYIFAKDKTRVTIVGWICAVFSVCVFAAPLSIMRRVIKTRSVEFMPFPLSFFLTICAV  179

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGAVPELVINVA  439
             MW  YGLL+KDM IA PN+LGF  GI QM+LY I+RN+K  ++ A+     + ++VI++ 
Sbjct  180   MWFFYGLLIKDMYIATPNILGFTFGIAQMILYAIFRNRKQQIQPADSNLKDLTQVVIDMK  239

Query  438   GLGELLHSSVEDSKTTAITVSDAVTEEK  355
              +   +  + + +K   +  +D     K
Sbjct  240   AMVLEMQENSDPNKEAEVDDTDEKKTNK  267



>ref|XP_003576225.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Brachypodium 
distachyon]
Length=292

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/262 (54%), Positives = 190/262 (73%), Gaps = 7/262 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGN++S + +LAP+PTFIRIYK+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLEHPWAFAFGLLGNVISFMSYLAPIPTFIRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA +K +  LLI+IN+ GCVIET+Y+ ++  YA + A+  T K++LLL GG++ VI+ 
Sbjct  61    IYYALVKSNESLLITINAAGCVIETIYVVMYFVYAPRKAKLFTAKIMLLLNGGVFGVILF  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+F   G  RV  +GWICVAFSV VF APLSI+ +V+KT+SVE+MPF+LS  LTL+AV+
Sbjct  121   CTLFLAHGEKRVVSLGWICVAFSVSVFVAPLSIIGRVIKTRSVEYMPFSLSLSLTLSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVP----ELVIN  445
             W  YGLL+KD  +ALPN+LGF  G+VQM LY  Y N+ P+   + K+G +P     +V+N
Sbjct  181   WFLYGLLIKDKYVALPNILGFSFGVVQMALYMFYMNKTPIVRGDGKEGKLPAAEEHVVVN  240

Query  444   VAGLGELLHSSVEDSKTTAITV  379
             +A LG     +  D+K     V
Sbjct  241   MAKLG---GGATPDNKNCGSEV  259



>ref|XP_009121791.1| PREDICTED: LOW QUALITY PROTEIN: bidirectional sugar transporter 
SWEET15 [Brassica rapa]
Length=298

 Score =   270 bits (690),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 135/227 (59%), Positives = 171/227 (75%), Gaps = 3/227 (1%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH    VFG+LGN +S LVFLAPVPTF RIYK KST  +QS+PY VSLFS M+ +YYA  
Sbjct  7     HHLLAIVFGILGNAISFLVFLAPVPTFYRIYKKKSTESFQSLPYQVSLFSCMIXLYYALT  66

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K+ A LLI+INS GCV+ET+YI++F  YA+K  R   MK+ L +    +S+I++ T F  
Sbjct  67    KQHAFLLITINSFGCVVETIYIAMFFTYATKDKRIAAMKLFLTINVAFFSLILMVTHFAV  126

Query  774   KG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
             K  +L+V+++GWICVA SV VFAAPL IV +V+KTKSVEFMPF LSFFLT++AVMW  YG
Sbjct  127   KRPSLQVSVLGWICVAISVSVFAAPLMIVARVIKTKSVEFMPFTLSFFLTISAVMWFAYG  186

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPE  457
             L L D+CIA+PNV+GF+LG+VQM+LYGIYRN  P E  + +K   P 
Sbjct  187   LFLHDICIAIPNVVGFILGMVQMLLYGIYRN--PGEKLDTEKKMNPS  231



>ref|XP_006493253.1| PREDICTED: bidirectional sugar transporter SWEET13-like isoform 
X2 [Citrus sinensis]
Length=285

 Score =   269 bits (688),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 146/268 (54%), Positives = 193/268 (72%), Gaps = 3/268 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M +F  H P VF FG+LGNIVS +VFLAP+PTF R+ K KST G+QS+PYVV+LFSAMLW
Sbjct  1     MTMFSTHDPSVFAFGLLGNIVSFIVFLAPMPTFYRVCKKKSTEGFQSLPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA +KK A LLI+IN+ GCVIET+Y+++++ +A K AR  T+++LLLL  G +  I+L
Sbjct  61    IYYAMMKKDAFLLITINAFGCVIETIYLALYITFAPKQARLYTLRLLLLLNFGGFGSILL  120

Query  792   ATMFPFKGT-LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
              + F  KG+  R+ ++GWICV FSV VFAAPLSI+  VV+TKSVEFMPF LS FLTL AV
Sbjct  121   LSHFLAKGSAARLRLLGWICVVFSVSVFAAPLSIMRLVVRTKSVEFMPFYLSLFLTLNAV  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAG  436
             MW  YGL LKD+ +A+PNVLGF+ G+VQM+LY IYRN + + V +  K  VPE  ++V  
Sbjct  181   MWFFYGLFLKDVYVAVPNVLGFIFGVVQMILYAIYRNYRRVVVEDVNK--VPEHTVDVVK  238

Query  435   LGELLHSSVEDSKTTAITVSDAVTEEKA  352
             L     ++ E+   +     D    E+A
Sbjct  239   LSTNNMTASEEQTNSRNNFDDKNEHEQA  266



>ref|XP_010025272.1| PREDICTED: bidirectional sugar transporter N3-like [Eucalyptus 
grandis]
Length=288

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 179/240 (75%), Gaps = 8/240 (3%)
 Frame = -1

Query  1122  VFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSA  943
             +F+FG+LGNIVSL VF APVPTF RIYK KST G+QS+PY+V+LFS+MLW+YYAFLK  +
Sbjct  5     IFIFGILGNIVSLFVFFAPVPTFYRIYKEKSTEGFQSIPYLVALFSSMLWLYYAFLKGHS  64

Query  942   PLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGTL  763
              LLI+INS GCVIE +YI+I++ YA + A+  T+K+  L+  GL+S+++L   F      
Sbjct  65    FLLITINSFGCVIEMVYIAIYIAYALRAAKSSTIKLFALMNVGLFSLLILIMHFIPNDDA  124

Query  762   RVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKD  583
             R  + GWIC   SV VFAAPL IV +VV+TKSVEFMPF+LSFFLTL+AVMW GYG   KD
Sbjct  125   RTTVFGWICTTISVSVFAAPLGIVARVVRTKSVEFMPFSLSFFLTLSAVMWFGYGFFQKD  184

Query  582   MCIALPNVLGFLLGIVQMVLYGIYRNQKPL----EVAEEKKGAVPELVIN-VAGLGELLH  418
              CI +PN++GF+LG+ QMVLYG YRN+  +    E+ +EK   +P+ V++  +G   ++H
Sbjct  185   WCIMIPNIVGFVLGLSQMVLYGYYRNKGVIIIKDEIMDEK---LPQHVVHPPSGRASVVH  241



>ref|XP_004161952.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=294

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/268 (53%), Positives = 189/268 (71%), Gaps = 5/268 (2%)
 Frame = -1

Query  1152  MAL-FDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAML  976
             MAL F+ H+P  F FG+LGNI+S +VFLAPVPTF+RIYK KST G+QS+PYVV+LFSAML
Sbjct  1     MALSFNTHNPAAFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAML  60

Query  975   WMYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             W+YYA    +  LLI+INS+GC+IET+Y++IF+ +A K  R  T++ +LLL  G + +I+
Sbjct  61    WLYYASFNPNETLLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIIL  120

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             L T F   G+ RV +VGWICVAFS+ VFAAPL+I+  V++TKSVEFMPF LSFFLTL+A 
Sbjct  121   LVTHFLVHGSNRVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSAT  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAG  436
              WL YG+ LKD+ IA+PN+ GF+ GI QM+LY IY+ ++     +  + +    VI  A 
Sbjct  181   SWLLYGVFLKDIYIAVPNIPGFMFGIAQMILYLIYKKRETAMEMQLPQHSTDNTVIVSAA  240

Query  435   LG---ELLH-SSVEDSKTTAITVSDAVT  364
                  +  H SS+  +      V D VT
Sbjct  241   TNSDKQKQHSSSLPSNNLVGAAVDDDVT  268



>ref|XP_002442119.1| hypothetical protein SORBIDRAFT_08g014040 [Sorghum bicolor]
 gb|EES15957.1| hypothetical protein SORBIDRAFT_08g014040 [Sorghum bicolor]
Length=302

 Score =   270 bits (689),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 177/230 (77%), Gaps = 0/230 (0%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGN++S L FLAP+PTF RIYK+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLQHPWAFAFGLLGNVISFLTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K +   LI+IN+ GCVIET+YI ++  YA K A+  T K++LLL  G++ VI+L
Sbjct  61    IFYALIKSNETFLITINAAGCVIETIYIVMYFVYAPKKAKLFTAKIMLLLNVGVFGVILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+  FKG  RV ++GWICV FSV VF APLSI+ +V++TKSVE+MPF+LS  LTL+AV+
Sbjct  121   VTLLLFKGDKRVVMLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAV  463
             W  YGLL+KD  +ALPN+LGF  G+VQMVLY +Y N+ P+ VAE K   V
Sbjct  181   WFLYGLLIKDKYVALPNILGFTFGVVQMVLYVLYMNKTPVAVAEGKDAGV  230



>ref|XP_006404221.1| hypothetical protein EUTSA_v10010591mg [Eutrema salsugineum]
 gb|ESQ45674.1| hypothetical protein EUTSA_v10010591mg [Eutrema salsugineum]
Length=291

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/266 (52%), Positives = 193/266 (73%), Gaps = 5/266 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M LFD H+ W FVFG++GN++S  VFL+PVPTF R++K K+T G+QS+PYVV+LFSA LW
Sbjct  1     MPLFDTHNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++IN+ GC IET+YIS++L YA K A+  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINAFGCFIETIYISMYLAYAPKTAKMLTVKLLLLMNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F FKG  R  I+G ICV FSVCVFAAPLSI+  V+KT+SVE+MPF+LS  LT++AV+
Sbjct  121   ICQFLFKGPTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVI  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGA--VPELVINV  442
             WL YGL LKD  +A PNV+GF+LG +QM+LY +Y+  K P  + E++  A  +PE+ +++
Sbjct  181   WLLYGLALKDFYVAFPNVIGFVLGALQMILYVVYKYCKTPPHLGEKEVEAAKLPEVSLDM  240

Query  441   AGLGELLHSSVEDSKTTAITVSDAVT  364
               LG +  SS E +    +  ++  T
Sbjct  241   LKLGTI--SSPEPAPIAVVRQANKCT  264



>ref|XP_009599477.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Nicotiana 
tomentosiformis]
Length=282

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 144/264 (55%), Positives = 183/264 (69%), Gaps = 19/264 (7%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W F FGVLGNIVS +VFL+P+PTF +IYK KST GYQS+PYV++LFS+MLW+YYAFLK +
Sbjct  7     WAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYYAFLKTN  66

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
               LLI+INS G  IET+Y+  +L YA K AR QT+KMLLL V   +  I+L   F FKG 
Sbjct  67    TTLLITINSFGVFIETIYVGFYLFYAPKKARVQTVKMLLLTVVAGFGAIILIAQFLFKGV  126

Query  765   LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLK  586
              R  +VGW+C+ FS+CVF APL IV KV+KTKSVEFMP  LS FLTL+AVMW  YGLLLK
Sbjct  127   ARGQVVGWVCLVFSLCVFVAPLCIVRKVIKTKSVEFMPLLLSVFLTLSAVMWFFYGLLLK  186

Query  585   DMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEK--------------KGAVPELV-  451
             D+ IA PN+LG + GI+Q+VLY IY N+K   + +E+                 +PEL  
Sbjct  187   DINIAAPNILGLIFGILQIVLYVIY-NKKEKHILKEQNLPELQNHVIILDDNKKLPELTE  245

Query  450   ---INVAGLGELLHSSVEDSKTTA  388
                I++  LG+L+ S  E++   A
Sbjct  246   EHKIDILKLGKLVSSLHENACAAA  269



>ref|XP_006394628.1| hypothetical protein EUTSA_v10004719mg [Eutrema salsugineum]
 gb|ESQ31914.1| hypothetical protein EUTSA_v10004719mg [Eutrema salsugineum]
Length=288

 Score =   269 bits (687),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 143/270 (53%), Positives = 199/270 (74%), Gaps = 6/270 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F+  + W F FG+LGN++S  VFL+PVPTF RI+K K+T G+QS+PYVV+LFSAMLW
Sbjct  1     MAIFNTQNTWAFAFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSLPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GC IET+YI+IF+ +A K AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCFIETIYIAIFVAFAPKKARMFTVKLLLLMNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KGT R  I+G ICV FSVCVFAAPLSI+  V+KTKSVE+MPF+LS  LTL+AV+
Sbjct  121   LCQFLAKGTTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSVSLTLSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGA--VPELVINV  442
             WL YGL LKD+ +A PNV+GF+LG +QM+LY +++  K P ++ E++  A  +PE+ I++
Sbjct  181   WLLYGLALKDIYVAFPNVIGFVLGALQMILYVVFKYCKTPSDLMEKELEAAKLPEVSIDM  240

Query  441   AGLGELLHSSVEDSKTTAI-TVSDAVTEEK  355
               LG L  +S E +  T + +V+  V  ++
Sbjct  241   LKLGTL--ASPEPAAITVVRSVNTCVCNDR  268



>ref|XP_010027260.1| PREDICTED: bidirectional sugar transporter N3-like [Eucalyptus 
grandis]
Length=285

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 133/256 (52%), Positives = 181/256 (71%), Gaps = 2/256 (1%)
 Frame = -1

Query  1122  VFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSA  943
             +F+FG+LGNIVS  VFLAP+PTF RIY+ KST  +QS+PY+V+LFS+MLW+YYAFLK  +
Sbjct  5     IFIFGILGNIVSFFVFLAPMPTFYRIYRNKSTEEFQSIPYLVALFSSMLWLYYAFLKGHS  64

Query  942   PLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGTL  763
              LLI+INS GCVIE +YI+I++ YA   AR  T+K+  L+  GL+S+++L T F      
Sbjct  65    FLLITINSFGCVIEMVYIAIYIAYALTAARNSTIKLFALMNMGLFSLLILITHFIPNDDA  124

Query  762   RVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKD  583
             R  + GWIC   SV VFAAPLSIV +VV+TKSVEFMPF+LSFFLTL+A+MW GYG   KD
Sbjct  125   RAMVFGWICTTISVSVFAAPLSIVARVVRTKSVEFMPFSLSFFLTLSAIMWFGYGFFQKD  184

Query  582   MCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLHSSVED  403
              CI +PN +GF+LG+ QMV+YG YRN + ++    +  A+  +   + G+ E+    V D
Sbjct  185   WCIMIPNTVGFVLGLSQMVVYGYYRNNEVMDEKLPQHVAITVVRPPLGGVSEV--RPVTD  242

Query  402   SKTTAITVSDAVTEEK  355
               +  I   +A  +E+
Sbjct  243   EISPPIDRGEARADEQ  258



>ref|XP_004235333.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Solanum 
lycopersicum]
Length=296

 Score =   269 bits (687),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 186/263 (71%), Gaps = 12/263 (5%)
 Frame = -1

Query  1143  FDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYY  964
             F   H W FVFGVLGNIVS +VFL+P+PTF  IYK K+  GYQS+PYVV+LFS+MLW+YY
Sbjct  3     FSADH-WAFVFGVLGNIVSFIVFLSPLPTFYTIYKKKTAEGYQSIPYVVALFSSMLWIYY  61

Query  963   AFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATM  784
             AFLK +  LLI+IN+ G  +ET+Y+  +L YA K +R QT+KML L V G +  I+L T 
Sbjct  62    AFLKTNTTLLITINTFGVFVETIYVVFYLIYAPKKSRVQTIKMLSLFVVGGFGAIILVTQ  121

Query  783   FPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLG  604
             F FKG +R  +VGWIC+ FS+CVF APL IV KV+KTKSVE+MP  LS FLTL+AVMW  
Sbjct  122   FLFKGVIRGQVVGWICLIFSLCVFVAPLGIVRKVIKTKSVEYMPLLLSVFLTLSAVMWFF  181

Query  603   YGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGEL  424
             YGLLLKD+ IA PN+LGF+ G++QM+LY IY  ++   + E+K   +PE+       GE+
Sbjct  182   YGLLLKDINIAAPNILGFIFGVLQMILYVIYSKKEKAILKEQK---LPEI-----QKGEV  233

Query  423   LHSSVEDSKTTAITVSDAVTEEK  355
             +   V+D    A      +T+E+
Sbjct  234   I---VKDENMNADKKFPELTQEQ  253



>ref|XP_010027261.1| PREDICTED: bidirectional sugar transporter N3-like [Eucalyptus 
grandis]
Length=282

 Score =   268 bits (685),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 131/229 (57%), Positives = 166/229 (72%), Gaps = 7/229 (3%)
 Frame = -1

Query  1122  VFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSA  943
             +F+FG+LGNIVS  VFLAPVPTF RIYK KST  +QS+PY+V+LFS+MLW+YYAFLK  +
Sbjct  5     IFIFGILGNIVSFFVFLAPVPTFYRIYKNKSTEEFQSIPYLVALFSSMLWLYYAFLKGHS  64

Query  942   PLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGTL  763
              LLI+INS GCVIE +YI+I++ YA   AR  T+K+  L+  GL+ +++L T F      
Sbjct  65    FLLITINSFGCVIEMVYIAIYIAYALGAARNSTIKLFALMNMGLFPLLILITHFIPNDDA  124

Query  762   RVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKD  583
             R  + GWIC   SV VFAAPLSIV +VV+TKSVEFMPF+LSFFLTL+A+MW GYG   KD
Sbjct  125   RATVFGWICTTISVSVFAAPLSIVARVVRTKSVEFMPFSLSFFLTLSAIMWFGYGFFQKD  184

Query  582   MCIALPNVLGFLLGIVQMVLYGIYRN-------QKPLEVAEEKKGAVPE  457
              CI +PN++GF+LG+ QMVLYG YRN       Q P ++       V E
Sbjct  185   WCIMIPNIVGFVLGLSQMVLYGYYRNIVDTKPPQDPAKIIAHPSSGVSE  233



>ref|XP_009385515.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=282

 Score =   268 bits (685),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 139/270 (51%), Positives = 183/270 (68%), Gaps = 6/270 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L  P  F+FG+LGNI+S +VFL+P+PTF RIY+ KST G+QSVPYVV+L S ML 
Sbjct  1     MAGLSLEQPLPFIFGILGNIISFMVFLSPLPTFYRIYRKKSTEGFQSVPYVVALSSCMLL  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA +K +A LLI+INS GC IET YI+I+L YA+K AR   +++ +LL    ++ IVL
Sbjct  61    IYYALVKTNAVLLITINSFGCFIETAYITIYLIYATKKARIFCIQIFVLLNVVAFAAIVL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T   F G  RV +VGWICV FS+CVFAAPLSI+  V++TKSVEFMPF LSFFLTL A+ 
Sbjct  121   LTRLAFTGPDRVTVVGWICVGFSLCVFAAPLSIIRLVIRTKSVEFMPFYLSFFLTLNAIA  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W GYG   KD+ + LPNVLGF+ G+VQMV+Y +Y+N       +    AVPE  + +A L
Sbjct  181   WFGYGFFTKDLYVELPNVLGFVFGVVQMVVYMLYKNNN--NKKDAAVAAVPEHRVKIAEL  238

Query  432   GEL----LHSSVEDSKTTAITVSDAVTEEK  355
                    L  S+E+      ++ D+   +K
Sbjct  239   SSAPASELQVSLEEKDQNKRSMEDSQDTDK  268



>ref|XP_010556111.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Tarenaya 
hassleriana]
Length=307

 Score =   269 bits (687),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 133/242 (55%), Positives = 179/242 (74%), Gaps = 1/242 (0%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+    H     FG+LGN +S LVFLAPVPTF RIYK KST  ++S+PY VSLFS MLW
Sbjct  1     MAVMINQHLLAVTFGILGNAISFLVFLAPVPTFYRIYKKKSTESFRSLPYQVSLFSCMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK++A LLI+INS GCV+ET YI++F+ YA+K  R   MK+ + +    +S+I++
Sbjct  61    LYYALLKQNAFLLITINSFGCVVETFYIAMFIAYAAKDKRISAMKLFMAMNVTFFSLILI  120

Query  792   ATMFPFKGT-LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
              T F  K +  ++ I+GWICVA SV VFAAPLS+V +V++TKSVEFMPF LSFFLT++AV
Sbjct  121   VTHFLVKNSSHQIVILGWICVAISVSVFAAPLSVVARVIRTKSVEFMPFTLSFFLTISAV  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAG  436
             MW  YGL L D+CIA+PNVLGF LG+VQM+LYGIYRN +   + ++ +    + ++ ++ 
Sbjct  181   MWFAYGLFLHDICIAIPNVLGFALGMVQMILYGIYRNSEKSNLEKKIQDHQLKTIVVLSP  240

Query  435   LG  430
             LG
Sbjct  241   LG  242



>ref|XP_009412768.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=284

 Score =   268 bits (684),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 186/265 (70%), Gaps = 8/265 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HP  F FG+LGN++S +VFLAP+PTF R+Y+ KST G+ SVPYVV+LFS MLW
Sbjct  1     MAGLSLQHPLPFAFGMLGNLISFMVFLAPIPTFYRVYRKKSTEGFHSVPYVVALFSCMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAF+K ++ LLI+INS G  IET+YI+I+L YA K AR   +++ +LL    ++ IVL
Sbjct  61    IYYAFVKTNSMLLITINSFGLFIETIYITIYLIYAPKKARIFCIQIFVLLDVVAFAAIVL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T   FKG+ RV ++GWICV FS+ VFAAPLS++  V++TKSVEFMPF LSFFLTL+A+ 
Sbjct  121   LTQLVFKGSNRVTVLGWICVGFSISVFAAPLSVIRLVIRTKSVEFMPFFLSFFLTLSAIA  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W GYGL  KD+ + LPNVLGF+ GI QM+LY IY+ +K + V    +  VPE ++ +A L
Sbjct  181   WFGYGLFTKDIYVQLPNVLGFVFGIAQMLLYIIYKKKKNVVV----EPTVPEHILKIAEL  236

Query  432   ----GELLHSSVEDSKTTAITVSDA  370
                    L  S+E++        DA
Sbjct  237   ITTPASELQVSIEENDRKKKANEDA  261



>ref|XP_004153501.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
 gb|KGN64433.1| hypothetical protein Csa_1G051710 [Cucumis sativus]
Length=295

 Score =   268 bits (685),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 133/236 (56%), Positives = 179/236 (76%), Gaps = 1/236 (0%)
 Frame = -1

Query  1152  MAL-FDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAML  976
             MAL F+ H+P  F FG+LGNI+S +VFLAPVPTF+RIYK KST G+QS+PYVV+LFSAML
Sbjct  1     MALSFNTHNPAAFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAML  60

Query  975   WMYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             W+YYA    +  LLI+INS+GC+IET+Y++IF+ +A K  R  T++ +LLL  G + +I+
Sbjct  61    WLYYASFNPNETLLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIIL  120

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             L T F   G+ RV +VGWICVAFS+ VFAAPL+I+  V++TKSVEFMPF LSFFLTL+A 
Sbjct  121   LVTHFLVHGSNRVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSAT  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVI  448
              WL YG+ LKD+ IA+PN+ GF+ GI QM+LY IY+ ++     +  + +   +VI
Sbjct  181   SWLLYGVFLKDIYIAVPNIPGFMFGIAQMILYLIYKKRETAMEMQLPQHSTDNIVI  236



>ref|XP_007139099.1| hypothetical protein PHAVU_008G001100g [Phaseolus vulgaris]
 gb|ESW11093.1| hypothetical protein PHAVU_008G001100g [Phaseolus vulgaris]
Length=270

 Score =   267 bits (682),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 146/263 (56%), Positives = 190/263 (72%), Gaps = 4/263 (2%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH   F FG+LGN++S LVFLAPVPTF RIYK KST  +QS+PY+V+LFS+MLW+YYA+L
Sbjct  5     HHTLAFTFGMLGNVISFLVFLAPVPTFYRIYKKKSTESFQSLPYLVALFSSMLWLYYAWL  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK A LLI+IN  GCVIE +YI +++ YA++ AR  T+K+   +  G +++I++ T F  
Sbjct  65    KKDAVLLITINLFGCVIEIIYIILYIIYATRDARNLTIKLFSAMNLGSFALILVVTNFIV  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G LRV ++GWICV+ SV VFAAPLSIV +VV+TKSVEFMPFNLSF LTL+A+MW GYGL
Sbjct  125   HGPLRVQVLGWICVSVSVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVA---GLGEL  424
              LKD+CIALPNVLGF+LG++QM+LY IYR         EK    P   I VA   G GE+
Sbjct  185   FLKDICIALPNVLGFVLGLLQMLLYTIYRKGNKKGNTMEKNPQEPLKNIVVASPMGTGEV  244

Query  423   LH-SSVEDSKTTAITVSDAVTEE  358
                   E++K + +   +  +EE
Sbjct  245   FPVEEDEEAKKSQVEREEKKSEE  267



>gb|KEH21448.1| bidirectional sugar transporter [Medicago truncatula]
Length=268

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/210 (63%), Positives = 170/210 (81%), Gaps = 0/210 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H+   F FG+LGN++S LVFLAP+ TF RIYK KST G+QS+PY+V+LFS+MLW+YYA L
Sbjct  5     HNTLAFTFGMLGNVISFLVFLAPISTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYALL  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK A LLI+INS GCV+ET+YI +++ YA + AR  T K+L  +  G +++I++ T +  
Sbjct  65    KKDAFLLITINSFGCVVETIYIILYIIYAPRDARNLTFKLLSAMNVGSFALILIVTNYAV  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G LRV ++GW+CV+ SV VFAAPLSIV +VV+TKSVEFMPFNLSF LTL+A MW GYGL
Sbjct  125   HGPLRVQVLGWVCVSLSVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSATMWFGYGL  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRN  505
              LKD+CIALPNVLGF+LG++QM+LY IYRN
Sbjct  185   FLKDICIALPNVLGFVLGLLQMLLYAIYRN  214



>ref|XP_002443167.1| hypothetical protein SORBIDRAFT_08g013840 [Sorghum bicolor]
 gb|EES17005.1| hypothetical protein SORBIDRAFT_08g013840 [Sorghum bicolor]
Length=302

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/280 (52%), Positives = 195/280 (70%), Gaps = 14/280 (5%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGN++S L FLAP+PTF RIYK KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLQHPWAFAFGLLGNLISFLTFLAPIPTFYRIYKTKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K +   LI+IN+ GCVIET+YI ++  YA K A+  T K++LLL  G++ VI+L
Sbjct  61    IFYALIKSNETFLITINAAGCVIETIYIVMYFVYAPKKAKLFTAKIMLLLNVGVFGVILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+  FKG  RV ++GWICV FSV VF APLSI+ +V++TKS+E+MPF+LS  LTL+AV+
Sbjct  121   VTLLLFKGDKRVVMLGWICVGFSVSVFVAPLSIMRRVIQTKSMEYMPFSLSLSLTLSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK--GAVP-----EL  454
             W  YGLL+KD  +ALPN+LGF  G+VQMVLY +Y N+ P+ VAE K   G +P      +
Sbjct  181   WFLYGLLIKDKYVALPNILGFTFGMVQMVLYVLYMNKTPVAVAEGKDAGGKLPSAGDKHV  240

Query  453   VINVAGLGELL-------HSSVEDSKTTAITVSDAVTEEK  355
             ++N+A L   L       H + + S   A + +   T  K
Sbjct  241   LVNIAKLSPALPERSSGVHRATQMSAVPAKSCAAEATAPK  280



>dbj|BAJ85621.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   267 bits (683),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/272 (52%), Positives = 186/272 (68%), Gaps = 5/272 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   + HPW F FG+LGNI+S    LAP+PTF RI+K+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSMEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K    LLI+IN+ GCVIET+YI ++L YA + A+  T K++LLL    + +I L
Sbjct  61    IFYALVKTGEGLLITINAAGCVIETVYIIMYLVYAPRKAKIFTAKIVLLLNVAGFGLIFL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+F F G  RV  +GWICV FSVCVF APLSI+ +V+KTKSVE+MPF+LS  LTL+AV+
Sbjct  121   LTLFAFHGETRVVSLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFSLSLTLTLSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKG----AVP-ELVI  448
             W  YGLL+KD  +ALPN+LGF  G++QMVLY  Y N  P+  ++ K+G     VP E  +
Sbjct  181   WFLYGLLIKDKYVALPNILGFTFGMIQMVLYMFYMNATPVVASDAKEGKEAWKVPAEDHV  240

Query  447   NVAGLGELLHSSVEDSKTTAITVSDAVTEEKA  352
              V  +G+   SS  + +  A        E  A
Sbjct  241   VVINVGKADKSSCAEVRPVADVPRRCAAEAAA  272



>ref|XP_004235342.2| PREDICTED: uncharacterized protein LOC101265905 [Solanum lycopersicum]
Length=599

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 151/267 (57%), Positives = 193/267 (72%), Gaps = 13/267 (5%)
 Frame = -1

Query  1155  EMALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAML  976
             E ++  +   W F FGVLGNIVS +VFL+P+PTF +IYK KST GYQS+PYVV+LFS+ML
Sbjct  300   EASMAGISGHWAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTDGYQSIPYVVALFSSML  359

Query  975   WMYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             W+YYAFLK +  LLI+INS G  IET+Y+  +L YA K  R QT+KML+L V G +  IV
Sbjct  360   WIYYAFLKTNTTLLITINSFGVFIETIYVGFYLFYAPKKDRVQTIKMLMLSVVGGFGAIV  419

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             L T F FKG +R  IVGWIC+ FS+CVF APL IV +V+KTKSVE+MP  LS FLTL+AV
Sbjct  420   LITEFLFKGVVRGQIVGWICLIFSLCVFVAPLGIVKQVIKTKSVEYMPLLLSIFLTLSAV  479

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAG  436
             +W  YGLLLKD+ IA+PNVLGF+LGI+QMVLY IY N+K   + +E+K  +PE + N   
Sbjct  480   VWFFYGLLLKDINIAIPNVLGFILGILQMVLYVIY-NKKEKAILKEQK--LPEKLQN---  533

Query  435   LGELLHSSVEDSKTTAITVSDAVTEEK  355
                ++ S  E +K      S  +TEE+
Sbjct  534   --HMIISMDEKNKN-----SPGLTEEQ  553


 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 172/224 (77%), Gaps = 3/224 (1%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W F FG+LGNI+S +VFL+P+PTF +IYK KST GYQS+PYVV+LFS+MLW+YYA LK +
Sbjct  8     WAFAFGILGNIISFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYALLKTN  67

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
               LLI+INS G  IET+Y+  +L YA K  R QT+KML+L V G +  IVL T F FKG 
Sbjct  68    TTLLITINSFGVFIETIYVGFYLFYAPKKDRVQTIKMLMLSVVGGFGAIVLVTEFLFKGV  127

Query  765   LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLK  586
             +R  +VGWIC+ FS+CVF APL IV +V+KTKSVE+MP  LS FLTL+AV+W  YGLLLK
Sbjct  128   VRGQVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSIFLTLSAVVWFFYGLLLK  187

Query  585   DMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL  454
             D+ IA PNVLGF+ GI+Q+VLY IY  ++ + + E+K   +PE+
Sbjct  188   DINIAAPNVLGFIFGILQIVLYVIYNKKEKVILKEQK---LPEI  228



>gb|ACV71016.1| UPA16 [Capsicum annuum]
Length=301

 Score =   268 bits (684),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 178/249 (71%), Gaps = 8/249 (3%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W F FGVLGNI+S +VFL+P+PTF  IYK K+  GYQS+PYV++LFS+MLW+YYAFLK +
Sbjct  8     WAFAFGVLGNIISFIVFLSPIPTFYTIYKKKTAEGYQSIPYVIALFSSMLWIYYAFLKTN  67

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
               LLI+INS G  IET+Y+ ++L YA K AR  T+KMLLL V G +  IVL T F FKG 
Sbjct  68    VTLLITINSFGIFIETIYVGLYLFYAPKKARVHTVKMLLLTVVGGFGAIVLVTQFLFKGV  127

Query  765   LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLK  586
             +R  IVGWIC+ F++ VF APL IV +V+KTKSVE+MP  LS FLTL+AVMW  YGLLLK
Sbjct  128   VRGQIVGWICLIFALSVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  585   DMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAG--------LG  430
             D+ IA PNVLGF+ G++Q+VLY IY  ++ + + E+K   + +  + VA         L 
Sbjct  188   DINIAAPNVLGFIFGVLQIVLYAIYSKKEKVILKEQKLPEIQKPAVIVADDNTNANKKLP  247

Query  429   ELLHSSVED  403
             EL H  + D
Sbjct  248   ELTHEQIID  256



>ref|XP_010042796.1| PREDICTED: bidirectional sugar transporter N3-like [Eucalyptus 
grandis]
Length=282

 Score =   267 bits (682),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/259 (53%), Positives = 178/259 (69%), Gaps = 11/259 (4%)
 Frame = -1

Query  1122  VFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSA  943
             + +FG+LGNIVSL VF APVPTF RIYK KST G+QS+PY+V+LFS+MLW+YYAFLK  +
Sbjct  5     IIIFGILGNIVSLFVFFAPVPTFYRIYKEKSTEGFQSIPYLVALFSSMLWLYYAFLKGHS  64

Query  942   PLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGTL  763
              LLI+INS GCVIE +YI+I++ YA + AR  T+K+  L+  GL+S+++L   F   G  
Sbjct  65    FLLITINSFGCVIEMVYITIYIAYALRAARSSTIKLFALMNVGLFSLLILIMHFIPNGDA  124

Query  762   RVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKD  583
             R  +  WIC   SV VFAAPL IV +VV+TKSVEFMPF+LSFFLTL+A+MW GYG   KD
Sbjct  125   RTTVFEWICTTISVSVFAAPLGIVARVVRTKSVEFMPFSLSFFLTLSAIMWFGYGFFQKD  184

Query  582   MCIALPNVLGFLLGIVQMVLYGIYRNQK---PLEVAEEKKGAVPELVINVAGLGELLHSS  412
              CI +PN++GF+LG+ QMVLYG YRN     P  VA       P       G+ E+    
Sbjct  185   WCIMIPNIVGFVLGLSQMVLYGYYRNMDEKLPQHVAITGVRPPP------GGVSEV--RP  236

Query  411   VEDSKTTAITVSDAVTEEK  355
             V D  +  I  S+A  +E+
Sbjct  237   VTDEISPPIDRSEARADEQ  255



>gb|KHN24975.1| Bidirectional sugar transporter N3 [Glycine soja]
Length=273

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/227 (61%), Positives = 178/227 (78%), Gaps = 2/227 (1%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H    F FG+LGN++S LVFLAP+ TF RI+K KST G+QS+PY+V+LFS+MLW+YYA L
Sbjct  5     HSTLAFAFGMLGNVISFLVFLAPITTFYRIFKKKSTEGFQSLPYLVALFSSMLWLYYALL  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK A LL++INS GCVIE +YI +++ YA+  AR  T+K+   +  G +++I+L T F  
Sbjct  65    KKDAMLLLTINSFGCVIEIIYIILYITYATGDARNLTLKLFFAMNVGAFALILLVTHFAV  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G+LRV ++GWICV+ S+ VFAAPLSIV +VV+TKSVEFMPFNLSF LTL+A+MW GYGL
Sbjct  125   HGSLRVQVLGWICVSLSISVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRN-QKPLEVAEEKKGAVPE  457
              LKD+CIALPNVLGF LG++QM+LY IYRN  K ++   EKK A PE
Sbjct  185   FLKDICIALPNVLGFALGLLQMLLYAIYRNGNKKVDKILEKK-APPE  230



>ref|XP_004952573.1| PREDICTED: bidirectional sugar transporter SWEET15-like [Setaria 
italica]
Length=319

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 180/243 (74%), Gaps = 6/243 (2%)
 Frame = -1

Query  1152  MALFDL-HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAML  976
             MA  ++    W F FG+LGNI+SL+VFL+P+PTF R+Y+ KST G+QS PYVV+LFS ML
Sbjct  1     MAFLNMEQQTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML  60

Query  975   WMYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             W++YA LK  A LL++IN +GCVIET+YI+++L YA + AR  T KMLL L  G++ ++ 
Sbjct  61    WIFYALLKTGAVLLVTINGVGCVIETVYIAMYLVYAPRAARVLTAKMLLGLNVGVFGLVS  120

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             L TM    G LRV+++GWICV+ ++ VFAAPLSI+ +V++TKSVEFMPF+LSFFL L+AV
Sbjct  121   LVTMVLSNGNLRVHVLGWICVSVALSVFAAPLSIMRQVIRTKSVEFMPFSLSFFLVLSAV  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLE---VAEEKKGAVPELVIN  445
             +W  YG L KD+ +A PNVLGF+ G+ QM LY  YRN+KP     + EE K  +PE V  
Sbjct  181   IWFAYGALKKDVFVAFPNVLGFVFGLAQMALYMAYRNRKPAAAVVMVEEVK--LPEHVKE  238

Query  444   VAG  436
             VA 
Sbjct  239   VAA  241



>ref|XP_009150896.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Brassica 
rapa]
Length=288

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/270 (51%), Positives = 198/270 (73%), Gaps = 6/270 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F+  + W F FG+LGNI+S  VFL+PVPTF RI+K K+T  +QS+PYVV+LFSAMLW
Sbjct  1     MAIFNTQNTWAFAFGLLGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GC IET+YI+IF+ +A+K AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KG+ R  I+G ICV FSVCVFAAPLSI+  V+KTKSVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLAKGSTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGA--VPELVINV  442
             WL YGL L+D+ +A PNV+GF LG +QM+LY +++  K P ++ E++  A  +PE+ I++
Sbjct  181   WLLYGLALRDIYVAFPNVIGFALGALQMILYVVFKYCKTPSDLVEKELEAAKLPEVSIDM  240

Query  441   AGLGELLHSSVEDSKTTAI-TVSDAVTEEK  355
               LG L  +S E ++ T + T +  +  ++
Sbjct  241   LKLGTL--ASPEPAEITVVPTANKCICNDR  268



>emb|CDX88041.1| BnaA06g26320D [Brassica napus]
Length=288

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/263 (52%), Positives = 195/263 (74%), Gaps = 5/263 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F+  + W F FG+LGNI+S  VFL+PVPTF RI+K K+T  +QS+PYVV+LFSAMLW
Sbjct  1     MAIFNTQNTWAFAFGLLGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GC IET+YI+IF+ +A+K AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KG+ R  I+G ICV FSVCVFAAPLSI+  V+KTKSVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLAKGSTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGA--VPELVINV  442
             WL YGL L+D+ +A PNV+GF LG +QM+LY +++  K P ++ E++  A  +PE+ I++
Sbjct  181   WLLYGLALRDIYVAFPNVIGFALGALQMILYVVFKYCKTPSDLVEKELEAAKLPEVSIDM  240

Query  441   AGLGELLHSSVEDSKTTAITVSD  373
               LG L  +S E ++ T +  ++
Sbjct  241   LKLGTL--ASPEPAEITVVPTAN  261



>gb|EMT11081.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=285

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/230 (58%), Positives = 173/230 (75%), Gaps = 2/230 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGNI+S    LAP+PTF RI+K+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K    LLISIN+ GCVIET+YI ++L YA + A+  T K+++LL    + +I+L
Sbjct  61    IFYALVKTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNVAGFGLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+F F G  RV  +GWICV FSVCVF APLSI+ +V+KTKSVE+MPF+LS  LTL+AV+
Sbjct  121   LTLFAFHGETRVISLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFSLSLTLTLSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPL--EVAEEKKG  469
             W  YGLL+KD  +ALPN+LGF  G++QMVLY  Y N  P+  ++ E K+G
Sbjct  181   WFLYGLLIKDKYVALPNILGFTFGMIQMVLYMFYMNATPVVSDLKEGKEG  230



>ref|XP_009609628.1| PREDICTED: bidirectional sugar transporter NEC1-like [Nicotiana 
tomentosiformis]
Length=277

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/262 (53%), Positives = 186/262 (71%), Gaps = 3/262 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F       FVFGVLGN VS LV+L+P+PTF RIYK KST G+QS+PY V+LFSAML+
Sbjct  1     MAIFTASQ-LAFVFGVLGNGVSFLVYLSPIPTFYRIYKRKSTEGFQSIPYSVALFSAMLY  59

Query  972   MYYAFLK-KSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             +YYA+LK K+  LL++INS G  IE +Y++IFL YA++ A+  T K++LLL  G Y  IV
Sbjct  60    LYYAYLKEKNGILLVTINSFGTAIELIYLTIFLIYATREAKIYTTKLVLLLNIGSYGAIV  119

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
               T    K   RV IVGWIC  FSVCVFAAPLSI+ +V++T+SVEFMPF LSFFLT+ AV
Sbjct  120   ALTYIFAKDETRVTIVGWICAVFSVCVFAAPLSIMRRVIRTRSVEFMPFPLSFFLTICAV  179

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGAVPELVINVA  439
             MW  YGLL+KDM IA PN+LGF  GI QM+LY I+RN+K  ++ A+     + ++VI++ 
Sbjct  180   MWFFYGLLIKDMYIATPNILGFTFGIAQMILYAIFRNRKQQIQPADSNLKDLTQVVIDMK  239

Query  438   GLGELLHSSVEDSKTTAITVSD  373
              +   +  + + +K   +  +D
Sbjct  240   AMVLEMQENSDPNKEAEVDDTD  261



>ref|NP_190443.1| bidirectional sugar transporter SWEET11 [Arabidopsis thaliana]
 sp|Q9SMM5.1|SWT11_ARATH RecName: Full=Bidirectional sugar transporter SWEET11; Short=AtSWEET11 
[Arabidopsis thaliana]
 gb|AAK32837.1|AF361825_1 AT3g48740/T8P19_250 [Arabidopsis thaliana]
 gb|AAL31891.1|AF419559_1 AT3g48740/T8P19_250 [Arabidopsis thaliana]
 emb|CAB62363.1| MTN3-like protein [Arabidopsis thaliana]
 gb|AAL49908.1| putative MTN3 protein [Arabidopsis thaliana]
 gb|AAL77742.1| AT3g48740/T8P19_250 [Arabidopsis thaliana]
 gb|AAM20244.1| putative MTN3 protein [Arabidopsis thaliana]
 gb|AEE78451.1| bidirectional sugar transporter SWEET11 [Arabidopsis thaliana]
Length=289

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/244 (56%), Positives = 179/244 (73%), Gaps = 3/244 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M+LF+  + W FVFG+LGN++S  VFL+PVPTF RI+K K+T G+QS+PYVV+LFSA LW
Sbjct  1     MSLFNTENTWAFVFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSIPYVVALFSATLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++IN+ GC IET+YIS+FL YA K AR  T+KMLLL+  G +  I+L
Sbjct  61    LYYATQKKDVFLLVTINAFGCFIETIYISMFLAYAPKPARMLTVKMLLLMNFGGFCAILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KG  R  I+G ICV FSVCVFAAPLSI+  V+KT+SVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLVKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVI  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKP---LEVAEEKKGAVPELVINV  442
             WL YGL LKD+ +A PNVLGF LG +QM+LY +Y+  K    L   E +   +PE+ +++
Sbjct  181   WLLYGLALKDIYVAFPNVLGFALGALQMILYVVYKYCKTSPHLGEKEVEAAKLPEVSLDM  240

Query  441   AGLG  430
               LG
Sbjct  241   LKLG  244



>ref|XP_003532319.1| PREDICTED: bidirectional sugar transporter N3-like [Glycine max]
Length=273

 Score =   266 bits (679),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 139/237 (59%), Positives = 180/237 (76%), Gaps = 1/237 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H    F FG+LGN++S LVFLAP+ TF RI+K KST G+QS+PY+V+LFS+MLW+YYA L
Sbjct  5     HSTLAFAFGMLGNVISFLVFLAPITTFYRIFKKKSTEGFQSLPYLVALFSSMLWLYYALL  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK A LL++INS GCVIE +YI +++ YA+  AR  T+K+   +  G +++I+L T F  
Sbjct  65    KKDAMLLLTINSFGCVIEIIYIILYITYATGDARNLTLKLFFAMNVGAFALILLVTHFAV  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G+LRV ++GWICV+ S+ VFAAPLSIV +VV+TKSVEFMPFNLSF LTL+A+MW GYGL
Sbjct  125   HGSLRVQVLGWICVSLSISVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRN-QKPLEVAEEKKGAVPELVINVAGLGE  427
              LKD+CIALPNVLGF LG++QM+LY IYRN  K ++   EKK  +  L   V   GE
Sbjct  185   FLKDICIALPNVLGFALGLLQMLLYAIYRNGNKKVDKILEKKAPLEPLKSVVIETGE  241



>ref|XP_010037373.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Eucalyptus 
grandis]
Length=266

 Score =   265 bits (678),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 174/229 (76%), Gaps = 2/229 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F   +P V +FGVLGNI+S++VFLAPVPTF RI + KST G++SVPYVVSLFSAMLW
Sbjct  1     MAIFTTDNPRVLIFGVLGNIISIVVFLAPVPTFWRICRRKSTEGFESVPYVVSLFSAMLW  60

Query  972   MYYAFLKK--SAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVI  799
             +YYA LK   +A LLI++NS+GC IET+YI+++L YA K AR+     LLLL  G Y  I
Sbjct  61    LYYASLKSESTAFLLITVNSVGCAIETIYIALYLAYAPKQARQMMTGTLLLLNFGGYCSI  120

Query  798   VLATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTA  619
             +L + F  KG+ RV +VGWICVA SV VFAAPLS++  V++TKSVEF+PF+LSFFL L+A
Sbjct  121   LLLSHFLAKGSARVQLVGWICVALSVAVFAAPLSVIRMVIRTKSVEFLPFSLSFFLMLSA  180

Query  618   VMWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK  472
             V WL YGL LKD+ +A PNVLG + G++QM L+ IYR    + + EE+ 
Sbjct  181   VTWLLYGLFLKDLYVAGPNVLGVIFGVLQMALHAIYRKGNTIAMEEEEN  229



>ref|XP_006663471.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Oryza 
brachyantha]
Length=310

 Score =   267 bits (682),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/256 (55%), Positives = 181/256 (71%), Gaps = 16/256 (6%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGNI+S + +LAP+PTF RIYK+KST G+QS+PYVV+LFSAMLW
Sbjct  1     MAGMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQGFQSIPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK    LLI+INS GCVIETLYI+++L YA K AR  T ++LLL+  G++ +I+L
Sbjct  61    IYYALLKSDECLLITINSAGCVIETLYIAVYLVYAPKKARVFTARLLLLVNVGVFGLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+    G  RV ++GW+CV FSV VF APLSI+  VV+TKSVEFMPF+LS  LT++AV+
Sbjct  121   LTLLLSAGPRRVVVLGWVCVGFSVSVFVAPLSIMRLVVRTKSVEFMPFSLSLSLTVSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLE---VAEE------------  478
             W  YGLL+KD  +ALPNVLGF  G++QM LY +YRN  P     VA+E            
Sbjct  181   WFLYGLLIKDKYVALPNVLGFTFGVIQMGLYAMYRNSTPKRSTMVAKEVEATATDDDDAA  240

Query  477   -KKGAVPELVINVAGL  433
                  V E V+N+A L
Sbjct  241   SPTAGVKEHVVNIAKL  256



>ref|XP_007137870.1| hypothetical protein PHAVU_009G162700g [Phaseolus vulgaris]
 gb|ESW09864.1| hypothetical protein PHAVU_009G162700g [Phaseolus vulgaris]
Length=264

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/262 (54%), Positives = 194/262 (74%), Gaps = 11/262 (4%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H  W FVFG+LGN++S +VFLAP+PTF +IYK K+  G+QS+PYVV+LFS+MLW+YYA +
Sbjct  5     HETWAFVFGLLGNVISFMVFLAPLPTFYQIYKKKTAEGFQSLPYVVALFSSMLWIYYALV  64

Query  954   KKSAPLL-ISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFP  778
             KK A LL I+INS GCVIE++Y++IFL YA    R  T+K+LLLL    +  ++L+T++ 
Sbjct  65    KKDASLLLITINSFGCVIESIYLAIFLLYAPSKTRLCTIKLLLLLNVFGFGAMLLSTLYF  124

Query  777   FKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
               G+ R++++GWIC+ F++ VFAAPL I+ +V+KTKSVE+MPF+LSFFLT+ AVMW  YG
Sbjct  125   TTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTKSVEYMPFSLSFFLTINAVMWFFYG  184

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL---VINVAGLGE  427
             LLLKD  IALPN LGFL GI+QM+LY +YRN KP  + E  K  + EL   +++V  LG 
Sbjct  185   LLLKDYYIALPNTLGFLFGIIQMMLYLVYRNAKPKTLEEPTK--LQELNGHIVDVVKLG-  241

Query  426   LLHSSVEDSKTTAITVSDAVTE  361
                 ++  S+   +T S AVTE
Sbjct  242   ----TMAPSEPNHVTKSGAVTE  259



>ref|XP_004145147.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=295

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 132/236 (56%), Positives = 179/236 (76%), Gaps = 1/236 (0%)
 Frame = -1

Query  1152  MAL-FDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAML  976
             MAL F+ H+P  F FG+LGNI+S +VFLAPVPTF+RIYK KST G+QS+PYVV+LFSAML
Sbjct  1     MALSFNTHNPAAFTFGLLGNIISFIVFLAPVPTFMRIYKKKSTEGFQSIPYVVALFSAML  60

Query  975   WMYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             W+YYA    +  LLI+INS+GC+IET+Y++IF+ +A K  R  T++ +LLL  G + +I+
Sbjct  61    WLYYASFNPNETLLITINSVGCLIETIYLAIFIVFAPKQIRVSTLRFVLLLNFGGFCIIL  120

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             L T F   G+ +V +VGWICVAFS+ VFAAPL+I+  V++TKSVEFMPF LSFFLTL+A 
Sbjct  121   LVTHFLVHGSNQVKVVGWICVAFSISVFAAPLTIIRLVIRTKSVEFMPFYLSFFLTLSAT  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVI  448
              WL YG+ LKD+ IA+PN+ GF+ GI QM+LY IY+ ++     +  + +   +VI
Sbjct  181   SWLLYGVFLKDIYIAVPNIPGFMFGIAQMILYLIYKKRETAMEMQLPQHSTDNIVI  236



>gb|EMT22394.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=296

 Score =   266 bits (680),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 178/249 (71%), Gaps = 8/249 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M    + HPW F FG+LGN++S + +LAP+PTF RIYK KST G+QSVPYVV+LFSAMLW
Sbjct  1     MGGLSVQHPWAFTFGLLGNVISFMTYLAPLPTFYRIYKNKSTQGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK    LLI+INS GCVIET+YI ++L YA K AR  T K+LLLL  G++ +I+L
Sbjct  61    IYYALLKSDEYLLITINSAGCVIETIYIVLYLAYAHKQARIFTAKILLLLNVGVFGLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+    G  R+ ++GW+CV FSV VF APLS++  VV+T+SVEFMPF+LS  LT +AV+
Sbjct  121   LTLLLTAGERRIVMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTASAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEE------KKGAV--PE  457
             W  YGLL+KD  +ALPN+LGF  G++QM LY +YRN  P    +E        GAV   E
Sbjct  181   WFLYGLLIKDKYVALPNILGFAFGVIQMGLYALYRNATPRPAPKEVDAPVSDDGAVKPSE  240

Query  456   LVINVAGLG  430
              V+N+A LG
Sbjct  241   HVVNIAKLG  249



>ref|XP_010036837.1| PREDICTED: bidirectional sugar transporter N3-like [Eucalyptus 
grandis]
 gb|KCW48495.1| hypothetical protein EUGRSUZ_K02183 [Eucalyptus grandis]
Length=250

 Score =   264 bits (675),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 176/240 (73%), Gaps = 4/240 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F   H W+F FG+LGN VS  VFLAPVPTF +IY+ K T  +QS+PY+V+LFS+MLW
Sbjct  1     MAIFVHPHLWIFTFGILGNFVSFFVFLAPVPTFYKIYRNKLTEKFQSIPYLVALFSSMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFLK  + LLI+INS GCVIE +YI+I++ YA   A++ T+K+  L+  GL+ +++L
Sbjct  61    LYYAFLKGHSFLLITINSFGCVIEMVYIAIYIAYAPIAAKKSTIKLFALMNMGLFPLLIL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T F      R  + GWIC   SV VFAAPLSIV +VV+T SVEFMPF+LSFFLTL+A+ 
Sbjct  121   ITHFIPNDDARATVFGWICTTISVSVFAAPLSIVARVVRTNSVEFMPFSLSFFLTLSAIT  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPL--EVAEEK--KGAVPELVIN  445
             W GYG   KD CI +PN++GF+LG+ QMVLYG YRN++ +  E+ +E   + A  E+V++
Sbjct  181   WFGYGFFQKDWCIMIPNIVGFVLGLSQMVLYGYYRNKEDIKDEIMDETLPQRAAVEVVVS  240



>ref|XP_006347632.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Solanum 
tuberosum]
Length=294

 Score =   266 bits (679),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 185/255 (73%), Gaps = 7/255 (3%)
 Frame = -1

Query  1119  FVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSAP  940
             FVFG+LGNIVS +V+LAPVPTF +IYK KST G+QSVPYVV LFSAMLW+YYAFLK    
Sbjct  7     FVFGLLGNIVSFMVYLAPVPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKPDTT  66

Query  939   LLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLL-VGGLYSVIVLATMFPFKGTL  763
             LLI+INS+GC I+T YI  FL YA+K A+  T+K+LL + V GL  +I+L T F  KG+ 
Sbjct  67    LLITINSVGCFIQTFYICFFLFYATKKAKMDTVKLLLSMNVVGL-GLIILLTQFFSKGSN  125

Query  762   RVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKD  583
             R  IVGWIC+ FS CVF APL ++ +V+++KSVE+MPF LSFFLTL+AVMW  YGLL KD
Sbjct  126   RAQIVGWICLIFSFCVFVAPLGVLRQVIRSKSVEYMPFQLSFFLTLSAVMWFFYGLLRKD  185

Query  582   MCIALPNVLGFLLGIVQMVLYGIYRNQKPL--EVAEEKKGAVPELVINVAGLGELLHSSV  409
               IA+PNVLGF LG++QM LY IY+N K +  EV  E    V +  + ++   E+L   +
Sbjct  186   YNIAIPNVLGFSLGVIQMTLYLIYKNAKKVTKEVRLENTETVVDEELKLS--EEMLKEQI  243

Query  408   ED-SKTTAITVSDAV  367
              D  K +A+  S+ +
Sbjct  244   IDVVKLSAMVCSEII  258



>gb|KCW61894.1| hypothetical protein EUGRSUZ_H04587, partial [Eucalyptus grandis]
Length=244

 Score =   264 bits (674),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 175/235 (74%), Gaps = 8/235 (3%)
 Frame = -1

Query  1107  VLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSAPLLIS  928
             ++GNIVSL VF APVPTF RIYK KST G+QS+PY+V+LFS+MLW+YYAFLK  + LLI+
Sbjct  1     MIGNIVSLFVFFAPVPTFYRIYKEKSTEGFQSIPYLVALFSSMLWLYYAFLKGHSFLLIT  60

Query  927   INSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGTLRVNIV  748
             INS GCVIE +YI+I++ YA + AR  T+K+  L+  GL+S+++L   F   G  R  + 
Sbjct  61    INSFGCVIEMVYIAIYIAYALRAARSSTIKLFALMNVGLFSLLILIIHFIPNGDARTTVF  120

Query  747   GWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKDMCIAL  568
             GWIC   SV VFAAPL IV +VV+TKSVEFMPF+LSFFLTL+A+MW GYG   KD CI +
Sbjct  121   GWICTTISVSVFAAPLGIVARVVRTKSVEFMPFSLSFFLTLSAIMWFGYGFFQKDWCIMI  180

Query  567   PNVLGFLLGIVQMVLYGIYRNQKPL----EVAEEKKGAVPELVIN-VAGLGELLH  418
             PN++GF+LG+ QMVLYG YRN+  +    E+ +EK   +P+ V++  +G   ++H
Sbjct  181   PNIVGFVLGLSQMVLYGYYRNKGVIIIKDEIMDEK---LPQHVVHPTSGRASVVH  232



>emb|CDX80379.1| BnaC07g30650D [Brassica napus]
Length=288

 Score =   265 bits (678),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 138/270 (51%), Positives = 198/270 (73%), Gaps = 6/270 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F+  + W F FG++GNI+S  VFL+PVPTF RI+K K+T  +QS+PYVV+LFSAMLW
Sbjct  1     MAIFNTQNTWAFAFGLVGNIISFAVFLSPVPTFYRIWKKKTTEDFQSLPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++INS GC IET+YI+IF+ +A+K AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINSFGCFIETIYIAIFVAFATKKARMLTVKLLLLMNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KG+ R  I+G ICV FSVCVFAAPLSI+  V+KTKSVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLAKGSTRAKIIGGICVGFSVCVFAAPLSIIRTVIKTKSVEYMPFSLSLTLTISAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK-PLEVAEEKKGA--VPELVINV  442
             WL YGL L+D+ +A PNV+GF LG +QM+LY +++  K P ++ E++  A  +PE+ I++
Sbjct  181   WLLYGLALRDIYVAFPNVIGFALGALQMILYVVFKYCKTPSDLVEKELEAAKLPEVSIDM  240

Query  441   AGLGELLHSSVEDSKTTAI-TVSDAVTEEK  355
               LG L  +S E ++ T + T +  +  ++
Sbjct  241   LKLGTL--ASPEPAEITVVPTANKCICNDR  268



>ref|NP_001242732.1| uncharacterized protein LOC100810962 [Glycine max]
 gb|ACU20322.1| unknown [Glycine max]
Length=258

 Score =   264 bits (674),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 130/222 (59%), Positives = 172/222 (77%), Gaps = 1/222 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H  W F+FG+LGN++S +VFLA +PT  +IYK KST G+QS+PY+V+LFS+MLW+YYA +
Sbjct  5     HETWAFIFGLLGNVISFMVFLASLPTLYQIYKKKSTDGFQSLPYIVALFSSMLWIYYALV  64

Query  954   KKSAPLL-ISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFP  778
             KK A LL I+INS GCVIET+Y++IFL YA    R  T+K+LL+L    +  ++L+T++ 
Sbjct  65    KKDASLLLITINSFGCVIETIYLAIFLIYAPSKTRLWTIKLLLMLNVFGFGAMLLSTLYL  124

Query  777   FKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
               G+ R++++GWIC+  ++ VFAAPL I+ +V+KTKSVEFMPF+LSFFLT+ AVMW  YG
Sbjct  125   TTGSKRLSVIGWICLVLNISVFAAPLCIMKRVIKTKSVEFMPFSLSFFLTINAVMWFFYG  184

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK  472
             LLLKD  IALPN LGFL GI+QMVLY IYRN KP  + E  K
Sbjct  185   LLLKDYYIALPNTLGFLFGIIQMVLYLIYRNAKPQGLEEPTK  226



>ref|XP_002322282.2| hypothetical protein POPTR_0015s11380g [Populus trichocarpa]
 gb|EEF06409.2| hypothetical protein POPTR_0015s11380g [Populus trichocarpa]
Length=276

 Score =   265 bits (676),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 175/224 (78%), Gaps = 3/224 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA F +H PW+F FG+LGN VS +VFLAP+PTF+RI + K+T G+QS+PYVV+LFSAM+W
Sbjct  1     MASFSIHCPWIFTFGLLGNFVSFVVFLAPIPTFLRICRKKTTEGFQSLPYVVALFSAMIW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK    LLI+INS+GC IE +YI++++ YA K AR  T+++L+L   G +  I+L
Sbjct  61    LYYASLKSDVLLLITINSVGCFIEMIYIALYVAYAPKQARIATLRILILFNFGGFCSILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              + F  KG+ RV ++GW CV FSV VFAAPL+I+  V++TKSVEFMPF LSFFLTL+A+ 
Sbjct  121   LSHFFVKGSNRVKVLGWACVIFSVSVFAAPLNIMRIVIRTKSVEFMPFTLSFFLTLSAIT  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK---PLE  490
             WL YG+L+KD  IA+PN++GF+ G++QMVLY IY+N K   P+E
Sbjct  181   WLVYGVLVKDYYIAIPNIVGFIFGVLQMVLYVIYKNFKTAVPME  224



>ref|XP_009614917.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Nicotiana 
tomentosiformis]
Length=286

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 145/263 (55%), Positives = 189/263 (72%), Gaps = 19/263 (7%)
 Frame = -1

Query  1131  HPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLK  952
             H W   FGVLG+IVS +VFL+P+PTF  IYK KST GYQS+PYVV+LFS +LW+YYA L 
Sbjct  7     HVWASAFGVLGDIVSFIVFLSPLPTFYTIYKKKSTEGYQSIPYVVALFSCILWIYYALLM  66

Query  951   KSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFK  772
              +   +I+IN+ GC IET+Y+  +L YA K AR QT+KMLLLLV G +  IVL T F FK
Sbjct  67    SNMIFIITINTFGCFIETIYVGFYLFYAPKKARVQTVKMLLLLVLGGFGAIVLVTQFLFK  126

Query  771   GTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLL  592
             G +R  IVGWIC+ FS+C FAAPL IV KV+KTKSVE+MPF LSFFLTL+AVMW  YGLL
Sbjct  127   GAVRGQIVGWICLVFSLCTFAAPLCIVRKVIKTKSVEYMPFLLSFFLTLSAVMWFFYGLL  186

Query  591   LKDMCIALPNVLGFLLGIVQMVLYGIY--------RNQKPLE------VAEEKKGAVPEL  454
             +KD  +A+PN+LGF+ GI+QM+LY IY        + QK  E      ++EE+K  +P+L
Sbjct  187   IKDKNVAIPNILGFIFGILQMILYVIYNKKEKNIIKEQKLRELQNHVVISEEQKN-LPQL  245

Query  453   ----VINVAGLGELLHSSVEDSK  397
                 +I++  LG L++S   +++
Sbjct  246   TEEQIIDIVKLGALVYSEKFNAR  268



>ref|XP_010027259.1| PREDICTED: bidirectional sugar transporter N3-like [Eucalyptus 
grandis]
Length=279

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 175/235 (74%), Gaps = 8/235 (3%)
 Frame = -1

Query  1107  VLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSAPLLIS  928
             ++GNIVSL VF APVPTF RIYK KST G+QS+PY+V+LFS+MLW+YYAFLK  + LLI+
Sbjct  1     MIGNIVSLFVFFAPVPTFYRIYKEKSTEGFQSIPYLVALFSSMLWLYYAFLKGHSFLLIT  60

Query  927   INSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGTLRVNIV  748
             INS GCVIE +YI+I++ YA + AR  T+K+  L+  GL+S+++L   F   G  R  + 
Sbjct  61    INSFGCVIEMVYIAIYIAYALRAARSSTIKLFALMNVGLFSLLILIIHFIPNGDARTTVF  120

Query  747   GWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKDMCIAL  568
             GWIC   SV VFAAPL IV +VV+TKSVEFMPF+LSFFLTL+A+MW GYG   KD CI +
Sbjct  121   GWICTTISVSVFAAPLGIVARVVRTKSVEFMPFSLSFFLTLSAIMWFGYGFFQKDWCIMI  180

Query  567   PNVLGFLLGIVQMVLYGIYRNQKPL----EVAEEKKGAVPELVIN-VAGLGELLH  418
             PN++GF+LG+ QMVLYG YRN+  +    E+ +EK   +P+ V++  +G   ++H
Sbjct  181   PNIVGFVLGLSQMVLYGYYRNKGVIIIKDEIMDEK---LPQHVVHPTSGRASVVH  232



>ref|XP_009801964.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Nicotiana 
sylvestris]
Length=294

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 181/254 (71%), Gaps = 2/254 (1%)
 Frame = -1

Query  1119  FVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSAP  940
             F FG+LGNIVS +V+LAPVPTF +I+K KST G+QSVPYVV LFSAMLW+YYAFLK    
Sbjct  6     FTFGLLGNIVSFMVYLAPVPTFYKIHKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKPDTT  65

Query  939   LLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGTLR  760
             LLI+INS+GC I++ YI  FL YA+K A+  T+K+LLLL      +I+L T F  K + R
Sbjct  66    LLITINSVGCCIQSFYICFFLFYATKKAKMDTVKLLLLLNFFGLGLIILLTQFLAKSSNR  125

Query  759   VNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKDM  580
               IVGWIC+ FS+CVF APL IV +V+KT+SVE+MPF LSFFLTL+AVMW  YGLL KD 
Sbjct  126   AQIVGWICLIFSLCVFVAPLGIVRQVIKTRSVEYMPFLLSFFLTLSAVMWFFYGLLRKDY  185

Query  579   CIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLHSSVEDS  400
              IA+PNVLGF LG++QMVLY IY+N K  +V +E K A  E  + +    +L    +++ 
Sbjct  186   NIAIPNVLGFTLGVLQMVLYVIYKNAK--KVTKEVKIAEKENTVTIVEEHKLSEDKLKEQ  243

Query  399   KTTAITVSDAVTEE  358
                 + +S  V  E
Sbjct  244   IIDVVKLSAMVCSE  257



>ref|XP_002877629.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53888.1| nodulin MtN3 family protein [Arabidopsis lyrata subsp. lyrata]
Length=289

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/244 (55%), Positives = 180/244 (74%), Gaps = 3/244 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M+LF+  + W FVFG+LGN++S  VFL+PVPTF RI+K K+T G+QS+PYVV+LFSA LW
Sbjct  1     MSLFNTENTWAFVFGLLGNLISFAVFLSPVPTFYRIWKKKTTEGFQSIPYVVALFSATLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++IN+ GC IET+YI++FL YA+K AR  T+K LLL+  G + VI+L
Sbjct  61    LYYATQKKDVFLLVTINAFGCFIETIYIAMFLAYATKPARMLTVKTLLLMNFGGFCVILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                F  KG  R  I+G ICV FSVCVFAAPLSI+  V+KT+SVE+MPF+LS  LT++AV+
Sbjct  121   LCQFLVKGATRAKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVI  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKP---LEVAEEKKGAVPELVINV  442
             WL YGL LKD+ +A PNV+GF LG +QM+LY +Y+  K    L   E +   +PE+ +++
Sbjct  181   WLLYGLALKDIYVAFPNVIGFALGALQMILYVVYKYCKTSPHLGEKEVEAAKLPEVSLDM  240

Query  441   AGLG  430
               LG
Sbjct  241   LKLG  244



>ref|XP_004962649.1| PREDICTED: bidirectional sugar transporter SWEET13-like [Setaria 
italica]
Length=300

 Score =   265 bits (677),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/249 (53%), Positives = 180/249 (72%), Gaps = 5/249 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA F L HPW F FG+LGN++S + FLAP+PTF RIYK+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGFSLQHPWAFTFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K +  LLI+IN  G VIE++Y+ ++  YA K AR  T K++L L  G +  I+L
Sbjct  61    IFYALIKSNEVLLITINVAGFVIESIYVILYFVYADKKARWFTAKIMLGLNVGFFGAILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+  F G  R+  +GWICVAFSV VF APLSI+ +V++T+SVE+MPF+LS  LTL+AV+
Sbjct  121   FTLLVFHGDKRIVTLGWICVAFSVGVFVAPLSIIKRVIQTRSVEYMPFSLSLTLTLSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVP-----ELVI  448
             W  YGLL+KD  +ALPN+LGF  G+VQMVLY  Y N+ P+    ++ G +P      +++
Sbjct  181   WFLYGLLIKDKYVALPNILGFTFGVVQMVLYVFYMNKTPVVADGKEAGKLPTAADEHVLV  240

Query  447   NVAGLGELL  421
             N+A L   L
Sbjct  241   NIAKLSPAL  249



>ref|XP_007139100.1| hypothetical protein PHAVU_008G001200g [Phaseolus vulgaris]
 gb|ESW11094.1| hypothetical protein PHAVU_008G001200g [Phaseolus vulgaris]
Length=272

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/237 (58%), Positives = 177/237 (75%), Gaps = 1/237 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H    F FG+LGN++S LVFLAP+ TF RI K KST G+QS+PY+V+LFS MLW+YYA L
Sbjct  5     HSSLAFAFGMLGNVISFLVFLAPITTFYRILKKKSTEGFQSLPYLVALFSCMLWLYYALL  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK A LL++INS GCVIE +YI +++ YA++  R  T+K+   +  G + +I+L T F  
Sbjct  65    KKDAVLLLTINSFGCVIEIIYIILYITYATRDVRNLTLKLFFAMNVGCFVLILLVTHFAV  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G+LRV ++GWICV+ S+ VFAAPLSIV +VV+TKSVEFMPFNLSF LTL+A+MW GYGL
Sbjct  125   HGSLRVQLLGWICVSLSISVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSAIMWFGYGL  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL-VINVAGLGE  427
              L+D+CIALPNVLGF LG++QM+LY IYRN        EKK  + +L  I +A  GE
Sbjct  185   FLRDICIALPNVLGFALGLIQMLLYAIYRNGNKKVDKMEKKAQLQQLKSIVIAESGE  241



>ref|XP_003523161.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Glycine 
max]
 gb|KHN31282.1| Bidirectional sugar transporter SWEET14-like protein [Glycine 
soja]
Length=258

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 173/222 (78%), Gaps = 1/222 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H  W F+FG+LGN++S +VFLAP+PTF +IYK KS+ G+QS+PYVV+LFS+MLW+YYA +
Sbjct  5     HETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIYYALV  64

Query  954   KKSAPLL-ISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFP  778
             KK A LL I+INS GCVIET+Y++IFL YA    R  T+K+LL+L    +  ++L+T++ 
Sbjct  65    KKDASLLLITINSFGCVIETIYLAIFLVYAPSKTRLWTIKLLLMLNVFGFGGMLLSTLYL  124

Query  777   FKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
               G+ R++++GWIC+ F++ VFAAPL I+ +V+KT+SVEFMPF+LS  LT+ AVMW  YG
Sbjct  125   TTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTRSVEFMPFSLSLSLTINAVMWFFYG  184

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK  472
             LLLKD  IALPN LGFL GI+QMVLY +YRN KP  + E  K
Sbjct  185   LLLKDYYIALPNTLGFLFGIIQMVLYLVYRNAKPQTLEEPTK  226



>ref|XP_010037379.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Eucalyptus 
grandis]
Length=265

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 177/229 (77%), Gaps = 3/229 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F   +PWV +FGVLGNI+S++VFLAPVPTF RI + KST G++SVPYVVSLFSAMLW
Sbjct  1     MAIFTTDNPWVLIFGVLGNIISIVVFLAPVPTFCRICRKKSTEGFESVPYVVSLFSAMLW  60

Query  972   MYYAFLKK--SAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVI  799
             +YYA LK   SA LL+++NS+GC IET+YI+++L YA K A+  T+ +LLL  GG Y  I
Sbjct  61    LYYASLKSEPSAFLLLTVNSVGCAIETIYIALYLAYAPKQAKMMTLTLLLLNFGG-YCSI  119

Query  798   VLATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTA  619
             +L + F  KG++RV +VGWICVA SV VFAAPLS++  V++TKSVEF+PF+LSFFL L+A
Sbjct  120   LLLSHFLAKGSVRVQLVGWICVALSVAVFAAPLSVIRMVIRTKSVEFLPFSLSFFLMLSA  179

Query  618   VMWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK  472
             V WL YGL LKD+ +A PNVLG + G++QM L+ IYR    +   EEK 
Sbjct  180   VTWLLYGLFLKDLYVAGPNVLGVIFGVLQMALHAIYRKGNTVATEEEKN  228



>ref|XP_006347652.1| PREDICTED: bidirectional sugar transporter SWEET11-like [Solanum 
tuberosum]
Length=482

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 171/224 (76%), Gaps = 3/224 (1%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W F FGVLGNI+S +VFL+P+PTF +IYK KST GYQS+PYVV+LFS+MLW+YYAFLK +
Sbjct  8     WAFAFGVLGNIISFIVFLSPIPTFYKIYKKKSTEGYQSIPYVVALFSSMLWIYYAFLKTN  67

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
               LLI+IN+ G  IET+Y+  +L YA K AR QT+KML L V G +  I++ T F FKG 
Sbjct  68    TTLLITINTFGVFIETIYVGFYLFYAPKKARVQTIKMLSLFVVGGFGAIIVVTQFLFKGA  127

Query  765   LRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLK  586
             +R  +VGWIC+ FS+CVF APL IV +V+KTKSVE+MP  LS FLTL+AVMW  YGLLLK
Sbjct  128   IRGQVVGWICLIFSLCVFVAPLGIVRQVIKTKSVEYMPLLLSVFLTLSAVMWFFYGLLLK  187

Query  585   DMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL  454
             D+ IA PNVLGF  GI+Q+VLY IY  ++   + E+K   +PE+
Sbjct  188   DINIAAPNVLGFFFGILQIVLYVIYSKKEKAILKEQK---LPEI  228


 Score =   130 bits (327),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 89/115 (77%), Gaps = 4/115 (3%)
 Frame = -1

Query  789  TMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMW  610
            T F FKG +R  +VGWIC+ FS+CVF APL I  +V+KTKSVE+MP  LS FLTL+AV+W
Sbjct  306  TEFLFKGAVRGQVVGWICLIFSLCVFVAPLGIR-QVIKTKSVEYMPLLLSIFLTLSAVVW  364

Query  609  LGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVIN  445
              YGLLLKD+ IA+PNVLGF+LGI+QMVLY IY N+K   + +E+K  +PE + N
Sbjct  365  FFYGLLLKDINIAIPNVLGFILGILQMVLYVIY-NKKEKAILKEQK--LPEKLQN  416



>gb|EMS53876.1| Bidirectional sugar transporter SWEET14 [Triticum urartu]
Length=532

 Score =   271 bits (694),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/241 (57%), Positives = 178/241 (74%), Gaps = 0/241 (0%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M    L HPW F FG+LGN++S + +LAP+PTF RIY++KST G+QSVPYVV+LFSAMLW
Sbjct  1     MGGLSLEHPWAFAFGLLGNVISFMTYLAPLPTFYRIYRSKSTQGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK    LLI+INS GCVIET+YI ++L YA K A+  T K+LLLL  G++ +I+L
Sbjct  61    IYYALLKSDELLLITINSAGCVIETIYIVMYLAYAPKQAKLFTAKILLLLNVGVFGLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+    G  RV ++GW+CV FSV VF APLS++  VV+T+SVEFMPF+LS  LT++AV+
Sbjct  121   LTLLLAGGEKRVIMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTVSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W  YGLL+KD  +ALPN+LGF  G++QM LY +Y N  P    +E    +PE VINVA L
Sbjct  181   WFLYGLLIKDKYVALPNILGFAFGVIQMGLYALYCNATPRPAPKEVDAPMPEHVINVAKL  240

Query  432   G  430
             G
Sbjct  241   G  241



>emb|CDP03543.1| unnamed protein product [Coffea canephora]
Length=267

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 175/240 (73%), Gaps = 2/240 (1%)
 Frame = -1

Query  1113  FGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSAPLL  934
             FG+LGN+VS LV+LAP+PTF RIYK KST G+Q+VPY V+LFSAML++YYA+LKK+  +L
Sbjct  13    FGILGNVVSFLVYLAPLPTFYRIYKKKSTQGFQAVPYSVALFSAMLYLYYAYLKKNGIIL  72

Query  933   ISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGTLRVN  754
              +INS GC IET+Y+ +F+ YA+K A+ +T K+L++   G Y++IV +T    +G  RV 
Sbjct  73    ATINSGGCAIETIYLVLFMIYATKDAKMRTAKLLVIFNVGAYALIVASTFLLSQGHRRVA  132

Query  753   IVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKDMCI  574
             +VGWIC  FSVCVFAAPLSI+ KV++T+SVEFMPF+LS FLTL AVMW  YG L+KD  I
Sbjct  133   LVGWICSVFSVCVFAAPLSIMMKVIRTRSVEFMPFSLSCFLTLCAVMWFFYGFLIKDYYI  192

Query  573   ALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLHSSVEDSKT  394
             A PN+LGF  GI QM+LY IYR +    V  E    V E+ + V  +G +L +   D  T
Sbjct  193   ATPNILGFAFGIAQMILYAIYRERDNGLVLPE--AYVKEIAVTVMEVGAVLETPPADYDT  250



>ref|XP_009349481.1| PREDICTED: bidirectional sugar transporter N3-like [Pyrus x bretschneideri]
Length=305

 Score =   264 bits (675),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/248 (52%), Positives = 182/248 (73%), Gaps = 3/248 (1%)
 Frame = -1

Query  1140  DLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYA  961
             D HHP  F FG+LGN++S +V+L+PVPTF RIY+ KST G+ SVPY+V+LFS+MLW YYA
Sbjct  6     DSHHPLAFTFGILGNLISAMVYLSPVPTFYRIYRKKSTEGFHSVPYLVALFSSMLWFYYA  65

Query  960   FLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMF  781
              +K +A +LI+INS G  +E +YI +F+ YA K AR+ T+K+  ++  GL+++I++ + F
Sbjct  66    LVKTNAMMLITINSFGSFVEIIYIVMFVVYAPKEARKLTVKLFGIMNVGLFTMILIVSHF  125

Query  780   PFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGY  601
                   RV I+GWI VA S  VF APLSIV +V++T+SVEFMPF LSFFLTL+AVMW  Y
Sbjct  126   LVGSAYRVPILGWINVAISTGVFVAPLSIVAQVIRTRSVEFMPFGLSFFLTLSAVMWFAY  185

Query  600   GLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK---GAVPELVINVAGLG  430
             GLLLKD+C+ +PNVLGF+LG++Q++LYGI RN++ + + + +K    A  E V N+  + 
Sbjct  186   GLLLKDICVVIPNVLGFVLGLLQILLYGICRNREQVIIDDHEKKLPAATHENVKNIVIIA  245

Query  429   ELLHSSVE  406
              L  S V 
Sbjct  246   ILAASEVH  253



>ref|XP_009405955.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=275

 Score =   263 bits (673),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 136/259 (53%), Positives = 186/259 (72%), Gaps = 8/259 (3%)
 Frame = -1

Query  1137  LHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAF  958
             L  PW F FG+LGNI+S +V+LAP+PTF R+YK KST G+QSVPYVV+LFSAMLW+ YAF
Sbjct  7     LDRPWAFTFGILGNIISFMVYLAPLPTFYRVYKRKSTEGFQSVPYVVALFSAMLWISYAF  66

Query  957   LKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFP  778
             LK  A LLI+INS+GC IET+YI     YA K  +  T K++LL++  ++ +I+L T+  
Sbjct  67    LKTDACLLITINSVGCAIETVYIV----YAPKATKIFTAKLVLLVIVAMFGLILLLTLLL  122

Query  777   FKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
              +G  RV I+GWICV+FSV VF APLS++  V++TKSVEFMPF+LSFFLTL+AV+W  YG
Sbjct  123   SEGAKRVEILGWICVSFSVSVFVAPLSVIRLVIRTKSVEFMPFSLSFFLTLSAVVWFAYG  182

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLH  418
             LL++D+ ++LPNVLGF+ GI+QM LY  Y+++K   V E++    PE V+ +    +   
Sbjct  183   LLIRDLYVSLPNVLGFIFGILQMALYVAYKDRKKAAVVEQEP---PEHVLPITN-RDTAQ  238

Query  417   SSVEDSKTTAITVSDAVTE  361
              +VE  +T      D V +
Sbjct  239   KAVEVHRTVETHGEDKVGD  257



>ref|XP_006436900.1| hypothetical protein CICLE_v10033645mg [Citrus clementina]
 ref|XP_006493251.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Citrus 
sinensis]
 gb|ESR50140.1| hypothetical protein CICLE_v10033645mg [Citrus clementina]
Length=271

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 184/257 (72%), Gaps = 2/257 (1%)
 Frame = -1

Query  1137  LHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAF  958
             +HH W   FG+LGNI S LV LAP+PTF +IYK KST G+QSVPYV+SLFSAM+W+YYA 
Sbjct  3     IHHSWATAFGLLGNITSFLVCLAPMPTFYKIYKKKSTEGFQSVPYVISLFSAMIWIYYAL  62

Query  957   LKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFP  778
             LK++A  L++IN+  CV++T+YI++++ YA K  R QT+K+LLLL    +  I L T F 
Sbjct  63    LKQNAIFLMTINTFCCVMQTIYIAVYVFYAPKKVRIQTVKLLLLLNIFGFGAICLLTFFL  122

Query  777   FKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
              KG +R  I+G+IC+ F++ VFAAPL IV KV+KTKSVE+MPF LSFFLT+ AV W  YG
Sbjct  123   SKGAIREKILGYICMTFALSVFAAPLFIVRKVIKTKSVEYMPFTLSFFLTIGAVAWFFYG  182

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLH  418
             LL+KD+ +A+PNVLGF+ G++QM+LY IY+N     V + K   + E V++V  L  ++ 
Sbjct  183   LLIKDLNVAIPNVLGFIFGVLQMILYVIYKNPNKKIVEQTKLQELSEHVVDVVKLSTMVC  242

Query  417   SSVED--SKTTAITVSD  373
             S +     + +AI   D
Sbjct  243   SELNSVVPQLSAIQNED  259



>ref|XP_009802195.1| PREDICTED: bidirectional sugar transporter SWEET9-like isoform 
X2 [Nicotiana sylvestris]
Length=297

 Score =   264 bits (674),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 171/240 (71%), Gaps = 3/240 (1%)
 Frame = -1

Query  1113  FGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSAPLL  934
             F   GNIVS  VFL+P+PTF +IYK KST  YQS+PYVV+LFSAM W+YYAFLK +  LL
Sbjct  11    FPFAGNIVSFFVFLSPLPTFYKIYKKKSTEDYQSIPYVVALFSAMFWIYYAFLKSNTTLL  70

Query  933   ISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGTLRVN  754
             I+INS GC IET+Y+  +L YA K AR QT+K+LLL V G +  IVL T   FKG +RV 
Sbjct  71    ITINSFGCFIETIYVGFYLFYAPKKARVQTVKLLLLSVFGGFGAIVLVTQLLFKGVVRVQ  130

Query  753   IVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKDMCI  574
             +VGWIC+ FS+CVF +PL I+ +V+KTKSVE+MPF +S FLTL+AV W  YGLLLKD  I
Sbjct  131   VVGWICLVFSLCVFVSPLCIMRQVIKTKSVEYMPFFISVFLTLSAVTWFFYGLLLKDFNI  190

Query  573   ALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVI---NVAGLGELLHSSVED  403
             A+PNVLGF++GI+QMV Y IY  ++ + V E K   +   VI   N   L EL    + D
Sbjct  191   AIPNVLGFIVGILQMVFYVIYYKKEEVIVKEHKFPEIQNHVIILHNDKNLPELTEEQIID  250



>ref|XP_009802608.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
 ref|XP_009792803.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
Length=293

 Score =   263 bits (673),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/267 (54%), Positives = 184/267 (69%), Gaps = 16/267 (6%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W F FGVLGNIVS +VFL+P+PTF +IYK KST GYQS+PYV++LFS+MLW+YYAFLK +
Sbjct  7     WAFAFGVLGNIVSFIVFLSPLPTFYKIYKKKSTEGYQSIPYVIALFSSMLWIYYAFLKTN  66

Query  945   APLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGT  766
               LLI+INS G  IET+Y+  +L YA K AR QT+KML L V G +  I+L   F FKG 
Sbjct  67    TTLLITINSFGVFIETIYVGFYLFYAPKKARIQTVKMLFLTVVGGFGAIILIAQFLFKGV  126

Query  765   LRVNIVGWICVAFSVCVFAAPLSIV-----------FKVVKTKSVEFMPFNLSFFLTLTA  619
              R  +VGW+C+ FS+CVF APL IV            KV+KTKSVE+MP  LS FLTL+A
Sbjct  127   ARGQVVGWVCLVFSLCVFVAPLCIVTALLLVDHFMQRKVIKTKSVEYMPLLLSVFLTLSA  186

Query  618   VMWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVA  439
             VMW  YGLLLKD+ IA PN+LGF+ GI+Q+VLY IY N+K   + +E+   +PEL  +V 
Sbjct  187   VMWFFYGLLLKDINIAAPNILGFIFGILQIVLYVIY-NKKEKHILKEQN--LPELQNHVI  243

Query  438   GLGE--LLHSSVEDSKTTAITVSDAVT  364
              L +   L    E+ K   + +S  V+
Sbjct  244   ILDDNKKLPELTEEQKIDIMKLSKLVS  270



>ref|XP_002520679.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41641.1| conserved hypothetical protein [Ricinus communis]
Length=286

 Score =   263 bits (672),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 146/274 (53%), Positives = 190/274 (69%), Gaps = 9/274 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MAL D    ++  FG+LGNIVS LV+LAP+PTF RI K KST G+QS+PY V+LFSAML 
Sbjct  1     MALNDPR--FILAFGILGNIVSFLVYLAPLPTFWRIVKKKSTEGFQSIPYSVALFSAMLT  58

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQ-TMKMLLLLVGGLYSVIV  796
             +YYA LK++A LLI+INSIGC+IE +Y++I++ YA++ +R Q   K+L+L   G Y +IV
Sbjct  59    LYYATLKENAILLITINSIGCLIEGIYLTIYMIYATQTSRVQIHFKLLILFNLGTYLLIV  118

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             +       GTLRV +VGWIC  FSVCVFAAPLSI+  V+KTKSVE+MPF+LSFFLTL A+
Sbjct  119   MLASELTHGTLRVQVVGWICAVFSVCVFAAPLSIMRLVIKTKSVEYMPFSLSFFLTLCAI  178

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQK----PLEVAEEKKGAVPELVI  448
              WLGYGL + D  IA PN+LGFL GIVQMVLY IY+N+K    P   ++E   + PE   
Sbjct  179   SWLGYGLAVNDYFIASPNILGFLFGIVQMVLYMIYKNKKNEILPTSTSQELAVSKPETSQ  238

Query  447   NV--AGLGELLHSSVEDSKTTAITVSDAVTEEKA  352
             +   +    L    +E +K      + AV EE +
Sbjct  239   DRENSNSSSLNQQDLEAAKDDRRENNKAVPEEAS  272



>ref|XP_010242697.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Nelumbo 
nucifera]
Length=276

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 173/226 (77%), Gaps = 3/226 (1%)
 Frame = -1

Query  1131  HPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLK  952
             H  VF FG+LGNIVS  V+LAPVPTF RIYK KST G+QS+PYVV+LFSAMLW+YYA LK
Sbjct  7     HTLVFAFGILGNIVSCAVYLAPVPTFYRIYKKKSTEGFQSIPYVVALFSAMLWIYYALLK  66

Query  951   KSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFK  772
              +  +LI+IN IGC IET+YI+++L YA K  +  T+K+LLLL  G Y +I+L +   FK
Sbjct  67    TNVTMLITINGIGCTIETIYITLYLVYAPKGTKIFTVKLLLLLNMGAYGLILLLSFLFFK  126

Query  771   GTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLL  592
             G  RV +VGW+C  FSV VFAAPLSI+ +V++TKSVEFMP +LSFFLTL AV W  YG+L
Sbjct  127   GFGRVTVVGWVCAGFSVIVFAAPLSIMRRVIRTKSVEFMPISLSFFLTLCAVFWFFYGIL  186

Query  591   LKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPEL  454
             +KD+ IA+PNVLGF LG+ QM+LY IYR+ K   + E K   +PEL
Sbjct  187   MKDLYIAIPNVLGFALGVAQMILYIIYRDSKKHLIVELK---LPEL  229



>ref|XP_009605548.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Nicotiana 
tomentosiformis]
Length=294

 Score =   263 bits (673),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 142/254 (56%), Positives = 180/254 (71%), Gaps = 2/254 (1%)
 Frame = -1

Query  1119  FVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSAP  940
             F FG+LGNIVS +V+LAP PTF +IYK KST G+QSVPYVV LFSAMLW+YYAFLK    
Sbjct  6     FTFGLLGNIVSFMVYLAPAPTFYKIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKPDTT  65

Query  939   LLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGTLR  760
             LLI+INS+GC I++ YI  FL YA+K A+  T+K+LLLL      +I+L T F  K + R
Sbjct  66    LLITINSVGCCIQSFYICFFLFYATKKAKMDTVKLLLLLNFFGLGLIILLTQFLAKSSNR  125

Query  759   VNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKDM  580
               IVGWIC+ FS+CVF APL IV +V+KT+SVE+MPF LSFFLTL+AVMW  YGLL KD 
Sbjct  126   AQIVGWICLIFSLCVFVAPLGIVRQVIKTQSVEYMPFLLSFFLTLSAVMWFFYGLLRKDY  185

Query  579   CIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLHSSVEDS  400
              IA+PNVLGF LG++QMVLY IY+N K  +V +E K A  E  + +    +L    +++ 
Sbjct  186   NIAIPNVLGFTLGVLQMVLYVIYKNAK--KVTKEIKIAEKENTVTIVEEHKLSEDLLKEQ  243

Query  399   KTTAITVSDAVTEE  358
                 + +S  V  E
Sbjct  244   IIDVVKLSAMVCSE  257



>ref|XP_009779208.1| PREDICTED: bidirectional sugar transporter SWEET12-like, partial 
[Nicotiana sylvestris]
Length=264

 Score =   262 bits (670),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/217 (58%), Positives = 168/217 (77%), Gaps = 1/217 (0%)
 Frame = -1

Query  1122  VFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSA  943
             +F FG+LGNI+S  VF++PVPTF  I K KS  G+QSVPYVV+LFS+MLW+YYA  K + 
Sbjct  1     IFAFGILGNIISFTVFISPVPTFYGIVKKKSAEGFQSVPYVVALFSSMLWIYYAMTKTNE  60

Query  942   PLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGTL  763
              L+I+INS GC+ ET+YI+I+  YA+K  R QT++++LLL  G + +I+  T    KG  
Sbjct  61    TLIITINSFGCIAETIYIAIYFAYATKKTRMQTLRLVLLLNFGGFGLILFLTQILCKGAK  120

Query  762   RVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKD  583
             R  ++GWIC+AFS+ VF APLSI+ +V++TKSVEFMPFNLS  LTL+AVMW  YGLLL+D
Sbjct  121   RAEVIGWICMAFSISVFVAPLSIMGRVIRTKSVEFMPFNLSLTLTLSAVMWFLYGLLLRD  180

Query  582   MCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK  472
             + + +PN+ G +LG++QMVLYGIYRN KP + AEEKK
Sbjct  181   IYVTVPNIAGMVLGVLQMVLYGIYRNAKPNQ-AEEKK  216



>ref|NP_001149087.1| MTN3 [Zea mays]
 gb|ACF85462.1| unknown [Zea mays]
 gb|ACG34136.1| MTN3 [Zea mays]
 gb|AFW56330.1| MTN3 [Zea mays]
Length=302

 Score =   263 bits (673),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 177/229 (77%), Gaps = 0/229 (0%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGN++S + FLAP+PTF RIYK+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGMSLQHPWAFAFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K +   LI+IN+ GCVIET+Y+ ++  YA K A+  T K+++LL GG++ VI+L
Sbjct  61    IFYALIKSNETFLITINAAGCVIETIYVVMYFVYAPKKAKLFTAKIMVLLNGGVFGVILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+  FKG+ RV ++GWICV FSV VF APLSI+ +V++TKSVE+MPF+LS  LTL+AV+
Sbjct  121   LTLLLFKGSKRVVLLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGA  466
             W  YGLL+KD  +ALPN+LGF  G+VQMVLY +Y N+ P+    E K A
Sbjct  181   WFLYGLLIKDKYVALPNILGFTFGVVQMVLYVLYMNKTPVAATAEGKDA  229



>gb|KFK34174.1| hypothetical protein AALP_AA5G110100 [Arabis alpina]
Length=290

 Score =   263 bits (672),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 134/246 (54%), Positives = 181/246 (74%), Gaps = 3/246 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M LFD H+ W FVFG++GN++S  VFL+PVPTF R++K K+T G+QS+PYVV+LFSA LW
Sbjct  1     MPLFDTHNTWAFVFGLMGNVISFAVFLSPVPTFYRVWKKKTTEGFQSLPYVVALFSATLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA  KK   LL++IN+ GC IET+YIS+FL YA K AR  T+K+LLL+  G + +I+L
Sbjct  61    LYYATQKKDVFLLVTINAFGCFIETIYISMFLAYAPKKARMLTVKLLLLMNFGGFCLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
                   KGT R  I+G ICV FSVCVFAAPLSI+  V+KT+SVE+MPF+LS  LT++AV+
Sbjct  121   LCQLLAKGTTRTKIIGGICVGFSVCVFAAPLSIIRTVIKTRSVEYMPFSLSLTLTISAVI  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK---GAVPELVINV  442
             WL YGL LKD+ +A PNV+GF LG +QM+LY +Y+  K      EK+     +PE+ +++
Sbjct  181   WLLYGLALKDIYVAFPNVIGFALGALQMILYVVYKYCKTTPHLGEKEVEAAKLPEVSLDM  240

Query  441   AGLGEL  424
               LG +
Sbjct  241   LKLGTI  246



>gb|EMT03611.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=294

 Score =   263 bits (671),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 135/256 (53%), Positives = 181/256 (71%), Gaps = 4/256 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M    + HPW F FG+LGN++S    LAP+PTF RI+K+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MGGLSMEHPWAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K    LLISIN+ GCVIET+YI ++L YA + A+  T K+++LL    + +I L
Sbjct  61    IFYALVKTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNIAGFGLIFL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+F F G  RV  +GWICV FSVCVF APLSI+ +V+KTKSVE+MPF LS  LTL+A++
Sbjct  121   LTLFAFHGETRVVTLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFTLSLTLTLSAIV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPL--EVAEEKKG--AVPELVIN  445
             W  YGLL+KD  +ALPN+LGF  G++QMVLY  Y N+ P+  +V E K+   A  E  + 
Sbjct  181   WFLYGLLIKDKYVALPNILGFTFGVIQMVLYVFYMNKTPMASQVKEGKEAWKAPAEDHVV  240

Query  444   VAGLGELLHSSVEDSK  397
             V  +G+   SS  + +
Sbjct  241   VINVGKADKSSCAEVR  256



>ref|XP_008791098.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Phoenix 
dactylifera]
Length=296

 Score =   263 bits (672),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 138/248 (56%), Positives = 182/248 (73%), Gaps = 4/248 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGNI+S +V++AP+PTF R+Y  KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLDHPWAFTFGILGNIISFMVYVAPLPTFYRVYIKKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA +K  + LL++INSIGC+IET+YI ++L YA K AR  T ++LLLL  GL+ +IVL
Sbjct  61    IYYALIKTDSYLLVTINSIGCIIETMYIIMYLSYAPKKARIFTAQILLLLNVGLFGLIVL  120

Query  792   ATMFPFKG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
              T+   KG   +V ++GW+CV+FS+ VF APLSI+  V++TKSVEFMPF LSFFLTL+A+
Sbjct  121   LTLLLAKGPREQVRVLGWVCVSFSISVFVAPLSIIRLVIRTKSVEFMPFWLSFFLTLSAI  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAG  436
              W  YGLL KD+ +ALPN+LGF+ G+VQM +Y  Y+  K     + K   V E +I +A 
Sbjct  181   AWFSYGLLTKDIYVALPNILGFIFGVVQMGIYIAYKGAKRAAYDQNK---VAEHIITMAK  237

Query  435   LGELLHSS  412
             LG    SS
Sbjct  238   LGTGERSS  245



>ref|XP_009803865.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Nicotiana 
sylvestris]
Length=288

 Score =   262 bits (670),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 138/264 (52%), Positives = 183/264 (69%), Gaps = 19/264 (7%)
 Frame = -1

Query  1125  WVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKS  946
             W   FGVLGNIVS +VFL+P+PTF  IYK KST GYQS+PYVV+LFS +LW+YYA L   
Sbjct  9     WTSAFGVLGNIVSFMVFLSPLPTFYSIYKKKSTEGYQSIPYVVALFSCVLWIYYALLMPQ  68

Query  945   APLL--ISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFK  772
             + L+  I+IN+IGC IET Y+ I+L YA K AR QT+KMLLLLV G +  +VL   F FK
Sbjct  69    SNLIFIITINTIGCFIETFYVGIYLFYAPKKARVQTVKMLLLLVVGGFGAMVLVIQFLFK  128

Query  771   GTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLL  592
             G +R  IVGWIC+ FSVC FAAPL I+ KV+KTKSVE+MPF LS FLTL AVMW  YGLL
Sbjct  129   GAVRGQIVGWICLVFSVCTFAAPLCILRKVIKTKSVEYMPFLLSLFLTLNAVMWFFYGLL  188

Query  591   LKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEK-------------KGAVPEL-  454
              ++  +A+PN+LGF  GI+QM+LY +Y  ++   + E+K             +  +P+L 
Sbjct  189   KRNKIVAIPNILGFTFGILQMILYVVYNKKEKNVIKEQKLRELQNHVIISDEQKKLPQLT  248

Query  453   ---VINVAGLGELLHSSVEDSKTT  391
                +I++  LG +++S   +++ T
Sbjct  249   EEQIIDIVKLGAIVYSEKFNARGT  272



>sp|Q2QR07.1|SWT13_ORYSJ RecName: Full=Bidirectional sugar transporter SWEET13; Short=OsSWEET13 
[Oryza sativa Japonica Group]
 gb|ABA98216.1| N3 like protein, putative, expressed [Oryza sativa Japonica Group]
 gb|EAZ20456.1| hypothetical protein OsJ_36063 [Oryza sativa Japonica Group]
 dbj|BAH01364.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGS56390.1| major disease resistance protein xa25 [Oryza sativa Indica Group]
Length=296

 Score =   263 bits (671),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 142/265 (54%), Positives = 187/265 (71%), Gaps = 12/265 (5%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGN++S   +LAP+PTF RIYK+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K +  LLI+IN+ GCVIET+YI ++L YA K A+  T K+LLLL  G++ VI+L
Sbjct  61    IFYALIKSNEALLITINAAGCVIETIYIVMYLAYAPKKAKVFTTKILLLLNVGVFGVILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+    G  RV  +GW+CVAFSV VF APLSI+ +V++++SVE+MPF+LS  LTL+AV+
Sbjct  121   LTLLLSHGEQRVVSLGWVCVAFSVSVFVAPLSIIKRVIQSRSVEYMPFSLSLTLTLSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKG-----AVPEL--  454
             W  YGLL+KD  +ALPN+LGF  G+VQM LY  Y N  P+   E K+G     A  EL  
Sbjct  181   WFLYGLLIKDKYVALPNILGFTFGVVQMGLYVFYMNATPV-AGEGKEGKGKLAAAEELPV  239

Query  453   VINVAGLGELLHSSVEDSKTTAITV  379
             V+NV  L     ++  D  T A+ V
Sbjct  240   VVNVGKLA----AATPDRSTGAVHV  260



>ref|XP_002453892.1| hypothetical protein SORBIDRAFT_04g021000 [Sorghum bicolor]
 gb|EES06868.1| hypothetical protein SORBIDRAFT_04g021000 [Sorghum bicolor]
Length=336

 Score =   264 bits (674),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 168/224 (75%), Gaps = 1/224 (0%)
 Frame = -1

Query  1152  MALFDL-HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAML  976
             MA  ++    W F FG+LGNI+SL+VFL+P+PTF R+Y+ KST G+QS PYVV+LFS ML
Sbjct  1     MAFLNMEQQTWAFTFGILGNIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYVVTLFSCML  60

Query  975   WMYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             W++YA LK  A LL++IN +GCVIET+Y+ ++L YA K AR  T KMLL L  G++ ++ 
Sbjct  61    WIFYALLKSGAELLVTINGVGCVIETVYLGMYLLYAPKAARVLTAKMLLGLNVGVFGLVA  120

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             L TM    G LRV ++GWICV+ ++ VFAAPLSI+ +V++TKSVEFMP +LSFFL L+AV
Sbjct  121   LVTMVLSNGGLRVKVLGWICVSVALSVFAAPLSIMRQVIRTKSVEFMPISLSFFLVLSAV  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVA  484
             +W  YG L KD+ +A PNVLGF+ G+ QM LY  YRN+KP   A
Sbjct  181   IWFAYGALKKDVFVAAPNVLGFVFGLAQMALYMAYRNKKPAAAA  224



>gb|EMT20808.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=290

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 135/256 (53%), Positives = 181/256 (71%), Gaps = 4/256 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M    + HPW F FG+LGN++S    LAP+PTF RI+K+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MGGLSMEHPWAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K    LLISIN+ GCVIET+YI ++L YA + A+  T K+++LL    + +I L
Sbjct  61    IFYALVKTGEGLLISINAAGCVIETVYIVMYLVYADRKAKIFTAKIVVLLNIAGFGLIFL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+F F G  RV  +GWICV FSVCVF APLSI+ +V+KTKSVE+MPF LS  LTL+A++
Sbjct  121   LTLFAFHGETRVVTLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFTLSLTLTLSAIV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPL--EVAEEKKG--AVPELVIN  445
             W  YGLL+KD  +ALPN+LGF  G++QMVLY  Y N+ P+  +V E K+   A  E  + 
Sbjct  181   WFLYGLLIKDKYVALPNILGFTFGVIQMVLYVFYMNKTPVASQVKEGKEAWKAPAEDHVV  240

Query  444   VAGLGELLHSSVEDSK  397
             V  +G+   SS  + +
Sbjct  241   VINVGKADKSSCAEVR  256



>ref|NP_001141654.1| hypothetical protein [Zea mays]
 gb|ACF86797.1| unknown [Zea mays]
 gb|AFW56326.1| hypothetical protein ZEAMMB73_553683 [Zea mays]
Length=301

 Score =   263 bits (671),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 140/250 (56%), Positives = 186/250 (74%), Gaps = 6/250 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGN++S + FLAP+PTF RIYK+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLEHPWAFAFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K +   LI+IN+ GCVIET+YI ++  YA K A+  T K++ LL GG++ VI+L
Sbjct  61    IFYALIKSNETFLITINAAGCVIETIYIVMYFVYAPKKAKLFTAKIMALLNGGVFGVILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+  FKG+ RV ++GWICV FSV VF APLSI+ +V++TKSVE+MPF+LS  LTL+AV+
Sbjct  121   LTLLLFKGSKRVVLLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK-GAVP-----ELV  451
             W  YGLL+KD  +ALPNVLGF+ G+VQMVLY  Y N+ P+  A  K  G +P      ++
Sbjct  181   WFLYGLLIKDKYVALPNVLGFIFGVVQMVLYVFYMNKTPVAAAVGKDAGKLPSAADEHVL  240

Query  450   INVAGLGELL  421
             +N+A L   L
Sbjct  241   VNIAKLNPAL  250



>ref|NP_001141106.1| uncharacterized protein LOC100273190 [Zea mays]
 gb|ACF85414.1| unknown [Zea mays]
Length=295

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/273 (53%), Positives = 191/273 (70%), Gaps = 8/273 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGN++S + FLAP+PTF RIYK+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLQHPWAFTFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K +   LI+IN+ GCVIET+Y+ ++  YA+K  R  T K++LLL  G +  I+L
Sbjct  61    IFYALIKSNETFLITINAAGCVIETVYVVMYFVYATKKGRMFTAKIMLLLNVGAFGAILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+  FKG  RV ++GWICV FSV VF APLSI+ +V++TKSVE+MPF+LS  LTL+AV+
Sbjct  121   LTLLLFKGDKRVVMLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEK-KGAVP-----ELV  451
             W  YGLL+KD  +ALPN+LGF  G+VQMVLY +Y N+ PL VA+ K  G +P      +V
Sbjct  181   WFLYGLLIKDKYVALPNILGFTFGVVQMVLYVVYMNKTPLPVADGKAAGKLPSAADEHVV  240

Query  450   INVAGLGELLHSSVEDSKTTAITVSDAVTEEKA  352
             +NV  L       V  ++  A+      TE  A
Sbjct  241   VNVTKLSPGRLPPV--TQMAAVPTKSCATEAAA  271



>ref|XP_004980522.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Setaria 
italica]
Length=299

 Score =   262 bits (670),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 144/263 (55%), Positives = 185/263 (70%), Gaps = 14/263 (5%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HP  F FG+LGNI+S + +LAP+PTF RIYK KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLDHPLAFTFGLLGNIISFMTYLAPLPTFYRIYKTKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK    LLI++N+ GCVIETLYI+++L YA K A+  T  +LLLL  G++ +I+L
Sbjct  61    IYYALLKSDEFLLITVNAAGCVIETLYITMYLAYAPKKAKLFTAMILLLLNVGVFGLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              TM    G  RV ++GW+CV F+V VF APLSI+ +VV+T+SVEFMPF LS  LT++AV+
Sbjct  121   LTMLLAAGEKRVVLLGWVCVGFAVSVFVAPLSIIRQVVRTRSVEFMPFFLSLSLTVSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPL----EVAEEKKG------AV  463
             W  YGLL+KD  +ALPNV+GF  G++QM LY +YRN  P     EVA+ K         V
Sbjct  181   WFLYGLLIKDKYVALPNVIGFTFGVIQMGLYALYRNATPRVPAKEVADVKATVVDDTFKV  240

Query  462   PELVINVAGLG----ELLHSSVE  406
             PE V+ +A LG    E+L S V 
Sbjct  241   PEHVVTIAKLGAPAVEILTSEVH  263



>gb|ACU23483.1| unknown [Glycine max]
Length=258

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/222 (58%), Positives = 173/222 (78%), Gaps = 1/222 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H  W F+FG+LGN++S +VFLAP+PTF +IYK KS+ G+QS+PYVV+LFS+MLW+YYA +
Sbjct  5     HETWAFIFGLLGNVISFMVFLAPLPTFYQIYKKKSSEGFQSLPYVVALFSSMLWIYYALV  64

Query  954   KKSAPLL-ISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFP  778
             KK A LL I+INS GCVIET++++IFL YA    R  T+K+LL+L    +  ++L+T++ 
Sbjct  65    KKDASLLLITINSFGCVIETIHLAIFLVYAPSKTRLWTIKLLLMLNVFGFGGMLLSTLYL  124

Query  777   FKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
               G+ R++++GWIC+ F++ VFAAPL I+ +V+KT+SVEFMPF+LS  LT+ AVMW  YG
Sbjct  125   TTGSKRLSVIGWICLVFNISVFAAPLCIMKRVIKTRSVEFMPFSLSSSLTINAVMWFFYG  184

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK  472
             LLLKD  IALPN LGFL GI+QMVLY +YRN KP  + E  K
Sbjct  185   LLLKDYYIALPNTLGFLFGIIQMVLYLVYRNAKPQTLEEPTK  226



>ref|XP_004242139.1| PREDICTED: bidirectional sugar transporter SWEET9-like [Solanum 
lycopersicum]
Length=289

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 171/216 (79%), Gaps = 2/216 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA F +H  WVF FGVLGNI+S  VFL+P+PTF ++YK KST GYQS+PY+V+LFSAMLW
Sbjct  1     MADFSVH--WVFAFGVLGNIISFFVFLSPLPTFYKMYKKKSTEGYQSIPYIVALFSAMLW  58

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYAFLK +  LLI+IN+ GC +E +YI  +L YASK AR QT+K+LLLLV G +  IVL
Sbjct  59    IYYAFLKTNTTLLITINTFGCFVEIMYIGFYLFYASKEARVQTVKLLLLLVVGGFGAIVL  118

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              + F F+G +RV +VG IC+  S+CVF APL IV +V+KTKSVE+MPF LS FLTL+AVM
Sbjct  119   VSQFLFEGAVRVQVVGCICLICSLCVFVAPLCIVRQVIKTKSVEYMPFLLSVFLTLSAVM  178

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRN  505
             W  YG+LL+D  IA+PNVLGF+ GI+QMVLY +Y N
Sbjct  179   WFFYGILLEDFNIAIPNVLGFIFGILQMVLYVMYYN  214



>gb|AFK39311.1| unknown [Lotus japonicus]
Length=260

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 177/231 (77%), Gaps = 2/231 (1%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H+   F FG+LGN++S +VFLAP+ TF RIYK KST G+QS+PY+V+LFS+MLW+YYA +
Sbjct  5     HNTLAFTFGMLGNVISFMVFLAPIATFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYAMV  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK A LLI+INS GCVIE +YI +++ YA + AR  T+K+   +  G +++I+L T F  
Sbjct  65    KKDAFLLITINSFGCVIEIIYIILYMIYAPRDARNLTLKLFTAMNVGSFALILLVTHFAV  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G LRV ++GWICV+ +V VFAAPLSIV +VV+TKSVEFMPFNLSF LTL+A MW GYGL
Sbjct  125   HGPLRVQVLGWICVSIAVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSATMWFGYGL  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINV  442
              LKD+CIALPN+LGF LG++QMVLY IYRN    E  ++   A+  +VI +
Sbjct  185   FLKDICIALPNILGFGLGLIQMVLYAIYRNGN--EKGKKPAAALKSVVIEI  233



>gb|AHB08882.1| bidirectional sugar transporter SWEET14-like protein [Suaeda 
glauca]
Length=323

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 170/224 (76%), Gaps = 0/224 (0%)
 Frame = -1

Query  1146  LFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMY  967
             +F +H+PWVF FG+LGNI+S +VFLAP+PTFIR+YK KST G+QSVPYVV++FSAMLW+Y
Sbjct  1     MFTIHNPWVFAFGILGNIISFMVFLAPLPTFIRVYKKKSTEGFQSVPYVVAIFSAMLWIY  60

Query  966   YAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLAT  787
             YA LK ++ LLI+IN  G +IET+Y++IF+ YA + AR  T+K+L+LL  G +  I+L  
Sbjct  61    YAMLKGNSVLLITINIAGVIIETIYVAIFITYAPRQARISTLKLLMLLNFGGFCGIILLC  120

Query  786   MFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWL  607
              +  KG  R+ + GWICVAFS+ VF APLS++  V++TKSVE+MPFNLS  LTLTA +W 
Sbjct  121   HYLAKGQARLQLYGWICVAFSISVFVAPLSVIRTVIRTKSVEYMPFNLSCCLTLTATVWF  180

Query  606   GYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEK  475
              YG + KD+ + LPNV+GF+ GI QM LY +Y  +   E  ++K
Sbjct  181   FYGFVQKDLYVTLPNVVGFIFGIAQMTLYLVYSRKYGKEAEKQK  224



>gb|ACG28570.1| MTN3 [Zea mays]
Length=295

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 144/273 (53%), Positives = 191/273 (70%), Gaps = 8/273 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGN++S + FLAP+PTF RIYK+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLQHPWAFTFGLLGNVISFMTFLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K +   LI+IN+ GCVIET+Y+ ++  YA+K  R  T K++LLL  G +  I+L
Sbjct  61    IFYALIKSNETFLITINAAGCVIETVYVVMYFVYATKKGRMFTAKIMLLLNVGAFGSILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+  FKG  RV ++GWICV FSV VF APLSI+ +V++TKSVE+MPF+LS  LTL+AV+
Sbjct  121   LTLLLFKGDKRVVMLGWICVGFSVSVFVAPLSIMRRVIQTKSVEYMPFSLSLSLTLSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEK-KGAVP-----ELV  451
             W  YGLL+KD  +ALPN+LGF  G+VQMVLY +Y N+ PL VA+ K  G +P      +V
Sbjct  181   WFLYGLLIKDKYVALPNILGFTFGVVQMVLYVVYMNKTPLPVADGKAAGKLPSAADEHVV  240

Query  450   INVAGLGELLHSSVEDSKTTAITVSDAVTEEKA  352
             +NV  L       V  ++  A+      TE  A
Sbjct  241   VNVTKLSPGRLPPV--TQMAAVPTKSCATEAAA  271



>sp|P93332.1|NOD3_MEDTR RecName: Full=Bidirectional sugar transporter N3; AltName: Full=Nodulin 
3; Short=MtN3; Short=N-3 [Medicago truncatula]
 emb|CAA69976.1| MtN3 [Medicago truncatula]
Length=268

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             H+   F FG+LGN++S LVFLAP+ TF RIYK KST G+QS+PY+V+LFS+MLW+YYA L
Sbjct  5     HNTLAFTFGMLGNVISFLVFLAPISTFYRIYKKKSTEGFQSLPYLVALFSSMLWLYYALL  64

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             KK A LLI+INS GCV+ET+YI +++ YA + AR  T K+L  +  G +++I++ T +  
Sbjct  65    KKDAFLLITINSFGCVVETIYIILYIIYAPRDARNLTFKLLSAMNVGSFALILIVTNYAV  124

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
              G LRV ++GW+CV+ SV VFAAPLSIV +VV+TKSVEFMPFNLSF LTL+A MW GYG 
Sbjct  125   HGPLRVQVLGWVCVSLSVSVFAAPLSIVAQVVRTKSVEFMPFNLSFTLTLSATMWFGYGF  184

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRN  505
              LKD+CI LPNVLG +LG++QM+LY IYRN
Sbjct  185   FLKDICIXLPNVLGXVLGLLQMLLYAIYRN  214



>ref|NP_001131289.1| mtN3-like protein [Zea mays]
 gb|ACF79630.1| unknown [Zea mays]
 gb|ACG31892.1| mtN3-like protein [Zea mays]
 gb|AFW60846.1| mtN3-like protein [Zea mays]
Length=293

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 173/225 (77%), Gaps = 0/225 (0%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HP  F FG+LGNI+S + +LAP+PTF RIYK KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLLHPMAFAFGLLGNIISFMTYLAPLPTFYRIYKNKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK +  LLI+INS GCVIETLYI+++L YA K A+  T K+LLLL  G++ +I+L
Sbjct  61    IYYALLKSNELLLITINSAGCVIETLYIAMYLLYAPKKAKLFTAKILLLLNVGVFGLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+    G  RV ++GW+CVAFSV VF APLSI+ +VV+T+SVEFMPF+LS  LT++AV+
Sbjct  121   LTLLLSAGQRRVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEE  478
             W  YGLL+KD  +ALPNV+GF  G+VQM LY +YRN  P   A++
Sbjct  181   WFLYGLLIKDKYVALPNVIGFSFGVVQMGLYALYRNATPRVPAKD  225



>gb|KDP22572.1| hypothetical protein JCGZ_26403 [Jatropha curcas]
Length=289

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 139/260 (53%), Positives = 182/260 (70%), Gaps = 16/260 (6%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M LF   +P  F FG+LGNI S +VFLAP+PTFIR+ K KST G+QS PY+VSLFSA + 
Sbjct  1     MGLFSTDNPGAFAFGLLGNITSFVVFLAPIPTFIRVCKKKSTEGFQSFPYLVSLFSASIL  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK     L++INS GC IET+YI++F+ YA K AR  T+++LLL   G + +I+L
Sbjct  61    LYYATLKTDGFFLMTINSFGCFIETIYIALFIVYAPKQARMSTLRILLLFDFGGFCLILL  120

Query  792   ATMFPFKG-TLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
              + F  KG + R+ ++GW+ V FS  VFAAPLSI+  V+KTKSVEF+PF LSFFLTL+A+
Sbjct  121   LSHFLAKGPSARIQMLGWVNVVFSFAVFAAPLSIMRVVIKTKSVEFLPFPLSFFLTLSAI  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAG  436
             MWL YG+L+KD+ IA PNVLGFL G+VQM+L+ IYRN KP  VA++              
Sbjct  181   MWLFYGILVKDLYIAGPNVLGFLCGVVQMILFVIYRNHKPATVAKDP-------------  227

Query  435   LGELLHSSVEDSKTTAITVS  376
               EL  +SV+D K  +IT  
Sbjct  228   --ELQQNSVDDIKLESITCE  245



>ref|XP_002443163.1| hypothetical protein SORBIDRAFT_08g013620 [Sorghum bicolor]
 gb|EES17001.1| hypothetical protein SORBIDRAFT_08g013620 [Sorghum bicolor]
Length=304

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 140/251 (56%), Positives = 185/251 (74%), Gaps = 7/251 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGN++S + FLAP+PTF RIYK KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLQHPWAFAFGLLGNVISFMTFLAPIPTFYRIYKTKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K +   LI+IN+ GCVIET+YI ++  YA K  +  T K++LLL  G++ VI+L
Sbjct  61    IFYALIKSNETFLITINAAGCVIETIYIIMYFVYAPKKGKMFTAKIMLLLNVGIFGVILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+  FKG  RV ++GWICV FSV VF APLSI+ +V++TKSVE+MPF+LS  LTL+AV+
Sbjct  121   LTLLLFKGDKRVVMLGWICVGFSVSVFVAPLSIMKRVIQTKSVEYMPFSLSLSLTLSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKK--GAVP-----EL  454
             W  YGLL+KD  +ALPN+LGF  G+VQMVLY +Y N+ P+ VAE K   G +P      +
Sbjct  181   WFLYGLLIKDKYVALPNILGFTFGVVQMVLYVLYMNKTPVAVAEGKDAGGKLPSAADEHV  240

Query  453   VINVAGLGELL  421
             ++N+A L   L
Sbjct  241   LVNIAKLSPAL  251



>gb|EMS51422.1| Bidirectional sugar transporter SWEET13 [Triticum urartu]
Length=290

 Score =   261 bits (666),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 130/230 (57%), Positives = 170/230 (74%), Gaps = 2/230 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M    + HPW F FG+LGN++S    LAP+PTF RI+K+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MGGLSMEHPWAFAFGLLGNVISFSSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K    LLISIN+ GCVIET+YI ++L YA + A+  T K+++LL    + +I L
Sbjct  61    IFYALVKTGEGLLISINAAGCVIETVYIVMYLVYAPRKAKIFTAKIVVLLNITGFGLIFL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+F F G  RV  +GWICV FSVCVF APLSI+ +V+KTKSVE+MPF LS  LTL+A++
Sbjct  121   LTLFAFHGETRVVSLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFTLSLTLTLSAIV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPL--EVAEEKKG  469
             W  YGLL+KD  +ALPN+LGF  G++QMVLY  Y N+ P+  EV E K+ 
Sbjct  181   WFLYGLLIKDKYVALPNILGFTFGVIQMVLYVFYMNKTPVASEVKEGKEA  230



>ref|XP_009403777.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Musa 
acuminata subsp. malaccensis]
Length=288

 Score =   260 bits (665),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 187/267 (70%), Gaps = 11/267 (4%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGNI+S +V+LAP+PTF R+Y+ KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLDHPWAFTFGILGNIISFMVYLAPLPTFYRVYRGKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             + YAFLK  A LLI+INS GCVIE++Y+ ++  YA K+A+  T K++L+L  G++  I+L
Sbjct  61    VLYAFLKTDAFLLITINSFGCVIESVYVVLYFTYAPKLAKILTAKLVLVLNVGMFGSILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+    G  RV ++GWIC+ FSV VF APLSI+  V++TKSVEFMPF LSFFLTL++++
Sbjct  121   LTLLLPDGLKRVRVLGWICMCFSVSVFVAPLSIIRLVIRTKSVEFMPFMLSFFLTLSSIV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGL  433
             W  YG L KD  +ALPNVLGF  G++QM LY  ++  KP  V       +PE +I+++ L
Sbjct  181   WFAYGCLTKDKFVALPNVLGFAFGLLQMGLYLAFKCMKPTAVEPR----LPEHIISISML  236

Query  432   GELLHSSVEDSKTTAITVSDAVTEEKA  352
             G  ++    D KT  +       EEKA
Sbjct  237   GVEVYPI--DWKTPEVN-----DEEKA  256



>ref|XP_008459891.1| PREDICTED: bidirectional sugar transporter N3 [Cucumis melo]
Length=277

 Score =   260 bits (664),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 132/268 (49%), Positives = 192/268 (72%), Gaps = 3/268 (1%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F   H  VF FG+LGNI+S  V+LAP+PTF RI++ KST G+ ++PY+V+LFS+ LW
Sbjct  1     MAIFHSPHLLVFTFGLLGNIISFFVYLAPLPTFYRIWQKKSTEGFHALPYLVALFSSALW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             + YAFLK +  LLI+INS GCVIE LY  +F+ +A+   R  T+++  ++  GL+ +I++
Sbjct  61    LCYAFLKTNTFLLITINSFGCVIEFLYFIVFIVFAANSVRMLTIRIFAMMNMGLFGLILV  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
             A  F    + R++++GWICVA SV VFAAPLSI+ +V+ TKSVEFMPF LSFFLTL+A+M
Sbjct  121   AIHFISNPSNRIDVMGWICVAVSVSVFAAPLSILRQVMTTKSVEFMPFTLSFFLTLSAIM  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELV--INVA  439
             W  YGLLL D+CIA+PNV+GF+LG++QMV+Y IYR +K + + EEKK   P ++  I V+
Sbjct  181   WFAYGLLLNDICIAIPNVVGFILGLLQMVVYAIYRKRK-IVIMEEKKQPEPVVLKSIAVS  239

Query  438   GLGELLHSSVEDSKTTAITVSDAVTEEK  355
              +  +  +S  D++   + +     +E 
Sbjct  240   EVFAMKKASGNDAQLKEVIIIKQEAQED  267



>ref|XP_007148462.1| hypothetical protein PHAVU_006G210800g [Phaseolus vulgaris]
 gb|ESW20456.1| hypothetical protein PHAVU_006G210800g [Phaseolus vulgaris]
Length=273

 Score =   260 bits (664),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 138/268 (51%), Positives = 184/268 (69%), Gaps = 8/268 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+   H+PW   FG+LGNI+SL+V+LAP  TF RIYK K T G+QS+PY+V+LFS+ LW
Sbjct  1     MAILGSHNPWAAAFGILGNIISLMVYLAPAHTFYRIYKKKCTEGFQSLPYLVALFSSSLW  60

Query  972   MYYA-FLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             +YYA F  K +  LI+INS+GCVIE +YI IF+ YA K A+  T+K++  +  G  ++I+
Sbjct  61    LYYASFNIKHSVFLITINSLGCVIEIVYIVIFIKYAHKDAKNLTIKLVAAMNLGSLALIL  120

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             L T F    +L+V ++GWIC   S+ VFAAPLSI+ +VV+TKSV+FMPF+LSF LTL A+
Sbjct  121   LVTHFALNASLQVKVIGWICDIVSLSVFAAPLSIMAQVVRTKSVQFMPFSLSFSLTLNAI  180

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAG  436
             MWL YGL  KD C+ALPNV G  LG++QMVLY IYRN    E+A E  G    +V+N  G
Sbjct  181   MWLAYGLFNKDNCVALPNVGGVALGLLQMVLYAIYRNCGARELATE-GGMRTIVVVNPLG  239

Query  435   LGELLHSSVEDSKTTAITVSDAVTEEKA  352
               E+   +  D       V+D V E+ A
Sbjct  240   PAEVFPIAENDE------VNDEVAEDHA  261



>ref|XP_011083538.1| PREDICTED: bidirectional sugar transporter SWEET14-like [Sesamum 
indicum]
Length=278

 Score =   260 bits (664),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 133/232 (57%), Positives = 172/232 (74%), Gaps = 10/232 (4%)
 Frame = -1

Query  1119  FVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSAP  940
             FVFG+LGN+VS +VFLAP+PTF +IYK KST G+QSVPYVV LFSAMLW+YYAFLK    
Sbjct  6     FVFGLLGNVVSFMVFLAPIPTFYQIYKKKSTEGFQSVPYVVGLFSAMLWIYYAFLKPDTT  65

Query  939   LLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGTLR  760
             LLI+INS+GC I++ YI  +L +A + AR QT+K+LLLL    + +I++ T F  KG+ R
Sbjct  66    LLITINSVGCFIQSAYICFYLFFAPRNARVQTVKLLLLLNTVGFGLIMVLTYFLAKGSNR  125

Query  759   VNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKDM  580
              N VGWIC+ FS+CVF APL +V +V++TKS E+MPF LSFFLT++A++W  YG L KD 
Sbjct  126   ANFVGWICLVFSLCVFVAPLCVVRQVLRTKSAEYMPFLLSFFLTISAIVWFFYGFLRKDY  185

Query  579   CIALPNVLGFLLGIVQMVLYGIYRNQKPLE----------VAEEKKGAVPEL  454
              IA+PNVLGF+ G++QMVLY IYRN K L           +A E +  +PEL
Sbjct  186   NIAIPNVLGFIFGVLQMVLYLIYRNGKTLVQENQQLPAGIIAVEDEKQLPEL  237



>ref|XP_010039121.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Eucalyptus 
grandis]
 gb|KCW49070.1| hypothetical protein EUGRSUZ_K02670 [Eucalyptus grandis]
Length=284

 Score =   260 bits (664),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 137/283 (48%), Positives = 192/283 (68%), Gaps = 17/283 (6%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F   +PW F FG+LGN++S +VFLAPVPTF  + K KST G+QSVPYVVSL SAMLW
Sbjct  1     MAIFSTDNPWAFAFGLLGNLISFMVFLAPVPTFYGVCKRKSTEGFQSVPYVVSLLSAMLW  60

Query  972   MYYAFLKKSAP--LLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVI  799
             +YYA +   +   LL+++NS+GCVIET+Y++++L YA K A+  T K++++  GG  S I
Sbjct  61    LYYASINSESNDFLLVTVNSVGCVIETIYVALYLAYAPKKAKIFTAKLMVMGFGGFCSFI  120

Query  798   VLATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTA  619
             +L+  F  +G+ RV ++GW+CV FSV VFAAPLS++  V++TKSVEFMPF+LSFFLTL+A
Sbjct  121   LLSR-FLTEGSTRVQLLGWLCVGFSVIVFAAPLSVMRMVIRTKSVEFMPFSLSFFLTLSA  179

Query  618   VMWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQ--------------KPLEVAE  481
             V WL YG+ LKD+ IA+PNVLGF+LG++QM LY IYR +              KP+   +
Sbjct  180   VTWLLYGIFLKDIHIAVPNVLGFILGVLQMGLYLIYRKRNIMVLEKPDYLGGAKPIANTQ  239

Query  480   EKKGAVPELVINVAGLGELLHSSVEDSKTTAITVSDAVTEEKA  352
                 A  + VI+V  + E      E  K++  + ++ V     
Sbjct  240   SCSIASNDNVIHVDEVKERKEDVHEGEKSSEASDNEQVANSSC  282



>gb|EMT20481.1| Protein RUPTURED POLLEN GRAIN 1 [Aegilops tauschii]
Length=293

 Score =   260 bits (664),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 136/249 (55%), Positives = 179/249 (72%), Gaps = 9/249 (4%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             M    L HPW F FG+LGNI+S + +LAP+PTF RIY++KST G+QSVPYVV+LFSAMLW
Sbjct  1     MGGLSLEHPWAFAFGLLGNIISFMTYLAPLPTFYRIYRSKSTQGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             +YYA LK    LLI+INS GCVIET+YI ++L YA K A+  T K+LLLL  G++ +I+L
Sbjct  61    IYYALLKSDELLLITINSAGCVIETIYIIMYLTYAPKQAKLFTAKILLLLNVGVFGLILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+    G  RV ++GW+CV FSV VF APLS++  VV+T+SVEFMPF+LS  LT++AV+
Sbjct  121   LTLLLAGGEKRVVMLGWVCVGFSVSVFVAPLSVIRLVVRTRSVEFMPFSLSLSLTVSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEE------KKGA---VP  460
             W  YGLL+KD  +ALPN+LGF  G++QM LY +Y N  P +  +E        GA    P
Sbjct  181   WFLYGLLIKDKYVALPNILGFAFGVIQMGLYALYCNAMPRQAPKEVDDPMSDHGAAVKAP  240

Query  459   ELVINVAGL  433
             E V+N++ L
Sbjct  241   EHVVNISKL  249



>ref|XP_010037381.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Eucalyptus 
grandis]
 gb|KCW49081.1| hypothetical protein EUGRSUZ_K02684 [Eucalyptus grandis]
Length=265

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/230 (60%), Positives = 177/230 (77%), Gaps = 4/230 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+F   + WV +FGVLGNIVS++VF+APVPTF RI + KST G++SVPYVVSLFSAMLW
Sbjct  1     MAIFTTDNTWVLIFGVLGNIVSIVVFMAPVPTFCRICRKKSTEGFESVPYVVSLFSAMLW  60

Query  972   MYYAFLKK--SAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVI  799
             +YYA LK   SA LL+ +NS+GC IET+YI+++L YA K AR  T+ +LLL  GG Y  I
Sbjct  61    LYYASLKSESSAFLLLMVNSVGCAIETIYIALYLTYAPKQARMMTLTLLLLNFGG-YCSI  119

Query  798   VLATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTA  619
             +L + F  KG+ RV +VGWICVA S  VFAAPLS++  V++TKSVEF+PF+LSFFL L+A
Sbjct  120   LLLSHFLAKGSARVQLVGWICVALSAAVFAAPLSVIRMVIRTKSVEFLPFSLSFFLMLSA  179

Query  618   VMWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKG  469
             V WL YGL LKD+ +A PNVLG + G++QM L+ IYR +  + VAEE+K 
Sbjct  180   VTWLLYGLFLKDLYVAGPNVLGVIFGVLQMALHAIYRKRNKV-VAEEEKN  228



>ref|XP_002270131.1| PREDICTED: bidirectional sugar transporter SWEET14 [Vitis vinifera]
Length=276

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 143/270 (53%), Positives = 184/270 (68%), Gaps = 6/270 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+  + H   F FG+LGNIVS LV+L+P+PTF RIYK KST G+QS+PY V+LFSAML 
Sbjct  1     MAMLTVPH-MAFAFGILGNIVSFLVYLSPLPTFYRIYKRKSTEGFQSIPYSVALFSAMLL  59

Query  972   MYYAFLKKSAP-LLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             +YYAFLK     +LI+INS+G  IE  Y+ +++ YA + A+  T K+LLL   G+Y  IV
Sbjct  60    LYYAFLKTDNQIMLITINSVGTCIEATYLLVYMIYAPRTAKIYTAKLLLLFNTGVYGAIV  119

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             L+T F  KG  R  IVGW+C AFS+CVFAAPLSI+  V++TKSVE+MPF LSFFLT+ AV
Sbjct  120   LSTFFLSKGHRRAKIVGWVCAAFSLCVFAAPLSIMRLVIRTKSVEYMPFPLSFFLTICAV  179

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPE-LVINVA  439
             MW  YGLL++D  IA PN+LGF  GI QM+LY IY+N K   +AE K   +P  LV    
Sbjct  180   MWFFYGLLIRDFYIAFPNILGFAFGIAQMILYTIYKNAKKGVLAEFKLQELPNGLVFPTL  239

Query  438   GLGELLHSSVEDS-KTTAITVSDAVTEEKA  352
                E   ++  D  + TA+T   A   +KA
Sbjct  240   KKAENTDTNPNDQPEDTAMTEGGA--RDKA  267



>ref|XP_002511125.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51727.1| conserved hypothetical protein [Ricinus communis]
Length=285

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 172/226 (76%), Gaps = 1/226 (0%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HHP +F FGVLGNI+S+L+FL+P+ TFIR+YK KST G+QS+PYVV+LFS MLW+YYA L
Sbjct  6     HHPLIFTFGVLGNIISILMFLSPMFTFIRVYKKKSTEGFQSIPYVVALFSCMLWIYYAML  65

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K    LL+SINS GC+++T+YI +F+ YA K A+  T+++L L+    +  IV  T F  
Sbjct  66    KSGDYLLLSINSFGCLVQTIYIVLFIFYAEKKAKILTLQLLFLMNFAGFLAIVALTRFFA  125

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
             KG+ R++IVGW CVA S  +FAAPLS++  VV+TKSVEFMPF LS FLTL+A+MWL YG+
Sbjct  126   KGSSRLHIVGWFCVAVSAVLFAAPLSVIRLVVRTKSVEFMPFTLSLFLTLSAIMWLLYGV  185

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRN-QKPLEVAEEKKGAVP  460
             LLKD+ IALPN+ G + G +QMVLY IYR+ +K +E+ E+     P
Sbjct  186   LLKDLYIALPNIFGLVFGAIQMVLYVIYRDGKKVIELPEKIDMDSP  231



>gb|EMS48886.1| Bidirectional sugar transporter SWEET13 [Triticum urartu]
Length=395

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 142/277 (51%), Positives = 190/277 (69%), Gaps = 10/277 (4%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   + HPW F FG+LGNI+S    LAP+PTF RI+K+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSMEHPWAFAFGLLGNIISFTSLLAPIPTFYRIFKSKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K    LLI+IN+ GCVIET+YI ++L YA + A+  T K++LLL    + +I L
Sbjct  61    IFYALVKTGEGLLITINAAGCVIETIYIVMYLVYAPRKAKIFTAKIVLLLNIAGFGLIFL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+F F+G  RV  +GWICV FSVCVF APLSI+ +V+KTKSVE+MPF+LS  LTL+A++
Sbjct  121   LTVFAFQGETRVVSLGWICVGFSVCVFVAPLSIIGRVIKTKSVEYMPFSLSLTLTLSAIV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPL---EVAEEKKG-AVP-ELVI  448
             W  YGLL+KD  +ALPN+LGF  G++QMVLY  Y N  P+   +V E K+   VP E  +
Sbjct  181   WFLYGLLIKDKYVALPNILGFTFGMIQMVLYMFYMNATPVVTSDVKEVKEAWKVPAEDQV  240

Query  447   NVAGLGELLHSSVEDSK-----TTAITVSDAVTEEKA  352
              V  +G+   SS  + +      +A+ V      E A
Sbjct  241   VVINVGKADKSSCAEVRPVTEMASAVDVPRRCAAEAA  277



>gb|EAY83053.1| hypothetical protein OsI_38270 [Oryza sativa Indica Group]
 gb|AGS56391.1| disease susceptible protein Xa25 [Oryza sativa Indica Group]
Length=293

 Score =   259 bits (662),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 172/228 (75%), Gaps = 1/228 (0%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA   L HPW F FG+LGN++S   +LAP+PTF RIYK+KST G+QSVPYVV+LFSAMLW
Sbjct  1     MAGLSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEGFQSVPYVVALFSAMLW  60

Query  972   MYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVL  793
             ++YA +K +  LLI+IN+ GCVIET+YI ++L YA K A+  T K+LLLL  G++ VI+L
Sbjct  61    IFYALIKSNEALLITINAAGCVIETIYIVMYLAYAPKKAKVFTTKILLLLNVGVFGVILL  120

Query  792   ATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVM  613
              T+    G  RV  +GW+CVAFSV VF APLSI+ +V++++SVE+MPF+LS  LTL+AV+
Sbjct  121   LTLLLSHGEQRVVSLGWVCVAFSVSVFVAPLSIIKRVIQSRSVEYMPFSLSLTLTLSAVV  180

Query  612   WLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKG  469
             W  YGLL+KD  +ALPN+LGF  G+VQM LY  Y N  P+   E K+G
Sbjct  181   WFLYGLLIKDKYVALPNILGFTFGVVQMGLYVFYMNATPV-AGEGKEG  227



>gb|EPS72542.1| hypothetical protein M569_02215, partial [Genlisea aurea]
Length=219

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 164/222 (74%), Gaps = 4/222 (2%)
 Frame = -1

Query  1134  HHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFL  955
             HH     FG+LGNI+S  V+ +P+PTF RIYK KST+ + S+PY V+LFSAMLWMYYAFL
Sbjct  1     HHHIGLAFGILGNIISFFVYFSPMPTFWRIYKEKSTMEFDSLPYAVALFSAMLWMYYAFL  60

Query  954   KKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPF  775
             K  + LLI+INS GCVI+T Y++++  YAS+ ARRQ +K+L ++  G   +I+  +   F
Sbjct  61    KPHSFLLITINSFGCVIQTFYLTLYFIYASRPARRQCLKILGIMNVGALGLILGVSYICF  120

Query  774   KGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGL  595
             +G +RV +VGW CVA SV VFAAPL IV  VVKT+S EFMPF LSFFLTL+AVMW GYG+
Sbjct  121   EGHIRVQVVGWACVAVSVGVFAAPLRIVIHVVKTRSAEFMPFYLSFFLTLSAVMWFGYGI  180

Query  594   LLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKG  469
                D+CIA+PNV+GF LG+VQM+L+  YR  K      EK+G
Sbjct  181   FQHDLCIAIPNVVGFALGLVQMLLFLAYREAK----TNEKEG  218



>dbj|BAK04274.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=307

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 169/226 (75%), Gaps = 5/226 (2%)
 Frame = -1

Query  1098  NIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSAPLLISINS  919
             NI+SL+VFL+P+PTF R+Y+ KST G+QS PY+V+LFS +LWMYYAFLK  + LL++IN 
Sbjct  14    NIISLMVFLSPLPTFYRVYRKKSTEGFQSTPYLVTLFSCLLWMYYAFLKSGSELLLTING  73

Query  918   IGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGTLRVNIVGWI  739
             +GCVIETLYI+++L YA K AR  T K+ + L  GL+ +I L TM    GTLRV +VGWI
Sbjct  74    VGCVIETLYIAMYLVYAPKSARFLTAKLFIGLDVGLFGIIALVTMLASAGTLRVQVVGWI  133

Query  738   CVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKDMCIALPNV  559
             CVA ++ VFAAPLSI+  V++TKSVEFMPF+LSFFL L+AV+W  YG L KD+ +A+PNV
Sbjct  134   CVAVALGVFAAPLSIIRLVIRTKSVEFMPFSLSFFLVLSAVVWFAYGALKKDIFVAVPNV  193

Query  558   LGFLLGIVQMVLYGIYRNQKPLEVA---EEKKGAVPELVINVAGLG  430
             LGF+ GI QM LY  YRN+KP  V    EE K  +PE V  V   G
Sbjct  194   LGFVFGIAQMALYMAYRNKKPATVVLVHEEMK--LPEHVKEVGAGG  237



>ref|XP_007038075.1| Nodulin MtN3 family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY22576.1| Nodulin MtN3 family protein, putative isoform 1 [Theobroma cacao]
Length=280

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/244 (55%), Positives = 177/244 (73%), Gaps = 0/244 (0%)
 Frame = -1

Query  1137  LHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAF  958
             LH  W FVFGVLGN+VS LV LAP+PTF +IYK +++ G+QS+PYVVSLFSAMLW+YYA 
Sbjct  3     LHLSWAFVFGVLGNVVSFLVSLAPLPTFYQIYKKRTSEGFQSIPYVVSLFSAMLWIYYAL  62

Query  957   LKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFP  778
             LKK A LLI+IN+  C I+T YI  +  YA K  +  T+K++LL     + VI L+T F 
Sbjct  63    LKKDAMLLITINTFCCFIQTFYIVAYFYYAPKKEKVVTVKLILLFNIFGFGVIFLSTFFL  122

Query  777   FKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYG  598
                  R++++G+IC+AF++ VFAAPL I+ KV+KTKSVE+MPF LS FLTL AVMW  YG
Sbjct  123   QNPLTRLHVLGYICMAFALSVFAAPLCILRKVIKTKSVEYMPFTLSVFLTLGAVMWFFYG  182

Query  597   LLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLH  418
             LLLKDM IA+PNV+GF+ GI+QM+LY IY+N     V + K   + E +++V  LG ++ 
Sbjct  183   LLLKDMNIAVPNVVGFIFGILQMILYAIYKNCPKKMVEDPKLHQLSEHIVDVVKLGTMVC  242

Query  417   SSVE  406
             S V 
Sbjct  243   SEVN  246



>gb|KCW61897.1| hypothetical protein EUGRSUZ_H04592 [Eucalyptus grandis]
Length=276

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 129/251 (51%), Positives = 176/251 (70%), Gaps = 2/251 (1%)
 Frame = -1

Query  1107  VLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAFLKKSAPLLIS  928
             ++GNIVS  VFLAP+PTF RIY+ KST  +QS+PY+V+LFS+MLW+YYAFLK  + LLI+
Sbjct  1     MIGNIVSFFVFLAPMPTFYRIYRNKSTEEFQSIPYLVALFSSMLWLYYAFLKGHSFLLIT  60

Query  927   INSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLATMFPFKGTLRVNIV  748
             INS GCVIE +YI+I++ YA   AR  T+K+  L+  GL+S+++L T F      R  + 
Sbjct  61    INSFGCVIEMVYIAIYIAYALTAARNSTIKLFALMNMGLFSLLILITHFIPNDDARAMVF  120

Query  747   GWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMWLGYGLLLKDMCIAL  568
             GWIC   SV VFAAPLSIV +VV+TKSVEFMPF+LSFFLTL+A+MW GYG   KD CI +
Sbjct  121   GWICTTISVSVFAAPLSIVARVVRTKSVEFMPFSLSFFLTLSAIMWFGYGFFQKDWCIMI  180

Query  567   PNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLGELLHSSVEDSKTTA  388
             PN +GF+LG+ QMV+YG YRN + ++    +  A+  +   + G+ E+    V D  +  
Sbjct  181   PNTVGFVLGLSQMVVYGYYRNNEVMDEKLPQHVAITVVRPPLGGVSEV--RPVTDEISPP  238

Query  387   ITVSDAVTEEK  355
             I   +A  +E+
Sbjct  239   IDRGEARADEQ  249



>ref|XP_002450786.1| hypothetical protein SORBIDRAFT_05g018110 [Sorghum bicolor]
 gb|EES09774.1| hypothetical protein SORBIDRAFT_05g018110 [Sorghum bicolor]
Length=291

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 175/236 (74%), Gaps = 7/236 (3%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPV--PTFIRIYKAKSTLGYQSVPYVVSLFSAM  979
             MA   L HP  F FG+LGNI+S + +LAP+  PTF RIYK+KST G+QSVPYVV+LFSAM
Sbjct  1     MAGLSLQHPMAFAFGLLGNIISFMTYLAPLYRPTFYRIYKSKSTQGFQSVPYVVALFSAM  60

Query  978   LWMYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVI  799
             LW+YYA LK +  LLI+INS GCVIETLYI ++L YA K A+  T K+LLLL  G++ +I
Sbjct  61    LWIYYALLKSNEFLLITINSAGCVIETLYIVMYLLYAPKKAKLFTAKILLLLNVGVFGLI  120

Query  798   VLATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTA  619
             +L T+    G  RV ++GW+CVAFSV VF APLSI+ +VV+T+SVEFMPF+LS  LT++A
Sbjct  121   LLLTLLLSAGQHRVVVLGWVCVAFSVSVFVAPLSIIRQVVRTRSVEFMPFSLSLSLTVSA  180

Query  618   VMWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPL-----EVAEEKKGA  466
             V+W  YGLL+KD  +ALPNVLGF  G+VQM LY +YRN  P      EV ++   A
Sbjct  181   VVWFLYGLLIKDKYVALPNVLGFSFGVVQMGLYALYRNATPRVPPAKEVTDDDAAA  236



>emb|CBI32263.3| unnamed protein product [Vitis vinifera]
Length=341

 Score =   260 bits (664),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 143/270 (53%), Positives = 184/270 (68%), Gaps = 6/270 (2%)
 Frame = -1

Query  1152  MALFDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLW  973
             MA+  + H   F FG+LGNIVS LV+L+P+PTF RIYK KST G+QS+PY V+LFSAML 
Sbjct  1     MAMLTVPH-MAFAFGILGNIVSFLVYLSPLPTFYRIYKRKSTEGFQSIPYSVALFSAMLL  59

Query  972   MYYAFLKKSAP-LLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIV  796
             +YYAFLK     +LI+INS+G  IE  Y+ +++ YA + A+  T K+LLL   G+Y  IV
Sbjct  60    LYYAFLKTDNQIMLITINSVGTCIEATYLLVYMIYAPRTAKIYTAKLLLLFNTGVYGAIV  119

Query  795   LATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAV  616
             L+T F  KG  R  IVGW+C AFS+CVFAAPLSI+  V++TKSVE+MPF LSFFLT+ AV
Sbjct  120   LSTFFLSKGHRRAKIVGWVCAAFSLCVFAAPLSIMRLVIRTKSVEYMPFPLSFFLTICAV  179

Query  615   MWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPE-LVINVA  439
             MW  YGLL++D  IA PN+LGF  GI QM+LY IY+N K   +AE K   +P  LV    
Sbjct  180   MWFFYGLLIRDFYIAFPNILGFAFGIAQMILYTIYKNAKKGVLAEFKLQELPNGLVFPTL  239

Query  438   GLGELLHSSVEDS-KTTAITVSDAVTEEKA  352
                E   ++  D  + TA+T   A   +KA
Sbjct  240   KKAENTDTNPNDQPEDTAMTEGGA--RDKA  267



>ref|XP_004138250.1| PREDICTED: bidirectional sugar transporter SWEET12-like [Cucumis 
sativus]
Length=302

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 133/228 (58%), Positives = 175/228 (77%), Gaps = 4/228 (2%)
 Frame = -1

Query  1152  MAL-FDLHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAML  976
             MAL F  H+PW+F FG+LGNI S +VFLAPVPTFIR+ + KST G+QS+PYVV+LFSA+L
Sbjct  1     MALSFMNHNPWIFAFGLLGNIFSFIVFLAPVPTFIRVCRKKSTEGFQSIPYVVALFSALL  60

Query  975   WMYYAFLKKSAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLL-VGGLYSVI  799
              +YY+ L      L++INS+GC IET+YI++++ YA K AR  T++ +LLL V G  S++
Sbjct  61    LIYYSTLNADEFFLMTINSVGCFIETIYIALYIAYAPKKARIFTVRFVLLLDVVGFCSIL  120

Query  798   VLATMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTA  619
             V+ T F  K   R  ++G+IC   SV VFAAPLSI+ +V++T+SVE+MPF+LSFFLTL+A
Sbjct  121   VV-TQFLVKRAYRARVIGFICGGLSVSVFAAPLSIMKRVIRTRSVEYMPFSLSFFLTLSA  179

Query  618   VMWLGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEK  475
             VMWL YGL LKD+ +ALPN LGF  G+ QM+LY IYRN KPL  +EEK
Sbjct  180   VMWLCYGLFLKDLYVALPNTLGFTFGMAQMILYAIYRNAKPLP-SEEK  226



>ref|XP_008356571.1| PREDICTED: bidirectional sugar transporter SWEET10-like [Malus 
domestica]
Length=295

 Score =   258 bits (660),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 173/243 (71%), Gaps = 4/243 (2%)
 Frame = -1

Query  1137  LHHPWVFVFGVLGNIVSLLVFLAPVPTFIRIYKAKSTLGYQSVPYVVSLFSAMLWMYYAF  958
             L H     FG+LGNI+SLLVFLAPVPTF  IYK K+T G+Q++PYV+ L S+ML++YYA 
Sbjct  3     LQHTLSLAFGLLGNIISLLVFLAPVPTFYTIYKKKTTEGFQALPYVIGLLSSMLYIYYAL  62

Query  957   LKK----SAPLLISINSIGCVIETLYISIFLGYASKIARRQTMKMLLLLVGGLYSVIVLA  790
             LK+     A LLI+INS+G VIETLYIS+FL YA K AR     +L LL G  Y+V+V+ 
Sbjct  63    LKEEIKYDATLLITINSVGSVIETLYISLFLFYAPKKARISNATLLFLLNGFSYAVMVVL  122

Query  789   TMFPFKGTLRVNIVGWICVAFSVCVFAAPLSIVFKVVKTKSVEFMPFNLSFFLTLTAVMW  610
             T F   G +R+ IVGWIC+ FS+ VF APL ++ +V +TKSVEFMPF LSFFLTL AV W
Sbjct  123   TRFLATGEMRIKIVGWICLVFSISVFVAPLGVLRQVXRTKSVEFMPFPLSFFLTLGAVAW  182

Query  609   LGYGLLLKDMCIALPNVLGFLLGIVQMVLYGIYRNQKPLEVAEEKKGAVPELVINVAGLG  430
               YG L+KD  IALPN+LGF LG+VQMV+Y +Y+N K +   + K   + E +I+V  + 
Sbjct  183   FFYGFLIKDFYIALPNILGFFLGVVQMVVYIVYKNAKEVLEDQPKGQELSEHIIDVRKIS  242

Query  429   ELL  421
              L+
Sbjct  243   TLV  245



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3309221463868