BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16628_g1_i1 len=1686 path=[1664:0-369 2034:370-1685]

Length=1686
                                                                      Score     E

ref|XP_009628672.1|  PREDICTED: probable dimethyladenosine transf...    441   6e-147   
ref|XP_009761442.1|  PREDICTED: probable dimethyladenosine transf...    440   1e-146   
ref|XP_006340679.1|  PREDICTED: probable dimethyladenosine transf...    434   2e-144   
ref|XP_004233729.1|  PREDICTED: probable dimethyladenosine transf...    425   9e-141   
ref|XP_007046798.1|  Ribosomal RNA adenine dimethylase family pro...    410   5e-135   
ref|XP_004158885.1|  PREDICTED: probable dimethyladenosine transf...    407   2e-134   
emb|CBI17432.3|  unnamed protein product                                408   4e-134   
ref|XP_004149981.1|  PREDICTED: probable dimethyladenosine transf...    406   4e-134   
ref|XP_010649089.1|  PREDICTED: probable dimethyladenosine transf...    405   5e-133   
emb|CAN73506.1|  hypothetical protein VITISV_007907                     402   5e-132   Vitis vinifera
ref|XP_008440777.1|  PREDICTED: probable dimethyladenosine transf...    400   9e-132   
ref|XP_010277808.1|  PREDICTED: probable dimethyladenosine transf...    397   2e-130   
ref|XP_010277807.1|  PREDICTED: probable dimethyladenosine transf...    397   6e-130   
ref|XP_010277806.1|  PREDICTED: probable dimethyladenosine transf...    397   4e-129   
ref|XP_002324910.1|  hypothetical protein POPTR_0018s02560g             391   1e-127   Populus trichocarpa [western balsam poplar]
ref|XP_011036685.1|  PREDICTED: probable dimethyladenosine transf...    389   7e-127   
ref|XP_007203689.1|  hypothetical protein PRUPE_ppa026107mg             385   5e-126   
ref|XP_006466875.1|  PREDICTED: dimethyladenosine transferase-like      387   1e-125   
ref|XP_011083164.1|  PREDICTED: probable dimethyladenosine transf...    382   6e-124   
ref|XP_008337773.1|  PREDICTED: probable dimethyladenosine transf...    378   1e-122   
ref|XP_004289104.1|  PREDICTED: probable dimethyladenosine transf...    375   1e-121   
gb|EYU31168.1|  hypothetical protein MIMGU_mgv1a026501mg                373   1e-121   
ref|XP_004512086.1|  PREDICTED: probable dimethyladenosine transf...    367   5e-119   
ref|XP_010557762.1|  PREDICTED: probable dimethyladenosine transf...    367   1e-118   
emb|CDP01955.1|  unnamed protein product                                368   2e-118   
ref|NP_975003.1|  adenosine dimethyl transferase 1B                     366   6e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003612095.1|  Dimethyladenosine transferase-like protein         362   3e-117   
gb|KDO71051.1|  hypothetical protein CISIN_1g047897mg                   357   1e-116   
ref|XP_010679813.1|  PREDICTED: probable dimethyladenosine transf...    361   4e-116   
ref|XP_008241767.1|  PREDICTED: probable dimethyladenosine transf...    359   2e-115   
ref|XP_008352452.1|  PREDICTED: probable dimethyladenosine transf...    363   4e-115   
emb|CDY65384.1|  BnaCnng46850D                                          358   4e-115   
emb|CDY45217.1|  BnaA07g12730D                                          357   1e-114   
ref|XP_006393823.1|  hypothetical protein EUTSA_v10005567mg             357   1e-114   
ref|XP_010465622.1|  PREDICTED: probable dimethyladenosine transf...    356   4e-114   
gb|KFK28308.1|  hypothetical protein AALP_AA8G499600                    355   1e-113   
ref|XP_009103542.1|  PREDICTED: probable dimethyladenosine transf...    353   2e-113   
ref|XP_002866759.1|  ribosomal RNA adenine dimethylase family pro...    353   7e-113   
ref|XP_006280630.1|  hypothetical protein CARUB_v10026592mg             352   2e-112   
ref|XP_002521501.1|  dimethyladenosine transferase, putative            348   2e-111   Ricinus communis
ref|XP_010484657.1|  PREDICTED: probable dimethyladenosine transf...    348   3e-111   
ref|XP_010033447.1|  PREDICTED: probable dimethyladenosine transf...    347   2e-110   
ref|XP_003537617.2|  PREDICTED: probable dimethyladenosine transf...    343   1e-109   
gb|ABB45840.1|  hypothetical protein                                    340   1e-108   Eutrema halophilum
gb|EPS63983.1|  hypothetical protein M569_10799                         338   2e-108   
ref|XP_003516557.1|  PREDICTED: probable dimethyladenosine transf...    337   6e-107   
ref|XP_008806474.1|  PREDICTED: probable dimethyladenosine transf...    337   1e-106   
ref|XP_010943978.1|  PREDICTED: LOW QUALITY PROTEIN: probable dim...    337   2e-106   
ref|XP_007158613.1|  hypothetical protein PHAVU_002G167300g             335   2e-106   
ref|XP_006838681.1|  hypothetical protein AMTR_s00002p00244930          330   5e-104   
ref|XP_009413375.1|  PREDICTED: dimethyladenosine transferase           318   2e-99    
ref|NP_201437.2|  adenosine dimethyl transferase 1B                     306   5e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004957819.1|  PREDICTED: probable dimethyladenosine transf...    304   3e-94    
ref|XP_002460752.1|  hypothetical protein SORBIDRAFT_02g034350          300   1e-92    Sorghum bicolor [broomcorn]
dbj|BAK04910.1|  predicted protein                                      298   7e-92    
gb|ADE76404.1|  unknown                                                 298   9e-92    
tpg|DAA40952.1|  TPA: hypothetical protein ZEAMMB73_963520              295   6e-91    
gb|EMT31450.1|  Dimethyladenosine transferase                           290   8e-89    
ref|XP_006425594.1|  hypothetical protein CICLE_v10026231mg             287   1e-88    
gb|EAZ04012.1|  hypothetical protein OsI_26151                          288   6e-88    Oryza sativa Indica Group [Indian rice]
gb|EAZ39958.1|  hypothetical protein OsJ_24395                          287   7e-88    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001059748.1|  Os07g0509600                                       287   8e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003563044.1|  PREDICTED: probable dimethyladenosine transf...    282   9e-86    
gb|KDP32681.1|  hypothetical protein JCGZ_13679                         278   9e-86    
ref|XP_006658601.1|  PREDICTED: dimethyladenosine transferase-like      278   4e-84    
gb|KCW53090.1|  hypothetical protein EUGRSUZ_J02386                     262   2e-79    
gb|KHN41932.1|  Dimethyladenosine transferase                           253   4e-76    
emb|CDX80102.1|  BnaA05g00540D                                          253   9e-75    
gb|KHN36066.1|  Dimethyladenosine transferase                           249   1e-74    
ref|XP_010091144.1|  putative dimethyladenosine transferase             254   9e-74    
ref|XP_002880301.1|  hypothetical protein ARALYDRAFT_904217             249   2e-73    
gb|KFK37481.1|  hypothetical protein AALP_AA4G263100                    249   2e-73    
ref|NP_182264.1|  dimethyladenosine transferase                         249   3e-73    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009142538.1|  PREDICTED: probable dimethyladenosine transf...    248   3e-73    
emb|CDY55380.1|  BnaC04g51980D                                          248   4e-73    
ref|XP_006397937.1|  hypothetical protein EUTSA_v10001522mg             249   4e-73    
ref|XP_009133814.1|  PREDICTED: probable dimethyladenosine transf...    248   8e-73    
emb|CDX83328.1|  BnaA03g21780D                                          247   2e-72    
ref|XP_006296482.1|  hypothetical protein CARUB_v10025667mg             246   3e-72    
ref|XP_010523927.1|  PREDICTED: probable dimethyladenosine transf...    245   9e-72    
gb|ETN76097.1|  dimethyladenosine transferase                           241   6e-71    
gb|KHG08361.1|  putative dimethyladenosine transferase                  243   7e-71    
gb|EPS71929.1|  hypothetical protein M569_02829                         241   4e-70    
ref|XP_007051093.1|  Ribosomal RNA adenine dimethylase family pro...    241   4e-70    
ref|XP_006285366.1|  hypothetical protein CARUB_v10006757mg             240   5e-70    
ref|XP_001769214.1|  predicted protein                                  238   7e-70    
ref|XP_002982218.1|  hypothetical protein SELMODRAFT_116036             238   9e-70    
ref|XP_002992246.1|  hypothetical protein SELMODRAFT_186635             238   2e-69    
ref|NP_001150423.1|  LOC100284053                                       239   2e-69    Zea mays [maize]
ref|XP_004951725.1|  PREDICTED: probable dimethyladenosine transf...    239   2e-69    
ref|XP_010518440.1|  PREDICTED: probable dimethyladenosine transf...    239   2e-69    
ref|XP_010506778.1|  PREDICTED: probable dimethyladenosine transf...    238   4e-69    
ref|XP_005649824.1|  dimethyladenosine transferase                      237   1e-68    
ref|XP_004951724.1|  PREDICTED: probable dimethyladenosine transf...    237   1e-68    
ref|XP_010268006.1|  PREDICTED: probable dimethyladenosine transf...    236   2e-68    
ref|XP_002451644.1|  hypothetical protein SORBIDRAFT_04g005150          236   3e-68    Sorghum bicolor [broomcorn]
emb|CAN77505.1|  hypothetical protein VITISV_017803                     236   3e-68    Vitis vinifera
ref|XP_002276165.1|  PREDICTED: probable dimethyladenosine transf...    236   3e-68    Vitis vinifera
ref|XP_004959693.1|  PREDICTED: dimethyladenosine transferase-like      236   4e-68    
gb|ACO12988.1|  Probable dimethyladenosine transferase                  234   5e-68    Lepeophtheirus salmonis
ref|XP_007141035.1|  hypothetical protein PHAVU_008G161800g             235   5e-68    
emb|CDP18245.1|  unnamed protein product                                235   6e-68    
ref|XP_005847372.1|  hypothetical protein CHLNCDRAFT_23464              234   6e-68    
gb|ABR16651.1|  unknown                                                 235   6e-68    Picea sitchensis
gb|EMS47567.1|  putative dimethyladenosine transferase                  234   1e-67    
gb|KDP28252.1|  hypothetical protein JCGZ_14023                         234   1e-67    
ref|XP_003573385.1|  PREDICTED: probable dimethyladenosine transf...    234   1e-67    
ref|XP_006847974.1|  hypothetical protein AMTR_s00029p00156590          234   1e-67    
gb|EYC18862.1|  hypothetical protein Y032_0026g1411                     232   2e-67    
ref|NP_001089685.1|  DIM1 dimethyladenosine transferase 1 homolog       232   2e-67    Xenopus laevis [clawed frog]
gb|AAI69134.1|  hypothetical protein LOC779588                          232   3e-67    Xenopus tropicalis [western clawed frog]
gb|AAI23078.1|  LOC779588 protein                                       232   3e-67    Xenopus tropicalis [western clawed frog]
ref|NP_001116194.1|  DIM1 dimethyladenosine transferase 1 homolog       231   4e-67    Xenopus tropicalis [western clawed frog]
ref|XP_009408036.1|  PREDICTED: probable dimethyladenosine transf...    233   4e-67    
ref|XP_007201224.1|  hypothetical protein PRUPE_ppa008081mg             232   5e-67    
emb|CDX95724.1|  BnaC03g26050D                                          232   6e-67    
ref|XP_006660422.1|  PREDICTED: probable dimethyladenosine transf...    233   6e-67    
ref|XP_006661664.1|  PREDICTED: probable dimethyladenosine transf...    232   8e-67    
gb|KFM23756.1|  putative dimethyladenosine transferase                  231   9e-67    
gb|EYU45154.1|  hypothetical protein MIMGU_mgv1a009179mg                231   1e-66    
ref|XP_007153382.1|  hypothetical protein PHAVU_003G030300g             231   2e-66    
ref|XP_008235202.1|  PREDICTED: probable dimethyladenosine transf...    231   2e-66    
ref|XP_003400619.1|  PREDICTED: probable dimethyladenosine transf...    229   3e-66    
ref|XP_002680934.1|  predicted protein                                  229   3e-66    Naegleria gruberi strain NEG-M
ref|NP_001064257.1|  Os10g0183900                                       231   4e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006492328.1|  PREDICTED: probable dimethyladenosine transf...    230   4e-66    
gb|KDO87006.1|  hypothetical protein CISIN_1g018261mg                   230   5e-66    
ref|XP_011084280.1|  PREDICTED: probable dimethyladenosine transf...    230   5e-66    
ref|XP_002529134.1|  dimethyladenosine transferase, putative            230   5e-66    Ricinus communis
ref|XP_002602632.1|  hypothetical protein BRAFLDRAFT_225323             228   6e-66    Branchiostoma floridae
ref|XP_005107724.1|  PREDICTED: probable dimethyladenosine transf...    228   7e-66    
ref|XP_003570045.1|  PREDICTED: probable dimethyladenosine transf...    229   8e-66    
ref|XP_004300457.1|  PREDICTED: probable dimethyladenosine transf...    229   8e-66    
emb|CDJ87454.1|  Ribosomal RNA adenine methylase transferase doma...    228   9e-66    
ref|XP_003493975.1|  PREDICTED: probable dimethyladenosine transf...    227   1e-65    
gb|AGT79993.1|  dimethyladenosine transferase                           227   1e-65    
gb|ACO10705.1|  Probable dimethyladenosine transferase                  227   2e-65    Caligus rogercresseyi
ref|XP_004230304.1|  PREDICTED: probable dimethyladenosine transf...    229   2e-65    
gb|ACO14626.1|  Probable dimethyladenosine transferase                  227   2e-65    Caligus clemensi
ref|XP_006344757.1|  PREDICTED: probable dimethyladenosine transf...    228   2e-65    
ref|XP_006444487.1|  hypothetical protein CICLE_v10020794mg             228   2e-65    
ref|XP_006564915.1|  PREDICTED: probable dimethyladenosine transf...    227   2e-65    
ref|XP_002320304.1|  hypothetical protein POPTR_0014s11630g             228   2e-65    Populus trichocarpa [western balsam poplar]
ref|XP_003598143.1|  Dimethyladenosine transferase                      228   2e-65    
ref|XP_002953877.1|  hypothetical protein VOLCADRAFT_106150             229   2e-65    
gb|KHN44950.1|  Putative dimethyladenosine transferase                  228   3e-65    
ref|XP_003542423.1|  PREDICTED: probable dimethyladenosine transf...    228   3e-65    
ref|XP_004583791.1|  PREDICTED: probable dimethyladenosine transf...    226   3e-65    
ref|XP_011073653.1|  PREDICTED: probable dimethyladenosine transf...    228   3e-65    
gb|KHN26450.1|  Putative dimethyladenosine transferase                  228   4e-65    
ref|XP_009617800.1|  PREDICTED: probable dimethyladenosine transf...    227   5e-65    
ref|XP_006581054.1|  PREDICTED: uncharacterized protein LOC100819...    227   5e-65    
ref|XP_009804609.1|  PREDICTED: probable dimethyladenosine transf...    227   6e-65    
gb|EPR78579.1|  Dimethyladenosine transferase                           224   7e-65    
ref|NP_001156188.1|  dimethyladenosine transferase-like                 225   7e-65    Acyrthosiphon pisum
ref|XP_002714103.1|  PREDICTED: probable dimethyladenosine transf...    225   7e-65    Oryctolagus cuniculus [domestic rabbit]
ref|XP_010024069.1|  PREDICTED: probable dimethyladenosine transf...    227   9e-65    
ref|XP_006618433.1|  PREDICTED: probable dimethyladenosine transf...    225   9e-65    
ref|XP_008783008.1|  PREDICTED: probable dimethyladenosine transf...    226   9e-65    
ref|XP_008443786.1|  PREDICTED: probable dimethyladenosine transf...    226   1e-64    
ref|XP_009378710.1|  PREDICTED: probable dimethyladenosine transf...    226   1e-64    
ref|XP_003702828.1|  PREDICTED: probable dimethyladenosine transf...    224   1e-64    
gb|ELK31210.1|  Putative dimethyladenosine transferase                  224   1e-64    
ref|XP_008053327.1|  PREDICTED: probable dimethyladenosine transf...    224   2e-64    
gb|KIH60645.1|  dimethyladenosine transferase                           223   2e-64    
ref|XP_005319638.1|  PREDICTED: probable dimethyladenosine transf...    224   2e-64    
ref|XP_004016997.1|  PREDICTED: probable dimethyladenosine transf...    223   2e-64    
ref|XP_007515190.1|  dimethyladenosine transferase                      225   2e-64    
gb|KDR21683.1|  putative dimethyladenosine transferase                  224   2e-64    
ref|XP_005971997.1|  PREDICTED: probable dimethyladenosine transf...    223   2e-64    
ref|XP_003782781.1|  PREDICTED: probable dimethyladenosine transf...    224   2e-64    
ref|XP_010929034.1|  PREDICTED: probable dimethyladenosine transf...    225   2e-64    
ref|XP_004422920.1|  PREDICTED: probable dimethyladenosine transf...    224   3e-64    
ref|XP_010964550.1|  PREDICTED: probable dimethyladenosine transf...    224   3e-64    
ref|XP_006188264.1|  PREDICTED: probable dimethyladenosine transf...    224   3e-64    
ref|XP_008160079.1|  PREDICTED: probable dimethyladenosine transf...    224   3e-64    
ref|NP_079723.1|  probable dimethyladenosine transferase                224   3e-64    Mus musculus [mouse]
ref|XP_005065625.1|  PREDICTED: probable dimethyladenosine transf...    224   3e-64    
ref|XP_006081480.1|  PREDICTED: probable dimethyladenosine transf...    224   3e-64    
ref|XP_009418145.1|  PREDICTED: probable dimethyladenosine transf...    225   4e-64    
ref|XP_004142540.1|  PREDICTED: probable dimethyladenosine transf...    225   4e-64    
ref|XP_009339780.1|  PREDICTED: probable dimethyladenosine transf...    224   4e-64    
ref|XP_007079974.1|  PREDICTED: probable dimethyladenosine transf...    223   4e-64    
ref|XP_004678333.1|  PREDICTED: probable dimethyladenosine transf...    224   4e-64    
ref|XP_004155690.1|  PREDICTED: probable dimethyladenosine transf...    224   5e-64    
ref|XP_003059014.1|  hypothetical protein MICPUCDRAFT_58407             226   5e-64    
ref|XP_011041285.1|  PREDICTED: probable dimethyladenosine transf...    224   5e-64    
ref|XP_006231965.1|  PREDICTED: probable dimethyladenosine transf...    223   5e-64    
ref|XP_008386722.1|  PREDICTED: probable dimethyladenosine transf...    224   5e-64    
ref|XP_010038164.1|  PREDICTED: probable dimethyladenosine transf...    224   6e-64    
gb|EFN63666.1|  Probable dimethyladenosine transferase                  221   6e-64    
ref|XP_004499616.1|  PREDICTED: probable dimethyladenosine transf...    224   6e-64    
ref|XP_010087246.1|  putative dimethyladenosine transferase             224   6e-64    
ref|XP_006231964.1|  PREDICTED: probable dimethyladenosine transf...    223   6e-64    
ref|XP_004416079.1|  PREDICTED: probable dimethyladenosine transf...    223   6e-64    
ref|XP_004623115.1|  PREDICTED: probable dimethyladenosine transf...    223   7e-64    
ref|XP_007079973.1|  PREDICTED: probable dimethyladenosine transf...    223   7e-64    
ref|NP_001272529.1|  dimethyladenosine transferase 1-like protein       223   8e-64    
gb|EZA52464.1|  putative dimethyladenosine transferase                  223   8e-64    
ref|XP_006906118.1|  PREDICTED: probable dimethyladenosine transf...    223   8e-64    
ref|XP_003462759.1|  PREDICTED: probable dimethyladenosine transf...    223   9e-64    
ref|XP_006927818.1|  PREDICTED: probable dimethyladenosine transf...    222   9e-64    
ref|XP_008689603.1|  PREDICTED: probable dimethyladenosine transf...    222   9e-64    
ref|NP_496061.2|  Protein E02H1.1                                       223   1e-63    Caenorhabditis elegans [roundworm]
ref|XP_005392699.1|  PREDICTED: probable dimethyladenosine transf...    223   1e-63    
ref|XP_007222323.1|  hypothetical protein PRUPE_ppa008082mg             224   1e-63    
ref|NP_001099878.2|  probable dimethyladenosine transferase             223   1e-63    Rattus norvegicus [brown rat]
ref|XP_007949747.1|  PREDICTED: probable dimethyladenosine transf...    223   1e-63    
ref|XP_005659022.1|  PREDICTED: probable dimethyladenosine transf...    221   1e-63    
ref|XP_003496259.1|  PREDICTED: probable dimethyladenosine transf...    222   1e-63    
ref|XP_001689703.1|  dimethyladenosine transferase                      224   1e-63    Chlamydomonas reinhardtii
ref|XP_010334886.1|  PREDICTED: probable dimethyladenosine transf...    221   1e-63    
ref|XP_009239016.1|  PREDICTED: probable dimethyladenosine transf...    221   1e-63    
ref|XP_005356821.1|  PREDICTED: probable dimethyladenosine transf...    222   1e-63    
ref|XP_004608527.1|  PREDICTED: probable dimethyladenosine transf...    222   1e-63    
ref|XP_004498555.1|  PREDICTED: probable dimethyladenosine transf...    223   2e-63    
ref|XP_001493943.1|  PREDICTED: probable dimethyladenosine transf...    222   2e-63    Equus caballus [domestic horse]
ref|XP_008577803.1|  PREDICTED: probable dimethyladenosine transf...    222   2e-63    
ref|XP_003981054.1|  PREDICTED: probable dimethyladenosine transf...    222   2e-63    
ref|XP_009206739.1|  PREDICTED: probable dimethyladenosine transf...    221   2e-63    
ref|XP_001636433.1|  predicted protein                                  222   2e-63    Nematostella vectensis
ref|XP_004744652.1|  PREDICTED: probable dimethyladenosine transf...    222   2e-63    
ref|XP_002916330.1|  PREDICTED: probable dimethyladenosine transf...    222   2e-63    
ref|XP_008854553.1|  PREDICTED: probable dimethyladenosine transf...    221   2e-63    
ref|XP_007130480.1|  PREDICTED: probable dimethyladenosine transf...    222   2e-63    
ref|XP_002428215.1|  dimethyladenosine transferase, putative            221   2e-63    Pediculus humanus corporis [human body lice]
ref|XP_007451233.1|  PREDICTED: probable dimethyladenosine transf...    221   2e-63    
ref|XP_006731288.1|  PREDICTED: probable dimethyladenosine transf...    222   2e-63    
ref|XP_003925860.1|  PREDICTED: probable dimethyladenosine transf...    222   2e-63    
pdb|1ZQ9|A  Chain A, Crystal Structure Of Human Dimethyladenosine...    221   2e-63    
ref|XP_004275240.1|  PREDICTED: probable dimethyladenosine transf...    221   3e-63    
ref|XP_004374612.1|  PREDICTED: probable dimethyladenosine transf...    221   3e-63    
ref|NP_001231242.1|  probable dimethyladenosine transferase             221   3e-63    
ref|XP_007176118.1|  PREDICTED: probable dimethyladenosine transf...    221   3e-63    
gb|EHJ76049.1|  dimethyladenosine transferase                           221   3e-63    
ref|XP_001955370.1|  GF16271                                            221   3e-63    Drosophila ananassae
ref|XP_003408103.1|  PREDICTED: probable dimethyladenosine transf...    221   3e-63    
ref|XP_002629730.1|  Hypothetical protein CBG00961                      221   3e-63    Caenorhabditis briggsae
ref|NP_001242880.1|  uncharacterized protein LOC100819707               221   3e-63    
ref|XP_002815639.1|  PREDICTED: probable dimethyladenosine transf...    221   3e-63    
ref|XP_001419390.1|  predicted protein                                  221   3e-63    Ostreococcus lucimarinus CCE9901
ref|XP_007971844.1|  PREDICTED: probable dimethyladenosine transf...    221   3e-63    
ref|XP_002806669.1|  PREDICTED: LOW QUALITY PROTEIN: probable dim...    221   4e-63    Callithrix jacchus [common marmoset]
dbj|BAE26964.1|  unnamed protein product                                221   4e-63    Mus musculus [mouse]
ref|XP_006876251.1|  PREDICTED: probable dimethyladenosine transf...    221   4e-63    
ref|XP_008854547.1|  PREDICTED: probable dimethyladenosine transf...    221   4e-63    
ref|XP_010383496.1|  PREDICTED: probable dimethyladenosine transf...    220   4e-63    
gb|EMT07530.1|  Putative dimethyladenosine transferase                  226   5e-63    
ref|NP_055288.1|  probable dimethyladenosine transferase                221   5e-63    Homo sapiens [man]
ref|XP_003266024.1|  PREDICTED: probable dimethyladenosine transf...    221   5e-63    
ref|NP_001039501.1|  probable dimethyladenosine transferase             221   5e-63    Bos taurus [bovine]
ref|XP_006995731.1|  PREDICTED: probable dimethyladenosine transf...    220   7e-63    
ref|XP_004072476.1|  PREDICTED: probable dimethyladenosine transf...    220   7e-63    
emb|CBY17942.1|  unnamed protein product                                220   7e-63    
ref|XP_004744651.1|  PREDICTED: probable dimethyladenosine transf...    221   8e-63    
dbj|GAM20171.1|  hypothetical protein SAMD00019534_033460               220   8e-63    
ref|XP_003975091.1|  PREDICTED: probable dimethyladenosine transf...    220   1e-62    
ref|XP_010383480.1|  PREDICTED: probable dimethyladenosine transf...    220   1e-62    
gb|EGT35383.1|  hypothetical protein CAEBREN_28911                      219   1e-62    
dbj|BAF85412.1|  unnamed protein product                                220   1e-62    Homo sapiens [man]
ref|XP_007229165.1|  PREDICTED: probable dimethyladenosine transf...    219   1e-62    
ref|XP_007461336.1|  PREDICTED: probable dimethyladenosine transf...    222   1e-62    
ref|XP_002508318.1|  hypothetical protein MICPUN_84159                  220   1e-62    Micromonas commoda
ref|XP_010635518.1|  PREDICTED: probable dimethyladenosine transf...    219   1e-62    
ref|XP_001358667.1|  GA11224                                            219   1e-62    Drosophila pseudoobscura pseudoobscura
ref|XP_424746.3|  PREDICTED: probable dimethyladenosine transferase     219   1e-62    Gallus gallus [bantam]
ref|XP_001989653.1|  GH18676                                            219   2e-62    Drosophila grimshawi
ref|XP_006891568.1|  PREDICTED: probable dimethyladenosine transf...    219   2e-62    
ref|XP_004703641.1|  PREDICTED: probable dimethyladenosine transf...    219   2e-62    
ref|XP_005301022.1|  PREDICTED: probable dimethyladenosine transf...    219   2e-62    
ref|XP_004529319.1|  PREDICTED: probable dimethyladenosine transf...    219   2e-62    
ref|XP_004714352.1|  PREDICTED: probable dimethyladenosine transf...    219   2e-62    
ref|XP_004448733.1|  PREDICTED: probable dimethyladenosine transf...    219   2e-62    
ref|XP_005858199.1|  PREDICTED: probable dimethyladenosine transf...    223   2e-62    
ref|XP_972612.1|  PREDICTED: probable dimethyladenosine transferase     218   3e-62    Tribolium castaneum [rust-red flour beetle]
ref|XP_004498556.1|  PREDICTED: probable dimethyladenosine transf...    220   3e-62    
gb|EFB24426.1|  hypothetical protein PANDA_004390                       218   3e-62    Ailuropoda melanoleuca
emb|CCG81669.1|  Dimethyladenosine transferase                          219   3e-62    
gb|EHB01122.1|  Putative dimethyladenosine transferase                  218   3e-62    
ref|XP_005166884.1|  PREDICTED: probable dimethyladenosine transf...    218   4e-62    
ref|XP_005535661.1|  probable dimethyladenosine transferase             219   4e-62    
ref|XP_006148398.1|  PREDICTED: probable dimethyladenosine transf...    223   4e-62    
gb|EFX89974.1|  hypothetical protein DAPPUDRAFT_205158                  218   4e-62    
ref|XP_004862941.1|  PREDICTED: probable dimethyladenosine transf...    218   5e-62    
ref|XP_009061158.1|  hypothetical protein LOTGIDRAFT_193721             218   5e-62    
ref|XP_006762553.1|  PREDICTED: probable dimethyladenosine transf...    223   5e-62    
gb|EPZ36372.1|  putative dimethyladenosine transferase                  218   5e-62    
ref|XP_008073796.1|  dimethyladenosine transferase                      216   5e-62    
ref|XP_004544527.1|  PREDICTED: probable dimethyladenosine transf...    218   6e-62    
ref|XP_003080857.1|  Ribosomal RNA adenine dimethylase (ISS)            219   6e-62    
ref|XP_002071976.1|  GK22567                                            218   6e-62    
ref|XP_005804047.1|  PREDICTED: probable dimethyladenosine transf...    218   6e-62    
ref|XP_004998019.1|  dimethyladenosine transferase                      218   6e-62    
ref|NP_001135031.1|  Probable dimethyladenosine transferase             218   6e-62    
ref|XP_003451727.1|  PREDICTED: probable dimethyladenosine transf...    218   7e-62    
ref|XP_010723767.1|  PREDICTED: probable dimethyladenosine transf...    218   7e-62    
ref|NP_001270420.1|  probable dimethyladenosine transferase             218   7e-62    
ref|XP_007055412.1|  PREDICTED: probable dimethyladenosine transf...    218   7e-62    
ref|XP_005947264.1|  PREDICTED: probable dimethyladenosine transf...    218   7e-62    
ref|XP_001366147.2|  PREDICTED: probable dimethyladenosine transf...    220   7e-62    
ref|XP_008355497.1|  PREDICTED: probable dimethyladenosine transf...    219   8e-62    
ref|XP_011059968.1|  PREDICTED: probable dimethyladenosine transf...    217   9e-62    
emb|CDW90754.1|  dimethyladenosine transferase                          219   9e-62    
ref|XP_008335074.1|  PREDICTED: probable dimethyladenosine transf...    217   1e-61    
ref|XP_008417064.1|  PREDICTED: probable dimethyladenosine transf...    217   1e-61    
ref|XP_004058848.1|  PREDICTED: probable dimethyladenosine transf...    217   1e-61    
ref|XP_001600750.1|  PREDICTED: probable dimethyladenosine transf...    217   1e-61    
ref|XP_009557895.1|  PREDICTED: probable dimethyladenosine transf...    216   1e-61    
ref|XP_008369049.1|  PREDICTED: probable dimethyladenosine transf...    218   1e-61    
ref|XP_006263810.1|  PREDICTED: probable dimethyladenosine transf...    217   1e-61    
ref|XP_005722348.1|  PREDICTED: probable dimethyladenosine transf...    216   2e-61    
ref|NP_001158611.1|  Probable dimethyladenosine transferase             216   2e-61    
ref|XP_005301024.1|  PREDICTED: probable dimethyladenosine transf...    216   2e-61    
gb|EJY84877.1|  Ribosomal RNA adenine dimethylase                       220   2e-61    
ref|XP_008279690.1|  PREDICTED: probable dimethyladenosine transf...    216   2e-61    
ref|XP_010124771.1|  PREDICTED: probable dimethyladenosine transf...    215   2e-61    
ref|XP_007890325.1|  PREDICTED: probable dimethyladenosine transf...    216   3e-61    
ref|XP_638864.1|  dimethyladenosine transferase                         216   3e-61    
ref|XP_313763.2|  AGAP004465-PA                                         216   3e-61    
ref|XP_005151979.1|  PREDICTED: probable dimethyladenosine transf...    216   3e-61    
ref|XP_010635519.1|  PREDICTED: probable dimethyladenosine transf...    216   3e-61    
ref|XP_002055863.1|  GJ10534                                            216   3e-61    
ref|XP_008545575.1|  PREDICTED: probable dimethyladenosine transf...    216   3e-61    
ref|XP_002115311.1|  hypothetical protein TRIADDRAFT_29342              215   3e-61    
emb|CAN81538.1|  hypothetical protein VITISV_011853                     216   3e-61    
ref|NP_001003556.1|  probable dimethyladenosine transferase             216   4e-61    
ref|XP_009905723.1|  PREDICTED: probable dimethyladenosine transf...    215   4e-61    
ref|XP_004881752.1|  PREDICTED: probable dimethyladenosine transf...    218   4e-61    
ref|XP_005060725.1|  PREDICTED: probable dimethyladenosine transf...    216   4e-61    
emb|CBY42886.1|  unnamed protein product                                215   4e-61    
ref|XP_009096436.1|  PREDICTED: probable dimethyladenosine transf...    216   4e-61    
ref|XP_010767543.1|  PREDICTED: probable dimethyladenosine transf...    215   4e-61    
emb|CDQ90095.1|  unnamed protein product                                215   4e-61    
ref|XP_001981404.1|  GG11635                                            215   4e-61    
ref|XP_007633546.1|  PREDICTED: probable dimethyladenosine transf...    222   5e-61    
ref|XP_004342657.1|  dimethyladenosine transferase                      215   5e-61    
ref|XP_009509115.1|  PREDICTED: probable dimethyladenosine transf...    214   5e-61    
ref|XP_005531889.1|  PREDICTED: probable dimethyladenosine transf...    215   5e-61    
ref|XP_005184370.1|  PREDICTED: probable dimethyladenosine transf...    215   6e-61    
ref|XP_779962.2|  PREDICTED: probable dimethyladenosine transfera...    214   6e-61    
gb|EFA78940.1|  dimethyladenosine transferase                           215   6e-61    
ref|XP_010737928.1|  PREDICTED: probable dimethyladenosine transf...    215   7e-61    
ref|XP_006626880.1|  PREDICTED: probable dimethyladenosine transf...    215   7e-61    
ref|NP_651660.1|  CG11837                                               215   7e-61    
ref|XP_004024194.1|  hypothetical protein IMG5_198180                   216   7e-61    
ref|XP_005473300.1|  PREDICTED: probable dimethyladenosine transf...    214   9e-61    
ref|XP_009012028.1|  hypothetical protein HELRODRAFT_72990              214   9e-61    
emb|CBI36945.3|  unnamed protein product                                214   9e-61    
ref|XP_002037146.1|  GM12757                                            214   1e-60    
gb|ELQ74243.1|  Ribosomal RNA adenine dimethylase                       213   1e-60    
ref|XP_005489847.1|  PREDICTED: LOW QUALITY PROTEIN: probable dim...    215   1e-60    
ref|XP_002098640.1|  GE23825                                            214   1e-60    
gb|KHJ43535.1|  dimethyladenosine transferase                           216   2e-60    
gb|ACO07891.1|  Probable dimethyladenosine transferase                  214   2e-60    
dbj|BAG61444.1|  unnamed protein product                                211   2e-60    
ref|XP_010224774.1|  PREDICTED: probable dimethyladenosine transf...    214   2e-60    
ref|XP_007424252.1|  PREDICTED: probable dimethyladenosine transf...    213   2e-60    
ref|XP_006517799.1|  PREDICTED: probable dimethyladenosine transf...    211   2e-60    
gb|EAW51386.1|  dimethyladenosine transferase, isoform CRA_c            212   2e-60    
gb|AAH02841.1|  DIMT1L protein                                          212   3e-60    
gb|KFM64480.1|  putative dimethyladenosine transferase                  213   3e-60    
ref|NP_001290592.1|  DIM1 dimethyladenosine transferase 1 homolog       213   3e-60    
gb|ETN60036.1|  dimethyladenosine transferase                           213   3e-60    
ref|XP_001998837.1|  GI24187                                            213   3e-60    
gb|KDD72308.1|  ribosomal RNA adenine dimethylase                       213   3e-60    
gb|KFB35980.1|  AGAP004465-PA-like protein                              213   4e-60    
ref|XP_007130481.1|  PREDICTED: probable dimethyladenosine transf...    213   4e-60    
dbj|BAC83949.1|  Ribosomal RNA adenine dimethylase-like protein         211   4e-60    
ref|XP_007176119.1|  PREDICTED: probable dimethyladenosine transf...    213   4e-60    
ref|XP_002460751.1|  hypothetical protein SORBIDRAFT_02g034340          216   4e-60    
ref|XP_001647892.1|  dimethyladenosine transferase                      213   4e-60    
ref|XP_009677497.1|  PREDICTED: probable dimethyladenosine transf...    213   4e-60    
ref|XP_005500457.1|  PREDICTED: probable dimethyladenosine transf...    214   5e-60    
ref|XP_004275239.1|  PREDICTED: probable dimethyladenosine transf...    213   5e-60    
ref|XP_005704187.1|  dimethyladenosine transferase                      213   5e-60    
ref|XP_008101065.1|  PREDICTED: probable dimethyladenosine transf...    213   5e-60    
ref|XP_006134498.1|  PREDICTED: probable dimethyladenosine transf...    212   5e-60    
gb|EFN87842.1|  Probable dimethyladenosine transferase                  212   7e-60    
ref|XP_004205020.1|  Piso0_000311                                       213   7e-60    
ref|XP_004204462.1|  Piso0_000311                                       213   7e-60    
ref|XP_004351209.1|  dimethyladenosine transferase                      213   7e-60    
ref|XP_010003711.1|  PREDICTED: probable dimethyladenosine transf...    213   8e-60    
gb|KFD55875.1|  hypothetical protein M513_03314                         214   9e-60    
ref|XP_006059403.1|  PREDICTED: probable dimethyladenosine transf...    212   1e-59    
ref|XP_010383488.1|  PREDICTED: probable dimethyladenosine transf...    211   1e-59    
ref|XP_003294306.1|  hypothetical protein DICPUDRAFT_84787              212   1e-59    
gb|EAS06893.2|  dimethyladenosine transferase, putative                 213   1e-59    
ref|XP_003739917.1|  PREDICTED: probable dimethyladenosine transf...    211   2e-59    
ref|XP_001458307.1|  hypothetical protein                               213   2e-59    
gb|EMC81029.1|  putative dimethyladenosine transferase                  210   2e-59    
ref|XP_001346899.1|  Ribosomal RNA adenine dimethylase                  213   2e-59    
ref|XP_005837443.1|  hypothetical protein GUITHDRAFT_135139             211   2e-59    
emb|CCF73729.1|  unnamed protein product                                212   3e-59    
gb|KFV73286.1|  putative dimethyladenosine transferase                  209   3e-59    
gb|KFU95492.1|  putative dimethyladenosine transferase                  209   3e-59    
gb|EIF49891.1|  dimethyladenosine transferase                           211   4e-59    
ref|XP_953139.1|  dimethyladenosine transferase                         212   5e-59    
ref|XP_001864755.1|  dimethyladenosine transferase                      210   5e-59    
ref|XP_503386.1|  YALI0E00770p                                          210   5e-59    
gb|KGL85369.1|  putative dimethyladenosine transferase                  209   6e-59    
gb|KFW94304.1|  putative dimethyladenosine transferase                  209   7e-59    
ref|XP_008053328.1|  PREDICTED: probable dimethyladenosine transf...    209   7e-59    
ref|XP_010679368.1|  PREDICTED: probable dimethyladenosine transf...    211   9e-59    
emb|CDP90835.1|  Protein Bm13770, isoform c                             208   2e-58    
ref|XP_001902290.1|  Probable dimethyladenosine transferase             208   2e-58    
gb|KFV83533.1|  putative dimethyladenosine transferase                  207   2e-58    
gb|ERZ99395.1|  hypothetical protein GLOINDRAFT_339093                  209   2e-58    
emb|CDO66642.1|  small subunit rRNA dimethylase, putative               210   2e-58    
gb|ETE68604.1|  putative dimethyladenosine transferase                  208   2e-58    
ref|XP_001348329.1|  dimethyladenosine transferase, putative            210   3e-58    
ref|XP_003956076.1|  hypothetical protein KAFR_0B06450                  208   3e-58    
ref|XP_453098.1|  hypothetical protein                                  208   3e-58    
gb|EWC86038.1|  dimethyladenosine transferase                           210   3e-58    
gb|EPX72524.1|  18S rRNA dimethylase                                    207   4e-58    
ref|XP_006687815.1|  Dimethyladenosine transferase                      207   5e-58    
gb|KFM02995.1|  putative dimethyladenosine transferase                  206   6e-58    
ref|XP_004831086.1|  dimethyladenosine transferase, putative            211   8e-58    
ref|XP_006023595.1|  PREDICTED: uncharacterized protein LOC102387257    216   8e-58    
ref|XP_009270822.1|  PREDICTED: probable dimethyladenosine transf...    212   8e-58    
ref|XP_009167182.1|  hypothetical protein T265_04225                    207   8e-58    
ref|XP_007779098.1|  hypothetical protein W97_03009                     209   1e-57    
ref|XP_745929.1|  dimethyladenosine transferase                         209   1e-57    
ref|XP_007375875.1|  Dimethyladenosine transferase                      207   1e-57    
ref|XP_008623989.1|  16S rRNA (-N6/-N6)-dimethyltransferase             209   1e-57    
ref|XP_006134499.1|  PREDICTED: probable dimethyladenosine transf...    206   2e-57    
ref|XP_458685.1|  DEHA2D05038p                                          206   2e-57    
ref|XP_001748254.1|  hypothetical protein                               207   2e-57    
gb|EPB89678.1|  dimethyladenosine transferase                           206   2e-57    
ref|XP_008817507.1|  16S rRNA (-N6/-N6)-dimethyltransferase             209   2e-57    
gb|EUD73754.1|  16S rRNA (-N6/-N6)-dimethyltransferase                  209   2e-57    
gb|KHN73776.1|  putative dimethyladenosine transferase                  206   2e-57    
emb|CDU21753.1|  dimethyladenosine transferase, putative                209   2e-57    
gb|EPY53905.1|  18S rRNA dimethylase                                    206   2e-57    
ref|XP_002491535.1|  Essential 18S rRNA dimethylase (dimethyladen...    206   2e-57    
gb|ESX02238.1|  Dimethyladenosine transferase                           206   2e-57    
ref|XP_009039917.1|  hypothetical protein AURANDRAFT_60268              205   3e-57    
gb|KFP44857.1|  putative dimethyladenosine transferase                  204   3e-57    
ref|XP_001643153.1|  hypothetical protein Kpol_449p12                   205   4e-57    
gb|EMG46133.1|  Dimethyladenosine transferase                           206   4e-57    
ref|XP_002549326.1|  dimethyladenosine transferase                      205   4e-57    
ref|XP_722328.1|  likely dimethyladenosine transferase                  205   4e-57    
ref|NP_596122.1|  18S rRNA dimethylase (predicted)                      204   5e-57    
ref|XP_727737.1|  dimethyladenosine transferase                         207   5e-57    
ref|XP_001616795.1|  dimethyladenosine transferase                      207   6e-57    
ref|XP_648602.1|  dimethyladenosine transferase                         204   6e-57    
ref|XP_009218176.1|  hypothetical protein GGTG_02141                    207   6e-57    
gb|EHY66601.1|  dimethyladenosine transferase                           204   8e-57    
ref|XP_002260834.1|  dimethyladenosine transferase                      206   8e-57    
emb|CDU85123.1|  dimethyladenosine transferase, putative                207   8e-57    
gb|KID76247.1|  dimethyladenosine transferase dimethyltransferase       206   9e-57    
gb|EJW04579.1|  dimethyladenosine transferase                           203   9e-57    
ref|XP_003387030.1|  PREDICTED: probable dimethyladenosine transf...    204   9e-57    
emb|CCH40580.1|  Dimethyladenosine transferase                          204   1e-56    
gb|ETB59554.1|  dimethyladenosine transferase                           207   1e-56    
emb|CDO93427.1|  unnamed protein product                                204   1e-56    
gb|ERG82855.1|  putative dimethyladenosine transferase                  203   1e-56    
emb|CCD44423.1|  similar to dimethyladenosine transferase               205   2e-56    
dbj|BAN38359.1|  dimethyladenosine transferase, putative                202   2e-56    
pdb|2H1R|A  Chain A, Crystal Structure Of A Dimethyladenosine Tra...    203   2e-56    
ref|XP_001593673.1|  hypothetical protein SS1G_05101                    205   2e-56    
gb|EMR88761.1|  putative dimethyladenosine transferase protein          205   2e-56    
gb|ESL10034.1|  ribosomal rRNA adenine dimethylase family protein       204   2e-56    
ref|XP_001387199.1|  Dimethyladenosine transferase (S-adenosylmet...    203   2e-56    
gb|AEE63310.1|  unknown                                                 202   3e-56    
ref|XP_003869150.1|  Dim1 18S rRNA dimethylase                          203   3e-56    
gb|EIJ89581.1|  dimethyladenosine transferase                           202   3e-56    
dbj|GAA57529.1|  18S rRNA (adenine1779-N6/adenine1780-N6)-dimethy...    202   3e-56    
gb|KGB32849.1|  putative dimethyladenosine transferase                  202   4e-56    
gb|KID87843.1|  dimethyladenosine transferase dimethyltransferase       204   4e-56    
ref|XP_007808923.1|  dimethyladenosine transferase dimethyltransf...    204   4e-56    
gb|ESZ98488.1|  dimethyladenosine transferase dimethyltransferase       204   4e-56    
ref|XP_001525618.1|  dimethyladenosine transferase                      202   4e-56    
dbj|BAP73721.1|  dimethyladenosine transferase                          202   4e-56    
emb|CCK72858.1|  hypothetical protein KNAG_0L02440                      202   5e-56    
ref|XP_677650.1|  dimethyladenosine transferase                         204   5e-56    
ref|XP_002737862.1|  PREDICTED: probable dimethyladenosine transf...    202   5e-56    
gb|KID98940.1|  dimethyladenosine transferase dimethyltransferase       204   5e-56    
gb|EPY23440.1|  18S rRNA (adenine1779-N6/adenine1780-N6)-dimethyl...    203   5e-56    
gb|EJD76435.1|  dimethyladenosine transferase                           201   6e-56    
emb|CDS04645.1|  Putative Dimethyladenosine transferase                 202   6e-56    
ref|XP_003676167.1|  hypothetical protein NCAS_0D02250                  202   7e-56    
dbj|BAO42327.1|  dimethyladenosine transferase                          202   7e-56    
emb|CDU21340.1|  dimethyladenosine transferase, putative                204   8e-56    
ref|XP_002417911.1|  18S rRNA dimethylase, putative; S-adenosylme...    202   9e-56    
emb|CCD59597.1|  dimethyladenosine transferase, putative                201   1e-55    
gb|KFH66747.1|  dimethyladenosine transferase                           201   1e-55    
ref|XP_845283.1|  ribosomal RNA adenine dimethylase family protei...    202   1e-55    
gb|KHN69896.1|  dimethyladenosine transferase                           200   1e-55    
gb|KDB13761.1|  dimethyladenosine transferase dimethyltransferase       203   1e-55    
ref|XP_001483047.1|  dimethyladenosine transferase                      206   1e-55    
ref|XP_003051264.1|  hypothetical protein NECHADRAFT_41763              201   1e-55    
ref|XP_009310980.1|  putative ribosomal RNA adenine dimethylase f...    202   2e-55    
ref|XP_007819245.1|  dimethyladenosine transferase dimethyltransf...    203   2e-55    
gb|EDK40904.2|  dimethyladenosine transferase                           206   2e-55    
ref|XP_006968460.1|  dimethyladenosine transferase-like protein         201   2e-55    
emb|CDS31155.1|  dna helicase ino80                                     201   2e-55    
gb|KFG81228.1|  dimethyladenosine transferase dimethyltransferase       203   2e-55    
gb|EKC26948.1|  Putative dimethyladenosine transferase                  200   2e-55    
ref|NP_983429.1|  ACR026Wp                                              201   2e-55    
ref|XP_003072690.1|  dimethyladenosine transferase                      199   2e-55    



>ref|XP_009628672.1| PREDICTED: probable dimethyladenosine transferase [Nicotiana 
tomentosiformis]
Length=391

 Score =   441 bits (1134),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 267/391 (68%), Positives = 310/391 (79%), Gaps = 24/391 (6%)
 Frame = +2

Query  290   MLHRQYLLQYNIfrhllrrhflqrqlrskssrrFNGGRSNHEEDDGNVRRKIENQEANIY  469
             MLHR   L  NI +  L +HFL++  R+KS+RRFN  + + +ED   VRRK ENQEA IY
Sbjct  1     MLHRTKTLSENISKLNLSQHFLRQHCRTKSTRRFNNAK-DEDEDYHRVRRKTENQEAQIY  59

Query  470   LLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKR  649
             LLKSRGQHLL NPRVL+SIV KSN+LPTDTVLEIGPGTGNLTLKL+  AE+VIAIEIDKR
Sbjct  60    LLKSRGQHLLMNPRVLNSIVQKSNILPTDTVLEIGPGTGNLTLKLLEVAEKVIAIEIDKR  119

Query  650   MVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYR  829
             MVEIL+KR +E GL D+L+V CQDAL+TEFP+FDLMVANIPYGISSPL+AKLVFG N+YR
Sbjct  120   MVEILHKRVSERGLQDRLTVFCQDALRTEFPKFDLMVANIPYGISSPLVAKLVFGKNSYR  179

Query  830   SATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKI  1009
               TLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVM+VSK+DFLPCPKVDSSVVKI
Sbjct  180   GGTLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMNVSKKDFLPCPKVDSSVVKI  239

Query  1010  HPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQE-------  1168
             HPKA IP+V+ +EW AFTRTCFTKKNKTLGA FKQKR+L++LMKLQE+K D+        
Sbjct  240   HPKAEIPEVDYEEWCAFTRTCFTKKNKTLGAIFKQKRMLLDLMKLQEIKGDEVNNTIYSD  299

Query  1169  ------------SVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhl  1312
                         S ED +  S    ++L  FRE +I+IL SGGF+DKRPSKLSHEELL+L
Sbjct  300   YHVNDTEDEDGLSNEDNANFSSDVGMDLNLFREKVIDILRSGGFEDKRPSKLSHEELLNL  359

Query  1313  lslFNQSGISFHGPAKLKNPRQ----TAFDP  1393
             LSLFN++ + FHG  K  N +     +AF P
Sbjct  360   LSLFNRARLHFHGQVKPTNRKDAELASAFGP  390



>ref|XP_009761442.1| PREDICTED: probable dimethyladenosine transferase [Nicotiana 
sylvestris]
Length=391

 Score =   440 bits (1132),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 267/391 (68%), Positives = 312/391 (80%), Gaps = 24/391 (6%)
 Frame = +2

Query  290   MLHRQYLLQYNIfrhllrrhflqrqlrskssrrFNGGRSNHEEDDGNVRRKIENQEANIY  469
             MLHR  +L  NI +  L +HFL++  R+KS+RRFN  + + +ED   VRRK ENQEA IY
Sbjct  1     MLHRTKILSENISKLNLSKHFLRQHCRTKSTRRFNNAK-DEDEDYHGVRRKTENQEAQIY  59

Query  470   LLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKR  649
             LLKSRGQHLL NPRVL+SIV KSN+LPTDTVLEIGPGTGNLTLKL+  AE+VIAIEIDKR
Sbjct  60    LLKSRGQHLLMNPRVLNSIVQKSNILPTDTVLEIGPGTGNLTLKLLEVAEKVIAIEIDKR  119

Query  650   MVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYR  829
             MVEIL+KR +E GL D+L+V+CQDALKTEFP FDL+VANIPYGISSPL+AKLVFG N YR
Sbjct  120   MVEILHKRVSERGLQDRLTVICQDALKTEFPEFDLLVANIPYGISSPLVAKLVFGKNPYR  179

Query  830   SATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKI  1009
             S TLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVM+VSK+DFLPCPKVDS+VVKI
Sbjct  180   SGTLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMNVSKKDFLPCPKVDSAVVKI  239

Query  1010  HPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQ--------  1165
             HPKA IP+++  EW AFTRTCFTKKNKTLGA FKQKR+L+ELMKLQE+K D+        
Sbjct  240   HPKAEIPELDYQEWCAFTRTCFTKKNKTLGAIFKQKRMLLELMKLQEIKLDEVNNAIYSD  299

Query  1166  ESVEDCSLQSG----------SEI-IELASFREMIINILSSGGFDDKRPSKlsheellhl  1312
               V D   + G          S++ ++L  FRE +I+IL SGGF+DKRPSKLSHEELL+L
Sbjct  300   YHVNDSEDEDGLHNEDNANVSSDVGMDLNLFREKVIDILRSGGFEDKRPSKLSHEELLNL  359

Query  1313  lslFNQSGISFHGPAKLKNPRQ----TAFDP  1393
             LSLFN++ + FHG  K  N +     +AF P
Sbjct  360   LSLFNRARLHFHGQVKPTNGKDAELASAFGP  390



>ref|XP_006340679.1| PREDICTED: probable dimethyladenosine transferase-like [Solanum 
tuberosum]
Length=388

 Score =   434 bits (1116),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 248/352 (70%), Positives = 287/352 (82%), Gaps = 23/352 (7%)
 Frame = +2

Query  407   NHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTG  586
             + +E+   VRRK EN+EA IYLLKSRGQHLL NPRVL+SIV KSN+LPTDTVLEIGPGTG
Sbjct  36    DEDEEYNKVRRKTENEEAQIYLLKSRGQHLLMNPRVLNSIVQKSNILPTDTVLEIGPGTG  95

Query  587   NLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVAN  766
             NLTLKL+  A++VIAIEIDKRMVEIL+KR +E GL D+L+V+CQDALKTEFP+FDLMVAN
Sbjct  96    NLTLKLLEVAQKVIAIEIDKRMVEILHKRVSERGLQDRLTVICQDALKTEFPQFDLMVAN  155

Query  767   IPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFV  946
             IPYGISSPL+AKLV+G N+YRS TLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFV
Sbjct  156   IPYGISSPLVAKLVYGKNSYRSGTLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFV  215

Query  947   MDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrll  1126
             M+VSK+DFLPCPKVDSSVVKI+PK  IP+V+ +EW AFTRTCFTKKNKTLGA FKQKR+L
Sbjct  216   MNVSKKDFLPCPKVDSSVVKIYPKTEIPEVDYEEWCAFTRTCFTKKNKTLGAIFKQKRML  275

Query  1127  melmklqemkeDQES--------VEDCSLQSG---------SEII--ELASFREMIINIL  1249
             MELMKLQE K D+E+        V D   + G         S ++  +L  FRE+I +IL
Sbjct  276   MELMKLQETKGDEENNTLYSDYHVNDTEDEDGLSNEDNVNFSPVMGKDLNLFREIINDIL  335

Query  1250  SSGGFDDKRPSKlsheellhllslFNQSGISFHGPAKLKNPRQ----TAFDP  1393
              SGGF+DKRPSKLSH+ELL LLSLFN++ I FHG   LK+       +AF P
Sbjct  336   RSGGFEDKRPSKLSHKELLDLLSLFNRARIRFHGQVNLKDESDAELASAFGP  387



>ref|XP_004233729.1| PREDICTED: probable dimethyladenosine transferase [Solanum lycopersicum]
Length=386

 Score =   425 bits (1092),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 244/340 (72%), Positives = 280/340 (82%), Gaps = 22/340 (6%)
 Frame = +2

Query  413   EEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNL  592
             +E+   VRRK EN+EA IYLLKSRGQHLL NPRVL+SIV KSN+LPTDTVLEIGPGTGNL
Sbjct  36    DEEYNKVRRKTENEEAQIYLLKSRGQHLLMNPRVLNSIVQKSNILPTDTVLEIGPGTGNL  95

Query  593   TLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIP  772
             TLKL+  A++VIAIEIDKRMVEIL+KR +E GL D+L+V+CQDALKTEFPRFDLMVANIP
Sbjct  96    TLKLLEVAQKVIAIEIDKRMVEILHKRVSELGLQDRLTVICQDALKTEFPRFDLMVANIP  155

Query  773   YGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMD  952
             YGISSPL+AKLV+G N+YRS TLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVM+
Sbjct  156   YGISSPLVAKLVYGKNSYRSGTLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMN  215

Query  953   VSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllme  1132
             VSK+DFLPCPKVDSSVVKI+PK  IP+V+ +EW AFTRTCFTKKNKTLGA FKQKR+LME
Sbjct  216   VSKKDFLPCPKVDSSVVKIYPKTEIPEVDYEEWCAFTRTCFTKKNKTLGAIFKQKRMLME  275

Query  1133  lmklqemkeDQES--------VEDCSLQSG---------SEII--ELASFREMIINILSS  1255
             LMKLQE K D+E+        V D   + G         S  I  +L  FR++I +IL +
Sbjct  276   LMKLQETKGDEENNALYSDYHVNDTEDEDGLSNEDNVNFSPDIGKDLNLFRDIINDILRT  335

Query  1256  GGFDDKRPSKlsheellhllslFNQSGISFHGPAKLKNPR  1375
              GF+DKRPSKLSH+ELL LLSLFN++ I FHG     NP+
Sbjct  336   SGFEDKRPSKLSHKELLDLLSLFNRARIHFHGQV---NPK  372



>ref|XP_007046798.1| Ribosomal RNA adenine dimethylase family protein [Theobroma cacao]
 gb|EOX90955.1| Ribosomal RNA adenine dimethylase family protein [Theobroma cacao]
Length=389

 Score =   410 bits (1054),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 225/317 (71%), Positives = 263/317 (83%), Gaps = 16/317 (5%)
 Frame = +2

Query  446   ENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERV  625
             ENQ+  +YL KS+GQHLLTN R+LD+IV +SNV PTDTVLEIGPGTGNLT+KL+ AA+RV
Sbjct  54    ENQQDPLYLYKSKGQHLLTNTRILDAIVRRSNVRPTDTVLEIGPGTGNLTVKLLEAAKRV  113

Query  626   IAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKL  805
             +AIEIDKRMV+ILNKR AE GL D+L V+CQDA+K EFP+FDL+VANIPYGISSPL+AKL
Sbjct  114   VAIEIDKRMVDILNKRVAEKGLQDRLHVICQDAMKAEFPQFDLVVANIPYGISSPLVAKL  173

Query  806   VFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPK  985
             V+G N +RSATLLLQKEFARRLLA PGDSEFNRLAVNVKLVADVEFVMDVSKR+FLPCPK
Sbjct  174   VYGRNPFRSATLLLQKEFARRLLAKPGDSEFNRLAVNVKLVADVEFVMDVSKREFLPCPK  233

Query  986   VDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemk---  1156
             VDSSVV I PKA +PDVNLDEWWAFTRTCF+KKNKTLGATFKQK+ ++EL+KL +     
Sbjct  234   VDSSVVMIRPKAQVPDVNLDEWWAFTRTCFSKKNKTLGATFKQKKKVIELLKLAKTALVC  293

Query  1157  eDQESVEDC-------------SLQSGSEIIELASFREMIINILSSGGFDDKRPSKlshe  1297
             +D ES +D                 S +  +E+  F+E I+ IL +GGF+DKRPSKLS+E
Sbjct  294   KDYESDDDYGGDNEEERTDEEDGFASSASDLEMTLFKEKIVGILRTGGFEDKRPSKLSNE  353

Query  1298  ellhllslFNQSGISFH  1348
             ELLHLL LFNQ+GI FH
Sbjct  354   ELLHLLFLFNQAGIHFH  370



>ref|XP_004158885.1| PREDICTED: probable dimethyladenosine transferase-like [Cucumis 
sativus]
Length=352

 Score =   407 bits (1047),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 210/322 (65%), Positives = 253/322 (79%), Gaps = 18/322 (6%)
 Frame = +2

Query  422   DGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLK  601
             +GN+R+K EN+EA++Y  KSRGQH+LTN R+LDSIV KS +LPTDTVLEIGPGTGNLTLK
Sbjct  40    NGNLRKKDENEEAHLYFYKSRGQHILTNQRILDSIVRKSAILPTDTVLEIGPGTGNLTLK  99

Query  602   LVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGI  781
             L+ A+++VIA+EIDKRMVE+L+KR AEH L D++ V+CQDALK EFP FDL+VANIPYGI
Sbjct  100   LLEASQKVIAVEIDKRMVEVLHKRVAEHQLEDRICVICQDALKCEFPHFDLVVANIPYGI  159

Query  782   SSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSK  961
             SSPL+AKLV+G   +RSATLLLQKEFARRLLA+PGDSE+NRLAVNVKLVADVE VMDVSK
Sbjct  160   SSPLVAKLVYGTIPFRSATLLLQKEFARRLLADPGDSEYNRLAVNVKLVADVEHVMDVSK  219

Query  962   RDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmk  1141
             RDF+PCPKVDSSVV I PK  +P VNL+EW AFTRTCF KKNKTLGATF           
Sbjct  220   RDFVPCPKVDSSVVLIRPKKEVPKVNLEEWRAFTRTCFGKKNKTLGATF-----------  268

Query  1142  lqemkeDQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllsl  1321
                    ++  +   L   + +    SFRE +I +L SG F+DKRP KL +EELLHLL+L
Sbjct  269   -------KQKRKLMDLMHSNSMEGFNSFRETVIQVLKSGDFEDKRPVKLCNEELLHLLAL  321

Query  1322  FNQSGISFHGPAKLKNPRQTAF  1387
             FNQSGI FH  + L++  ++  
Sbjct  322   FNQSGIYFHNRSDLQDAERSVL  343



>emb|CBI17432.3| unnamed protein product [Vitis vinifera]
Length=383

 Score =   408 bits (1048),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 218/319 (68%), Positives = 257/319 (81%), Gaps = 12/319 (4%)
 Frame = +2

Query  437   RKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAA  616
             +K +N E +++L KS GQH+LTNPRVLD+IV KSN+ PTDTVLEIGPGTGNLTL+L+ AA
Sbjct  37    QKKDNGEKHMFLYKSWGQHILTNPRVLDTIVRKSNIKPTDTVLEIGPGTGNLTLRLLQAA  96

Query  617   ERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLL  796
             +RV+A+E+D RMVEIL KR AEHGL D+L+V+C+DALKT+FP+FDL+VANIPYGISSPL+
Sbjct  97    QRVVAVELDARMVEILRKRVAEHGLEDQLTVICKDALKTDFPQFDLVVANIPYGISSPLV  156

Query  797   AKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLP  976
             AKLVFGAN +RSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVA+VEFVMDVSKRDFLP
Sbjct  157   AKLVFGANPFRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAEVEFVMDVSKRDFLP  216

Query  977   CPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemk  1156
             CPKVDSSVV I PKA +PDV+L+EW AFTRTCF+KKNKTLGATFK KR +          
Sbjct  217   CPKVDSSVVTIRPKAEVPDVDLNEWCAFTRTCFSKKNKTLGATFKHKRRV----------  266

Query  1157  eDQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSG  1336
                E     +L+       ++ F+E I  +L  GGFDDKRP+KLS +ELL LLSLFNQ+G
Sbjct  267   --MELWRLSNLRGSETGNAMSLFKEKINGVLKLGGFDDKRPAKLSGKELLQLLSLFNQAG  324

Query  1337  ISFHGPAKLKNPRQTAFDP  1393
             I FH  AK +N    A  P
Sbjct  325   IHFHDQAKPRNADNIAASP  343



>ref|XP_004149981.1| PREDICTED: probable dimethyladenosine transferase-like [Cucumis 
sativus]
 gb|KGN48879.1| hypothetical protein Csa_6G504600 [Cucumis sativus]
Length=352

 Score =   406 bits (1044),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 209/322 (65%), Positives = 253/322 (79%), Gaps = 18/322 (6%)
 Frame = +2

Query  422   DGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLK  601
             +GN+R+K EN+EA++Y  KSRGQH+LTN R+LDSIV KS +LPTDTVLEIGPGTGNLTLK
Sbjct  40    NGNLRKKDENEEAHLYFYKSRGQHILTNQRILDSIVRKSAILPTDTVLEIGPGTGNLTLK  99

Query  602   LVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGI  781
             L+ A+++VIA+EIDKRMVE+L+KR  EH L D++ V+CQDALK EFP FDL+VANIPYGI
Sbjct  100   LLEASQKVIAVEIDKRMVEVLHKRVVEHQLEDRICVICQDALKCEFPHFDLVVANIPYGI  159

Query  782   SSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSK  961
             SSPL+AKLV+G   +RSATLLLQKEFARRLLA+PGDSE+NRLAVNVKLVADVE VMDVSK
Sbjct  160   SSPLVAKLVYGTIPFRSATLLLQKEFARRLLADPGDSEYNRLAVNVKLVADVEHVMDVSK  219

Query  962   RDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmk  1141
             RDF+PCPKVDSSVV I PK  +P+VNL+EW AFTRTCF KKNKTLGATF           
Sbjct  220   RDFVPCPKVDSSVVLIRPKKEVPEVNLEEWRAFTRTCFGKKNKTLGATF-----------  268

Query  1142  lqemkeDQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllsl  1321
                    ++  +   L   + +    SFRE +I +L SG F+DKRP KL +EELLHLL+L
Sbjct  269   -------KQKRKLMDLMHSNSMEGFNSFRETVIQVLKSGDFEDKRPVKLCNEELLHLLAL  321

Query  1322  FNQSGISFHGPAKLKNPRQTAF  1387
             FNQSGI FH  + L++  ++  
Sbjct  322   FNQSGIYFHNRSDLQDAERSVL  343



>ref|XP_010649089.1| PREDICTED: probable dimethyladenosine transferase [Vitis vinifera]
Length=383

 Score =   405 bits (1040),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 225/336 (67%), Positives = 267/336 (79%), Gaps = 26/336 (8%)
 Frame = +2

Query  437   RKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAA  616
             +K +N E +++L KS GQH+LTNPRVLD+IV KSN+ PTDTVLEIGPGTGNLTL+L+ AA
Sbjct  37    QKKDNGEKHMFLYKSWGQHILTNPRVLDTIVRKSNIKPTDTVLEIGPGTGNLTLRLLQAA  96

Query  617   ERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLL  796
             +RV+A+E+D RMVEIL KR AEHGL D+L+V+C+DALKT+FP+FDL+VANIPYGISSPL+
Sbjct  97    QRVVAVELDARMVEILRKRVAEHGLEDQLTVICKDALKTDFPQFDLVVANIPYGISSPLV  156

Query  797   AKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLP  976
             AKLVFGAN +RSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVA+VEFVMDVSKRDFLP
Sbjct  157   AKLVFGANPFRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAEVEFVMDVSKRDFLP  216

Query  977   CPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemk  1156
             CPKVDSSVV I PKA +PDV+L+EW AFTRTCF+KKNKTLGATFK KR +MEL +L  ++
Sbjct  217   CPKVDSSVVTIRPKAEVPDVDLNEWCAFTRTCFSKKNKTLGATFKHKRRVMELWRLSNLR  276

Query  1157  eDQESVE------DCSL-------------------QSGSEIIELASFREMIINILSSGG  1261
               +          DCS                      GSE +E++ F+E I  +L  GG
Sbjct  277   GSETGNAVSGCNYDCSYDEDKEEEEGNESDEGNGDPSPGSE-MEMSLFKEKINGVLKLGG  335

Query  1262  FDDKRPSKlsheellhllslFNQSGISFHGPAKLKN  1369
             FDDKRP+KLS +ELL LLSLFNQ+GI FH  AK +N
Sbjct  336   FDDKRPAKLSGKELLQLLSLFNQAGIHFHDQAKPRN  371



>emb|CAN73506.1| hypothetical protein VITISV_007907 [Vitis vinifera]
Length=383

 Score =   402 bits (1034),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 225/336 (67%), Positives = 265/336 (79%), Gaps = 26/336 (8%)
 Frame = +2

Query  437   RKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAA  616
             +K +N E  ++L KS GQH+LTNPRVLD+IV KSN+ PTDTVLEIGPGTGNLTL+L+ AA
Sbjct  37    QKKDNGEKXMFLYKSWGQHILTNPRVLDTIVRKSNIKPTDTVLEIGPGTGNLTLRLLQAA  96

Query  617   ERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLL  796
             +RV+A+ +D RMVEIL KR AEHGL D+L+V+C+DALKT+FP+FDL+VANIPYGISSPL+
Sbjct  97    QRVVAVXLDARMVEILRKRVAEHGLEDQLTVICKDALKTDFPQFDLVVANIPYGISSPLV  156

Query  797   AKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLP  976
             AKLVFGAN +RSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVA+VEFVMDVSKRDFLP
Sbjct  157   AKLVFGANPFRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAEVEFVMDVSKRDFLP  216

Query  977   CPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemk  1156
             CPKVDSSVV I PKA IPDV+L+EW AFTRTCF+KKNKTLGATFK KR +MEL +L  ++
Sbjct  217   CPKVDSSVVTIRPKAEIPDVDLNEWCAFTRTCFSKKNKTLGATFKHKRRVMELWRLSNLR  276

Query  1157  eDQESVE------DCSL-------------------QSGSEIIELASFREMIINILSSGG  1261
               +          DCS                      GSE +E++ F+E I  +L  GG
Sbjct  277   GSETGNAVSGCNYDCSYDEDKEEEEGNERHEGNGDPSPGSE-MEMSLFKEKINGVLKLGG  335

Query  1262  FDDKRPSKlsheellhllslFNQSGISFHGPAKLKN  1369
             FDDKRP+KLS +ELL LLSLFNQ+GI FH  AK +N
Sbjct  336   FDDKRPAKLSGKELLQLLSLFNQAGIHFHDQAKPRN  371



>ref|XP_008440777.1| PREDICTED: probable dimethyladenosine transferase [Cucumis melo]
Length=352

 Score =   400 bits (1029),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 211/331 (64%), Positives = 258/331 (78%), Gaps = 20/331 (6%)
 Frame = +2

Query  401   RSNHEED--DGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIG  574
             + NH  +   GN+ +K EN+EA++Y  KSRGQH+LTN R+LDSIV KS +LPTDTVLEIG
Sbjct  31    QHNHRNNGPHGNLPKKDENEEAHLYFYKSRGQHILTNQRILDSIVRKSAILPTDTVLEIG  90

Query  575   PGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDL  754
             PGTGNLTLKL+ A+++VIA+EIDKRMVE+L++R AEH L D++ V+CQDALK E P FDL
Sbjct  91    PGTGNLTLKLLEASQKVIAVEIDKRMVEVLHRRVAEHQLEDRICVICQDALKCELPHFDL  150

Query  755   MVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAD  934
             +VANIPYGISSPL+AKLV+G   +RSATLLLQKEFARRLLA+PGDSE+NRLAVNVKLVAD
Sbjct  151   VVANIPYGISSPLVAKLVYGTIPFRSATLLLQKEFARRLLADPGDSEYNRLAVNVKLVAD  210

Query  935   VEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkq  1114
             VE VMDVSKRDF+PCPKVDSSVV I PK  +P+VNL+EW AFTRTCF KKNKTLGATF  
Sbjct  211   VEHVMDVSKRDFVPCPKVDSSVVLIRPKKEVPEVNLEEWRAFTRTCFGKKNKTLGATF--  268

Query  1115  krllmelmklqemkeDQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsh  1294
                           + +  + D  + S SE     SFRE +I +L SG F+DKRP KL +
Sbjct  269   --------------KQKRKLMDL-MHSNSE-EGFNSFRETVIQVLKSGDFEDKRPVKLCN  312

Query  1295  eellhllslFNQSGISFHGPAKLKNPRQTAF  1387
             E+LLHLL+LFNQSGI FH  ++L++  ++  
Sbjct  313   EKLLHLLALFNQSGIYFHNRSELQDAERSVL  343



>ref|XP_010277808.1| PREDICTED: probable dimethyladenosine transferase isoform X3 
[Nelumbo nucifera]
Length=362

 Score =   397 bits (1021),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 222/350 (63%), Positives = 265/350 (76%), Gaps = 23/350 (7%)
 Frame = +2

Query  401   RSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPG  580
             R +++ED+   +RK E QE  IY  KSRGQH+LTNPRVLDSIV ++ + PTDTVLEIGPG
Sbjct  9     RDDNDEDER--KRKREGQEGYIYFHKSRGQHILTNPRVLDSIVRRAEIRPTDTVLEIGPG  66

Query  581   TGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMV  760
             TGNLTLKL+  AE+V A+EIDKRMVE+LN R AE GL D+L+V+C+DALK +FP FDL+V
Sbjct  67    TGNLTLKLLEVAEKVFAVEIDKRMVEVLNNRVAECGLEDRLTVICKDALKMDFPPFDLIV  126

Query  761   ANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVE  940
             ANIPYGISSPL+AKLVFGA  +RSATLLLQKEFARRLLANPGDS FNRLAVNVKLVA+VE
Sbjct  127   ANIPYGISSPLIAKLVFGAYPFRSATLLLQKEFARRLLANPGDSAFNRLAVNVKLVAEVE  186

Query  941   FVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr  1120
             FVMDVSK+DF+PCPKVDSSVVKI PK  +PDV++ EWWAFTRTCF KKNKTLGATFKQK+
Sbjct  187   FVMDVSKKDFIPCPKVDSSVVKIWPKTKVPDVDMHEWWAFTRTCFNKKNKTLGATFKQKK  246

Query  1121  llme-------------lmklqemkeDQESVEDCSLQSGSEII--------ELASFREMI  1237
              ++E              +  +   +D +  E+   QS  E          +L SF+EMI
Sbjct  247   KVVELLRRSQMMDSLKDHVATRYNYDDYDDKEEQEEQSDGEHCFPSPCSEKDLVSFKEMI  306

Query  1238  INILSSGGFDDKRPSKlsheellhllslFNQSGISFHGPAKLKNPRQTAF  1387
               +L +GGF+ KRPSKLS EELLHLLSL NQ+GI F+   K K+     F
Sbjct  307   AEVLKAGGFEAKRPSKLSIEELLHLLSLLNQAGIYFNDRTKGKDVSNEGF  356



>ref|XP_010277807.1| PREDICTED: probable dimethyladenosine transferase isoform X2 
[Nelumbo nucifera]
Length=396

 Score =   397 bits (1021),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 222/350 (63%), Positives = 265/350 (76%), Gaps = 23/350 (7%)
 Frame = +2

Query  401   RSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPG  580
             R +++ED+   +RK E QE  IY  KSRGQH+LTNPRVLDSIV ++ + PTDTVLEIGPG
Sbjct  43    RDDNDEDER--KRKREGQEGYIYFHKSRGQHILTNPRVLDSIVRRAEIRPTDTVLEIGPG  100

Query  581   TGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMV  760
             TGNLTLKL+  AE+V A+EIDKRMVE+LN R AE GL D+L+V+C+DALK +FP FDL+V
Sbjct  101   TGNLTLKLLEVAEKVFAVEIDKRMVEVLNNRVAECGLEDRLTVICKDALKMDFPPFDLIV  160

Query  761   ANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVE  940
             ANIPYGISSPL+AKLVFGA  +RSATLLLQKEFARRLLANPGDS FNRLAVNVKLVA+VE
Sbjct  161   ANIPYGISSPLIAKLVFGAYPFRSATLLLQKEFARRLLANPGDSAFNRLAVNVKLVAEVE  220

Query  941   FVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr  1120
             FVMDVSK+DF+PCPKVDSSVVKI PK  +PDV++ EWWAFTRTCF KKNKTLGATFKQK+
Sbjct  221   FVMDVSKKDFIPCPKVDSSVVKIWPKTKVPDVDMHEWWAFTRTCFNKKNKTLGATFKQKK  280

Query  1121  llme-------------lmklqemkeDQESVEDCSLQSGSEII--------ELASFREMI  1237
              ++E              +  +   +D +  E+   QS  E          +L SF+EMI
Sbjct  281   KVVELLRRSQMMDSLKDHVATRYNYDDYDDKEEQEEQSDGEHCFPSPCSEKDLVSFKEMI  340

Query  1238  INILSSGGFDDKRPSKlsheellhllslFNQSGISFHGPAKLKNPRQTAF  1387
               +L +GGF+ KRPSKLS EELLHLLSL NQ+GI F+   K K+     F
Sbjct  341   AEVLKAGGFEAKRPSKLSIEELLHLLSLLNQAGIYFNDRTKGKDVSNEGF  390



>ref|XP_010277806.1| PREDICTED: probable dimethyladenosine transferase isoform X1 
[Nelumbo nucifera]
Length=437

 Score =   397 bits (1020),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 225/351 (64%), Positives = 268/351 (76%), Gaps = 25/351 (7%)
 Frame = +2

Query  401   RSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPG  580
             R +++ED+   +RK E QE  IY  KSRGQH+LTNPRVLDSIV ++ + PTDTVLEIGPG
Sbjct  84    RDDNDEDER--KRKREGQEGYIYFHKSRGQHILTNPRVLDSIVRRAEIRPTDTVLEIGPG  141

Query  581   TGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMV  760
             TGNLTLKL+  AE+V A+EIDKRMVE+LN R AE GL D+L+V+C+DALK +FP FDL+V
Sbjct  142   TGNLTLKLLEVAEKVFAVEIDKRMVEVLNNRVAECGLEDRLTVICKDALKMDFPPFDLIV  201

Query  761   ANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVE  940
             ANIPYGISSPL+AKLVFGA  +RSATLLLQKEFARRLLANPGDS FNRLAVNVKLVA+VE
Sbjct  202   ANIPYGISSPLIAKLVFGAYPFRSATLLLQKEFARRLLANPGDSAFNRLAVNVKLVAEVE  261

Query  941   FVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr  1120
             FVMDVSK+DF+PCPKVDSSVVKI PK  +PDV++ EWWAFTRTCF KKNKTLGATFKQK+
Sbjct  262   FVMDVSKKDFIPCPKVDSSVVKIWPKTKVPDVDMHEWWAFTRTCFNKKNKTLGATFKQKK  321

Query  1121  llmelmklqem----------------------keDQESVEDCSLQSGSEIIELASFREM  1234
              ++EL++  +M                      +E+Q   E C     SE  +L SF+EM
Sbjct  322   KVVELLRRSQMMDSLKDHVATRYNYDDYDDKEEQEEQSDGEHCFPSPCSE-KDLVSFKEM  380

Query  1235  IINILSSGGFDDKRPSKlsheellhllslFNQSGISFHGPAKLKNPRQTAF  1387
             I  +L +GGF+ KRPSKLS EELLHLLSL NQ+GI F+   K K+     F
Sbjct  381   IAEVLKAGGFEAKRPSKLSIEELLHLLSLLNQAGIYFNDRTKGKDVSNEGF  431



>ref|XP_002324910.1| hypothetical protein POPTR_0018s02560g [Populus trichocarpa]
 gb|EEF03475.1| hypothetical protein POPTR_0018s02560g [Populus trichocarpa]
Length=386

 Score =   391 bits (1005),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 220/350 (63%), Positives = 263/350 (75%), Gaps = 23/350 (7%)
 Frame = +2

Query  404   SNHEEDDGNVRRKIEN-QEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPG  580
             ++H  D    R   E+ Q+ +++L KS+GQHLLTN R+LDSIV KS++ PTDTVLEIGPG
Sbjct  33    THHYNDKYRTRNTKEDKQQDDLFLYKSKGQHLLTNQRILDSIVRKSSINPTDTVLEIGPG  92

Query  581   TGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMV  760
             TGNLTLKL+  A +V+A+EIDKRMV +LNKR  EHG  DKLSV+ +DALK EFP+FDL+V
Sbjct  93    TGNLTLKLLDVASKVVAVEIDKRMVGVLNKRVKEHGFEDKLSVIREDALKAEFPKFDLVV  152

Query  761   ANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVE  940
             ANIPYGISSPL+AKLV+GAN +RSATLLLQKEFARRLLA PGDSEFNRLAVNVKLVADVE
Sbjct  153   ANIPYGISSPLVAKLVYGANPFRSATLLLQKEFARRLLAKPGDSEFNRLAVNVKLVADVE  212

Query  941   FVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr  1120
             FVM+VSKRDF P PKVDSSVV I PK  IPDVNLDEWWAFT+ CF KKNKTLGATFKQK+
Sbjct  213   FVMNVSKRDFFPVPKVDSSVVIIRPKDRIPDVNLDEWWAFTKNCFGKKNKTLGATFKQKK  272

Query  1121  llmelmklqemke---------------------DQESVEDCSLQSGSEIIELASFREMI  1237
              ++EL +L +M                       ++   E+C   S ++  EL  F+E I
Sbjct  273   KVIELFRLSKMTSSNGEEINRNQYVCADDDGDNEEESDGEECHSSSCAD-RELLLFKEKI  331

Query  1238  INILSSGGFDDKRPSKlsheellhllslFNQSGISFHGPAKLKNPRQTAF  1387
             I +L +G F+DKRPSKL +EELL+LLS+ NQSGI FH   K +N    AF
Sbjct  332   IEVLKAGSFEDKRPSKLCNEELLYLLSMLNQSGIYFHEQTKPRNVGNVAF  381



>ref|XP_011036685.1| PREDICTED: probable dimethyladenosine transferase [Populus euphratica]
Length=386

 Score =   389 bits (1000),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 219/352 (62%), Positives = 263/352 (75%), Gaps = 24/352 (7%)
 Frame = +2

Query  401   RSNHEEDDGNVRR--KIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIG  574
             + NH  +D    R  K +NQ+ +++L K +GQHLLTN R+LDSIV  S++ PTDTVLEIG
Sbjct  31    KPNHHYNDKYRTRNTKEDNQQDDLFLYKGKGQHLLTNQRILDSIVRNSSINPTDTVLEIG  90

Query  575   PGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDL  754
             PGTGNLTLKL+  A +V+A+EIDKRMV +LNKR  EHG  DKLSV+  DALK EFP+FDL
Sbjct  91    PGTGNLTLKLLDVASKVVAVEIDKRMVGVLNKRVKEHGFEDKLSVIRADALKAEFPKFDL  150

Query  755   MVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAD  934
             +VANIPYGISSPL+AKLV+GAN +RSATLLLQKEFARRLLA PGDSEFNRLAVNVKLVAD
Sbjct  151   VVANIPYGISSPLVAKLVYGANPFRSATLLLQKEFARRLLAKPGDSEFNRLAVNVKLVAD  210

Query  935   VEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkq  1114
             VEFVM+VSKRDF+P PKVDSSVV I PK  IPDVNLDEWWAFT+ CF KKNKTLGATFKQ
Sbjct  211   VEFVMNVSKRDFVPVPKVDSSVVIIRPKDRIPDVNLDEWWAFTKHCFGKKNKTLGATFKQ  270

Query  1115  krllmelmklqemke---------------------DQESVEDCSLQSGSEIIELASFRE  1231
             K+ ++EL +L ++                       ++   E+C   S ++  EL  F+E
Sbjct  271   KKKVIELFRLSKLTSSNGEEMNRNQYVCADDDGDNEEESDGEECHSSSCAD-RELLLFKE  329

Query  1232  MIINILSSGGFDDKRPSKlsheellhllslFNQSGISFHGPAKLKNPRQTAF  1387
              II +L +G F+DKRPSKL +EELL+LLS+ NQSGI FH   K +N    AF
Sbjct  330   KIIEVLKAGSFEDKRPSKLCNEELLYLLSMLNQSGIYFHEQTKPRNVDDVAF  381



>ref|XP_007203689.1| hypothetical protein PRUPE_ppa026107mg, partial [Prunus persica]
 gb|EMJ04888.1| hypothetical protein PRUPE_ppa026107mg, partial [Prunus persica]
Length=344

 Score =   385 bits (990),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 212/340 (62%), Positives = 265/340 (78%), Gaps = 18/340 (5%)
 Frame = +2

Query  419   DDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTL  598
             DDG  R++ E Q+ ++ L KS+GQHLLTN R+LDSIV KS + PTDTVLEIGPGTGNLTL
Sbjct  1     DDGR-RKREEGQDGHLQLHKSKGQHLLTNQRILDSIVRKSAIKPTDTVLEIGPGTGNLTL  59

Query  599   KLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYG  778
             KL+ AA+ V+A+EIDKRMVE+L KR AE G+ D+L+V+C+DALK EFP FD++VANIPYG
Sbjct  60    KLLEAAKSVVAVEIDKRMVEVLQKRVAECGVQDRLTVICKDALKAEFPPFDIVVANIPYG  119

Query  779   ISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVS  958
             ISSPL+AKLV+GA ++RSATLLLQKEFARRL+A PGDSEFNRLAVNVKLV +VEFVMDVS
Sbjct  120   ISSPLVAKLVYGARSFRSATLLLQKEFARRLMAKPGDSEFNRLAVNVKLVVNVEFVMDVS  179

Query  959   KRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelm  1138
             KR+F+PCPKVDSSVV I PKA +P+VNLDEWWAFT+ CF  KNKTLGATFKQK+ +MEL+
Sbjct  180   KREFVPCPKVDSSVVIIRPKAEVPNVNLDEWWAFTKACFCNKNKTLGATFKQKKKVMELL  239

Query  1139  klqemkeDQESVED--CSLQSGSE---------------IIELASFREMIINILSSGGFD  1267
             +L ++       ++  CS     +                +  +SF+E ++ +L S  F+
Sbjct  240   RLSKLAGSNGETDNYICSNDDNGDGGESNEEELSSSSCSEMGASSFKEKLMGVLKSADFE  299

Query  1268  DKRPSKlsheellhllslFNQSGISFHGPAKLKNPRQTAF  1387
             DKRPSKLS+EELLHLL+LFNQ+GI FH  +K +N    +F
Sbjct  300   DKRPSKLSNEELLHLLALFNQAGIYFHDQSKSRNAENESF  339



>ref|XP_006466875.1| PREDICTED: dimethyladenosine transferase-like [Citrus sinensis]
Length=399

 Score =   387 bits (993),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 223/340 (66%), Positives = 266/340 (78%), Gaps = 22/340 (6%)
 Frame = +2

Query  395   GGRSNHE--EDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLE  568
               R  H+  +DD  +   I++QE  I+  KS+GQH+LTN RVLDSIV KS++ P DTVLE
Sbjct  33    SNRCTHKNKDDDKKIHSPIKHQEDYIFFHKSKGQHILTNQRVLDSIVRKSSINPDDTVLE  92

Query  569   IGPGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRF  748
             IGPGTGNLTLKL+  +++V AIEID+RMVEILN+RAA+ G  D+L+V+ +DALKTEFP+F
Sbjct  93    IGPGTGNLTLKLLEVSKKVHAIEIDERMVEILNRRAADSGFHDRLNVISKDALKTEFPQF  152

Query  749   DLMVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLV  928
             DL+VANIPYGISSPL+AKLV+G  ++RSATLLLQKEFARRLLA+PGDSEFNRLAVNVKLV
Sbjct  153   DLVVANIPYGISSPLVAKLVYGTKSFRSATLLLQKEFARRLLASPGDSEFNRLAVNVKLV  212

Query  929   ADVEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             ADVEFVMDVSKRDFLPCPKVDSSVV I PKA IPDVNLDEW AFTRTCF+KKNKTLGATF
Sbjct  213   ADVEFVMDVSKRDFLPCPKVDSSVVIIRPKAEIPDVNLDEWRAFTRTCFSKKNKTLGATF  272

Query  1109  kqkrllmelmklqemk--eDQESVEDCSLQSG--------SEIIELAS----------FR  1228
             KQK+ ++EL++L + K   ++  V D    SG        S + +L S          F+
Sbjct  273   KQKKKVIELLRLSKQKGPNNENFVSDDGCHSGEDDDDEEASGVDDLCSSSCSEMEMSLFK  332

Query  1229  EMIINILSSGGFDDKRPSKlsheellhllslFNQSGISFH  1348
             E II +L S  F+DKRP KLS+EELLHLLSLFNQ GI FH
Sbjct  333   EKIIQVLKSAAFEDKRPCKLSNEELLHLLSLFNQVGIYFH  372



>ref|XP_011083164.1| PREDICTED: probable dimethyladenosine transferase [Sesamum indicum]
Length=389

 Score =   382 bits (980),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 223/334 (67%), Positives = 260/334 (78%), Gaps = 23/334 (7%)
 Frame = +2

Query  446   ENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERV  625
             E +E  + LLKSRGQHLLTNPRVLDSIV  S++ P DTVLEIGPGTGNLTLKL+ AA RV
Sbjct  52    EEKEGRVRLLKSRGQHLLTNPRVLDSIVRTSDIKPDDTVLEIGPGTGNLTLKLLEAARRV  111

Query  626   IAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKL  805
             +A+EID RMVEIL KRAAE G  D+L++V  DALKT+FP F+L+VANIPYGISSPLLAKL
Sbjct  112   VAVEIDNRMVEILRKRAAERGFQDRLNIVSGDALKTKFPEFNLVVANIPYGISSPLLAKL  171

Query  806   VFGANA--YRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPC  979
             V+G N   +RSATLLLQKEFARRLLA PGDSEFNRLAVN+KLVA++EFVMDVSKRDF+PC
Sbjct  172   VYGVNVNPFRSATLLLQKEFARRLLAKPGDSEFNRLAVNMKLVAELEFVMDVSKRDFVPC  231

Query  980   PKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemke  1159
             PKVDSSV+KI+PK+ IPDV+L+EWWAFTRTCF+KKNKTLGAT KQKR LMELMKL + + 
Sbjct  232   PKVDSSVIKIYPKSEIPDVDLEEWWAFTRTCFSKKNKTLGATLKQKRKLMELMKLSKAEV  291

Query  1160  ---------DQESVEDC---------SLQSGSEIIELASFREMIINILSSGGFDDKRPSK  1285
                        +  E+C         SL SG+ I     FR  I+ IL SGGF +KRPSK
Sbjct  292   FADDGNPECHDDGDEECDSDEGSSDSSLNSGTGI---GLFRTKIVRILGSGGFLEKRPSK  348

Query  1286  lsheellhllslFNQSGISFHGPAKLKNPRQTAF  1387
             LS++ELL LLSL N +GI FH   K K+  + AF
Sbjct  349   LSNDELLQLLSLLNGAGIYFHDGTKKKDTCEAAF  382



>ref|XP_008337773.1| PREDICTED: probable dimethyladenosine transferase [Malus domestica]
 ref|XP_008363094.1| PREDICTED: probable dimethyladenosine transferase [Malus domestica]
Length=380

 Score =   378 bits (971),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 211/346 (61%), Positives = 263/346 (76%), Gaps = 20/346 (6%)
 Frame = +2

Query  410   HEEDDGN---VRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPG  580
             H ++DG    V +  E ++  + L K++GQHLLTN R+LDSIV KS + PTDTVLEIGPG
Sbjct  30    HPKNDGGGDGVWKTEEKKDGYLQLHKNKGQHLLTNQRILDSIVRKSAIKPTDTVLEIGPG  89

Query  581   TGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMV  760
             TGNLTLKL+ AA+ V+A+E+DKRMVE+L KR AE G+ D+L+V+C+DALK EFP FDL+V
Sbjct  90    TGNLTLKLLEAAQXVVAVELDKRMVEVLQKRVAESGVQDRLTVICKDALKAEFPXFDLVV  149

Query  761   ANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVE  940
             ANIPYGISSPL+AKLV+GA  +RSATLLLQKEFARRLLA PGDSEFNRLAVNV LVADVE
Sbjct  150   ANIPYGISSPLVAKLVYGARPFRSATLLLQKEFARRLLAKPGDSEFNRLAVNVNLVADVE  209

Query  941   FVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr  1120
             FVMDVSKR+F+PCPKVDSSVV I PK  +P+V+L+EWWAFT+ CF KKNKTLGATFKQK+
Sbjct  210   FVMDVSKREFVPCPKVDSSVVIIRPKPEVPNVDLNEWWAFTKACFCKKNKTLGATFKQKK  269

Query  1121  llmelmklqemkeDQESVEDC---------------SLQSGSEIIEL--ASFREMIINIL  1249
              +MEL+ + ++       +D                   S S   E+  +SF+E ++ +L
Sbjct  270   KVMELLGMSKLAGSNGESKDYISSTDNDDDEGESDEEEFSPSPCSEMGASSFKEKLMGVL  329

Query  1250  SSGGFDDKRPSKlsheellhllslFNQSGISFHGPAKLKNPRQTAF  1387
              S  F+DKRPSKLS+EELLHLL+LFNQ+GI FH  +K +N    +F
Sbjct  330   KSADFEDKRPSKLSNEELLHLLALFNQAGIYFHDQSKSRNAENESF  375



>ref|XP_004289104.1| PREDICTED: probable dimethyladenosine transferase-like [Fragaria 
vesca subsp. vesca]
Length=375

 Score =   375 bits (963),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 212/342 (62%), Positives = 261/342 (76%), Gaps = 16/342 (5%)
 Frame = +2

Query  413   EEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNL  592
             E+D    RR+  N++    L KS+GQHLLTN R+LDSIV KS++ PTDTVLEIGPGTGNL
Sbjct  34    EDDVYKARRREVNRDDYFQLYKSKGQHLLTNQRILDSIVRKSDIKPTDTVLEIGPGTGNL  93

Query  593   TLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIP  772
             TLKL+ AA +V+A EIDKRMVE L+KR  E G+GD+L+VVC+DALK EFP FDL+VANIP
Sbjct  94    TLKLLEAANKVVAFEIDKRMVEALHKRVVERGVGDRLTVVCKDALKAEFPEFDLVVANIP  153

Query  773   YGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMD  952
             YGISSPL+AKLV+G   +RSATLLLQKEFARRLLA PG+SEFNRLAVNV LVADVEFVMD
Sbjct  154   YGISSPLVAKLVYGGRRFRSATLLLQKEFARRLLAKPGESEFNRLAVNVSLVADVEFVMD  213

Query  953   VSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllme  1132
             VSKR+F+PCPKVDSSVV I PKA +PDVNL+EW AFT+ CF KKNKTLGATFKQK+ ++E
Sbjct  214   VSKREFVPCPKVDSSVVIIRPKAEVPDVNLEEWCAFTKACFGKKNKTLGATFKQKKKVVE  273

Query  1133  lmklqemkeDQESVED-----C-----------SLQSGSEIIELASFREMIINILSSGGF  1264
             L+ L ++ +     E+     C              +  E+ E +SF+E +I +L S  F
Sbjct  274   LLGLSKLTDSNVESENHIGSNCPDDEEESDEEECSSACLEMGEASSFKEKLIGVLKSADF  333

Query  1265  DDKRPSKlsheellhllslFNQSGISFHGPAKLKNPRQTAFD  1390
             ++KRPSKLS++ELLHLL+LFNQ+GI F   +K  +    +FD
Sbjct  334   ENKRPSKLSNDELLHLLALFNQAGIYFLDRSKSTSVVVESFD  375



>gb|EYU31168.1| hypothetical protein MIMGU_mgv1a026501mg [Erythranthe guttata]
Length=320

 Score =   373 bits (958),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 201/314 (64%), Positives = 243/314 (77%), Gaps = 23/314 (7%)
 Frame = +2

Query  473   LKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRM  652
             +KSRGQHLLTNPR+LD IV  SN+   DTVLEIGPGTGNLTL+L+ AA+ V+A+EID RM
Sbjct  16    MKSRGQHLLTNPRILDCIVRTSNIKSDDTVLEIGPGTGNLTLELLEAAKNVVAVEIDNRM  75

Query  653   VEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG--ANAY  826
             VEIL KR +E G  D+L+++  DALKT+FP F+L+VANIPY ISSPLLAKLV+G   N +
Sbjct  76    VEILRKRTSERGFNDRLNIISGDALKTDFPEFNLVVANIPYNISSPLLAKLVYGVKTNPF  135

Query  827   RSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVK  1006
             RSATLLLQKEFARRLLA PGDSEFNRLAVNV LVA+VEFVMDVSKRDF+PCPKVDSSV+K
Sbjct  136   RSATLLLQKEFARRLLAKPGDSEFNRLAVNVTLVAEVEFVMDVSKRDFVPCPKVDSSVIK  195

Query  1007  IHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCS  1186
             I+PK+ IP+V+L+EWWAFTRTCF+KKNKTLGATFKQK               ++ +E  +
Sbjct  196   IYPKSEIPNVDLNEWWAFTRTCFSKKNKTLGATFKQK---------------KKLIELMN  240

Query  1187  LQSGSEIIE------LASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISFH  1348
             L    + +E      + SFR  I+ +L  GGF DKRP KL +++LL LLSLFN++GI FH
Sbjct  241   LSDSGKFLENDTSSSMTSFRGEIMRLLECGGFSDKRPIKLGNDDLLCLLSLFNEAGIFFH  300

Query  1349  GPAKLKNPRQTAFD  1390
               AK K+   TAFD
Sbjct  301   DRAKNKDTFDTAFD  314



>ref|XP_004512086.1| PREDICTED: probable dimethyladenosine transferase-like [Cicer 
arietinum]
Length=326

 Score =   367 bits (941),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 204/320 (64%), Positives = 236/320 (74%), Gaps = 30/320 (9%)
 Frame = +2

Query  428   NVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLV  607
             ++RR  E+ E NI+  KSRGQH+LTNPR+LD+IV KS + PTDTVLEIGPGTGNLTLKL+
Sbjct  18    SLRRLHEDIEDNIHFYKSRGQHILTNPRILDAIVRKSAINPTDTVLEIGPGTGNLTLKLL  77

Query  608   SAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISS  787
              A+  VIAIEID RMV IL  RA + GL +KL V+ +DAL+TEFP FDL+VANIPYGISS
Sbjct  78    EASHEVIAIEIDHRMVPILENRALKRGLRNKLKVITKDALRTEFPPFDLVVANIPYGISS  137

Query  788   PLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRD  967
             PL+ KLV+G   +RSATLLLQKEFARRLLANPGDSEFNRLAVNVKL+ADVEFVMDVSKRD
Sbjct  138   PLVIKLVYGTTRFRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLLADVEFVMDVSKRD  197

Query  968   FLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklq  1147
             F P PKVDSSVV I PK  IP V+L EW AFTRTCF  KNKTLGATFK            
Sbjct  198   FFPSPKVDSSVVIIRPKDKIPTVDLREWRAFTRTCFNNKNKTLGATFK------------  245

Query  1148  emkeDQESVEDCSLQSGSEIIELA------SFREMIINILSSGGFDDKRPSKlsheellh  1309
                         S +   E++E +      SF+E II +L  GGF+DKRPSKLS +ELLH
Sbjct  246   ------------SKRKVLELLEFSKDDVCNSFKEKIIGVLREGGFEDKRPSKLSIDELLH  293

Query  1310  llslFNQSGISFHGPAKLKN  1369
             LL LFNQ G+ F    +L+N
Sbjct  294   LLYLFNQVGVYFDHHGELRN  313



>ref|XP_010557762.1| PREDICTED: probable dimethyladenosine transferase [Tarenaya hassleriana]
 ref|XP_010557772.1| PREDICTED: probable dimethyladenosine transferase [Tarenaya hassleriana]
Length=367

 Score =   367 bits (943),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 207/309 (67%), Positives = 247/309 (80%), Gaps = 0/309 (0%)
 Frame = +2

Query  422   DGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLK  601
             +GN   + + ++  +YL KS+GQHLLTN R+LD+IV  S+V  TDTVLEIGPGTGNLTLK
Sbjct  47    EGNAYAEGKREQERLYLYKSKGQHLLTNNRILDAIVCSSDVRTTDTVLEIGPGTGNLTLK  106

Query  602   LVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGI  781
             L+ AA+ V+A+E+DKRMVEIL+KR AE G  DKL+V+ +DALK EFPRFDL+VANIPY I
Sbjct  107   LLQAAQNVVAVEVDKRMVEILHKRVAELGFEDKLTVIQKDALKAEFPRFDLVVANIPYNI  166

Query  782   SSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSK  961
             SSPL+AKLV+G+N +RSATLLLQKEFA+RLLANPGD++FNRLAVNVKL+A V+FVMDVSK
Sbjct  167   SSPLVAKLVYGSNTFRSATLLLQKEFAQRLLANPGDADFNRLAVNVKLMAHVDFVMDVSK  226

Query  962   RDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmk  1141
             R+F+PCPKVDSSVV I PK   PDVNL EW AFTRTCF KKNKTLGATFKQK+ +MEL+K
Sbjct  227   REFVPCPKVDSSVVMIRPKEVTPDVNLQEWLAFTRTCFGKKNKTLGATFKQKKKVMELLK  286

Query  1142  lqemkeDQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllsl  1321
             L+E         D            + F+E II +L S G +DKRPSKLSH ELLHLLSL
Sbjct  287   LREWNNSFGLSGDGEEDGSCLATNPSLFKERIIGVLRSSGLEDKRPSKLSHGELLHLLSL  346

Query  1322  FNQSGISFH  1348
             FNQ+GI FH
Sbjct  347   FNQAGIFFH  355



>emb|CDP01955.1| unnamed protein product [Coffea canephora]
Length=406

 Score =   368 bits (945),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 209/340 (61%), Positives = 257/340 (76%), Gaps = 20/340 (6%)
 Frame = +2

Query  428   NVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLV  607
             N+   ++  E ++ L KSRGQHLLTNPRVLD+IV KSN+ P DTVLEIGPGTGNLTLKL+
Sbjct  51    NLGSDVKVSEKHLQLFKSRGQHLLTNPRVLDTIVRKSNIKPNDTVLEIGPGTGNLTLKLL  110

Query  608   SAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISS  787
               AE+V AIEIDKRMVEIL+K+ AE G  D+L+V+  DALK +FP+FDL+VANIPYGISS
Sbjct  111   EVAEKVNAIEIDKRMVEILHKKVAERGFEDRLTVIRDDALKVDFPQFDLVVANIPYGISS  170

Query  788   PLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRD  967
              L+AK VFG + +RSATLLLQKEFARRLLA+PG+ E+NRLA NVKLVADVEFVMDVSKRD
Sbjct  171   RLVAKFVFGGSKFRSATLLLQKEFARRLLADPGEPEYNRLAANVKLVADVEFVMDVSKRD  230

Query  968   FLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklq  1147
             FLP PK+DSSV+KI PK  +P V+L EWWAFTR CF+KKNKTLGA FK+KR LMELMKL 
Sbjct  231   FLPVPKIDSSVIKIWPKEDVPSVDLMEWWAFTRMCFSKKNKTLGAIFKKKRKLMELMKLS  290

Query  1148  emke----DQESVEDCSLQSGSEIIE----------------LASFREMIINILSSGGFD  1267
             +       D E   + + +S  E  +                ++SF+E ++ I+ SGG +
Sbjct  291   QTDVSFHGDDEKEVELNAESEDEHEDDKNEMETNLPMGYKKGMSSFKEKVVEIIRSGGVE  350

Query  1268  DKRPSKlsheellhllslFNQSGISFHGPAKLKNPRQTAF  1387
              KRPSKLS+EELLHLLS+FNQ+GI FH  A++K+     +
Sbjct  351   SKRPSKLSNEELLHLLSVFNQAGIHFHDQAEVKDTNNAEY  390



>ref|NP_975003.1| adenosine dimethyl transferase 1B  [Arabidopsis thaliana]
 dbj|BAB10912.1| dimethyladenosine transferase-like protein [Arabidopsis thaliana]
 gb|AED98204.1| ribosomal RNA adenine dimethylase family protein [Arabidopsis 
thaliana]
Length=380

 Score =   366 bits (939),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 204/336 (61%), Positives = 256/336 (76%), Gaps = 17/336 (5%)
 Frame = +2

Query  401   RSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPG  580
             R  +E D   VR + + +   ++L KS+GQHLLTN R+LDSIV  S++ PTDTVLEIGPG
Sbjct  43    RRGYERD---VRIEEKKEHDGLFLCKSKGQHLLTNTRILDSIVRSSDIRPTDTVLEIGPG  99

Query  581   TGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMV  760
             TGNLT+KL+ AA+ V+A+E+DKRMVEIL KR ++HG  DKL+++ +D LKT+FP FDL+V
Sbjct  100   TGNLTMKLLEAAQNVVAVELDKRMVEILRKRVSDHGFADKLTIIQKDVLKTDFPHFDLVV  159

Query  761   ANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVE  940
             ANIPY ISSPL+AKLV+G+N +RSATLLLQKEF+RRLLANPGDS+FNRLAVNVKLVADV+
Sbjct  160   ANIPYNISSPLVAKLVYGSNTFRSATLLLQKEFSRRLLANPGDSDFNRLAVNVKLVADVK  219

Query  941   FVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr  1120
             FVMDVSKR+F+P PKVDSSV++I PK  IPDVN+ EW AFTRTCF KKNKTLG+ F+QK+
Sbjct  220   FVMDVSKREFVPPPKVDSSVIRITPKEIIPDVNVQEWLAFTRTCFGKKNKTLGSMFRQKK  279

Query  1121  llmelmklqe--mkeDQESVEDCSLQSGSEIIE------------LASFREMIINILSSG  1258
              +MEL  L       + E +      S S++ E             + F+E +I IL + 
Sbjct  280   KVMELQSLSAGRHGSNVEVMNQTGGDSDSDVEEDGKDDLLCLDTDASMFKERVIEILRTN  339

Query  1259  GFDDKRPSKlsheellhllslFNQSGISFHGPAKLK  1366
             GF++KRPSKLSH ELLHLLSLFNQ+GI FH    L+
Sbjct  340   GFEEKRPSKLSHRELLHLLSLFNQAGIFFHDITSLQ  375



>ref|XP_003612095.1| Dimethyladenosine transferase-like protein [Medicago truncatula]
 gb|AES95053.1| ribosomal RNA adenine dimethylase family protein [Medicago truncatula]
Length=332

 Score =   362 bits (930),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 197/317 (62%), Positives = 241/317 (76%), Gaps = 19/317 (6%)
 Frame = +2

Query  431   VRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVS  610
             +R+  E+ E +IY  KSRGQH+LTNPRVLD+IV KS + P+DTVLEIGPGTGNLTLKL+ 
Sbjct  19    LRQLHEDIEESIYFYKSRGQHILTNPRVLDTIVQKSAINPSDTVLEIGPGTGNLTLKLLE  78

Query  611   AAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSP  790
             A+  V+AIEID+RMV IL  RA + GL +KL+V+ +DAL+TEFP FDL+VANIPYGISSP
Sbjct  79    ASREVVAIEIDQRMVNILENRALKRGLRNKLTVISKDALRTEFPPFDLVVANIPYGISSP  138

Query  791   LLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDF  970
             L+ KL++    +RSATLLLQKEFARRLLANPGDSEFNRLAVN+KL+ADVEFVMDVSKRDF
Sbjct  139   LIIKLIYETTPFRSATLLLQKEFARRLLANPGDSEFNRLAVNIKLLADVEFVMDVSKRDF  198

Query  971   LPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqe  1150
             LP PKVDSSVV I PK ++P VNL +W AFTRTCF  KNKTLGATFK K           
Sbjct  199   LPSPKVDSSVVIIRPKVNVPAVNLHQWRAFTRTCFNNKNKTLGATFKNK-----------  247

Query  1151  mkeDQESVEDCSLQSGSEII----ELASFREMIINILSSGGFDDKRPSKlsheellhlls  1318
                 ++ +E     + S ++    ++  F+E I+ +L  GGFDDKRPSKLS EEL+HLLS
Sbjct  248   ----RKVLELLEFNNVSGLVGEQDDVCLFKEKIVEVLREGGFDDKRPSKLSIEELMHLLS  303

Query  1319  lFNQSGISFHGPAKLKN  1369
             LFN+ G+ F     ++N
Sbjct  304   LFNEVGVYFDHREDVRN  320



>gb|KDO71051.1| hypothetical protein CISIN_1g047897mg, partial [Citrus sinensis]
Length=232

 Score =   357 bits (916),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/215 (80%), Positives = 196/215 (91%), Gaps = 0/215 (0%)
 Frame = +2

Query  464   IYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEID  643
             I+  KS+GQH+LTN RVLDSIV KS++ P DTVLEIGPGTGNLTLKL+  +++V AIEID
Sbjct  2     IFFHKSKGQHILTNQRVLDSIVRKSSINPDDTVLEIGPGTGNLTLKLLEVSKKVHAIEID  61

Query  644   KRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANA  823
             +RMVEILN+RAA+ G  D+L+V+ +DALKTEFP+FDL+VANIPYGISSPL+AKLV+G  +
Sbjct  62    ERMVEILNRRAADSGFHDRLNVISKDALKTEFPQFDLVVANIPYGISSPLVAKLVYGTKS  121

Query  824   YRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVV  1003
             +RSATLLLQKEFARRLLA+PGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVV
Sbjct  122   FRSATLLLQKEFARRLLASPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVV  181

Query  1004  KIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
              I PKA IPDVNLDEW AFTRTCF+KKNKTLGATF
Sbjct  182   IIRPKAEIPDVNLDEWRAFTRTCFSKKNKTLGATF  216



>ref|XP_010679813.1| PREDICTED: probable dimethyladenosine transferase [Beta vulgaris 
subsp. vulgaris]
Length=378

 Score =   361 bits (927),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 211/330 (64%), Positives = 250/330 (76%), Gaps = 16/330 (5%)
 Frame = +2

Query  446   ENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERV  625
             EN+E +  L KSRGQHLLT+ RVLDSIV  SN+  TDTVLEIGPGTGNLTL+L+ AA RV
Sbjct  49    ENRECHFQLYKSRGQHLLTSARVLDSIVKNSNIKATDTVLEIGPGTGNLTLRLLEAASRV  108

Query  626   IAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKL  805
             +AIEID RM E L KR AE    D+L+++ +DALKTE P FDL+VANIPYGISSPL+AKL
Sbjct  109   VAIEIDWRMAEALQKRVAESAFEDRLNLIREDALKTELPHFDLVVANIPYGISSPLIAKL  168

Query  806   VFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPK  985
             +FG +++RSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVA+VE +MDVSKRDFLP P+
Sbjct  169   MFGTHSFRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAEVEHIMDVSKRDFLPAPR  228

Query  986   VDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQ  1165
             VDSSVV I PKA IP V+L+EW AFTRTCF KKNKTLGATFKQK+ L+EL ++  +   +
Sbjct  229   VDSSVVLIKPKADIPKVDLNEWCAFTRTCFNKKNKTLGATFKQKKRLVELKRISSLMGVK  288

Query  1166  ES------------VEDCSLQSG--SEIIELASFREMIINILSSGGFDDKRPSKlsheel  1303
             E+             ED    S   S  IE+ SF+E +  IL S GF+DKRP KLS EEL
Sbjct  289   ETQILNLFSDTTDAYEDGKANSSLLSSEIEM-SFKEKVTEILRSSGFEDKRPLKLSIEEL  347

Query  1304  lhllslFNQSGISFHGPAKLKNPR-QTAFD  1390
             LHLLSLFN++ I FH    + N    T+F+
Sbjct  348   LHLLSLFNENKIYFHDKEDVGNTELDTSFE  377



>ref|XP_008241767.1| PREDICTED: probable dimethyladenosine transferase [Prunus mume]
Length=367

 Score =   359 bits (922),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 205/344 (60%), Positives = 255/344 (74%), Gaps = 32/344 (9%)
 Frame = +2

Query  407   NHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTG  586
             N  +DDG  R++ E Q+  + L KS+GQHLLTN R+LDSIV KS + PTDTVLEIGPGTG
Sbjct  34    NGADDDGR-RKREEGQDGYLQLHKSKGQHLLTNQRILDSIVQKSAIKPTDTVLEIGPGTG  92

Query  587   NLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVAN  766
             NLTLKL+              MVE+L KR AE G+ D+L+V+C+DALK EFP FD++VAN
Sbjct  93    NLTLKLL--------------MVEVLQKRVAECGVQDRLTVICKDALKAEFPPFDIVVAN  138

Query  767   IPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFV  946
             IPYGISSPL+AKLV+GA ++RSATLLLQKEFARRL+A PGDSEFNRLAVNVKLVA+VEFV
Sbjct  139   IPYGISSPLVAKLVYGARSFRSATLLLQKEFARRLMAKPGDSEFNRLAVNVKLVANVEFV  198

Query  947   MDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrll  1126
             MDVSKR+F+PCPKVDSSVV I PKA +P+VNLDEWWAFT+ CF  KNKTLGATFKQK+ +
Sbjct  199   MDVSKREFVPCPKVDSSVVIIRPKAEVPNVNLDEWWAFTKACFGNKNKTLGATFKQKKKV  258

Query  1127  melmklqemkeDQESVED--CSLQSGSE---------------IIELASFREMIINILSS  1255
             MEL++L ++       ++  CS     +                +  +SF+E ++ +L S
Sbjct  259   MELLRLSKLAGSDGETDNYICSNDDNGDGGESDDEELSSSSCSEMGASSFKEKLMGVLKS  318

Query  1256  GGFDDKRPSKlsheellhllslFNQSGISFHGPAKLKNPRQTAF  1387
               F+DKRPSKLS+EELLHLL+LFNQ+GI FH  +K +N    +F
Sbjct  319   ADFEDKRPSKLSNEELLHLLALFNQAGIYFHDQSKSRNAENESF  362



>ref|XP_008352452.1| PREDICTED: probable dimethyladenosine transferase [Malus domestica]
Length=515

 Score =   363 bits (933),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 199/316 (63%), Positives = 240/316 (76%), Gaps = 17/316 (5%)
 Frame = +2

Query  452   QEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIA  631
             ++  + L KS+GQHLLTN R+LD IV KS + PTDTVLEIGPGTGNLTL LV AA+ V+ 
Sbjct  197   KDGYLXLHKSKGQHLLTNQRILDKIVQKSAIKPTDTVLEIGPGTGNLTLNLVEAAQSVVV  256

Query  632   IEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVF  811
             +E+DKRMVE+L KR  E G+ D+L V+ +DALK EFP FDL+VANIPYGISSPL+AKLV+
Sbjct  257   VELDKRMVEVLQKRVEESGVQDRLXVINKDALKAEFPPFDLVVANIPYGISSPLVAKLVY  316

Query  812   GANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
             GA  +RS TLLLQ+EFARRLLA PGDSEFNRLAVNV LVADVEFVMDVSK++F+PCP+VD
Sbjct  317   GARLFRSTTLLLQREFARRLLAKPGDSEFNRLAVNVNLVADVEFVMDVSKKEFVPCPEVD  376

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmel------------  1135
             SSVV I PKA +P++NLDEWWAF + CF KKN+TLGATFKQK+ +MEL            
Sbjct  377   SSVVIIRPKAEVPNINLDEWWAFIKACFCKKNRTLGATFKQKKKVMELLXMFNLAGLNGE  436

Query  1136  ---mklqemkeDQESVEDCSLQSGSEIIEL--ASFREMIINILSSGGFDDKRPSKlshee  1300
                       +D E   D    S S   E+  +SF+E +I +L SG F+DKRPSKLS+EE
Sbjct  437   GKDYISSSDNDDDEGKSDEEEFSPSSCSEIGASSFKEKLIGVLKSGNFEDKRPSKLSNEE  496

Query  1301  llhllslFNQSGISFH  1348
             LLHLL++FNQ GI FH
Sbjct  497   LLHLLAMFNQKGIYFH  512



>emb|CDY65384.1| BnaCnng46850D [Brassica napus]
Length=351

 Score =   358 bits (918),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 198/321 (62%), Positives = 248/321 (77%), Gaps = 5/321 (2%)
 Frame = +2

Query  401   RSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPG  580
             R N    +G V  K + Q   ++L KS+GQHLLTN R+LD+IV  S+V PTDTVLEIGPG
Sbjct  24    RRNSHSRNGQVVEK-KKQHDGLFLQKSKGQHLLTNTRILDAIVRSSDVRPTDTVLEIGPG  82

Query  581   TGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMV  760
             TGNLT+KL+ AA+ VIA+E+DKRMVEIL  R ++H L  KL+++ +D LKT+FP FDL+V
Sbjct  83    TGNLTMKLLEAAQHVIAVELDKRMVEILRARVSDHALQHKLTIIQKDVLKTDFPEFDLVV  142

Query  761   ANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVE  940
             ANIPY ISSPL+AKLV+G+N +R+ATLLLQKEF+RRLLANPGDS+FNRLAVNVKL+ADV+
Sbjct  143   ANIPYNISSPLVAKLVYGSNTFRTATLLLQKEFSRRLLANPGDSDFNRLAVNVKLLADVK  202

Query  941   FVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr  1120
             FVMDVSKR+F+P PKVDSSVV I PK   PDV++ EW AFTRTCF KKNKTLG+ F+QK+
Sbjct  203   FVMDVSKREFVPPPKVDSSVVMITPKEVKPDVDVREWLAFTRTCFGKKNKTLGSMFRQKK  262

Query  1121  llmelmklqemkeDQESVEDCSLQSGSEIIELAS----FREMIINILSSGGFDDKRPSKl  1288
              +MEL+ L E      + +    Q  + ++ L +    F+E +I IL S GF+DKRPSKL
Sbjct  263   KVMELLSLSEAGIATNASDVVEEQGDNRLLCLDTDASVFKERVIGILKSNGFEDKRPSKL  322

Query  1289  sheellhllslFNQSGISFHG  1351
             SH +LL LLSLFNQ+ I FH 
Sbjct  323   SHGQLLRLLSLFNQAAIFFHS  343



>emb|CDY45217.1| BnaA07g12730D [Brassica napus]
Length=358

 Score =   357 bits (915),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 195/316 (62%), Positives = 248/316 (78%), Gaps = 6/316 (2%)
 Frame = +2

Query  416   EDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLT  595
             E +G V  K + Q   ++L KS+GQHLLTN R+LD+IV  S+V PTDTVLEIGPGTGNLT
Sbjct  35    ESNGQVVEK-KKQHDGLFLQKSKGQHLLTNTRILDAIVRSSDVRPTDTVLEIGPGTGNLT  93

Query  596   LKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPY  775
             +KL+ AA  V+A+E+DKRMVEIL  R ++HG   KL+++ +D LKT+FP FDL+VANIPY
Sbjct  94    MKLLEAAHHVVAVELDKRMVEILRTRVSDHGFQHKLTIIQKDVLKTDFPEFDLVVANIPY  153

Query  776   GISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDV  955
              ISSPL+AKLV+G+N +R+ATLLLQKEF+RRLLANPGDS+FNRLAVNVKL+ADV+FVMDV
Sbjct  154   NISSPLVAKLVYGSNTFRTATLLLQKEFSRRLLANPGDSDFNRLAVNVKLLADVKFVMDV  213

Query  956   SKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmel  1135
             SKR+F+P PKVDSSVV I PK   PDVN+ EW AFTRTCF KKNKTLG+ F+QK+ ++EL
Sbjct  214   SKREFVPPPKVDSSVVMITPKEVKPDVNVREWLAFTRTCFGKKNKTLGSMFRQKKKVVEL  273

Query  1136  mklqemkeDQESVEDCSLQSGSEII-----ELASFREMIINILSSGGFDDKRPSKlshee  1300
             + L ++     + +    + G + +     + + F+E +I +L S GF+DKRPSKLSH E
Sbjct  274   LSLSKVGITTNASDVVEEEEGEDRVLCLDTDASMFKERVIGVLKSNGFEDKRPSKLSHGE  333

Query  1301  llhllslFNQSGISFH  1348
             LL LLSLFNQ+GI FH
Sbjct  334   LLRLLSLFNQAGIFFH  349



>ref|XP_006393823.1| hypothetical protein EUTSA_v10005567mg [Eutrema salsugineum]
 gb|ESQ31109.1| hypothetical protein EUTSA_v10005567mg [Eutrema salsugineum]
Length=371

 Score =   357 bits (916),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 203/341 (60%), Positives = 256/341 (75%), Gaps = 23/341 (7%)
 Frame = +2

Query  389   FNGGRSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLE  568
             +   R N+    G V +K E  +  ++L KS+GQHLLTN R+LD+IV  S+V PTDTVLE
Sbjct  22    YLASRRNYHSWSGQVEKKKE--QDGLFLHKSKGQHLLTNNRILDAIVRISDVRPTDTVLE  79

Query  569   IGPGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRF  748
             IGPGTGNLT+KL+ AA+ V+A+EIDKRMVEIL KR A+HGL DKL+++ +D LKT+FP+F
Sbjct  80    IGPGTGNLTMKLLEAAQNVVAVEIDKRMVEILGKRVADHGLEDKLTIIQKDVLKTDFPQF  139

Query  749   DLMVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLV  928
             DL+VANIPY ISSPL+AKLV+G+NA+RSATLLLQKEF+RRLLANPGDS+FNRLAVNVKLV
Sbjct  140   DLVVANIPYNISSPLVAKLVYGSNAFRSATLLLQKEFSRRLLANPGDSDFNRLAVNVKLV  199

Query  929   ADVEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             ADV+FVMDVSKR+F+P PKVDSS+V I PK   PDV++ EW AFTRTCF  KNKTLG+ F
Sbjct  200   ADVQFVMDVSKREFVPPPKVDSSLVIIRPKEVKPDVDVQEWLAFTRTCFGNKNKTLGSMF  259

Query  1109  kqkrllmelmklqe------------------mkeDQESVEDCSLQSGSEIIEL---ASF  1225
             +QK+ ++EL+                       + ++   ED    + S  ++    + F
Sbjct  260   RQKKKVIELLNFSAGRNGAKVGVMNQKCGNFDSEVEEAKDEDEDWINHSLCLDTDASSMF  319

Query  1226  REMIINILSSGGFDDKRPSKlsheellhllslFNQSGISFH  1348
             +E +I +LSS GF +KRPSKLSH ELLHLLSLFNQ+GI FH
Sbjct  320   KERLIGVLSSNGFQEKRPSKLSHGELLHLLSLFNQAGIFFH  360



>ref|XP_010465622.1| PREDICTED: probable dimethyladenosine transferase [Camelina sativa]
Length=375

 Score =   356 bits (913),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 195/338 (58%), Positives = 249/338 (74%), Gaps = 40/338 (12%)
 Frame = +2

Query  419   DDGNVRRKIENQEAN------IYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPG  580
             D    RR+ E  E +      ++L KS+GQHLLTN R+LD+IV  S++ PTDTVLEIGPG
Sbjct  38    DHDRRRREYEGSEKSKKEHDGLFLCKSKGQHLLTNTRILDAIVRSSDIRPTDTVLEIGPG  97

Query  581   TGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMV  760
             TGNLT+KL+ A++ V+A+E+DKRMVEIL KR ++HG  DKL+++ +D LKTEFP+FDL+V
Sbjct  98    TGNLTMKLLEASQNVVAVELDKRMVEILRKRVSDHGFADKLTIIEKDVLKTEFPKFDLVV  157

Query  761   ANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVE  940
             ANIPY ISSPL+AKLV+G+N +RSATLLLQKEF+RRLLANPGDS+FNRLAVNVKLVADV+
Sbjct  158   ANIPYNISSPLVAKLVYGSNTFRSATLLLQKEFSRRLLANPGDSDFNRLAVNVKLVADVK  217

Query  941   FVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr  1120
             FVMDVSKR+F+P PKVDSSVV I PK   PDVN+ EW AFTRTCF KKNKTLG+ F+QK+
Sbjct  218   FVMDVSKREFVPPPKVDSSVVMITPKEVKPDVNVQEWLAFTRTCFGKKNKTLGSMFRQKK  277

Query  1121  llmelmklqemkeDQESVEDCSLQSGSEI----------------------IELASFREM  1234
              +             E +   + ++GS++                       + + F+E 
Sbjct  278   KV------------MELLSLSAARNGSKVEFDTDVEDDEDEDGRDSVLCLDTDASIFKER  325

Query  1235  IINILSSGGFDDKRPSKlsheellhllslFNQSGISFH  1348
             ++ +L + GF++KRPSKLSH ELLHLLSLFNQ+GI FH
Sbjct  326   VVGLLRTNGFEEKRPSKLSHGELLHLLSLFNQAGIFFH  363



>gb|KFK28308.1| hypothetical protein AALP_AA8G499600 [Arabis alpina]
Length=379

 Score =   355 bits (910),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 200/348 (57%), Positives = 251/348 (72%), Gaps = 43/348 (12%)
 Frame = +2

Query  401   RSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPG  580
             R    E +  V RK + +   ++L KS+GQHLLTN R+LD+IV  S++ PTDTVLEIGPG
Sbjct  39    RKRGYERNTVVERK-KKEHDGLFLQKSKGQHLLTNTRILDAIVRSSDIKPTDTVLEIGPG  97

Query  581   TGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMV  760
             TGNLT+KL+ AA  V+A+E+DKRMVEIL KR ++HG  DKL+++ +D LKT+FP FDL+V
Sbjct  98    TGNLTMKLLEAAHNVVAVELDKRMVEILRKRVSDHGFADKLTIIQKDVLKTDFPEFDLVV  157

Query  761   ANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVE  940
             ANIPY ISSPL+AKLV+G+N +RSATLLLQKEF+RRLLANPGDS+FNRLAVNVKLVADV+
Sbjct  158   ANIPYNISSPLIAKLVYGSNTFRSATLLLQKEFSRRLLANPGDSDFNRLAVNVKLVADVK  217

Query  941   FVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr  1120
             FVMDVSKR+F+P PKVDSSVV I PK   PDVN+ EW AFTRTCF KKNKTLG+ F+QK 
Sbjct  218   FVMDVSKREFVPPPKVDSSVVMIRPKEVKPDVNVQEWLAFTRTCFGKKNKTLGSMFRQK-  276

Query  1121  llmelmklqemkeDQESVEDCSL---QSGSEI------------------------IELA  1219
                           ++ +E  SL   ++GS++                         + +
Sbjct  277   --------------KKVMELLSLSAGRNGSKVGVMSHFDSDVEEDEDGEDHLLCLDTDAS  322

Query  1220  SFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISFHGPAKL  1363
              F+E +I I+ S GF++KRPSKLSHEELLHLL LFNQ+GI FH  + L
Sbjct  323   MFKEKVIGIVRSNGFEEKRPSKLSHEELLHLLYLFNQAGIFFHDISSL  370



>ref|XP_009103542.1| PREDICTED: probable dimethyladenosine transferase [Brassica rapa]
Length=359

 Score =   353 bits (907),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 194/317 (61%), Positives = 248/317 (78%), Gaps = 6/317 (2%)
 Frame = +2

Query  416   EDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLT  595
             E +G V  K + Q   ++L KS+GQHLLTN R+LDSIV  S+V PTDTVLEIGPGTGNLT
Sbjct  36    ESNGQVVEK-KKQHDGLFLQKSKGQHLLTNTRILDSIVRSSDVRPTDTVLEIGPGTGNLT  94

Query  596   LKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPY  775
             +KL+ AA  V+A+E+DKRMVEIL  R ++HG   KL+++ +D LKT+FP FDL+VANIPY
Sbjct  95    MKLLEAAHHVVAVELDKRMVEILRTRVSDHGFQHKLTIIQKDVLKTDFPEFDLVVANIPY  154

Query  776   GISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDV  955
              ISSPL+AKLV+G+N +R+ATLLLQKEF+RRLLANPGDS+FNRLAVNVKL+ADV+FVM+V
Sbjct  155   NISSPLVAKLVYGSNTFRTATLLLQKEFSRRLLANPGDSDFNRLAVNVKLLADVKFVMNV  214

Query  956   SKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmel  1135
             SKR+F+P PKVDSSVV I PK   PDV++ EW AFTRTCF KKNKTLG+ F+QK+ ++EL
Sbjct  215   SKREFVPPPKVDSSVVMITPKEVKPDVDVREWLAFTRTCFGKKNKTLGSMFRQKKKVVEL  274

Query  1136  mklqemkeDQESVEDCSLQSGSEII-----ELASFREMIINILSSGGFDDKRPSKlshee  1300
             + L ++     + +    + G + +     + + F+E +I +L S GF+DKRPSKLSH E
Sbjct  275   LSLSKVGITTNASDVVEEEEGEDRVLCLDTDASMFKERVIGVLKSNGFEDKRPSKLSHGE  334

Query  1301  llhllslFNQSGISFHG  1351
             LL LLSLFNQ+GI FH 
Sbjct  335   LLRLLSLFNQAGIFFHS  351



>ref|XP_002866759.1| ribosomal RNA adenine dimethylase family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH43018.1| ribosomal RNA adenine dimethylase family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=376

 Score =   353 bits (905),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 199/332 (60%), Positives = 253/332 (76%), Gaps = 19/332 (6%)
 Frame = +2

Query  401   RSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPG  580
             R  +E D G   +K   +   ++L KS+GQHLLTN R+LD+IV  S+V PTDTVLEIGPG
Sbjct  36    RRGYERDVGIEEKK---EHDGLFLCKSKGQHLLTNTRILDAIVRCSDVRPTDTVLEIGPG  92

Query  581   TGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMV  760
             TGNLT+KL+ AA+ V+A+E+DKRMVEIL KR ++HG   KL+++ +D LKT+FP+FDL+V
Sbjct  93    TGNLTMKLLEAAQDVVAVELDKRMVEILRKRVSDHGFAHKLTIIQKDVLKTDFPQFDLVV  152

Query  761   ANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVE  940
             ANIPY ISSPL+AKLV+G+N +RSATLLLQKEF+RRLLANPGDS+FNRLAVNVKLVADV+
Sbjct  153   ANIPYNISSPLVAKLVYGSNTFRSATLLLQKEFSRRLLANPGDSDFNRLAVNVKLVADVK  212

Query  941   FVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr  1120
             FVMDVSKR+F+P PKVDSSVV I PK  IPDVN+ EW AFTRTCF KKNKTLG+ F+QK+
Sbjct  213   FVMDVSKREFVPPPKVDSSVVMITPKEIIPDVNVQEWLAFTRTCFGKKNKTLGSMFRQKK  272

Query  1121  llmelmklqemkeDQE--SVEDCSLQSGSEIIE--------------LASFREMIINILS  1252
              +MEL+ L   +   +   +      S S++ E               + F+E +I IL 
Sbjct  273   KVMELLSLSAGRNGSKVGVMNQTCGDSDSDVEEDGDGKDDLLCLDTDASMFKERVIGILR  332

Query  1253  SGGFDDKRPSKlsheellhllslFNQSGISFH  1348
             + GF++KRPSKLSH ELLH+LSLFN++G+ FH
Sbjct  333   TNGFEEKRPSKLSHSELLHVLSLFNRAGVFFH  364



>ref|XP_006280630.1| hypothetical protein CARUB_v10026592mg [Capsella rubella]
 gb|EOA13528.1| hypothetical protein CARUB_v10026592mg [Capsella rubella]
Length=381

 Score =   352 bits (902),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 244/314 (78%), Gaps = 13/314 (4%)
 Frame = +2

Query  446   ENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERV  625
             + +   ++L KS+GQHLLTN R+LD+IV  S+V PTDTVLEIGPGTGNLT+KL+ A+  V
Sbjct  56    KKEHDGLFLCKSKGQHLLTNTRILDAIVRSSDVRPTDTVLEIGPGTGNLTMKLLEASHSV  115

Query  626   IAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKL  805
             +A+E+DKRMVEIL KR ++HG  DKL+++ +D LKT+FP+FDL+VANIPY ISSPL+AKL
Sbjct  116   VAVELDKRMVEILRKRVSDHGFADKLTIIEKDVLKTDFPQFDLVVANIPYNISSPLVAKL  175

Query  806   VFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPK  985
             V+G+N +RSATLLLQKEF+RRLLANPGDS+FNRLAVNVKLVADV FVMDVSKR+F+P PK
Sbjct  176   VYGSNTFRSATLLLQKEFSRRLLANPGDSDFNRLAVNVKLVADVRFVMDVSKREFVPPPK  235

Query  986   VDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqe-----  1150
             VDSSVV I PK   PDVN+ EW AFTRTCF KKNKTLG+ F+QK+ +MEL+ L       
Sbjct  236   VDSSVVMITPKEVKPDVNVQEWLAFTRTCFGKKNKTLGSMFRQKKKVMELLSLSAGRNGS  295

Query  1151  -------mkeDQES-VEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheell  1306
                       D ES  ED   +      + + F+E +I IL + GF++KRPSKLSH ELL
Sbjct  296   NVGVMNQTCGDFESDDEDGRGKVLCLDTDASMFKERVIGILRTNGFEEKRPSKLSHGELL  355

Query  1307  hllslFNQSGISFH  1348
             HLLSLFNQ+GI FH
Sbjct  356   HLLSLFNQAGIFFH  369



>ref|XP_002521501.1| dimethyladenosine transferase, putative [Ricinus communis]
 gb|EEF40772.1| dimethyladenosine transferase, putative [Ricinus communis]
Length=366

 Score =   348 bits (894),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 198/320 (62%), Positives = 241/320 (75%), Gaps = 25/320 (8%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  ++L KS+GQHLLTNPRVLD+IV +S V PTDTVLEIGPGTGNLTL+L+  A +V+A+
Sbjct  48    QEKLHLYKSKGQHLLTNPRVLDTIVRRSAVEPTDTVLEIGPGTGNLTLRLLEVARKVVAV  107

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EIDKRMVEIL +RA+E GL DKL ++ +DALK EFP F+++VANIPYGISSPL+ KLV+G
Sbjct  108   EIDKRMVEILRERASEQGLQDKLDIIHKDALKAEFPNFNIVVANIPYGISSPLVTKLVYG  167

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
              N +RS TLLLQKEFARRLLANPGD E+NRLAVNVKLVADVEFVMDVSKRDF+P PKVDS
Sbjct  168   VNKFRSLTLLLQKEFARRLLANPGDPEYNRLAVNVKLVADVEFVMDVSKRDFVPSPKVDS  227

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemk------  1156
             SVV I PK  IP VNL EW AFTRTCF  KNKTLGA FKQK+ +MEL+++  M       
Sbjct  228   SVVIIRPKTEIPSVNLVEWRAFTRTCFGNKNKTLGAIFKQKKKVMELLRMHNMTSCNSKS  287

Query  1157  -----------------eDQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSK  1285
                               D E  E     S SE +E++ ++E II +L + GF+  RPSK
Sbjct  288   RVNANDDDDDDHNHNENSDGEG-EGGHFCSCSE-MEVSFYKERIIEVLKANGFEGNRPSK  345

Query  1286  lsheellhllslFNQSGISF  1345
             LS++EL++LLSL NQ+G+ F
Sbjct  346   LSNKELVNLLSLLNQAGVFF  365



>ref|XP_010484657.1| PREDICTED: probable dimethyladenosine transferase [Camelina sativa]
Length=379

 Score =   348 bits (894),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 197/331 (60%), Positives = 251/331 (76%), Gaps = 21/331 (6%)
 Frame = +2

Query  419   DDGNVRRKIENQEAN-------IYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGP  577
             D    RR+ E  E +       ++L KS+GQHLLTN R+LD+IV  S++ PTDTVLEIGP
Sbjct  38    DHDRRRREYEGSEKSKKKEHDGLFLCKSKGQHLLTNTRILDAIVRSSDIRPTDTVLEIGP  97

Query  578   GTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLM  757
             GTGNLT+KL+ A++ V+A+E+DKRMVEIL KR +++G  DKL+++ +D LKTEFP+FDL+
Sbjct  98    GTGNLTMKLLEASQNVVAVELDKRMVEILRKRVSDNGFADKLTIIQKDVLKTEFPQFDLV  157

Query  758   VANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADV  937
             VANIPY ISSPL+AKLV+G+N +RSATLLLQKEF+RRLLAN GDS+FNRLAVNVKLVADV
Sbjct  158   VANIPYNISSPLVAKLVYGSNTFRSATLLLQKEFSRRLLANSGDSDFNRLAVNVKLVADV  217

Query  938   EFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqk  1117
             +FVMDVSKR+F+P PKVDSSVV I PK   PDVN+ EW AFTRTCF  KNKTLG+ F+QK
Sbjct  218   KFVMDVSKREFVPPPKVDSSVVMITPKEVKPDVNVQEWLAFTRTCFGNKNKTLGSMFRQK  277

Query  1118  rllmelmklqemke---------DQESVEDCSLQSGSEII-----ELASFREMIINILSS  1255
             + +MEL+ L   +          D E   D   + G + +     + + F+E ++ +L +
Sbjct  278   KKVMELLSLSAGRNGSKVGMECGDGEFDTDVEDEGGRDNVLCMDTDASMFKERVVGLLRT  337

Query  1256  GGFDDKRPSKlsheellhllslFNQSGISFH  1348
              GF++KRPSKLSH ELLHLLSLFNQ+GI FH
Sbjct  338   HGFEEKRPSKLSHGELLHLLSLFNQAGIFFH  368



>ref|XP_010033447.1| PREDICTED: probable dimethyladenosine transferase [Eucalyptus 
grandis]
Length=379

 Score =   347 bits (890),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 203/342 (59%), Positives = 246/342 (72%), Gaps = 27/342 (8%)
 Frame = +2

Query  416   EDDGNVRRKIENQEAN---IYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTG  586
             EDDG    +   +EA      L KS+GQH+LTNPRVLDSIV ++ + P DTVLEIGPGTG
Sbjct  37    EDDGRRGSEKGAREARGPEFRLHKSKGQHILTNPRVLDSIVRRAELKPGDTVLEIGPGTG  96

Query  587   NLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVAN  766
             NLTLKL+  + +V+A+EID RMV+ L KR A+ G  D+L+V+ +DALKTEFP FD++VAN
Sbjct  97    NLTLKLLEVSRKVVAVEIDGRMVDALRKRVADRGSEDRLTVIQKDALKTEFPPFDIVVAN  156

Query  767   IPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFV  946
             IPY ISSPL+ KLV+G   +RSATLLLQKEFARRLLANPGDSE+NRLAVNVKLVADVEF 
Sbjct  157   IPYQISSPLIIKLVYGKIQFRSATLLLQKEFARRLLANPGDSEYNRLAVNVKLVADVEFA  216

Query  947   MDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrll  1126
             MDVSKRDFLP PKVDSSVV I PK  +P VNL EWWAFTRTCF KKNKTLGATFKQKR L
Sbjct  217   MDVSKRDFLPVPKVDSSVVIIRPKTELPKVNLAEWWAFTRTCFGKKNKTLGATFKQKRKL  276

Query  1127  melmklqemkeDQE-------------SVEDCSLQSGSEII-----------ELASFREM  1234
             ME+ K   +   ++             SVED  +                  E+  F+E 
Sbjct  277   MEIFKTSTLAGLKKDVAITNNDGISGVSVEDDDIDEEGNSEEESLSSSVPEGEMNLFKEK  336

Query  1235  IINILSSGGFDDKRPSKlsheellhllslFNQSGISFHGPAK  1360
             I+ +L + GF+DKRPSKLS++ELLHLL++ N +G+ FH  A+
Sbjct  337   IVGVLRAEGFEDKRPSKLSNDELLHLLAVLNHAGVYFHNQAE  378



>ref|XP_003537617.2| PREDICTED: probable dimethyladenosine transferase-like [Glycine 
max]
Length=355

 Score =   343 bits (881),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 199/327 (61%), Positives = 242/327 (74%), Gaps = 20/327 (6%)
 Frame = +2

Query  401   RSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPG  580
             R  H + DG         E  +   KSRGQH+L NPR+LD+IV +S + PTDTVLEIGPG
Sbjct  34    RQVHGDGDG---------EEALRFHKSRGQHILINPRILDTIVRRSAINPTDTVLEIGPG  84

Query  581   TGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMV  760
             TGNLTLKL+ AA +V+AIEID RMV++L KR  + GL DKL V+ +DA++  FPRFDL+V
Sbjct  85    TGNLTLKLLEAAHKVVAIEIDHRMVQVLEKRVLQRGLKDKLRVIERDAMRAPFPRFDLVV  144

Query  761   ANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDS-EFNRLAVNVKLVADV  937
             ANIPY ISSPL+ KLV+GA  +RSATLLLQKEFARRLLA PGDS  FNRL+ NVKLVADV
Sbjct  145   ANIPYRISSPLVIKLVYGATPFRSATLLLQKEFARRLLACPGDSGGFNRLSANVKLVADV  204

Query  938   EFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTK-KNKTLGATFkq  1114
             E VMDVSKRDFLP PKVDSSVV I PK  IP+V+L EW +FTRTCF+  +NKTLGA FK 
Sbjct  205   ELVMDVSKRDFLPSPKVDSSVVIIRPKHQIPNVDLHEWRSFTRTCFSSNRNKTLGALFKL  264

Query  1115  krllmelmklqemkeDQESVEDCSLQSGSEIIE---LASFREMIINILSSGGFDDKRPSK  1285
             K  + EL K+          ++CSL  G E+ +   L SF+E II ++ +GGF+DKRP+K
Sbjct  265   KGKVFELFKI------SNGNDECSLHKGDEVQDEGGLTSFKEKIIGVVRTGGFEDKRPAK  318

Query  1286  lsheellhllslFNQSGISFHGPAKLK  1366
             LS +ELLHLLSLFNQ+GI F+   + K
Sbjct  319   LSLQELLHLLSLFNQAGIYFNHRGRHK  345



>gb|ABB45840.1| hypothetical protein [Eutrema halophilum]
Length=310

 Score =   340 bits (871),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/240 (69%), Positives = 201/240 (84%), Gaps = 2/240 (1%)
 Frame = +2

Query  389   FNGGRSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLE  568
             +   R N+    G V +K E  +  ++L KS+GQHLLTN R+LD+IV  S+V PTDTVLE
Sbjct  22    YLASRRNYHSWSGQVEKKKE--QDGLFLHKSKGQHLLTNNRILDAIVRISDVRPTDTVLE  79

Query  569   IGPGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRF  748
             IGPGTGNLT+KL+ AA+ V+A+EIDKRMVEIL KR A+HGL DKL+++ +D LKT+FP+F
Sbjct  80    IGPGTGNLTMKLLEAAQNVVAVEIDKRMVEILGKRVADHGLEDKLTIIQKDVLKTDFPQF  139

Query  749   DLMVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLV  928
             DL+VANIPY ISSPL+AKLV+G+NA+RSATLLLQKEF+RRLLANPGDS+FNRLAVNVKLV
Sbjct  140   DLVVANIPYNISSPLVAKLVYGSNAFRSATLLLQKEFSRRLLANPGDSDFNRLAVNVKLV  199

Query  929   ADVEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             ADV+FVMDVSKR+F+P PKVDSS+V I PK   PDV++ EW AFTRTCF  KNKTLG+ F
Sbjct  200   ADVQFVMDVSKREFVPPPKVDSSLVIIRPKEVKPDVDVQEWLAFTRTCFGNKNKTLGSMF  259



>gb|EPS63983.1| hypothetical protein M569_10799, partial [Genlisea aurea]
Length=289

 Score =   338 bits (867),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 188/295 (64%), Positives = 233/295 (79%), Gaps = 9/295 (3%)
 Frame = +2

Query  470   LLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKR  649
             L KSRGQHLLTN RVLDSIV  S + P DTVLEIGPGTGNLTLKL+  A+ V+A+EID R
Sbjct  1     LYKSRGQHLLTNSRVLDSIVRCSEISPDDTVLEIGPGTGNLTLKLLQQAKNVVALEIDNR  60

Query  650   MVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANA--  823
             MV+IL +R A+ GL  +L+++C DALKTE P+FDL+VANIPYGISSPLLAKL++G NA  
Sbjct  61    MVDILQRRVADTGLQSRLNIICGDALKTELPQFDLVVANIPYGISSPLLAKLLYGTNANP  120

Query  824   YRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVV  1003
             +R+ATLLLQKEFA+RL+A PGDS FNRLA+N+ L+AD+EFVMDVSKR+F P PKVDS+VV
Sbjct  121   FRAATLLLQKEFAKRLMAEPGDSSFNRLALNMNLMADIEFVMDVSKREFTPPPKVDSAVV  180

Query  1004  KIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDC  1183
             K+ P++ +P+VNL EW AFTRTCF  +N+TLGA+FK+KR LMELM+      D       
Sbjct  181   KLRPRSHVPEVNLPEWCAFTRTCFGNRNRTLGASFKKKRKLMELMRFSGGHGD-------  233

Query  1184  SLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISFH  1348
               +   E  EL  FRE +  +LSSGGF D+RPSK+S +ELL LL+LFN+SG+ FH
Sbjct  234   GEEEEEEEAELRLFRERVGGVLSSGGFADRRPSKMSSDELLDLLALFNESGVYFH  288



>ref|XP_003516557.1| PREDICTED: probable dimethyladenosine transferase-like [Glycine 
max]
Length=345

 Score =   337 bits (863),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 193/309 (62%), Positives = 233/309 (75%), Gaps = 11/309 (4%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             E  +   KSRGQH+  NPR+LD+I  +S + PTDTVLEIGPGTGNLTLKL+ AA +V+AI
Sbjct  33    EEALRFYKSRGQHIFINPRILDTIFRRSAINPTDTVLEIGPGTGNLTLKLLEAAHKVVAI  92

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV++L KR  + GL DKL V+ +DA++  FPRFDL+VANIPY ISSPL+ KLV+G
Sbjct  93    EIDHRMVQVLEKRVLQRGLQDKLRVIERDAMRAPFPRFDLVVANIPYRISSPLVIKLVYG  152

Query  815   ANAYRSATLLLQKEFARRLLANPGDS-EFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
             A  +RSATLLLQKEFARRLL  PGDS  FNRL+ NVKLVADVE VMDVSKRDFLP PKVD
Sbjct  153   ATPFRSATLLLQKEFARRLLTCPGDSGGFNRLSANVKLVADVELVMDVSKRDFLPSPKVD  212

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTK-KNKTLGATFkqkrllmelmklqemkeDQE  1168
             SSVV I PK  IP+V+L EW AFTRTCF+  +NKTLGA FK K  + EL K+        
Sbjct  213   SSVVIIRPKPQIPNVDLHEWRAFTRTCFSSNRNKTLGALFKLKGKVFELFKI------SN  266

Query  1169  SVEDCSLQSGSEIIE---LASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGI  1339
               ++CS   G E  +   LA F+E II +++SGGF+DKRP+KLS +ELLHLLSLFNQ+GI
Sbjct  267   GNDECSPHKGDEAQDERGLALFKEKIIGVVTSGGFEDKRPAKLSLQELLHLLSLFNQAGI  326

Query  1340  SFHGPAKLK  1366
              F+   + K
Sbjct  327   YFNHRGRHK  335



>ref|XP_008806474.1| PREDICTED: probable dimethyladenosine transferase [Phoenix dactylifera]
Length=382

 Score =   337 bits (864),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 189/318 (59%), Positives = 240/318 (75%), Gaps = 23/318 (7%)
 Frame = +2

Query  464   IYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEID  643
              +L K RGQH+LTNPRVLDSIV +++V PTDTVLEIGPG+GNLT++L+ AA RV++ EID
Sbjct  65    FHLHKGRGQHILTNPRVLDSIVRRASVRPTDTVLEIGPGSGNLTVRLLEAARRVVSFEID  124

Query  644   KRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGAN-  820
              RMV+ L+ R ++ GL D+L+V+  DAL+TEFP FDL VANIPYGISSPL+AKL+F    
Sbjct  125   DRMVDALHSRVSQLGLQDRLTVIMGDALQTEFPPFDLCVANIPYGISSPLIAKLLFELGR  184

Query  821   --AYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
                +RSATLLLQKEFARRLLA+PGDSEFNRLA NV+LVA VE +MDVSK+DF+PCPKVDS
Sbjct  185   PCGFRSATLLLQKEFARRLLASPGDSEFNRLAANVRLVATVELLMDVSKKDFVPCPKVDS  244

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESV  1174
             S+V+I P++ +P V+LDEW AFTRTCF+KKNKTLGA FKQK+ ++EL +   ++     V
Sbjct  245   SLVRIRPRSDVPAVDLDEWLAFTRTCFSKKNKTLGAIFKQKKKIVELFERSRLEGKACKV  304

Query  1175  ------------EDCSLQSGSEI--------IELASFREMIINILSSGGFDDKRPSKlsh  1294
                         +D   Q G+ +        +EL   +E ++ IL +GGF+DKRPSKLS 
Sbjct  305   LEEEEEEDGVDDDDDDDQLGTRVGEKEAVNALELNVLKEKVVGILKAGGFEDKRPSKLST  364

Query  1295  eellhllslFNQSGISFH  1348
             +ELLHLL LFNQ G+ FH
Sbjct  365   KELLHLLQLFNQEGVLFH  382



>ref|XP_010943978.1| PREDICTED: LOW QUALITY PROTEIN: probable dimethyladenosine transferase 
[Elaeis guineensis]
Length=390

 Score =   337 bits (864),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 189/317 (60%), Positives = 243/317 (77%), Gaps = 22/317 (7%)
 Frame = +2

Query  464   IYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEID  643
              +L K RGQH+LTNPRVLDSIV ++++ P+DTVLEIGPG+GNLT++L+ AA +V+A+EID
Sbjct  74    FHLHKXRGQHILTNPRVLDSIVRRASIRPSDTVLEIGPGSGNLTVRLLEAARQVVAVEID  133

Query  644   KRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGAN-  820
              RMV+ ++ R ++ GL D+L+V+  DALKTEFPRFDL VANIPYGISSPL+AKL+F    
Sbjct  134   DRMVDAVHGRVSQLGLQDRLTVIKGDALKTEFPRFDLCVANIPYGISSPLIAKLLFKLGR  193

Query  821   --AYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
                +RSATLLLQKEFARRLLA+PGDSEFNRLA NV+L A VE +MDVSK+DF+PCPKVDS
Sbjct  194   PCGFRSATLLLQKEFARRLLASPGDSEFNRLAANVRLAATVELLMDVSKKDFVPCPKVDS  253

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeD----  1162
             S+V+I P++ +P V+LDEW AFTRTCF+KKNKTLGA FKQKR ++EL +  +++      
Sbjct  254   SLVRIRPRSDVPAVDLDEWLAFTRTCFSKKNKTLGAIFKQKRKIVELFERSQLEGKACRL  313

Query  1163  -QESVED------CSLQSGSEI--------IELASFREMIINILSSGGFDDKRPSKlshe  1297
              +E  ED         Q G+ +         EL+  +E I+ +L +GGF+DKRPSKLS E
Sbjct  314   LEEEEEDGVNDSDDDDQLGTRVGEKEETNASELSVLQEKIVGMLKAGGFEDKRPSKLSTE  373

Query  1298  ellhllslFNQSGISFH  1348
             ELLHLL LFN+ G+ FH
Sbjct  374   ELLHLLQLFNREGVLFH  390



>ref|XP_007158613.1| hypothetical protein PHAVU_002G167300g [Phaseolus vulgaris]
 gb|ESW30607.1| hypothetical protein PHAVU_002G167300g [Phaseolus vulgaris]
Length=339

 Score =   335 bits (858),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 196/332 (59%), Positives = 241/332 (73%), Gaps = 18/332 (5%)
 Frame = +2

Query  401   RSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPG  580
             R  H + DG         E  ++  KS+GQH+L NPRVLD+IV KS + P DTVLEIGPG
Sbjct  20    RQVHGDGDG---------EERLHFHKSKGQHILINPRVLDTIVRKSAINPADTVLEIGPG  70

Query  581   TGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMV  760
             TGNLTLKL+ AA +V+A EID R+V++L KR  + GL DKL V+ +DA+K  FPRFDL+V
Sbjct  71    TGNLTLKLLEAAHKVVAFEIDHRLVQVLEKRVLQSGLKDKLRVIERDAMKAPFPRFDLVV  130

Query  761   ANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVE  940
             ANIPY ISSPL+ KLV+G+  +RSATLLLQKEFARRL+ANPGDS+F+RL+VNVKL+ADVE
Sbjct  131   ANIPYQISSPLVIKLVYGSTPFRSATLLLQKEFARRLVANPGDSDFSRLSVNVKLLADVE  190

Query  941   FVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr  1120
              VMDVSKRDFLP PKVDSSVV I PK  +P+V+L EW AFT +CF  +NKTLGA+FK KR
Sbjct  191   HVMDVSKRDFLPSPKVDSSVVIIRPKPQVPNVDLREWRAFTSSCFNNRNKTLGASFKNKR  250

Query  1121  llmelmklqemkeDQESV--EDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsh  1294
              + EL+K+    +   S   +D     G       SF+E II +L +G F+DKRP+KLS 
Sbjct  251   KVFELLKISNENDKASSHKGDDAEDDGG-----FTSFKEKIIGVLRTGEFEDKRPAKLSI  305

Query  1295  eellhllslFNQSGISFHGPAKLKNPRQTAFD  1390
             EELLHLLSLFNQ+GI F      K  R+  FD
Sbjct  306   EELLHLLSLFNQAGIYFAYRGHFK--REDRFD  335



>ref|XP_006838681.1| hypothetical protein AMTR_s00002p00244930 [Amborella trichopoda]
 gb|ERN01250.1| hypothetical protein AMTR_s00002p00244930 [Amborella trichopoda]
Length=366

 Score =   330 bits (845),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 188/330 (57%), Positives = 237/330 (72%), Gaps = 18/330 (5%)
 Frame = +2

Query  413   EEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNL  592
             E  +G   +  E +E  +YL +SRGQHLLTN RVLD+IVGK+ V  TDTVLEIGPGTGNL
Sbjct  38    ESQEGKGGKDAEAEEEPLYLHRSRGQHLLTNQRVLDAIVGKAGVERTDTVLEIGPGTGNL  97

Query  593   TLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIP  772
             TL L+     VIA+EID+RM+  LN RA+  GL  +L+V+  DALKT+FP FDL VANIP
Sbjct  98    TLTLLHHVRHVIAVEIDQRMIRALNSRASMLGLAHQLTVISGDALKTQFPPFDLCVANIP  157

Query  773   YGISSPLLAKLVFGAN--AYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFV  946
             YGISSPL+AKL+F      +R+ATLLLQKEFA RLLA PGDS FNRLAVNV+LVA V+ +
Sbjct  158   YGISSPLIAKLLFDQTITPFRNATLLLQKEFASRLLARPGDSAFNRLAVNVQLVAHVQHL  217

Query  947   MDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrll  1126
             M VSKRDF+PCPKVDSS+VKI P +  P+V+L EWWAFTRTCF KKNKTLGA F+QK+ +
Sbjct  218   MGVSKRDFVPCPKVDSSLVKIVPNSVKPNVDLKEWWAFTRTCFCKKNKTLGAIFRQKKKV  277

Query  1127  melmklqemkeDQESVEDCSLQSGSEIIEL---------------ASFREMIINILSSGG  1261
             +ELMK + M     + ++C      +  E                + F+E ++++L  GG
Sbjct  278   LELMKRRSMVRKGGN-DECGFVFEDDESEDDGEEGEGVEVKGGEVSEFKEKVLSVLKDGG  336

Query  1262  FDDKRPSKlsheellhllslFNQSGISFHG  1351
             ++DKRPSKLS ++ LHLL++FN  GI FHG
Sbjct  337   YEDKRPSKLSIDQFLHLLTMFNNGGIRFHG  366



>ref|XP_009413375.1| PREDICTED: dimethyladenosine transferase [Musa acuminata subsp. 
malaccensis]
Length=382

 Score =   318 bits (816),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 182/322 (57%), Positives = 236/322 (73%), Gaps = 21/322 (7%)
 Frame = +2

Query  446   ENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERV  625
             E  + +  L K RGQ+LLTNPRVLD+I   + + P+DTVLEIGPGTGNLT +L+ +A RV
Sbjct  61    EPWDRSFRLDKGRGQYLLTNPRVLDTIARVAGLRPSDTVLEIGPGTGNLTARLLQSARRV  120

Query  626   IAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKL  805
             +A+EID RMV+ +  RA+  G+ D+L+V+  DALKTEFP FD+ VANIPYGISSPL+AKL
Sbjct  121   VAVEIDPRMVDSVLARASRLGVDDRLTVITGDALKTEFPEFDICVANIPYGISSPLIAKL  180

Query  806   VFGAN---AYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLP  976
             +F  +   ++RSA LLLQKEFARRLLA PGDSEFNRLA NV LVA VE +MDVSK+DF+P
Sbjct  181   LFSTSRPSSFRSAVLLLQKEFARRLLAVPGDSEFNRLAANVSLVATVELLMDVSKKDFVP  240

Query  977   CPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemk  1156
             CPKVDS++V++ P+  +P+V+LDEW AF+RTCF+ KNKTLGA FKQK+ + EL+   + +
Sbjct  241   CPKVDSTLVRLRPRTDVPEVDLDEWLAFSRTCFSNKNKTLGAIFKQKKRIAELLGRSKSE  300

Query  1157  eDQESV--EDCSLQSGSE----------------IIELASFREMIINILSSGGFDDKRPS  1282
                  V  E+    +G+E                  E++SF+E  + IL SGGF+ KRPS
Sbjct  301   GRSIKVFMEEEQNDNGAEENDDDNRDDDDLLEQNASEVSSFKEKAVGILKSGGFEGKRPS  360

Query  1283  KlsheellhllslFNQSGISFH  1348
             KLS+EELLHLL LFNQ+G+ F 
Sbjct  361   KLSNEELLHLLQLFNQNGVQFR  382



>ref|NP_201437.2| adenosine dimethyl transferase 1B  [Arabidopsis thaliana]
 gb|AAM53271.1| dimethyladenosine transferase-like protein [Arabidopsis thaliana]
 gb|AAP68275.1| At5g66360 [Arabidopsis thaliana]
 gb|AED98203.1| ribosomal RNA adenine dimethylase family protein [Arabidopsis 
thaliana]
Length=352

 Score =   306 bits (783),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 182/336 (54%), Positives = 229/336 (68%), Gaps = 45/336 (13%)
 Frame = +2

Query  401   RSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPG  580
             R  +E D   VR + + +   ++L KS+GQHLLTN R+LDSIV  S++ PTDTVLEIGPG
Sbjct  43    RRGYERD---VRIEEKKEHDGLFLCKSKGQHLLTNTRILDSIVRSSDIRPTDTVLEIGPG  99

Query  581   TGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMV  760
             TGNLT+KL+ AA+ V+A+E+DKRMVEIL KR ++HG  DKL+++ +D LKT+FP FDL+V
Sbjct  100   TGNLTMKLLEAAQNVVAVELDKRMVEILRKRVSDHGFADKLTIIQKDVLKTDFPHFDLVV  159

Query  761   ANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVE  940
             ANIPY ISSPL+AKLV+G+N +RSATLLLQKEF+RRLLANPGDS+FNRLAVN        
Sbjct  160   ANIPYNISSPLVAKLVYGSNTFRSATLLLQKEFSRRLLANPGDSDFNRLAVN--------  211

Query  941   FVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr  1120
                                 VKI PK  IPDVN+ EW AFTRTCF KKNKTLG+ F+QK+
Sbjct  212   --------------------VKITPKEIIPDVNVQEWLAFTRTCFGKKNKTLGSMFRQKK  251

Query  1121  llmelmklqe--mkeDQESVEDCSLQSGSEIIE------------LASFREMIINILSSG  1258
              +MEL  L       + E +      S S++ E             + F+E +I IL + 
Sbjct  252   KVMELQSLSAGRHGSNVEVMNQTGGDSDSDVEEDGKDDLLCLDTDASMFKERVIEILRTN  311

Query  1259  GFDDKRPSKlsheellhllslFNQSGISFHGPAKLK  1366
             GF++KRPSKLSH ELLHLLSLFNQ+GI FH    L+
Sbjct  312   GFEEKRPSKLSHRELLHLLSLFNQAGIFFHDITSLQ  347



>ref|XP_004957819.1| PREDICTED: probable dimethyladenosine transferase-like [Setaria 
italica]
Length=360

 Score =   304 bits (779),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 175/322 (54%), Positives = 219/322 (68%), Gaps = 24/322 (7%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLV-SAAERVIA  631
             +    L K RGQHLLTNPRVLD+I  ++ + P D VLE+GPGTGNLT +L+ S A RV A
Sbjct  39    DGRFRLHKPRGQHLLTNPRVLDAIARRAAISPGDAVLEVGPGTGNLTARLLASPASRVAA  98

Query  632   IEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVF  811
             +EID RMVE +  RAA  GL DKL+V+  DA++ EFP FD+ VANIPY ISSPL+AKL+F
Sbjct  99    VEIDPRMVEAVTARAAALGLADKLTVIAGDAVEVEFPEFDVCVANIPYSISSPLIAKLLF  158

Query  812   GANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
             G   +R+ATLLLQKEFARRL A PGD E+NRLA NV+LVADV  +MDVSKRDF+P P+VD
Sbjct  159   GTYRFRTATLLLQKEFARRLAATPGDGEYNRLAANVRLVADVRLLMDVSKRDFVPMPRVD  218

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllme-------------  1132
             SS+V+I P+A+ P V+L EW AFTR CF +KNKTLGA FKQKR++ME             
Sbjct  219   SSLVEIRPRAATPGVDLGEWLAFTRACFGQKNKTLGAIFKQKRMVMELFGRSRRAEERDG  278

Query  1133  -lmklqemkeDQESVED---------CSLQSGSEIIELASFREMIINILSSGGFDDKRPS  1282
                 +     D ++ ED           + +G    E+A+F+E I   L S     KRPS
Sbjct  279   GAGGISLGALDDDTDEDGYGKEDDGGSRVAAGCSEEEVAAFKESIAGALESAELASKRPS  338

Query  1283  KlsheellhllslFNQSGISFH  1348
             KLS++ELL LL LFN+ G+ F 
Sbjct  339   KLSNDELLRLLLLFNERGVRFR  360



>ref|XP_002460752.1| hypothetical protein SORBIDRAFT_02g034350 [Sorghum bicolor]
 gb|EER97273.1| hypothetical protein SORBIDRAFT_02g034350 [Sorghum bicolor]
Length=356

 Score =   300 bits (767),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 171/321 (53%), Positives = 220/321 (69%), Gaps = 20/321 (6%)
 Frame = +2

Query  446   ENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLV-SAAER  622
             E  +    L K RGQHLLTNPRVLD+IV ++ +   D +LE+GPGTGNLT +L+ S A R
Sbjct  36    EAWDGRFRLHKPRGQHLLTNPRVLDAIVRRAAISSGDAILEVGPGTGNLTARLLASHAAR  95

Query  623   VIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAK  802
             V+A+EID RMVE +  RAA  GL DKL+V+  DA++ EFP FD+ VANIPYGISSPL+AK
Sbjct  96    VVAVEIDPRMVESVTARAAALGLADKLTVIAGDAVEVEFPEFDVCVANIPYGISSPLIAK  155

Query  803   LVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCP  982
             L+FG   +R+ATLLLQKEFARRL+A PGD E+NRLA NV+LVADV  +MDVSKRDF+P P
Sbjct  156   LLFGPYRFRTATLLLQKEFARRLVATPGDGEYNRLAANVRLVADVRLLMDVSKRDFVPMP  215

Query  983   KVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllme----------  1132
             +VDSS+V+I P+   P V++ EW AFTR CF +KNKTLGA FKQKR++ME          
Sbjct  216   RVDSSLVEIRPRGIAPGVDVSEWLAFTRACFGQKNKTLGAIFKQKRMVMELFGRSQRAEE  275

Query  1133  -lmklqemkeDQESVEDCSLQS--------GSEIIELASFREMIINILSSGGFDDKRPSK  1285
                 +     D +S ED   ++        G    E+A+F+E +   L +     KRPSK
Sbjct  276   CAGGVSLGALDGDSGEDDCGETDDGSNRAVGFSEEEVAAFKERVAGALDTAELAGKRPSK  335

Query  1286  lsheellhllslFNQSGISFH  1348
             +S++EL  LL LFN+ G+ F 
Sbjct  336   VSNDELKRLLRLFNKRGVRFQ  356



>dbj|BAK04910.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=351

 Score =   298 bits (762),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 172/323 (53%), Positives = 223/323 (69%), Gaps = 22/323 (7%)
 Frame = +2

Query  446   ENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVS-AAER  622
             E  +    L K RGQHLLTNPRVLD+IV  + + P D VLE+GPGTGNLT +L++    R
Sbjct  29    EAWDGRFRLHKPRGQHLLTNPRVLDAIVRHAALRPGDAVLEVGPGTGNLTARLLAFPVNR  88

Query  623   VIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAK  802
             V A+E D RMV+ +  R     +  KL+V+  DA++TEFP FD+ VANIPYGISSPL+AK
Sbjct  89    VTAVETDPRMVDAVTARFGALDMTRKLTVIQGDAMETEFPEFDVCVANIPYGISSPLIAK  148

Query  803   LVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCP  982
             L+FGA  +R+ATLLLQKEFARRL+A PGDSE+NRLA NV +VADV+ +MDVSKRDF+P P
Sbjct  149   LLFGAYHFRTATLLLQKEFARRLVAMPGDSEYNRLAANVGMVADVKLLMDVSKRDFVPMP  208

Query  983   KVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemke-  1159
             +VDSS+V+I P+A+ P+V+L EW  FTR CF +KNKTLGA FKQKR +++L+K  +  E 
Sbjct  209   RVDSSLVEIRPRAAPPEVDLAEWLGFTRECFGQKNKTLGAIFKQKRKILDLLKRSQRTER  268

Query  1160  --------------------DQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRP  1279
                                   E  E C   +G    E+ +F+E I++ L+S G   KRP
Sbjct  269   CTGGGIILGVLDDDRNDEACSDEDEESCDRAAGFSTEEVGAFKERIVSALASTGLAGKRP  328

Query  1280  SKlsheellhllslFNQSGISFH  1348
             SK+S++ELL+LL LFNQ GI F 
Sbjct  329   SKMSNDELLYLLRLFNQRGIWFQ  351



>gb|ADE76404.1| unknown [Picea sitchensis]
Length=390

 Score =   298 bits (764),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 181/339 (53%), Positives = 228/339 (67%), Gaps = 30/339 (9%)
 Frame = +2

Query  413   EEDDGNVRRKIENQEA-NIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGN  589
             E DD   ++  E +EA  I L KSRGQH+LTNPRVL SIV K+ V  TDTVLEIGPGTGN
Sbjct  53    EPDDA--KKGEEKEEAPRIELHKSRGQHILTNPRVLKSIVDKAGVRETDTVLEIGPGTGN  110

Query  590   LTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANI  769
             LTL+L+ AA RVIA+EID RM+E ++KR     +  +L +V  D L+T+ P FD+ VANI
Sbjct  111   LTLELLQAARRVIAVEIDPRMIEAVHKRVQGTEMAQRLELVRGDILRTDLPSFDICVANI  170

Query  770   PYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVM  949
             PY ISSPL+ KL+     +R+ATL+LQKEF RRL+A PGDS FNRLAVNV L+A  + +M
Sbjct  171   PYQISSPLIFKLLSTMPKFRNATLMLQKEFGRRLVAKPGDSLFNRLAVNVDLLASAKLLM  230

Query  950   DVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllm  1129
             DVSKRDF PCPKVDSSVV+I P+A  P V+L EW  FT  CFT+KNKTLGA F+QK+ + 
Sbjct  231   DVSKRDFTPCPKVDSSVVRIEPRAWPPPVDLSEWNRFTLMCFTRKNKTLGAIFRQKKTVF  290

Query  1130  elmklqemkeDQES-----------VEDCSL----------------QSGSEIIELASFR  1228
              LMK  E+  +++            V D SL                +S  +  +   F+
Sbjct  291   CLMKKAELWHEKQKLKGSHDNLEKIVSDLSLLGELDDDTTDTEDIDVESDRDNEKFVCFK  350

Query  1229  EMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             E I+NIL SGG++DKR SKLS +E L L+SLFN+ GI F
Sbjct  351   EKIVNILKSGGYEDKRSSKLSVKEFLRLISLFNKEGIHF  389



>tpg|DAA40952.1| TPA: hypothetical protein ZEAMMB73_963520 [Zea mays]
Length=361

 Score =   295 bits (756),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 169/322 (52%), Positives = 216/322 (67%), Gaps = 21/322 (7%)
 Frame = +2

Query  446   ENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLV-SAAER  622
             E  +    L K RGQHLLTNPRVLD+I   + + P D VLE+GPGTGNLT +L+ S A R
Sbjct  40    EAWDGRFRLHKPRGQHLLTNPRVLDAIARHAAISPGDAVLEVGPGTGNLTARLLASQAAR  99

Query  623   VIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAK  802
             V A+EID RMVE +  RAA  GL  K  V+  DA++ EFP FD+ VANIPYGISSPL+AK
Sbjct  100   VTAVEIDPRMVEAVTARAAALGLAHKFKVIAGDAVEVEFPEFDVCVANIPYGISSPLIAK  159

Query  803   LVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCP  982
             L+FG   +R+ATLLLQKEFARRL+A PGD E+NRLA NV+LVADV  +MDVSKRDF+P P
Sbjct  160   LLFGPYRFRTATLLLQKEFARRLVAAPGDGEYNRLAANVRLVADVRLLMDVSKRDFVPMP  219

Query  983   KVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemk--  1156
             +VDSS+V+I P+ ++P V++ EW AFTR CF +KNKTL A FKQKR+++EL++       
Sbjct  220   RVDSSLVEIRPRGTVPGVDVSEWLAFTRVCFGQKNKTLAAIFKQKRMVVELLRRSLRTER  279

Query  1157  -----------eDQESVEDCSLQ-SGSEII------ELASFREMIINILSSGGFDDKRPS  1282
                         D    +DC     GS  +      E+A+F+E +   L +     KRPS
Sbjct  280   CAGGVSLGPLEVDDSGEDDCGGNDDGSNRVVGFSEEEVAAFKEKVAGALDTAELAGKRPS  339

Query  1283  KlsheellhllslFNQSGISFH  1348
             K+S++EL  LL LFN  G+ F 
Sbjct  340   KVSNDELKRLLRLFNDRGVRFQ  361



>gb|EMT31450.1| Dimethyladenosine transferase [Aegilops tauschii]
Length=352

 Score =   290 bits (741),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 171/326 (52%), Positives = 222/326 (68%), Gaps = 28/326 (9%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLV-SAAERVIA  631
             +    L K RGQHLLTNPRVLD+I   + + P D VLE+GPGTGNLT +L+ S A+RV A
Sbjct  27    DGRFRLHKPRGQHLLTNPRVLDAIARHAALRPGDAVLEVGPGTGNLTARLLASPADRVTA  86

Query  632   IEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVF  811
             +EID RMV+ +  R     L  KL+V+  DA++TEFP+FD+ VANIPYGISSPL+AKL+F
Sbjct  87    VEIDPRMVDAVTARFGALDLAHKLTVIQGDAMETEFPKFDVCVANIPYGISSPLIAKLLF  146

Query  812   GANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
             G   +R+ATLLLQKEFARRL+A PGDSE+NRLA NV++VADV+ +MDVSKRDF+P P+VD
Sbjct  147   GTYHFRTATLLLQKEFARRLVAMPGDSEYNRLAANVRMVADVKLLMDVSKRDFVPMPRVD  206

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemke----  1159
             SS+V+I P+ + P+V+L EW  FTR CF +KNKTLGA FKQKR +++L+K  +  E    
Sbjct  207   SSLVEIQPRGAPPEVDLAEWLGFTRECFGQKNKTLGAIFKQKRKILDLLKRSQRSERCTS  266

Query  1160  ---------------DQESVEDCSLQSGS--------EIIELASFREMIINILSSGGFDD  1270
                            D  + E CS + G            E+ +F+E I   L S     
Sbjct  267   DAPGTGSGIILGVLDDDGNDEACSDEDGDSGDRAAGFSTEEVGAFKERIAGALESTDLAG  326

Query  1271  KRPSKlsheellhllslFNQSGISFH  1348
             KRPSK+S++ELL+LL LFN+ GI F 
Sbjct  327   KRPSKMSNDELLYLLRLFNERGIWFQ  352



>ref|XP_006425594.1| hypothetical protein CICLE_v10026231mg [Citrus clementina]
 gb|ESR38834.1| hypothetical protein CICLE_v10026231mg [Citrus clementina]
Length=281

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 171/253 (68%), Positives = 198/253 (78%), Gaps = 20/253 (8%)
 Frame = +2

Query  650   MVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYR  829
             MVEILN+RAA+ G  D+L+V+ +DALKTEFP+FDL+VANIPYGISSPL+AKLV+G  ++R
Sbjct  1     MVEILNRRAADSGFHDRLNVISKDALKTEFPQFDLVVANIPYGISSPLVAKLVYGTKSFR  60

Query  830   SATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKI  1009
             SATLLLQKEFARRLLA+PGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVV I
Sbjct  61    SATLLLQKEFARRLLASPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVII  120

Query  1010  HPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQ--------  1165
              PKA IPDVNLDEW AFTRTCF+KKNKTLGATFKQK+ ++EL++L + K           
Sbjct  121   RPKAEIPDVNLDEWRAFTRTCFSKKNKTLGATFKQKKKVIELLRLSKQKGPNTENFVSDD  180

Query  1166  --ESVEDCSLQSGSEIIELAS----------FREMIINILSSGGFDDKRPSKlsheellh  1309
                S ED   +  S + +L S          F+E I  +L S  F+DKRP KLS+EELLH
Sbjct  181   GCHSGEDDDDEEASGVDDLCSSSCSEMEMSLFKEKITQVLKSAAFEDKRPCKLSNEELLH  240

Query  1310  llslFNQSGISFH  1348
             LLSLFNQ GI FH
Sbjct  241   LLSLFNQVGIYFH  253



>gb|EAZ04012.1| hypothetical protein OsI_26151 [Oryza sativa Indica Group]
Length=358

 Score =   288 bits (736),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 174/219 (79%), Gaps = 1/219 (0%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLV-SAAERVIA  631
             +    L K RGQHLLTNPRVLD+IV ++ + P D VLE+GPGTGNLT++L+ S A RV A
Sbjct  32    DGRFRLHKPRGQHLLTNPRVLDAIVRRAALRPGDAVLEVGPGTGNLTVRLLESPAARVSA  91

Query  632   IEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVF  811
             +EID RMV+ +  R    GL  KL+V+  DA++ EFP FD+ VANIPYGISSPL+AKL+F
Sbjct  92    VEIDPRMVDAVTARVDALGLAHKLTVIRADAVEAEFPEFDVCVANIPYGISSPLIAKLLF  151

Query  812   GANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
             G   +R+ATLLLQKEFARRL+A PGDSE+NRLA NV++VAD   +MDVSKRDF+P PKVD
Sbjct  152   GPYRFRAATLLLQKEFARRLVAAPGDSEYNRLAANVRMVADARLLMDVSKRDFVPMPKVD  211

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             SS+V+I P+A+ P+V+L EW AFTR+CF +KNKTLGA F
Sbjct  212   SSLVEIRPRAAEPNVDLAEWLAFTRSCFGQKNKTLGAIF  250



>gb|EAZ39958.1| hypothetical protein OsJ_24395 [Oryza sativa Japonica Group]
Length=358

 Score =   287 bits (735),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 174/219 (79%), Gaps = 1/219 (0%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLV-SAAERVIA  631
             +    L K RGQHLLTNPRVLD+IV ++ + P D VLE+GPGTGNLT++L+ S A RV A
Sbjct  32    DGRFRLHKPRGQHLLTNPRVLDAIVRRAALRPGDAVLEVGPGTGNLTVRLLESPAARVSA  91

Query  632   IEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVF  811
             +EID RMV+ +  R    GL  KL+V+  DA++ EFP FD+ VANIPYGISSPL+AKL+F
Sbjct  92    VEIDPRMVDAVTARVDALGLAHKLTVIRADAVEAEFPEFDVCVANIPYGISSPLIAKLLF  151

Query  812   GANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
             G   +R+ATLLLQKEFARRL+A PGDSE+NRLA NV++VAD   +MDVSKRDF+P PKVD
Sbjct  152   GPYRFRAATLLLQKEFARRLVAAPGDSEYNRLAANVRMVADARLLMDVSKRDFVPMPKVD  211

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             SS+V+I P+A+ P+V+L EW AFTR+CF +KNKTLGA F
Sbjct  212   SSLVEIRPRAAEPNVDLAEWLAFTRSCFGQKNKTLGAIF  250



>ref|NP_001059748.1| Os07g0509600 [Oryza sativa Japonica Group]
 dbj|BAF21662.1| Os07g0509600, partial [Oryza sativa Japonica Group]
Length=347

 Score =   287 bits (734),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 174/219 (79%), Gaps = 1/219 (0%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLV-SAAERVIA  631
             +    L K RGQHLLTNPRVLD+IV ++ + P D VLE+GPGTGNLT++L+ S A RV A
Sbjct  21    DGRFRLHKPRGQHLLTNPRVLDAIVRRAALRPGDAVLEVGPGTGNLTVRLLESPAARVSA  80

Query  632   IEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVF  811
             +EID RMV+ +  R    GL  KL+V+  DA++ EFP FD+ VANIPYGISSPL+AKL+F
Sbjct  81    VEIDPRMVDAVTARVDALGLAHKLTVIRADAVEAEFPEFDVCVANIPYGISSPLIAKLLF  140

Query  812   GANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
             G   +R+ATLLLQKEFARRL+A PGDSE+NRLA NV++VAD   +MDVSKRDF+P PKVD
Sbjct  141   GPYRFRAATLLLQKEFARRLVAAPGDSEYNRLAANVRMVADARLLMDVSKRDFVPMPKVD  200

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             SS+V+I P+A+ P+V+L EW AFTR+CF +KNKTLGA F
Sbjct  201   SSLVEIRPRAAEPNVDLAEWLAFTRSCFGQKNKTLGAIF  239



>ref|XP_003563044.1| PREDICTED: probable dimethyladenosine transferase [Brachypodium 
distachyon]
Length=361

 Score =   282 bits (721),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 168/330 (51%), Positives = 219/330 (66%), Gaps = 29/330 (9%)
 Frame = +2

Query  446   ENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLV-SAAER  622
             E  +    L K RGQHLLTNPRVLD+I   + + P D VLE+GPGTGNLT +L+ S A R
Sbjct  32    EAWDGRFRLHKPRGQHLLTNPRVLDAIARHAALRPGDAVLEVGPGTGNLTARLLASPAAR  91

Query  623   VIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAK  802
             V A+EID RMV+ +  RA+   L  KL+V+  DA++T+FP FD+ VANIPYGISSPL+AK
Sbjct  92    VSAVEIDPRMVDAVTARASALNLAHKLTVILGDAVETDFPEFDVCVANIPYGISSPLIAK  151

Query  803   LVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCP  982
             L+FG   +R+ATLLLQKEFARRL+A PGDSE+NRLA NV +VA+   +MDVSKRDF+P P
Sbjct  152   LLFGTYRFRTATLLLQKEFARRLVAKPGDSEYNRLAANVHMVAETRLLMDVSKRDFVPMP  211

Query  983   KVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemke-  1159
             +VDSS+V+I P+  +P+ +L EW AFTR CF +KNKTLGA FKQKR ++EL K     + 
Sbjct  212   RVDSSLVEIRPRVDMPEADLAEWLAFTRECFGQKNKTLGAIFKQKRKILELFKRSHRTKR  271

Query  1160  ---------------DQESVEDCS------------LQSGSEIIELASFREMIINILSSG  1258
                            D ++ E CS            + +G    ++ +F+E I N L S 
Sbjct  272   CADDAPGRGVILGVLDDDNDEACSDDDGNDDNGRSDVVAGFNKEDVGAFKERIANALEST  331

Query  1259  GFDDKRPSKlsheellhllslFNQSGISFH  1348
                 KRPS+LS++ELL LL L N+ G+ F 
Sbjct  332   ELAGKRPSQLSNDELLRLLRLLNERGVWFQ  361



>gb|KDP32681.1| hypothetical protein JCGZ_13679 [Jatropha curcas]
Length=253

 Score =   278 bits (711),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 164/257 (64%), Positives = 198/257 (77%), Gaps = 27/257 (11%)
 Frame = +2

Query  650   MVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYR  829
             MVEIL+KR +E G  DKL ++C+DALK +FP+FDL+VANIPYGISSPL+ KLV+GAN +R
Sbjct  1     MVEILHKRVSELGFKDKLEIICEDALKAQFPQFDLVVANIPYGISSPLVTKLVYGANPFR  60

Query  830   SATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKI  1009
             S TLLLQKEFARRLLANPGDSE+NRLAVNVKLVA+VEFVMDVSKRDFLPCPKVDSSVV I
Sbjct  61    SLTLLLQKEFARRLLANPGDSEYNRLAVNVKLVAEVEFVMDVSKRDFLPCPKVDSSVVII  120

Query  1010  HPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemk-----------  1156
              PKA IP VNLDEW AFTRTCFT KNKTL A FKQK+ ++EL +L +MK           
Sbjct  121   RPKAQIPHVNLDEWRAFTRTCFTNKNKTLAAMFKQKKKIIELFRLSKMKDSPNKYGVTNS  180

Query  1157  ------------eDQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlshee  1300
                          D+E  + C   S SE +EL+S+++ II +L + GF+ KRPSKLS+EE
Sbjct  181   NCEFVDDDEGEESDKEGFDPC---SDSE-MELSSYKKKIIEVLKAHGFEAKRPSKLSNEE  236

Query  1301  llhllslFNQSGISFHG  1351
             LL+LL+L N++G+ FHG
Sbjct  237   LLNLLALLNRAGVYFHG  253



>ref|XP_006658601.1| PREDICTED: dimethyladenosine transferase-like [Oryza brachyantha]
Length=366

 Score =   278 bits (710),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 172/219 (79%), Gaps = 1/219 (0%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +    L K RGQHLLTNPRVLD+IV ++ +   D VLE+GPGTGNLT++L+++A   ++ 
Sbjct  39    DGRFRLHKPRGQHLLTNPRVLDAIVRRAALRQGDAVLEVGPGTGNLTVRLLASAAARVSA  98

Query  635   -EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVF  811
              EID RMV+ +  R    GL  KL+++  DA++TEFP FD+ VANIPYGISSPL+AKL+F
Sbjct  99    VEIDPRMVDAVTARVDALGLAHKLTLIAGDAVETEFPEFDVCVANIPYGISSPLIAKLLF  158

Query  812   GANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
             G   +R+ATLLLQKEFARRL+A PGDSE+NRLA NV++VAD   +MDVSKRDF+P PKVD
Sbjct  159   GPYRFRAATLLLQKEFARRLVAAPGDSEYNRLAANVRMVADARLLMDVSKRDFVPVPKVD  218

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             SS+V+I P+A+ PDV+L EW AFTR CF +KNKTLGA F
Sbjct  219   SSLVEIRPRAAAPDVDLAEWLAFTRACFGQKNKTLGAIF  257



>gb|KCW53090.1| hypothetical protein EUGRSUZ_J02386 [Eucalyptus grandis]
Length=262

 Score =   262 bits (669),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 156/261 (60%), Positives = 187/261 (72%), Gaps = 24/261 (9%)
 Frame = +2

Query  650   MVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYR  829
             MV+ L KR A+ G  D+L+V+ +DALKTEFP FD++VANIPY ISSPL+ KLV+G   +R
Sbjct  1     MVDALRKRVADRGSEDRLTVIQKDALKTEFPPFDIVVANIPYQISSPLIIKLVYGKIQFR  60

Query  830   SATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKI  1009
             SATLLLQKEFARRLLANPGDSE+NRLAVNVKLVADVEF MDVSKRDFLP PKVDSSVV I
Sbjct  61    SATLLLQKEFARRLLANPGDSEYNRLAVNVKLVADVEFAMDVSKRDFLPVPKVDSSVVII  120

Query  1010  HPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQE-------  1168
              PK  +P VNL EWWAFTRTCF KKNKTLGATFKQKR LME+ K   +   ++       
Sbjct  121   RPKTELPKVNLAEWWAFTRTCFGKKNKTLGATFKQKRKLMEIFKTSTLAGLKKDVAITNN  180

Query  1169  ------SVEDCSLQSGSEII-----------ELASFREMIINILSSGGFDDKRPSKlshe  1297
                   SVED  +                  E+  F+E I+ +L + GF+DKRPSKLS++
Sbjct  181   DGISGVSVEDDDIDEEGNSEEESLSSSVPEGEMNLFKEKIVGVLRAEGFEDKRPSKLSND  240

Query  1298  ellhllslFNQSGISFHGPAK  1360
             ELLHLL++ N +G+ FH  A+
Sbjct  241   ELLHLLAVLNHAGVYFHNQAE  261



>gb|KHN41932.1| Dimethyladenosine transferase [Glycine soja]
Length=248

 Score =   253 bits (645),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 151/244 (62%), Positives = 184/244 (75%), Gaps = 11/244 (5%)
 Frame = +2

Query  650   MVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYR  829
             MV++L KR  + GL DKL V+ +DA++  FPRFDL+VANIPY ISSPL+ KLV+GA  +R
Sbjct  1     MVQVLEKRVLQRGLKDKLRVIERDAMRAPFPRFDLVVANIPYRISSPLVIKLVYGATPFR  60

Query  830   SATLLLQKEFARRLLANPGDS-EFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVK  1006
             SATLLLQKEFARRLLA PGDS  FNRL+ NVKLVADVE VMDVSKRDFLP PKVDSSVV 
Sbjct  61    SATLLLQKEFARRLLACPGDSGGFNRLSANVKLVADVELVMDVSKRDFLPSPKVDSSVVI  120

Query  1007  IHPKASIPDVNLDEWWAFTRTCFTK-KNKTLGATFkqkrllmelmklqemkeDQESVEDC  1183
             I PK  IP+V+L EW +FTRTCF+  +NKTLGA FK K  + EL K+          ++C
Sbjct  121   IRPKHQIPNVDLHEWRSFTRTCFSSNRNKTLGALFKLKGKVFELFKI------SNGNDEC  174

Query  1184  SLQSGSEIIE---LASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISFHGP  1354
             SL  G E+ +   L SF+E II ++ +GGF+DKRP+KLS +ELLHLLSLFNQ+GI F+  
Sbjct  175   SLHKGDEVQDEGGLTSFKEKIIGVVRTGGFEDKRPAKLSLQELLHLLSLFNQAGIYFNHR  234

Query  1355  AKLK  1366
              + K
Sbjct  235   GRHK  238



>emb|CDX80102.1| BnaA05g00540D [Brassica napus]
Length=345

 Score =   253 bits (645),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 147/328 (45%), Positives = 202/328 (62%), Gaps = 29/328 (9%)
 Frame = +2

Query  449   NQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVI  628
             N +  I   KS+GQH+L NP ++DSIV K+ +  TD +LEIGPGTGNLT KL+ A + VI
Sbjct  17    NYQGGISFHKSKGQHILKNPLLVDSIVQKAGIKSTDVILEIGPGTGNLTKKLLEAGKEVI  76

Query  629   AIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLV  808
             A+E+D RMV  L +R     L ++L V+  D LKTE PRFD+ VANIPY ISSPL  KL+
Sbjct  77    AVELDSRMVLELQRRFQGTPLSNRLKVIQGDVLKTELPRFDICVANIPYQISSPLTFKLL  136

Query  809   FGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKV  988
             F   ++R A ++ Q+EFA RL+A PGD+ + RL+VN +L A V  ++ V K +F P PKV
Sbjct  137   FHPTSFRCAVIMYQREFAMRLVAQPGDNLYCRLSVNTQLYARVSHLLKVGKNNFRPPPKV  196

Query  989   DSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllme------lmklqe  1150
             DSSVV+I P+   P VN  EW  F R CF +KNKTLGA F+QK ++         ++   
Sbjct  197   DSSVVRIEPRKPQPQVNKKEWDGFLRVCFIRKNKTLGAIFRQKSVVSMLEKNFKTLQAVL  256

Query  1151  mkeDQESVEDCSLQSGSEIIEL-----------------------ASFREMIINILSSGG  1261
                +  +VE  ++  G + + +                         F+E ++N+L  GG
Sbjct  257   ASLNGATVEAATMDVGDQSMGMEDDDNEMEDDDEDMEMDEGQGGGGEFKEKVMNVLKEGG  316

Query  1262  FDDKRPSKlsheellhllslFNQSGISF  1345
             F++KR SKLS +E L+LLSLFN+SGI F
Sbjct  317   FEEKRSSKLSQQEFLYLLSLFNKSGIHF  344



>gb|KHN36066.1| Dimethyladenosine transferase [Glycine soja]
Length=248

 Score =   249 bits (636),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 150/238 (63%), Positives = 180/238 (76%), Gaps = 11/238 (5%)
 Frame = +2

Query  650   MVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYR  829
             MV++L KR  + GL DKL V+ +DA++  FPRFDL+VANIPY ISSPL+ KLV+GA  +R
Sbjct  1     MVQVLEKRVLQRGLQDKLRVIERDAMRAPFPRFDLVVANIPYRISSPLVIKLVYGATPFR  60

Query  830   SATLLLQKEFARRLLANPGDS-EFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVK  1006
             SATLLLQKEFARRLL  PGDS  FNRL+ NVKLVADVE VMDVSKRDFLP PKVDSSVV 
Sbjct  61    SATLLLQKEFARRLLTCPGDSGGFNRLSANVKLVADVELVMDVSKRDFLPSPKVDSSVVI  120

Query  1007  IHPKASIPDVNLDEWWAFTRTCFTK-KNKTLGATFkqkrllmelmklqemkeDQESVEDC  1183
             I PK  IP+V+L EW AFTRTCF+  +NKTLGA FK K  + EL K+          ++C
Sbjct  121   IRPKPQIPNVDLHEWRAFTRTCFSSNRNKTLGALFKLKGKVFELFKI------SNGNDEC  174

Query  1184  SLQSGSEIIE---LASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISFH  1348
             S   G E  +   LA F+E II +++SGGF+DKRP+KLS +ELLHLLSLFNQ+GI F+
Sbjct  175   SPHKGDEAQDERGLALFKEKIIGVVTSGGFEDKRPAKLSLQELLHLLSLFNQAGIYFN  232



>ref|XP_010091144.1| putative dimethyladenosine transferase [Morus notabilis]
 gb|EXB42737.1| putative dimethyladenosine transferase [Morus notabilis]
Length=457

 Score =   254 bits (648),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 198/308 (64%), Gaps = 62/308 (20%)
 Frame = +2

Query  497   LTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRA  676
             L N R+LDSIV KS + PTDTVLEI PGT NLTLKL+  + RVI +EID RMVEIL KRA
Sbjct  110   LKNQRILDSIVRKSAIKPTDTVLEIRPGTRNLTLKLLEVSSRVIVVEIDGRMVEILLKRA  169

Query  677   AEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLLLQKE  856
             +E G  D+LS                                     N Y+S+TLLLQKE
Sbjct  170   SECGFKDRLS-------------------------------------NPYQSSTLLLQKE  192

Query  857   FARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDV  1036
             FA+RLLA PGDSEFNRLAVNV+LVADVE V DVSKR+FLPCPKVDSSVV I PKA  PDV
Sbjct  193   FAKRLLAKPGDSEFNRLAVNVQLVADVEHVTDVSKREFLPCPKVDSSVVIIRPKAHFPDV  252

Query  1037  NLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemke------------DQESVED  1180
             NLDEW AFTRTCF KKNKTLGATFKQK+ +MEL++L EM              D  ++++
Sbjct  253   NLDEWGAFTRTCFGKKNKTLGATFKQKKKVMELLRLSEMVALNGENTFDLRGYDSTNLKE  312

Query  1181  ------------CSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslF  1324
                         C   SG +   ++ F E +I +L +GGF+DKRP KL HEELL LL+LF
Sbjct  313   VEEGGDGDGEEECFSSSGCKT-RVSLFWEKVIRVLKAGGFEDKRPLKLLHEELLSLLALF  371

Query  1325  NQSGISFH  1348
             NQ+GI  H
Sbjct  372   NQAGICLH  379



>ref|XP_002880301.1| hypothetical protein ARALYDRAFT_904217 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56560.1| hypothetical protein ARALYDRAFT_904217 [Arabidopsis lyrata subsp. 
lyrata]
Length=352

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 150/349 (43%), Positives = 208/349 (60%), Gaps = 32/349 (9%)
 Frame = +2

Query  395   GGRSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIG  574
             GG+   E+   + R    + +  I   KS+GQH+L NP ++DSIV K+ +  TD +LEIG
Sbjct  3     GGKMRKEKPKASNRAPSNHYQGGISFHKSKGQHILKNPLLVDSIVQKAGIKSTDVILEIG  62

Query  575   PGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDL  754
             PGTGNLT KL+ A + VIA+E+D RMV  L +R       ++L V+  D LKTE PRFD+
Sbjct  63    PGTGNLTKKLLEAGKEVIAVELDSRMVLELQRRFQGTPYSNRLKVIQGDVLKTELPRFDI  122

Query  755   MVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAD  934
              VANIPY ISSPL  KL+F   ++R A ++ Q+EFA RL+A PGD+ + RL+VN +L A 
Sbjct  123   CVANIPYQISSPLTFKLLFHPTSFRCAVIMYQREFAMRLVAQPGDNLYCRLSVNTQLYAR  182

Query  935   VEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkq  1114
             V  ++ V K +F P PKVDSSVV+I P+   P VN  EW  F R CF +KNKTLG+ FKQ
Sbjct  183   VSHLLKVGKNNFRPPPKVDSSVVRIEPRRPGPQVNKKEWDGFLRVCFIRKNKTLGSIFKQ  242

Query  1115  kr--------llmelmklqemkeDQESVEDCSLQSGSEII--------------------  1210
             K                L  ++ + ++  + S+  G + +                    
Sbjct  243   KSVLSMLEKNYKTLQAVLASLQNNGDAALNTSMDLGDQSMGMEDDDNEMDDDDMEMDDGE  302

Query  1211  ----ELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
                 E + F+E ++N+L  GGF++KR SKLS +E L+LLSLFN+SGI F
Sbjct  303   GDGGETSEFKEKVMNVLKEGGFEEKRSSKLSQQEFLYLLSLFNKSGIHF  351



>gb|KFK37481.1| hypothetical protein AALP_AA4G263100 [Arabis alpina]
Length=346

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 148/327 (45%), Positives = 200/327 (61%), Gaps = 30/327 (9%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV K+ +  TD +LEIGPGTGNLT KL+ A + VIAI
Sbjct  19    QGGISFHKSKGQHILKNPLLVDSIVQKAGIKTTDVILEIGPGTGNLTKKLLEAGKEVIAI  78

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L +R       ++L V+  D LKTE PRFD+ VANIPY ISSPL  KL+F 
Sbjct  79    ELDSRMVLELQRRFQGTPFSNRLKVIQGDVLKTELPRFDICVANIPYQISSPLTFKLLFH  138

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
              +++R A ++ Q+EFA RL+A PGD+ + RL+VN +L A V  ++ V K +F P PKVDS
Sbjct  139   QSSFRCAVIMYQREFAMRLVAQPGDNLYCRLSVNTQLYARVSHLLKVGKNNFRPPPKVDS  198

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrl--------lmelmklqe  1150
             SVV+I P+   P VN  EW  F R CF +KNKTLG+ FKQK +              L  
Sbjct  199   SVVRIEPRKPQPQVNKKEWDGFLRVCFIRKNKTLGSIFKQKSVLVMLEKNFKTLQAVLAS  258

Query  1151  mkeDQESVEDCSLQSGSEIIEL----------------------ASFREMIINILSSGGF  1264
             ++ D  + E  ++  G   + L                      + F+E ++N+L  GGF
Sbjct  259   IQNDGSNGEAAAMDLGDHSMGLEDDDNEMDDDDMEMDEGEGGEVSEFKEKVMNVLKEGGF  318

Query  1265  DDKRPSKlsheellhllslFNQSGISF  1345
             ++KR SKLS +E L+LLSLFN+SGI F
Sbjct  319   EEKRSSKLSQQEFLYLLSLFNKSGIHF  345



>ref|NP_182264.1| dimethyladenosine transferase [Arabidopsis thaliana]
 gb|AAC62868.1| putative dimethyladenosine transferase [Arabidopsis thaliana]
 gb|AAK64053.1| putative dimethyladenosine transferase [Arabidopsis thaliana]
 gb|AAM44912.1| putative dimethyladenosine transferase [Arabidopsis thaliana]
 gb|AEC10839.1| dimethyladenosine transferase [Arabidopsis thaliana]
Length=353

 Score =   249 bits (635),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 149/350 (43%), Positives = 207/350 (59%), Gaps = 33/350 (9%)
 Frame = +2

Query  395   GGRSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIG  574
             GG+   E+   + R    + +  I   KS+GQH+L NP ++DSIV K+ +  TD +LEIG
Sbjct  3     GGKIRKEKPKASNRAPSNHYQGGISFHKSKGQHILKNPLLVDSIVQKAGIKSTDVILEIG  62

Query  575   PGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDL  754
             PGTGNLT KL+ A + VIA+E+D RMV  L +R       ++L V+  D LKTE PRFD+
Sbjct  63    PGTGNLTKKLLEAGKEVIAVELDSRMVLELQRRFQGTPFSNRLKVIQGDVLKTELPRFDI  122

Query  755   MVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAD  934
              VANIPY ISSPL  KL+F   ++R A ++ Q+EFA RL+A PGD+ + RL+VN +L A 
Sbjct  123   CVANIPYQISSPLTFKLLFHPTSFRCAVIMYQREFAMRLVAQPGDNLYCRLSVNTQLYAR  182

Query  935   VEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkq  1114
             V  ++ V K +F P PKVDSSVV+I P+   P VN  EW  F R CF +KNKTLG+ FKQ
Sbjct  183   VSHLLKVGKNNFRPPPKVDSSVVRIEPRRPGPQVNKKEWDGFLRVCFIRKNKTLGSIFKQ  242

Query  1115  kr---------llmelmklqemkeDQESVEDCSLQSGSEII-------------------  1210
             K            ++ +        + ++   S+  G + +                   
Sbjct  243   KSVLSMLEKNFKTLQAVLASLQNNGEPALNTTSMDLGDQSMGMEDDDNEMDDDDMEMDEG  302

Query  1211  -----ELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
                  E + F+E ++N+L  GGF++KR SKLS +E L+LLSLFN+SGI F
Sbjct  303   EGDGGETSEFKEKVMNVLKEGGFEEKRSSKLSQQEFLYLLSLFNKSGIHF  352



>ref|XP_009142538.1| PREDICTED: probable dimethyladenosine transferase [Brassica rapa]
Length=345

 Score =   248 bits (634),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 148/328 (45%), Positives = 197/328 (60%), Gaps = 29/328 (9%)
 Frame = +2

Query  449   NQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVI  628
             N +  I   KS+GQH+L NP ++DSIV K+ +  TD +LEIGPGTGNLT KL+ A + VI
Sbjct  17    NYQGGISFHKSKGQHILKNPLLVDSIVQKAGIKSTDVILEIGPGTGNLTKKLLEAGKEVI  76

Query  629   AIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLV  808
             A+E+D RMV  L +R       ++L V+  D LKTE PRFD+ VANIPY ISSPL  KL+
Sbjct  77    AVELDSRMVLELQRRFQGTPYSNRLKVIQGDVLKTELPRFDICVANIPYQISSPLTFKLL  136

Query  809   FGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKV  988
             F   ++R A ++ Q+EFA RL+A PGD+ + RL+VN +L A V  ++ V K +F P PKV
Sbjct  137   FHPTSFRCAVIMYQREFAMRLVAQPGDNLYCRLSVNTQLYARVSHLLKVGKNNFRPPPKV  196

Query  989   DSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr----------llmelm  1138
             DSSVV+I P+   P VN  EW  F R CF +KNKTLGA F+QK            L  ++
Sbjct  197   DSSVVRIEPRKPQPQVNKKEWDGFLRVCFIRKNKTLGAIFRQKSVVLMLEKNFKTLQAVL  256

Query  1139  klqemkeDQESVEDCSLQSGSEIIEL-------------------ASFREMIINILSSGG  1261
                     + +V D   QS     +                      F+E ++N+L  GG
Sbjct  257   ASLNGVTGEAAVMDVGDQSMGMEDDDNEMEDDDEDMEMDEGQGGGGEFKEKVMNVLKEGG  316

Query  1262  FDDKRPSKlsheellhllslFNQSGISF  1345
             F++KR SKLS +E L+LLSLFN+SGI F
Sbjct  317   FEEKRSSKLSQQEFLYLLSLFNKSGIHF  344



>emb|CDY55380.1| BnaC04g51980D [Brassica napus]
Length=346

 Score =   248 bits (634),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 146/329 (44%), Positives = 199/329 (60%), Gaps = 30/329 (9%)
 Frame = +2

Query  449   NQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVI  628
             N +  I   KS+GQH+L NP ++DSIV K+ +  TD +LEIGPGTGNLT KL+ A + VI
Sbjct  17    NYQGGISFHKSKGQHILKNPLLVDSIVQKAGIKSTDVILEIGPGTGNLTKKLLEAGKEVI  76

Query  629   AIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLV  808
             A+E+D RMV  L +R       ++L V+  D LKTE PRFD+ VANIPY ISSPL  KL+
Sbjct  77    AVELDSRMVLELQRRFQGTPYSNRLKVIQGDVLKTELPRFDICVANIPYQISSPLTFKLL  136

Query  809   FGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKV  988
             F   ++R A ++ Q+EFA RL+A PGD+ + RL+VN +L A V  ++ V K +F P PKV
Sbjct  137   FHPTSFRCAVIMYQREFAMRLVAQPGDNLYCRLSVNTQLYARVSHLLKVGKNNFRPPPKV  196

Query  989   DSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllme------lmklqe  1150
             DSSVV+I P+   P VN  EW  F R CF +KNKTLGA F+QK ++         ++   
Sbjct  197   DSSVVRIEPRKPQPQVNKKEWDGFLRVCFIRKNKTLGAIFRQKSVVSMLEKNFKTLQAVL  256

Query  1151  mkeDQESVEDCSLQSGSEIIEL------------------------ASFREMIINILSSG  1258
                +  + E   +  G + + L                          F+E ++N+L  G
Sbjct  257   ASLNGSTGEAAVMDVGDQSMGLEDDDNEMEDDDEDMEMEEGQGGGGGEFKEKVMNVLKEG  316

Query  1259  GFDDKRPSKlsheellhllslFNQSGISF  1345
             GF++KR SKLS +E L+LLSLFN+SGI F
Sbjct  317   GFEEKRSSKLSQQEFLYLLSLFNKSGIHF  345



>ref|XP_006397937.1| hypothetical protein EUTSA_v10001522mg [Eutrema salsugineum]
 gb|ESQ39390.1| hypothetical protein EUTSA_v10001522mg [Eutrema salsugineum]
Length=352

 Score =   249 bits (635),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 146/349 (42%), Positives = 206/349 (59%), Gaps = 32/349 (9%)
 Frame = +2

Query  395   GGRSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIG  574
             GG+   E+   + R      +  I   KS+GQH+L NP ++DSIV K+ +  TD +LEIG
Sbjct  3     GGKMRKEKPKASNRAPSSQYQGGISFHKSKGQHILKNPLLVDSIVQKAGIKSTDVILEIG  62

Query  575   PGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDL  754
             PGTGNLT KL+ A + VIA+E+D RMV  L +R       ++L V+  D LKTE PRFD+
Sbjct  63    PGTGNLTKKLLEAGKEVIAVELDSRMVLELQRRFQGTPFSNRLRVIQGDVLKTELPRFDI  122

Query  755   MVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAD  934
              VANIPY ISSPL  KL+F   ++R A ++ Q+EFA RL+A PGD+ + RL+VN +L A 
Sbjct  123   CVANIPYQISSPLTFKLLFHPTSFRCAVIMYQREFAMRLVAQPGDNLYCRLSVNTQLYAR  182

Query  935   VEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkq  1114
             V  ++ V K +F P PKVDSSVV+I P+   P VN  EW  F R CF +KNKTLG+ F+Q
Sbjct  183   VSHLLKVGKNNFRPPPKVDSSVVRIEPRKPQPQVNKKEWDGFLRVCFIRKNKTLGSIFRQ  242

Query  1115  kr--------llmelmklqemkeDQESVEDCSLQSGSEIIEL------------------  1216
             K                L  ++ + ++  + ++  G + + +                  
Sbjct  243   KSVLSMLEKNYKTLQAVLASLQNNGQAAPNTAMDLGDQSMGIEDDDNALDDDDDDMEMDE  302

Query  1217  ------ASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
                   + F+E ++N+L  G F++KR SKLS +E L+LLSLFN+SGI F
Sbjct  303   GDGGEASEFKEKVMNVLKEGAFEEKRSSKLSQQEFLYLLSLFNKSGIHF  351



>ref|XP_009133814.1| PREDICTED: probable dimethyladenosine transferase [Brassica rapa]
Length=342

 Score =   248 bits (632),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 147/338 (43%), Positives = 206/338 (61%), Gaps = 31/338 (9%)
 Frame = +2

Query  425   GNVRRKIENQEANIY-----LLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGN  589
             G +R++     +N Y       KS+GQH+L NP ++DSIV K+ +  TD +LEIGPGTGN
Sbjct  4     GKIRKEKAKAPSNHYQGGISFHKSKGQHILKNPPLVDSIVQKAGIKSTDVILEIGPGTGN  63

Query  590   LTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANI  769
             LT KL+ A + VIA+E+D RMV  L +R       ++L V+  D LKTE PRFD+ VANI
Sbjct  64    LTKKLLEAGKEVIAVELDSRMVLALQRRFQGTPYSNRLKVIQGDVLKTELPRFDICVANI  123

Query  770   PYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVM  949
             PY ISSPL  KL+F   ++R A ++ Q+EFA RL+A PGD+ + RL+VN +L A V  ++
Sbjct  124   PYQISSPLTFKLLFHPTSFRCAVIMYQREFAMRLVAQPGDNLYCRLSVNTQLYARVSHLL  183

Query  950   DVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllm  1129
              V K +F P PKVDSSVV+I P+   P VN  EW  F R CF +KNKTLG+ F+QK +L+
Sbjct  184   KVGKNNFRPPPKVDSSVVRIEPRKPQPQVNKKEWDGFLRVCFIRKNKTLGSIFRQKSVLL  243

Query  1130  e------lmklqemkeDQESVEDCSLQSGSE---------------IIEL-----ASFRE  1231
                     ++      +  + E   +  G +                +E+       F+E
Sbjct  244   MLEKNFKTLQAVLASLNGSTGEAAGMDLGDQSMGMEDDDNEMDDDGDVEMDEGQGGEFKE  303

Query  1232  MIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
              ++N+L  GGF++KR SKLS ++ L+LLSLFN+SGI F
Sbjct  304   KVMNVLKEGGFEEKRSSKLSQQDFLYLLSLFNKSGIHF  341



>emb|CDX83328.1| BnaA03g21780D [Brassica napus]
Length=342

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 147/338 (43%), Positives = 206/338 (61%), Gaps = 31/338 (9%)
 Frame = +2

Query  425   GNVRRKIENQEANIY-----LLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGN  589
             G +R++     +N Y       KS+GQH+L NP ++DSIV K+ +  TD +LEIGPGTGN
Sbjct  4     GKIRKEKAKAPSNHYQGGISFHKSKGQHILKNPLLVDSIVQKAGIKSTDVILEIGPGTGN  63

Query  590   LTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANI  769
             LT KL+ A + VIA+E+D RMV  L +R       ++L V+  D LKTE PRFD+ VANI
Sbjct  64    LTKKLLEAGKEVIAVELDSRMVLELQRRFQGTPYSNRLKVIQGDVLKTELPRFDICVANI  123

Query  770   PYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVM  949
             PY ISSPL  KL+F   ++R A ++ Q+EFA RL+A PGD+ + RL+VN +L A V  ++
Sbjct  124   PYQISSPLTFKLLFHPTSFRCAVIMYQREFAMRLVAQPGDNLYCRLSVNTQLYARVSHLL  183

Query  950   DVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllm  1129
              V K +F P PKVDSSVV+I P+   P VN  EW  F R CF +KNKTLG+ F+QK +L+
Sbjct  184   KVGKNNFRPPPKVDSSVVRIEPRKPQPQVNKKEWDGFLRVCFIRKNKTLGSIFRQKSVLL  243

Query  1130  e------lmklqemkeDQESVEDCSLQSGSE---------------IIEL-----ASFRE  1231
                     ++      +  + E   +  G +                +E+       F+E
Sbjct  244   MLEKNFKTLQAVLASLNGSTGEAAGMDLGDQSMGMEDDDNEMDDDGDVEMDEGQGGEFKE  303

Query  1232  MIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
              ++N+L  GGF++KR SKLS ++ L+LLSLFN+SGI F
Sbjct  304   KVMNVLKEGGFEEKRSSKLSQQDFLYLLSLFNKSGIHF  341



>ref|XP_006296482.1| hypothetical protein CARUB_v10025667mg [Capsella rubella]
 gb|EOA29380.1| hypothetical protein CARUB_v10025667mg [Capsella rubella]
Length=346

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 152/343 (44%), Positives = 204/343 (59%), Gaps = 26/343 (8%)
 Frame = +2

Query  395   GGRSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIG  574
             GG+   E    + R    + +  I   KS+GQH+L NP ++DSIV K+ +  +D +LEIG
Sbjct  3     GGKIRKERASASNRAPSNHYQGGISFQKSKGQHILKNPLLVDSIVQKAGIKSSDVILEIG  62

Query  575   PGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDL  754
             PGTGNLT KL+ A ++VIA+E+D RMV  L +R       ++L V+  D LKTE PRFD+
Sbjct  63    PGTGNLTKKLLEAGKQVIAVELDPRMVLELERRFQGTPFSNRLKVIQGDVLKTELPRFDI  122

Query  755   MVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAD  934
              VANIPY ISSPL  KL+F   ++R A ++ Q+EFA RL+A PGD+ + RL+VN +L A 
Sbjct  123   CVANIPYQISSPLTFKLLFHPTSFRCAVIMYQREFAMRLVAQPGDNLYCRLSVNTQLYAR  182

Query  935   VEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkq  1114
             V  ++ V K +F P PKVDSSVV+I P+   P VN  EW  F R CF +KNKTLG+ FKQ
Sbjct  183   VSHLLKVGKNNFRPPPKVDSSVVRIEPRKPGPQVNNKEWDGFLRVCFIRKNKTLGSIFKQ  242

Query  1115  krll-------melmklqemkeDQESVEDCSLQSGSEII-------------------EL  1216
             K LL         L  L     +        L   S  I                   E 
Sbjct  243   KSLLLMLENNFKTLQALLASLHNNGEAAATHLADHSMGIEDDDNEMDDDDVDMDDGEGET  302

Query  1217  ASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             + F++ ++N+L  GGF++KR SKLS +E L+LLSLFN+SGI F
Sbjct  303   SEFKDKVMNVLKEGGFEEKRASKLSQQEFLYLLSLFNKSGIHF  345



>ref|XP_010523927.1| PREDICTED: probable dimethyladenosine transferase [Tarenaya hassleriana]
Length=351

 Score =   245 bits (625),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 151/349 (43%), Positives = 203/349 (58%), Gaps = 33/349 (9%)
 Frame = +2

Query  395   GGRSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIG  574
             GG+   E+  GN R    + +  I   KS+GQH+L NP ++DSIV K+ +  TD +LEIG
Sbjct  3     GGKMKKEKPKGN-RAPSNHYQGGISFHKSKGQHILKNPLLVDSIVQKAGIKSTDVILEIG  61

Query  575   PGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDL  754
             PGTGNLT KL+ + + VIA+E+D RMV  L +R        +L V+  D LKTE P FD+
Sbjct  62    PGTGNLTKKLLESGKEVIAVELDPRMVLELQRRFQGTPYSSRLKVIQGDVLKTELPHFDI  121

Query  755   MVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAD  934
              VANIPY ISSPL  KL+F   ++R A ++ Q+EFA RL+A PGD+ + RL+VN +L A 
Sbjct  122   CVANIPYQISSPLTFKLLFHPTSFRCAVIMYQREFAMRLVAQPGDNLYCRLSVNTQLYAR  181

Query  935   VEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkq  1114
             V  ++ V K +F P PKVDSSVV+I P+   P VN  EW  F R CF +KNKTLG+ F+Q
Sbjct  182   VSHLLKVGKNNFRPPPKVDSSVVRIEPRKPRPQVNSKEWDGFIRICFIRKNKTLGSIFRQ  241

Query  1115  k-------------rllmelmklqemkeDQESVEDCSLQS-------------------G  1198
             K             + L           +  +V D   QS                   G
Sbjct  242   KNVLSLLEKNYKTLQALQASQNGGGSTGESMNVSDFGDQSMGIDDDDDNEVDDEMEMDDG  301

Query  1199  SEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
                 E++ F+E + N+L  G F+DKR SKLS +E L+LLSLFN++GI F
Sbjct  302   EGDGEVSEFKEKVSNVLKEGDFEDKRSSKLSQQEFLYLLSLFNKAGIHF  350



>gb|ETN76097.1| dimethyladenosine transferase [Necator americanus]
Length=305

 Score =   241 bits (616),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 135/290 (47%), Positives = 184/290 (63%), Gaps = 9/290 (3%)
 Frame = +2

Query  482   RGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEI  661
             +GQH+L NP +++SI+ KS +  TDTVLE+GPGTGNLT+K++  A++VIA EID RM+  
Sbjct  25    KGQHILKNPGIVNSIIEKSALKSTDTVLEVGPGTGNLTVKMLECAKKVIACEIDPRMIAE  84

Query  662   LNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATL  841
             L KR     L +KL V   D +KTE+P FD+ VAN+PY ISSP + KL+      R A L
Sbjct  85    LKKRVMATPLQNKLEVRPGDVMKTEWPFFDVCVANLPYQISSPFVFKLLLQRPLPRYAVL  144

Query  842   LLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKA  1021
             + QKEFA RL+A PGD ++ RL+VNV+L+A VE +M V + +F P PKVDS+VV+I PK 
Sbjct  145   MFQKEFADRLIAKPGDKDYCRLSVNVQLLAKVEHLMKVKRTEFRPPPKVDSAVVRIAPKN  204

Query  1022  SIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGS  1201
               P +N DEW    R CF +KNKTL + F                 ++   + CSL +  
Sbjct  205   PPPPINFDEWEGMLRLCFLRKNKTLLSIF--------KQNNVAELIEKNYQKLCSLLN-K  255

Query  1202  EIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISFHG  1351
              I +    +++I N L+ GGF DKR  K+S E+ L LL  FN++GI FH 
Sbjct  256   PIPKDFDVKKLIENTLTEGGFADKRARKMSIEQFLALLLTFNKAGIHFHS  305



>gb|KHG08361.1| putative dimethyladenosine transferase [Gossypium arboreum]
Length=349

 Score =   243 bits (619),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 147/348 (42%), Positives = 209/348 (60%), Gaps = 33/348 (9%)
 Frame = +2

Query  395   GGRSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIG  574
             GG+   ++  G  R    + +  +   KS+GQH+L NP ++D+IV K+ + PTDT+LEIG
Sbjct  3     GGKMKKDKQKGP-RAPSNHYQGGVTFHKSKGQHILKNPMLVDAIVQKAGIKPTDTILEIG  61

Query  575   PGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDL  754
             PGTGNLT KL+   + VIA+E+D RMV  L +R       ++L V+  D LKT+ P FD+
Sbjct  62    PGTGNLTKKLLETGKMVIAVELDPRMVLELQRRFQGTPFSNRLKVIQGDVLKTDLPYFDI  121

Query  755   MVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAD  934
              VANIPY ISSPL  KL+F   A+R A ++ Q+EFA RL+A PGD+ + RL+VN +  A 
Sbjct  122   CVANIPYQISSPLTFKLLFHQPAFRCAIIMFQREFAMRLVAQPGDNLYCRLSVNTQFYAR  181

Query  935   VEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkq  1114
             V  ++ V K +F P PKVDSSVV+I P+   P+VN  EW  F R CF +KNKTLG+ FKQ
Sbjct  182   VFHLLKVGKNNFRPPPKVDSSVVRIEPRKPRPEVNHKEWDGFIRICFIRKNKTLGSIFKQ  241

Query  1115  krllmelmklqemkeDQESVEDCSLQSGSEIIELA-------------------------  1219
             K +L  L K  +  +  +  ++ SL SG++ +E+A                         
Sbjct  242   KNVLSLLEKNYKTLQALQGSQNVSL-SGNDDMEIARLGDESMEMEDGMDDDMDMECDEAE  300

Query  1220  ------SFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
                    F+  +I++L  G F+++R SKLS E  L LLS+FN++GI F
Sbjct  301   GEGEVSEFKNKVISVLKEGKFEEQRASKLSQESFLTLLSMFNKAGIHF  348



>gb|EPS71929.1| hypothetical protein M569_02829 [Genlisea aurea]
Length=353

 Score =   241 bits (615),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 144/327 (44%), Positives = 198/327 (61%), Gaps = 30/327 (9%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS +  TDT+LEIGPGTGNLT KL+   + VIA+
Sbjct  26    QGGIPFHKSKGQHILKNPLLIDSIVQKSGIKSTDTILEIGPGTGNLTKKLLEVGKSVIAV  85

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L +R        KL V+  D LK++ P FD+ VANIPY ISSPL  KL+  
Sbjct  86    ELDPRMVLELQRRFQGTPYSSKLKVIQGDVLKSDLPYFDICVANIPYQISSPLTFKLLSH  145

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
                +R A ++ Q+EFA RL+A PGD+ + RL+VN +L+A +  ++ V + +F P PKVDS
Sbjct  146   RPLFRCAVIMFQREFAMRLVAQPGDTLYCRLSVNAQLLARINHLLKVGRNNFRPPPKVDS  205

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQE--  1168
             SVV+I P+  +P VN  EW    R CF +KNKTLGA F+QK +L  L K     +  +  
Sbjct  206   SVVRIEPRRPLPPVNFKEWDGLVRICFNRKNKTLGALFRQKTVLSMLEKNYRTLQALQLV  265

Query  1169  -SVEDCSLQS------GSEIIEL---------------------ASFREMIINILSSGGF  1264
               VED +  S      G  + +L                     + F+EM++ +L  GGF
Sbjct  266   PPVEDAAEMSAFVSVLGDAVGDLSIADDDDNGEDDVQMDDGDAKSGFKEMVLGVLKGGGF  325

Query  1265  DDKRPSKlsheellhllslFNQSGISF  1345
             DDKR SKL+  + +HLL+LFN++GI F
Sbjct  326   DDKRASKLTQSDFVHLLALFNKAGIHF  352



>ref|XP_007051093.1| Ribosomal RNA adenine dimethylase family protein [Theobroma cacao]
 gb|EOX95250.1| Ribosomal RNA adenine dimethylase family protein [Theobroma cacao]
Length=347

 Score =   241 bits (614),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 146/345 (42%), Positives = 207/345 (60%), Gaps = 29/345 (8%)
 Frame = +2

Query  395   GGRSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIG  574
             GG+   E+  G  R    + +  +   KS+GQH+L NP ++DSIV K+ +  TD +LEIG
Sbjct  3     GGKIKKEKQKGQ-RAPSNHYQGGVTFHKSKGQHILKNPLLVDSIVQKAGIKSTDVILEIG  61

Query  575   PGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDL  754
             PGTGNLT KL+ A + VIA+E+D RMV  L +R        +L+V+  D LKT+ P FD+
Sbjct  62    PGTGNLTKKLLEAGKMVIAVELDPRMVLELQRRFQGTPFSSRLTVIQGDVLKTDLPYFDI  121

Query  755   MVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAD  934
              VANIPY ISSPL  KL+F   A+R A ++ Q+EFA RL+A PGD+ + RL+VN +  A 
Sbjct  122   CVANIPYQISSPLTFKLLFHQPAFRCAVIMFQREFAMRLVAQPGDNLYCRLSVNTQFYAR  181

Query  935   VEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkq  1114
             V  ++ V K +F P PKVDSSVV+I P+   P+VN  EW  F R CF +KNKTLG+ FKQ
Sbjct  182   VSHLLKVGKNNFRPPPKVDSSVVRIEPRKPRPEVNHKEWDGFIRICFIRKNKTLGSIFKQ  241

Query  1115  krllmelmklqemkeDQESVEDCSL---------QSGSEIIEL-----------------  1216
             K +L  L K  +  +  +   + SL         + G++ +EL                 
Sbjct  242   KNVLALLEKNYKTLQALQGSRNVSLGGIDDMDVARLGNQSMELDDGMDDEMDVECDEAEG  301

Query  1217  --ASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
               + F+  ++++L  G F+++R SKLS E  L LLS+FN++GI F
Sbjct  302   EVSEFKNKVLSVLKEGNFEEQRASKLSQESFLTLLSMFNKAGIHF  346



>ref|XP_006285366.1| hypothetical protein CARUB_v10006757mg [Capsella rubella]
 gb|EOA18264.1| hypothetical protein CARUB_v10006757mg [Capsella rubella]
Length=343

 Score =   240 bits (613),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 146/329 (44%), Positives = 203/329 (62%), Gaps = 32/329 (10%)
 Frame = +2

Query  449   NQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVI  628
             + + NI   KS+GQH+L NP ++DSIV K+ +  TD +LEIGPGTGNLT KL+ A ++VI
Sbjct  16    HYQGNISFHKSKGQHILKNPLLVDSIVQKAGIKSTDVILEIGPGTGNLTKKLLEAGKQVI  75

Query  629   AIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLV  808
             AIE+D RMV  L +R    G  ++L V+  D LKTE P FD+ VA IPY ISSPL  KL+
Sbjct  76    AIELDSRMVLELQRRF--QGFSNRLKVIQGDVLKTELPHFDICVAIIPYKISSPLTFKLL  133

Query  809   FGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKV  988
             F   ++R A ++ Q+EFA RL+A PG++ + RL+VN +L A V  ++ V K +F P PKV
Sbjct  134   FHGTSFRCAVIMYQREFAMRLVARPGENLYCRLSVNTQLYARVSHLLQVGKNNFCPPPKV  193

Query  989   DSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemke---  1159
             DSSVV+I P+   P VN  EW  F R CF + NKTLG+ FKQK +L+ L K  +  +   
Sbjct  194   DSSVVRIEPRKLGPQVNKKEWDGFLRVCFIRLNKTLGSIFKQKYVLLMLEKNFKTLQNVL  253

Query  1160  ----DQESVEDCSLQSGSEIIEL-----------------------ASFREMIINILSSG  1258
                 +  S+ + ++  G   I +                       + F+E +IN+L  G
Sbjct  254   GSFHNNGSIGEAAMDLGDHSIGIEDEHENEMDDDDDMDMDDGEGKTSEFKEKVINVLKEG  313

Query  1259  GFDDKRPSKlsheellhllslFNQSGISF  1345
             GF++K  SK+S +E L+LLSLFN+SGI F
Sbjct  314   GFEEKIASKMSQQEFLYLLSLFNKSGIHF  342



>ref|XP_001769214.1| predicted protein [Physcomitrella patens]
 gb|EDQ65926.1| predicted protein [Physcomitrella patens]
Length=302

 Score =   238 bits (608),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 134/294 (46%), Positives = 191/294 (65%), Gaps = 11/294 (4%)
 Frame = +2

Query  464   IYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEID  643
             I   KS+GQH+L NP ++ SIV K+ +  TD VLEIGPGTGNLT+KL+   ++V+A+E+D
Sbjct  19    IQFQKSKGQHILKNPLLVQSIVQKAGLKSTDIVLEIGPGTGNLTMKLLEVCKKVVAVELD  78

Query  644   KRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANA  823
              RMV  + +R       +KL V+  D LKTE P FD+ VAN+PY ISSP+  KL+     
Sbjct  79    PRMVLEVTRRVQGTPYANKLQVIQGDILKTELPYFDVCVANVPYQISSPITFKLLSHRPL  138

Query  824   YRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVV  1003
             +R A ++ QKEFA+RL+A PGDS F RL+VN +L+A V  ++ V K +F P PKVDSSVV
Sbjct  139   FRCAVIMFQKEFAQRLVAQPGDSLFCRLSVNTQLLARVFHLLKVGKNNFRPPPKVDSSVV  198

Query  1004  KIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDC  1183
             +I P+  +P +N  EW    R CF +KNKTLG+ F+QK +L  + K  +           
Sbjct  199   RIEPRNPLPPINFKEWDGLIRLCFNRKNKTLGSIFRQKAVLALIEKNYK-----------  247

Query  1184  SLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             + Q+  E      F+E  + +L+ GG++DKR SKL+ ++ L LL+LFN++G+ F
Sbjct  248   TFQALQEAGGNTFFKEKCLGVLAEGGYEDKRSSKLTQDDFLRLLALFNKAGVHF  301



>ref|XP_002982218.1| hypothetical protein SELMODRAFT_116036 [Selaginella moellendorffii]
 gb|EFJ16886.1| hypothetical protein SELMODRAFT_116036 [Selaginella moellendorffii]
Length=312

 Score =   238 bits (608),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 135/297 (45%), Positives = 190/297 (64%), Gaps = 5/297 (2%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KSRGQH+L NP V+ SIV K+ +  TD VLEIGPGTGNLT+KL+  A++VIA+
Sbjct  19    QGGIQFYKSRGQHILKNPLVVQSIVQKAGLKSTDIVLEIGPGTGNLTVKLLEVAKKVIAV  78

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L +R       + L ++  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  79    ELDPRMVLELQRRVQGTPQANHLQIIQGDVLKTELPYFDVCVANIPYQISSPLTFKLLSH  138

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
                +R+A ++ QKEFA RL+A P D  + RL+VN +L+A V+ ++ V K +F P PKVDS
Sbjct  139   RPLFRAAVIMFQKEFAMRLVAKPADPLYCRLSVNTQLLARVDHLLKVGKNNFRPPPKVDS  198

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESV  1174
             SVV+I P+  +P V+  EW    R CF +KNKTLG+ F+QK ++  + + ++     E  
Sbjct  199   SVVRIEPRNPLPPVSFKEWDGLVRLCFNRKNKTLGSIFRQKNVVQLVERNRKAVMANEDG  258

Query  1175  EDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
              D     GS+       +EM++ IL  G + DKR SKL+ ++ L LL+ FN++G+ F
Sbjct  259   MDVD-DDGSK----CQTKEMLLEILEKGKYLDKRSSKLTQDDFLTLLASFNKAGVHF  310



>ref|XP_002992246.1| hypothetical protein SELMODRAFT_186635 [Selaginella moellendorffii]
 gb|EFJ06743.1| hypothetical protein SELMODRAFT_186635 [Selaginella moellendorffii]
Length=312

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 134/297 (45%), Positives = 190/297 (64%), Gaps = 5/297 (2%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KSRGQH+L NP ++ SIV K+ +  TD VLEIGPGTGNLT+KL+  A++VIA+
Sbjct  19    QGGIQFYKSRGQHILKNPLIVQSIVQKAGLKSTDIVLEIGPGTGNLTVKLLEVAKKVIAV  78

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L +R       + L ++  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  79    ELDPRMVLELQRRVQGTPQANHLQIIQGDVLKTELPYFDVCVANIPYQISSPLTFKLLSH  138

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
                +R+A ++ QKEFA RL+A P D  + RL+VN +L+A V+ ++ V K +F P PKVDS
Sbjct  139   RPLFRAAVIMFQKEFAMRLVAKPADPLYCRLSVNTQLLARVDHLLKVGKNNFRPPPKVDS  198

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESV  1174
             SVV+I P+  +P V+  EW    R CF +KNKTLG+ F+QK ++  + + ++     E  
Sbjct  199   SVVRIEPRNPLPPVSFKEWDGLVRLCFNRKNKTLGSIFRQKNVVQLVERNRKAVMANEDG  258

Query  1175  EDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
              D     GS+       +EM++ IL  G + DKR SKL+ ++ L LL+ FN++G+ F
Sbjct  259   MDVD-DDGSK----CQTKEMLLEILEKGKYLDKRSSKLTQDDFLTLLASFNKAGVHF  310



>ref|NP_001150423.1| LOC100284053 [Zea mays]
 gb|ACG39040.1| dimethyladenosine transferase [Zea mays]
 gb|AFW70368.1| dimethyladenosine transferase [Zea mays]
Length=354

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 149/334 (45%), Positives = 205/334 (61%), Gaps = 37/334 (11%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAER-VIA  631
             +  I   KS+GQH+L NP ++DSIV K+ + PTDTVLEIGPGTGNLT +L+ A  + V+A
Sbjct  20    QGGIPFEKSKGQHILRNPALVDSIVAKAGLKPTDTVLEIGPGTGNLTKRLLEAGVKAVVA  79

Query  632   IEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVF  811
             +E+D RMV  LN+R   H L  +L V+  D LK + P FD+ VANIPY ISSPL  KL+ 
Sbjct  80    VELDPRMVLELNRRFQGHPLSSRLKVIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLS  139

Query  812   GANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
                 +R A ++ Q+EFA RL+A PGDS + RL+VNV+L++ V  ++ V + +F P PKVD
Sbjct  140   HRPIFRCAVIMFQREFAMRLVAQPGDSLYCRLSVNVQLLSRVSHLLKVGRNNFRPPPKVD  199

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQES  1171
             SSVV+I P+  +P V+  EW    R CF +KNKTLG+ FKQKR+L  L K  +  +  ++
Sbjct  200   SSVVRIEPRKPLPPVSFKEWDGLVRICFNRKNKTLGSLFKQKRVLELLEKNYKTMQSLQT  259

Query  1172  ----------------------VEDCSLQSGSEIIEL--------------ASFREMIIN  1243
                                   VED S+++G +  +               ASF+E I+ 
Sbjct  260   VQDAEMGEEKMSADDVALLANMVEDMSMETGYDKEDDEMEMDDADMAGDGAASFKEKIMG  319

Query  1244  ILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             IL  G F +KR SKLS  + L+LLSLFN++GI F
Sbjct  320   ILQQGDFAEKRGSKLSQVDFLYLLSLFNKAGIHF  353



>ref|XP_004951725.1| PREDICTED: probable dimethyladenosine transferase-like [Setaria 
italica]
Length=359

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 151/334 (45%), Positives = 207/334 (62%), Gaps = 37/334 (11%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAER-VIA  631
             +  I   KS+GQH+L NP ++DSIV K+ + PTDTVLEIGPGTGNLT +L+ A  + V+A
Sbjct  25    QGGIPFEKSKGQHILRNPALVDSIVAKAGLKPTDTVLEIGPGTGNLTKRLLEAGVKAVVA  84

Query  632   IEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVF  811
             +E+D RMV  LN+R   H L  +L V+  D LK + P FD+ VANIPY ISSPL  KL+ 
Sbjct  85    VELDPRMVLELNRRFQGHPLSSRLKVIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLS  144

Query  812   GANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
                 +R A ++ Q+EFA RL+A PGDS + RL+VNV+L++ V  ++ V + +F P PKVD
Sbjct  145   HRPIFRCAVIMFQREFAMRLVAQPGDSLYCRLSVNVQLLSRVSHLLKVGRNNFRPPPKVD  204

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrll------melmklqem  1153
             SSVV+I P+  +P V+  EW    R CF +KNKTLG+ FKQKR+L       + M+  ++
Sbjct  205   SSVVRIEPRKPLPPVSFKEWDGLVRICFNRKNKTLGSIFKQKRVLELLEKNYKTMQSLQL  264

Query  1154  keDQE----------------SVEDCSLQSGSEIIEL--------------ASFREMIIN  1243
              +D E                 VED S+++G E  +               ASF+E I+ 
Sbjct  265   TQDAEMGEEKMSADDVALLANMVEDLSMETGDEKEDDEMEMDDADMVGGGAASFKEKIMG  324

Query  1244  ILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             IL  G F +KR SKLS  + L+LLSLFN++GI F
Sbjct  325   ILQQGDFAEKRGSKLSQVDFLYLLSLFNKAGIHF  358



>ref|XP_010518440.1| PREDICTED: probable dimethyladenosine transferase [Camelina sativa]
Length=356

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 157/238 (66%), Gaps = 0/238 (0%)
 Frame = +2

Query  395   GGRSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIG  574
             GG+   E    + R    + +  I   KS+GQH+L NP ++DSIV K+ +  TD +LEIG
Sbjct  3     GGKMRKERPTASSRAPSNHYQGGISFQKSKGQHILKNPLLVDSIVQKAGIKSTDVILEIG  62

Query  575   PGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDL  754
             PGTGNLT KL+ A ++VIA+E+D RMV  L +R       ++L V+  D LKTE PRFD+
Sbjct  63    PGTGNLTKKLLEAGKQVIAVELDPRMVLELQRRFQGTPFSNRLKVIQGDVLKTELPRFDI  122

Query  755   MVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAD  934
              VANIPY ISSPL  KL+F   ++R A ++ Q+EFA RL+A PGD+ + RL+VN +L A 
Sbjct  123   CVANIPYQISSPLTFKLLFHPTSFRCAVIMYQREFAMRLVAQPGDNLYCRLSVNTQLYAR  182

Query  935   VEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             V  ++ V K +F P PKVDSSVV+I P+   P VN  EW  F R CF +KNKTLG+ F
Sbjct  183   VSHLLKVGKNNFRPPPKVDSSVVRIEPRRPGPQVNKKEWDGFLRVCFIRKNKTLGSIF  240



>ref|XP_010506778.1| PREDICTED: probable dimethyladenosine transferase [Camelina sativa]
Length=351

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 118/238 (50%), Positives = 157/238 (66%), Gaps = 0/238 (0%)
 Frame = +2

Query  395   GGRSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIG  574
             GG+   E    + R    + +  I   KS+GQH+L NP ++DSIV K+ +  TD +LEIG
Sbjct  3     GGKMRKERPTASNRAPSNHYQGGISFQKSKGQHILKNPLLVDSIVQKAGIKSTDVILEIG  62

Query  575   PGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDL  754
             PGTGNLT KL+ A ++VIA+E+D RMV  L +R       ++L V+  D LKTE PRFD+
Sbjct  63    PGTGNLTKKLLEAGKQVIAVELDPRMVLELQRRFQGTPFSNRLKVIQGDVLKTELPRFDI  122

Query  755   MVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAD  934
              VANIPY ISSPL  KL+F   ++R A ++ Q+EFA RL+A PGD+ + RL+VN +L A 
Sbjct  123   CVANIPYQISSPLTFKLLFHPTSFRCAVIMYQREFAMRLVAQPGDNLYCRLSVNTQLYAR  182

Query  935   VEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             V  ++ V K +F P PKVDSSVV+I P+   P VN  EW  F R CF +KNKTLG+ F
Sbjct  183   VSHLLKVGKNNFRPPPKVDSSVVRIEPRRPGPQVNKKEWDGFLRVCFIRKNKTLGSIF  240



>ref|XP_005649824.1| dimethyladenosine transferase [Coccomyxa subellipsoidea C-169]
 gb|EIE25280.1| dimethyladenosine transferase [Coccomyxa subellipsoidea C-169]
Length=362

 Score =   237 bits (605),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 147/350 (42%), Positives = 199/350 (57%), Gaps = 43/350 (12%)
 Frame = +2

Query  425   GNVRRKIENQ----EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNL  592
             G V +K   Q     + I  LKS+GQH+L NP+V+ SIV K+ V  TD VLEIGPGTGNL
Sbjct  11    GRVLKKSSKQGIGGNSGIEFLKSKGQHILKNPQVVQSIVDKAGVKSTDVVLEIGPGTGNL  70

Query  593   TLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIP  772
             TLKL+  A++VIA+E+D RMV  L +R         L ++  D +K + P FD+ VANIP
Sbjct  71    TLKLLERAKKVIAVEVDPRMVLELQRRVQGTQFASHLQIIQGDVMKQDLPFFDICVANIP  130

Query  773   YGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMD  952
             Y ISSPL  KL+    A+R+A ++ Q EFA RL+A PGDS F RLAVN +L+A V  ++ 
Sbjct  131   YQISSPLTFKLLAHRPAFRAAVIMFQHEFAMRLVARPGDSLFCRLAVNTQLLACVSHLLK  190

Query  953   VSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllme  1132
             V + +F P PKVDSSVV+I P+   P VN  EW    R CF +KNKTLGA F+Q   L  
Sbjct  191   VGRNNFRPPPKVDSSVVRIEPRHPPPPVNFREWDGLVRVCFGRKNKTLGAIFRQSSTLAL  250

Query  1133  l-----------------mklqemkeDQESVEDCSL-QSGS-------EIIELA------  1219
             L                         D  S  D  + ++GS       E  E+A      
Sbjct  251   LEANYKLHQALAIDKTPGSAGVAQPSDGSSFADTMMEEAGSLGDGDEDEDAEMAVADQQR  310

Query  1220  --------SFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
                      F+E+++ IL   GF+D+R +K++ ++ L LL+ FN+SG+ F
Sbjct  311   TKKNQYSEGFKELVMGILQQMGFEDRRSAKMTLDDFLLLLAKFNESGVHF  360



>ref|XP_004951724.1| PREDICTED: probable dimethyladenosine transferase-like [Setaria 
italica]
Length=359

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 149/334 (45%), Positives = 205/334 (61%), Gaps = 37/334 (11%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAER-VIA  631
             +  I   KS+GQH+L NP ++DSIV K+ + PTDTVLEIGPGTGNLT +L+ A  + V+A
Sbjct  25    QGGIPFEKSKGQHILRNPALVDSIVAKAGLKPTDTVLEIGPGTGNLTKRLLEAGVKAVVA  84

Query  632   IEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVF  811
             +E+D RMV  LN+R   H L  +L V+  D LK + P FD+ VANIPY ISSPL  KL+ 
Sbjct  85    VELDPRMVLELNRRFQGHPLSSRLKVIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLS  144

Query  812   GANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
                 +R A ++ Q+EFA RL+A PGDS + RL+VNV+L++ V  ++ V + +F P PKVD
Sbjct  145   HRPIFRCAVIMFQREFAMRLVAQPGDSLYCRLSVNVQLLSRVSHLLRVPRNNFRPPPKVD  204

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrll------melmklqem  1153
             SSVV+I P   +P V+  EW    R CF +KNKTLG+ FKQKR+L       + M+  ++
Sbjct  205   SSVVRIEPTKPLPSVSFKEWDGLVRICFNRKNKTLGSIFKQKRVLELLEKNYKTMQSLQL  264

Query  1154  keDQE----------------SVEDCSLQSGSEIIEL--------------ASFREMIIN  1243
              +D E                 VED S+++G E  +               ASF+E I+ 
Sbjct  265   TQDAEMGEEKMSADDVALLANMVEDLSMETGDEKEDDEMEMDDADMVGGGAASFKEKIMG  324

Query  1244  ILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             IL  G F +KR SKL  ++  +LLSLFN++GI F
Sbjct  325   ILQQGDFAEKRGSKLGQDDFSNLLSLFNKAGIHF  358



>ref|XP_010268006.1| PREDICTED: probable dimethyladenosine transferase [Nelumbo nucifera]
Length=349

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 146/349 (42%), Positives = 204/349 (58%), Gaps = 35/349 (10%)
 Frame = +2

Query  395   GGRSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIG  574
             GG+   E+     R    + +  I   KS+GQH+L NP ++D+IV KS +  TD +LEIG
Sbjct  3     GGKIKKEKAS---RATTNHLQGGIPFHKSKGQHILKNPLIVDTIVQKSGIKNTDVILEIG  59

Query  575   PGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDL  754
             PGTGNLT KL+   ++VIAIE+D RMV  L +R       ++L+V+  D LK + P FD+
Sbjct  60    PGTGNLTKKLLEVGKKVIAIELDARMVLELQRRFQGTPFSNRLTVIQGDVLKCDLPYFDI  119

Query  755   MVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAD  934
              VANIPY ISSPL  KL+    A+R A ++ Q+EFA RL+A PGD+ + RL+VN +L+A 
Sbjct  120   CVANIPYQISSPLTFKLLSHRPAFRCAVIMFQREFAMRLVAQPGDNLYCRLSVNTQLLAR  179

Query  935   VEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkq  1114
             V  ++ V K +F P PKVDSSVV+I P+  +P VN  EW    R CF +KNKTLG+ F+Q
Sbjct  180   VNHLLKVGKNNFRPPPKVDSSVVRIEPRKPLPPVNFKEWDGLVRICFNRKNKTLGSIFRQ  239

Query  1115  krllmelmklqemkeDQESV-------------------EDCSL-------------QSG  1198
             K +L  L K     +  + +                   ED S+             ++G
Sbjct  240   KTVLSLLEKNYRTLQALQQLQRGHSEDTEMDVSVLGDTGEDVSMDIEDERDEDEMEVENG  299

Query  1199  SEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
                 E + F+E I+ +L  G F+DKR SKL+  + L+LLSLFN+ GI F
Sbjct  300   GAGGEFSEFKEKILGVLKHGDFEDKRSSKLTQVDFLYLLSLFNKEGIHF  348



>ref|XP_002451644.1| hypothetical protein SORBIDRAFT_04g005150 [Sorghum bicolor]
 gb|EES04620.1| hypothetical protein SORBIDRAFT_04g005150 [Sorghum bicolor]
Length=359

 Score =   236 bits (602),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 147/334 (44%), Positives = 203/334 (61%), Gaps = 37/334 (11%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAER-VIA  631
             +  I   KS+GQH+L NP ++DSIV K+ + PTDTVLEIGPGTGNLT +L+ A  + V+A
Sbjct  25    QGGIPFEKSKGQHILKNPALVDSIVAKAGLKPTDTVLEIGPGTGNLTKRLLEAGVKAVVA  84

Query  632   IEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVF  811
             +E+D RMV  LN+R   H L  +L V+  D LK + P FD+ VANIPY ISSPL  KL+ 
Sbjct  85    VELDPRMVLELNRRFQGHPLSSRLKVIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLS  144

Query  812   GANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
                 +R A ++ Q+EFA RL+A PGD+ + RL+VNV+L++ V  ++ V K +F P PKVD
Sbjct  145   HRPIFRCAVIMFQREFAMRLVAQPGDTLYCRLSVNVQLLSRVSHLLKVGKNNFRPPPKVD  204

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQE-  1168
             SSVV+I P+  +P V+  EW    R CF +KN+TLG+ FK KR+L  L K  +  +  + 
Sbjct  205   SSVVRIEPRKPLPPVSFKEWDGLVRICFNRKNRTLGSLFKTKRVLELLEKNYKTMQSLQL  264

Query  1169  ---------------------SVEDCSLQSGSEIIEL--------------ASFREMIIN  1243
                                   VED ++++G E  +               ASF+E I+ 
Sbjct  265   TRDADMGEQKMSADDVALLANMVEDLNMETGDEKEDDEMEMDDADMAGDGAASFKEKIMG  324

Query  1244  ILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             IL  G F +KR SKLS  + L+LLSLFN++GI F
Sbjct  325   ILQQGDFAEKRGSKLSQVDFLYLLSLFNKAGIHF  358



>emb|CAN77505.1| hypothetical protein VITISV_017803 [Vitis vinifera]
Length=350

 Score =   236 bits (601),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 144/331 (44%), Positives = 201/331 (61%), Gaps = 31/331 (9%)
 Frame = +2

Query  446   ENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERV  625
             ++ +  +   KS+GQH+L NP ++DSIV KS +  TD +LEIGPGTGNLT KL+ A + V
Sbjct  19    KHYQGGVTFHKSKGQHILKNPLLVDSIVEKSGIKSTDVILEIGPGTGNLTKKLLEAGKSV  78

Query  626   IAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKL  805
             IA+E+D RMV  L +R     L ++L V+  D L+ + P FD+ VANIPY ISSPL  KL
Sbjct  79    IAVEVDPRMVLELQRRFQGTPLSNRLEVIQGDVLRCDLPYFDICVANIPYQISSPLTFKL  138

Query  806   VFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPK  985
             +     +R A ++ Q+EFA RL+A PGD+ + RL+VN +L+A V  ++ V K +F P PK
Sbjct  139   LAHRPVFRCAVIMFQREFAMRLVAQPGDNLYCRLSVNTQLLARVSHLLKVGKNNFRPPPK  198

Query  986   VDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemke--  1159
             VDSSVV+I P+  +P VN  EW    R CF +KNKTLG+ F+QK +L  L K  +  +  
Sbjct  199   VDSSVVRIEPRKPLPPVNFKEWDGLVRLCFNRKNKTLGSIFRQKSVLSLLEKNYKTVQAL  258

Query  1160  -------DQESVEDCS------------LQSGS----EII------ELASFREMIINILS  1252
                    D E+  D +            L  G     E++      E + F+E ++NIL 
Sbjct  259   QLSGPSGDAETEMDLTGFGDANEDQSMDLDDGRDDEMEVVDGNAGGEASDFKEKVLNILK  318

Query  1253  SGGFDDKRPSKlsheellhllslFNQSGISF  1345
              G F+DKR SKL+  + L+LLSLFN+ GI F
Sbjct  319   QGNFEDKRSSKLTQVDFLYLLSLFNKXGIHF  349



>ref|XP_002276165.1| PREDICTED: probable dimethyladenosine transferase [Vitis vinifera]
Length=350

 Score =   236 bits (601),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 144/331 (44%), Positives = 201/331 (61%), Gaps = 31/331 (9%)
 Frame = +2

Query  446   ENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERV  625
             ++ +  +   KS+GQH+L NP ++DSIV KS +  TD +LEIGPGTGNLT KL+ A + V
Sbjct  19    KHYQGGVTFHKSKGQHILKNPLLVDSIVEKSGIKSTDVILEIGPGTGNLTKKLLEAGKSV  78

Query  626   IAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKL  805
             IA+E+D RMV  L +R     L ++L V+  D L+ + P FD+ VANIPY ISSPL  KL
Sbjct  79    IAVEVDPRMVLELQRRFQGTPLSNRLKVIQGDVLRCDLPYFDICVANIPYQISSPLTFKL  138

Query  806   VFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPK  985
             +     +R A ++ Q+EFA RL+A PGD+ + RL+VN +L+A V  ++ V K +F P PK
Sbjct  139   LAHRPVFRCAVIMFQREFAMRLVAQPGDNLYCRLSVNTQLLARVSHLLKVGKNNFRPPPK  198

Query  986   VDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemke--  1159
             VDSSVV+I P+  +P VN  EW    R CF +KNKTLG+ F+QK +L  L K  +  +  
Sbjct  199   VDSSVVRIEPRKPLPPVNFKEWDGLVRLCFNRKNKTLGSIFRQKSVLSLLEKNYKTVQAL  258

Query  1160  -------DQESVEDCS------------LQSGS----EII------ELASFREMIINILS  1252
                    D E+  D +            L  G     E++      E + F+E ++NIL 
Sbjct  259   QLSGPSGDAETEMDLTGFGDANEDQSMDLDDGRDDEMEVVDGNAGGEASDFKEKVLNILK  318

Query  1253  SGGFDDKRPSKlsheellhllslFNQSGISF  1345
              G F+DKR SKL+  + L+LLSLFN+ GI F
Sbjct  319   QGNFEDKRSSKLTQVDFLYLLSLFNKDGIHF  349



>ref|XP_004959693.1| PREDICTED: dimethyladenosine transferase-like, partial [Setaria 
italica]
Length=355

 Score =   236 bits (601),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 158/339 (47%), Positives = 201/339 (59%), Gaps = 44/339 (13%)
 Frame = +2

Query  464   IYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLV-SAAERVIAIEI  640
             I L K RGQ++L NPRVLD IV ++ + P D VLE+GPGTGNLT +L+ S A RV A+EI
Sbjct  17    IRLQKQRGQYMLINPRVLDDIVRRAAIRPGDAVLEVGPGTGNLTARLLASPAARVAAVEI  76

Query  641   DKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGAN  820
             D RM      RA   GL  KL+V   DA+K EFP FD+ V+NIPY ISSPL AKL+FGA 
Sbjct  77    DPRMAAAAAARATALGLAHKLTVTTGDAMKVEFPEFDVCVSNIPYVISSPLAAKLLFGAY  136

Query  821   AYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSV  1000
              +R+ATLL+QKEFARRL+  PG  E N LA N +LVADV   MDV K DF+P P VDSS+
Sbjct  137   RFRTATLLVQKEFARRLVGAPGHGERNHLATNARLVADVTLRMDVGKEDFVPVPGVDSSL  196

Query  1001  VKI-----HPKASIPDVNLDEWWAFTRTCFTKKN-------------KTLGATFkqkrll  1126
             V+I      P    P + LDEW  FTR CF +               KTLGA FK++ + 
Sbjct  197   VEIRMKEDRPAEVEPGIGLDEWLEFTRVCFGQHRLQQQKKKKKRKEEKTLGAIFKREEMA  256

Query  1127  melmklqemkeDQ------------------------ESVED-CSLQSGSEIIELASFRE  1231
             MEL +L    E++                        E  ED C +  G    E+ +F+E
Sbjct  257   MELFRLSRRAEERDGNAACSGDQSALHDDDDDDVGDGEYEEDCCEVADGLSKEEVVAFKE  316

Query  1232  MIINILSSGGFDDKRPSKlsheellhllslFNQSGISFH  1348
              I   L S G +++RPS+LS+++LL LL LF + G+ FH
Sbjct  317   RIAGALQSAGLNNERPSRLSNDDLLRLLRLFIKRGVRFH  355



>gb|ACO12988.1| Probable dimethyladenosine transferase [Lepeophtheirus salmonis]
Length=312

 Score =   234 bits (596),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 126/287 (44%), Positives = 175/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP V+DSIV +S +  TDTVLEIGPGTGNLT KL+   +RVI  E+D RMV  L
Sbjct  34    GQHILKNPAVVDSIVEESGLRSTDTVLEIGPGTGNLTAKLLEKVKRVIVCEVDPRMVAEL  93

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
              K         KL ++  DA+KT+ P FD+ VAN+PY ISSPL+ KL+     +R A L+
Sbjct  94    QKHFQHSSYKSKLDIIVGDAIKTDLPFFDVCVANVPYQISSPLVFKLLLHRPFFRVAVLM  153

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA+RL+A PGD  + RL++N +L++ V  ++ V K +F P PKV+SSVV+I PK  
Sbjct  154   FQREFAQRLIAPPGDKLYCRLSINTQLLSTVHHLLKVGKNNFRPPPKVESSVVRIEPKNP  213

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW   TR CF +KNKTLGA F              +  D+      SL+    
Sbjct  214   PPPINFKEWDGLTRICFVRKNKTLGAAF--------SQTPVLLTLDKSYRTHMSLKE-EM  264

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             + E  S +E+I+++L S  F +KRP  +  ++ + L+  FN  G+ F
Sbjct  265   LPEEFSIKELIVDVLESIDFSEKRPRTMDIDDFMKLMHAFNSVGVHF  311



>ref|XP_007141035.1| hypothetical protein PHAVU_008G161800g [Phaseolus vulgaris]
 gb|ESW13029.1| hypothetical protein PHAVU_008G161800g [Phaseolus vulgaris]
Length=349

 Score =   235 bits (599),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 145/329 (44%), Positives = 197/329 (60%), Gaps = 32/329 (10%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS V PTD VLEIGPGTGNLT KL+ AA++VIA+
Sbjct  20    QGGISFHKSKGQHILKNPLLVDSIVQKSGVKPTDVVLEIGPGTGNLTKKLLEAAKKVIAV  79

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV  L +R       ++L+V+  D L+TE P FD+ VANIPY ISSPL  KL+  
Sbjct  80    EIDPRMVLELQRRFQGTPHSNRLTVIQGDVLRTELPYFDICVANIPYQISSPLTFKLLNH  139

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
                +R+A ++ Q+EFA RL+A PGD  + RL VN +L A V  ++ V + +F P PKVDS
Sbjct  140   QPVFRAAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLHARVFHLLKVGRNNFRPPPKVDS  199

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESV  1174
             SVV+I P+    +V L EW  F R CF +KNKTLG+ F+QK ++  L K        E  
Sbjct  200   SVVRIEPRKPRIEVKLKEWDGFLRICFNRKNKTLGSIFRQKSVISLLEKNYRTVRALELG  259

Query  1175  EDCSLQSGSEIIELAS--------------------------------FREMIINILSSG  1258
             +  SL+      +LAS                                F++ ++ +L  G
Sbjct  260   QKDSLKEADTKTDLASFGDDQGMEMDDDEADDDEMEVEDGETDEVQSEFKDKVLGVLKEG  319

Query  1259  GFDDKRPSKlsheellhllslFNQSGISF  1345
              F++KR SKL+ +E L+LLSLFN++GI F
Sbjct  320   DFEEKRSSKLTLQEFLYLLSLFNKAGIHF  348



>emb|CDP18245.1| unnamed protein product [Coffea canephora]
Length=354

 Score =   235 bits (600),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 139/329 (42%), Positives = 197/329 (60%), Gaps = 32/329 (10%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSI+ KS + PTD +LEIGPGTGNLT KL+ A + VIA+
Sbjct  25    QGGIPFHKSKGQHILKNPLLIDSIIQKSGIKPTDVILEIGPGTGNLTKKLLEAGKSVIAV  84

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L +R        +L V+  D LK E P FD+ VANIPY ISSPL  KL+  
Sbjct  85    EVDPRMVLELQRRFQGTPFSSRLKVIQGDVLKCELPYFDICVANIPYQISSPLTFKLLSH  144

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
                +R A ++ Q+EFA RL+A PGD+ + RL+VN +L+A V  ++ V + +F P PKVDS
Sbjct  145   RPLFRCAVIMFQREFAMRLVAQPGDTLYCRLSVNTQLLARVSHLLKVGRNNFRPPPKVDS  204

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrl-----------lmelmk  1141
             SVV+I P+  +P VN  EW    R CF +KNKTLG+ F+QK +               + 
Sbjct  205   SVVRIEPRKPLPPVNFKEWDGLVRICFNRKNKTLGSIFRQKTVLSLLEKNYKTLQALQLS  264

Query  1142  lqemkeDQE----------SVEDCSL--QSGSEIIEL---------ASFREMIINILSSG  1258
              +   +D E          ++ED S+    G +  E+         + F+E ++N+L  G
Sbjct  265   HEGSSDDTEMALAVSALGDTLEDLSMDVDDGRDDEEMEVEDGNAKGSEFKEKVLNVLKQG  324

Query  1259  GFDDKRPSKlsheellhllslFNQSGISF  1345
              F+++R SKL+  E + LLSLFN++GI F
Sbjct  325   DFEERRSSKLTQTEFMFLLSLFNKAGIHF  353



>ref|XP_005847372.1| hypothetical protein CHLNCDRAFT_23464 [Chlorella variabilis]
 gb|EFN55270.1| hypothetical protein CHLNCDRAFT_23464 [Chlorella variabilis]
Length=312

 Score =   234 bits (596),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 132/296 (45%), Positives = 188/296 (64%), Gaps = 9/296 (3%)
 Frame = +2

Query  458   ANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIE  637
             A I   KS+GQH+L NP V+ SIV K+ +  TD VLEIGPGTGNLT+KL+  A++VIA+E
Sbjct  25    AGIEFHKSKGQHILKNPLVVQSIVDKAGIKSTDVVLEIGPGTGNLTMKLLERAKKVIAVE  84

Query  638   IDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGA  817
             +D RMV  L +R       ++L ++  D +K + P FD+ VANIPY ISSPL  KL+   
Sbjct  85    LDPRMVLELTRRVQGTPYQNQLQIIHGDVMKVQLPYFDICVANIPYQISSPLTFKLLAHR  144

Query  818   NAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSS  997
               +R+A ++ Q EFA RL+A PGD  ++RLAVN +L+A V  ++ V + +F P PKVDSS
Sbjct  145   PCFRAAVIMYQHEFAMRLVAKPGDPAYSRLAVNTQLLARVNHLLKVGRNNFRPPPKVDSS  204

Query  998   VVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVE  1177
             VV+I P+   P VNL EW    R CF +KNKTLGA F+Q   L  L +   + +      
Sbjct  205   VVRIEPRNPAPPVNLLEWDGLVRLCFGRKNKTLGAIFRQGNTLALLEQNYAVAQALHRAA  264

Query  1178  DCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             D     G E+  +A+    ++ +LS  GF ++R +K++ ++ L LL++FN +GI F
Sbjct  265   D-----GGEVDLVAA----VVEVLSGSGFLERRSAKMTQDDFLQLLAVFNTAGIHF  311



>gb|ABR16651.1| unknown [Picea sitchensis]
Length=346

 Score =   235 bits (599),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 140/332 (42%), Positives = 202/332 (61%), Gaps = 31/332 (9%)
 Frame = +2

Query  446   ENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERV  625
             +  +  I   KS+GQH+L NP ++ +IV K+ +  TD VLEIGPGTGNLT+KL+  A++V
Sbjct  15    QRHQGGIQFQKSKGQHILKNPMLVQTIVQKAGIKSTDIVLEIGPGTGNLTMKLLEVAKKV  74

Query  626   IAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKL  805
             IA+E+D RMV  L +R        +L V+  D LK+E P FD+ VANIPY ISSPL  KL
Sbjct  75    IAVELDPRMVLELQRRVQGTSSAIRLQVIQGDVLKSELPYFDVCVANIPYQISSPLTFKL  134

Query  806   VFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPK  985
             +     +R A ++ Q+EFA RL+A PGD+ + RL+VN +L+A V  ++ V K +F P PK
Sbjct  135   LSHRPIFRCAIIMFQREFAMRLVAKPGDNLYCRLSVNTQLLARVSHLLKVGKNNFRPPPK  194

Query  986   VDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr---------llmelm  1138
             VDSSVV+I P+  +P ++  EW    R CF +KNKTLGA F+QK             + +
Sbjct  195   VDSSVVRIEPRNPLPPISFKEWDGMVRLCFNRKNKTLGAIFRQKAILSLLEKNYKTFQAL  254

Query  1139  klqemkeDQESVEDCSLQSGSE---------------------IIELAS-FREMIINILS  1252
             +  + K ++ S  D S+   +                      + E AS F++ ++NIL 
Sbjct  255   QEAQQKSNESSFGDVSILGDTSNDVSMDIDAGEDQDMDVDDADMQEGASQFKDKVLNILK  314

Query  1253  SGGFDDKRPSKlsheellhllslFNQSGISFH  1348
              GGF+DKR SKL+ ++ L+LLSLFN++GI F+
Sbjct  315   EGGFEDKRSSKLAQDDFLYLLSLFNKAGIHFN  346



>gb|EMS47567.1| putative dimethyladenosine transferase [Triticum urartu]
Length=356

 Score =   234 bits (598),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 149/333 (45%), Positives = 205/333 (62%), Gaps = 36/333 (11%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLV-SAAERVIA  631
             +  I   KS+GQH+L NP ++DSI+ K+ + PTDTVLEIGPGTGNLT +L+ S  + V+A
Sbjct  23    QGGIPFEKSKGQHILRNPALVDSIIAKAGLKPTDTVLEIGPGTGNLTKRLLESGVKAVVA  82

Query  632   IEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVF  811
             +E+D RMV  L++R   H L  +L V+  D LK + P FD+ VANIPY ISSPL  KL+ 
Sbjct  83    VELDPRMVLELSRRFQGHPLSSRLKVIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLS  142

Query  812   GANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
                 +R A ++ Q+EFA RL+A PGD+ + RL+VNV+L++ V  ++ V + +F P PKVD
Sbjct  143   HRPIFRCAVIMFQREFAMRLVAQPGDTLYCRLSVNVQLLSRVSHLLKVGRNNFRPPPKVD  202

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeD---  1162
             SSVV+I P+  +P V+  EW    R CF +KNKTLG+ FKQKR+L  L K  +  +    
Sbjct  203   SSVVRIEPRKPLPPVSFKEWDGLVRICFNRKNKTLGSLFKQKRVLELLEKNYKTMQSLQL  262

Query  1163  -QES------------------VEDCSLQSGSEIIEL-------------ASFREMIINI  1246
              QES                  VED S+++  E  +              ASF+E I+ I
Sbjct  263   AQESEMGEEKMSPDDVAVLANMVEDLSVETNDEKEDDDMEMDDADAADGRASFKEKIMGI  322

Query  1247  LSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             L  G F +KR SKLS  + L+LLSLFN++GI F
Sbjct  323   LQQGDFAEKRSSKLSQVDFLYLLSLFNKAGIHF  355



>gb|KDP28252.1| hypothetical protein JCGZ_14023 [Jatropha curcas]
Length=352

 Score =   234 bits (597),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 140/330 (42%), Positives = 195/330 (59%), Gaps = 33/330 (10%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++D+IV KS +  TD +LEIGPGTGNLT KL+   + VIA+
Sbjct  22    QGGISFHKSKGQHILKNPLLVDTIVQKSGIKSTDVILEIGPGTGNLTKKLLEVGKMVIAV  81

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV  L +R       ++L V+  D LKT+ P FD+ VANIPY ISSPL  KL+  
Sbjct  82    EIDSRMVLELQRRFQGTPFSNRLKVIQGDVLKTDLPYFDICVANIPYQISSPLTFKLLNH  141

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               ++R A ++ Q+EFA RL+A PGD+ + RL+VN +L A V  ++ V K +F P PKVDS
Sbjct  142   QPSFRCAIIMFQREFAMRLVAQPGDTLYCRLSVNTQLYARVNHLLKVGKNNFRPPPKVDS  201

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESV  1174
             SVV+I P+  +P VN  EW  F R CF +KNKTLGA F+ K +L  L K  +  +  ++ 
Sbjct  202   SVVRIEPRKPLPKVNPKEWDGFIRICFIRKNKTLGAIFRMKNVLSMLEKNYKTLQAIQTS  261

Query  1175  EDCSLQS---------------------------------GSEIIELASFREMIINILSS  1255
             ++ SL+                                  G   +E++ F+E ++ +L  
Sbjct  262   QNGSLEGTDAQMDISGLGDHKEDHSMDLDNGTDDEMEVEDGDTDVEVSEFKEKVLAVLKE  321

Query  1256  GGFDDKRPSKlsheellhllslFNQSGISF  1345
               F +KR SKL+ EE L+LLS FN +GI F
Sbjct  322   RNFYEKRSSKLTQEEFLYLLSRFNMAGIHF  351



>ref|XP_003573385.1| PREDICTED: probable dimethyladenosine transferase [Brachypodium 
distachyon]
Length=354

 Score =   234 bits (597),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 146/327 (45%), Positives = 204/327 (62%), Gaps = 37/327 (11%)
 Frame = +2

Query  476   KSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAER-VIAIEIDKRM  652
             KS+GQH+L NP ++DSI+ K+ + PTDTVLEIGPGTGNLT +L+ A  + V+A+E+D RM
Sbjct  27    KSKGQHILKNPALVDSIIAKAGLKPTDTVLEIGPGTGNLTKRLLEAGVKAVVAVELDPRM  86

Query  653   VEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRS  832
             V  L++R   H L  +L V+  D LK + P FD+ VANIPY ISSPL  KL+     +R 
Sbjct  87    VLELSRRFQGHPLSSRLKVIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLSHRPIFRC  146

Query  833   ATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIH  1012
             A ++ Q+EFA RL+A PGD+ + RL+VNV+L++ V  ++ V + +F P PKVDSSVV+I 
Sbjct  147   AVIMFQREFAMRLVAQPGDTLYCRLSVNVQLLSRVSHLLKVGRNNFRPPPKVDSSVVRIE  206

Query  1013  PKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrll------melmklqemkeDQE--  1168
             P+  +P V+  EW    R CF +KNKTLGA FKQKR+L       + M+  ++ +D E  
Sbjct  207   PRKPLPPVSFKEWDGLVRVCFNRKNKTLGAIFKQKRVLELLEKNYKTMQSLQLAQDSEMG  266

Query  1169  --------------SVEDCSLQSGSEII--------------ELASFREMIINILSSGGF  1264
                            VED S+++  E                + ASF+E I+ IL  G F
Sbjct  267   EEKMSPGDVAVLANMVEDLSMETCDEKEDDEMEMDDADMVGDDRASFKEKIMGILQQGDF  326

Query  1265  DDKRPSKlsheellhllslFNQSGISF  1345
              +KR SKLS  + L+LLSLFN++G+ F
Sbjct  327   AEKRSSKLSQVDFLYLLSLFNKAGVHF  353



>ref|XP_006847974.1| hypothetical protein AMTR_s00029p00156590 [Amborella trichopoda]
 gb|ERN09555.1| hypothetical protein AMTR_s00029p00156590 [Amborella trichopoda]
Length=347

 Score =   234 bits (596),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 143/326 (44%), Positives = 199/326 (61%), Gaps = 30/326 (9%)
 Frame = +2

Query  458   ANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIE  637
               I   KS+GQH+L NP ++D IV K+ +  TD VLE+GPGTGNLT KL+   + V+A+E
Sbjct  21    TGIQFHKSKGQHILKNPLIVDRIVEKAGIKNTDVVLEVGPGTGNLTKKLLDVCKNVVAVE  80

Query  638   IDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGA  817
             +D RMV  L +R    G  D+L V+  D LK E P FD+ VANIPY ISSPL  KL+   
Sbjct  81    MDPRMVLELQRRFQGTGPSDRLKVIQGDVLKCELPYFDVCVANIPYQISSPLTFKLLSHR  140

Query  818   NAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSS  997
               +RSAT++ Q+EFA RL+A PGDS + RL+VN +L+A V  ++ V K +F P PKVDSS
Sbjct  141   PMFRSATIMFQREFAMRLVAKPGDSLYCRLSVNTQLLARVSHLLKVGKNNFRPPPKVDSS  200

Query  998   VVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeD-QESV  1174
             VV+I P+  +P V+  EW    R CF++KNKTLG+ F+QK +L  L K  +  +  QE +
Sbjct  201   VVRIEPRKPLPPVSFKEWDGLIRLCFSRKNKTLGSIFRQKSILSLLEKNFKTVQSLQEGM  260

Query  1175  EDCSL--------QSGSEIIEL---------------------ASFREMIINILSSGGFD  1267
              D S+         SG   +E+                     ++F++ ++ IL  G F+
Sbjct  261   ADVSIGDAAVLGDTSGDLSLEIDEAMRDDDDMEVEGDDMEAEASTFKDKVLGILREGDFE  320

Query  1268  DKRPSKlsheellhllslFNQSGISF  1345
              KR SKL+  + L+LLSLFN++GI F
Sbjct  321   AKRSSKLTQVDFLYLLSLFNRAGIHF  346



>gb|EYC18862.1| hypothetical protein Y032_0026g1411 [Ancylostoma ceylanicum]
Length=305

 Score =   232 bits (592),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/290 (45%), Positives = 181/290 (62%), Gaps = 9/290 (3%)
 Frame = +2

Query  482   RGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEI  661
             +GQH+L NP +++SIV KS +  TDTVLE+GPGTGNLT+K++  A++VIA EID RM+  
Sbjct  25    KGQHILKNPGIVNSIVDKSALKSTDTVLEVGPGTGNLTVKMLECAKKVIACEIDPRMIAE  84

Query  662   LNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATL  841
             L KR     L +KL V   D +K E+P FD+ VAN+PY ISSP + KL+      R A L
Sbjct  85    LKKRVLATPLQNKLEVRPGDVMKAEWPFFDVCVANLPYQISSPFVFKLLLHRPLPRYAVL  144

Query  842   LLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKA  1021
             + QKEFA RL+A PGD ++ RL+VNV+L+A VE +M + + +F P PKVDS+VV+I PK 
Sbjct  145   MFQKEFADRLIAKPGDKDYCRLSVNVQLLAKVEHLMKIKRTEFRPPPKVDSAVVRIAPKN  204

Query  1022  SIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGS  1201
               P +N +EW    R CF +KNKTL + F                 ++   + CSL +  
Sbjct  205   PPPPINFEEWEGMLRLCFLRKNKTLLSIF--------KQNNVAELIEKNYQKLCSLLNKP  256

Query  1202  EIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISFHG  1351
                +L   +++I + L+  GF DKR   +S E+ L LL  FN++GI FH 
Sbjct  257   VPKDL-DVKKLIEDTLTEAGFADKRARTMSIEQFLALLLAFNKAGIHFHS  305



>ref|NP_001089685.1| DIM1 dimethyladenosine transferase 1 homolog [Xenopus laevis]
 gb|AAI06333.1| MGC130862 protein [Xenopus laevis]
Length=306

 Score =   232 bits (591),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 183/313 (58%), Gaps = 19/313 (6%)
 Frame = +2

Query  422   DGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLK  601
             +   RR  E +   +      GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+K
Sbjct  7     EKKTRRHQEVKSQGVLFNTGLGQHILKNPLIVNSIIDKAAIRPTDVVLEVGPGTGNMTMK  66

Query  602   LVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGI  781
             L+  ++RVIA E+D R+V  L KR     +  KL V+  D LKT+ P FDL VAN+PY I
Sbjct  67    LLEKSKRVIACELDTRLVAELQKRVQGSAVASKLQVMVGDVLKTDLPFFDLCVANLPYQI  126

Query  782   SSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSK  961
             SSP + KL+     +R A L+ Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K
Sbjct  127   SSPFVFKLLLHRPFFRCAVLMFQREFAMRLVAKPGDKLYCRLSINTQLLARVDHLMKVGK  186

Query  962   RDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmk  1141
              +F P PKV+SSVV+I PK   P +N  EW    R  F +KNKTL A+FK   +      
Sbjct  187   NNFRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRIAFVRKNKTLAASFKSTAV------  240

Query  1142  lqemkeDQESVE-----DCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheell  1306
                    QE +E      CSL + S + E  S  E I  IL+  GF +KR   +  ++ +
Sbjct  241   -------QELLEKNYRIHCSLHNIS-VPENFSIAEKIEGILTETGFSEKRARSMDIDDFM  292

Query  1307  hllslFNQSGISF  1345
              LL  FN  GI F
Sbjct  293   ALLHGFNSQGIHF  305



>gb|AAI69134.1| hypothetical protein LOC779588 [Xenopus (Silurana) tropicalis]
Length=306

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 131/313 (42%), Positives = 182/313 (58%), Gaps = 19/313 (6%)
 Frame = +2

Query  422   DGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLK  601
             +   RR  E +   +      GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+K
Sbjct  7     EKKTRRHQEVKSQGVLFNTGLGQHILKNPLIVNSIIDKAAIRPTDVVLEVGPGTGNMTMK  66

Query  602   LVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGI  781
             L+  A+RV+A E+D R+V  L KR     +  KL V+  D LKT+ P FDL VAN+PY I
Sbjct  67    LLEKAKRVVACELDTRLVAELQKRVQGSAVASKLQVMVGDVLKTDLPFFDLCVANLPYQI  126

Query  782   SSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSK  961
             SSP + KL+     +R A L+ Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K
Sbjct  127   SSPFVFKLLLHRPFFRCAVLMFQREFALRLVAKPGDKLYCRLSINTQLLARVDHIMKVGK  186

Query  962   RDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmk  1141
              +F P PKV+SSVV+I PK   P +N  EW    R  F +KNKTL A FK   +      
Sbjct  187   NNFRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRIAFVRKNKTLAAAFKSTAV------  240

Query  1142  lqemkeDQESVE-----DCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheell  1306
                    QE +E      CSL + S + E  S  E I  +L+  GF +KR   +  ++ +
Sbjct  241   -------QELLEKNYKIHCSLHNIS-VPENFSIAEKIEGVLTETGFSEKRARSMDIDDFM  292

Query  1307  hllslFNQSGISF  1345
              LL  FN  GI F
Sbjct  293   ALLHGFNSQGIHF  305



>gb|AAI23078.1| LOC779588 protein [Xenopus (Silurana) tropicalis]
Length=304

 Score =   232 bits (591),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 131/313 (42%), Positives = 182/313 (58%), Gaps = 19/313 (6%)
 Frame = +2

Query  422   DGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLK  601
             +   RR  E +   +      GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+K
Sbjct  5     EKKTRRHQEVKSQGVLFNTGLGQHILKNPLIVNSIIDKAAIRPTDVVLEVGPGTGNMTMK  64

Query  602   LVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGI  781
             L+  A+RV+A E+D R+V  L KR     +  KL V+  D LKT+ P FDL VAN+PY I
Sbjct  65    LLEKAKRVVACELDTRLVAELQKRVQGSAVASKLQVMVGDVLKTDLPFFDLCVANLPYQI  124

Query  782   SSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSK  961
             SSP + KL+     +R A L+ Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K
Sbjct  125   SSPFVFKLLLHRPFFRCAVLMFQREFALRLVAKPGDKLYCRLSINTQLLARVDHIMKVGK  184

Query  962   RDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmk  1141
              +F P PKV+SSVV+I PK   P +N  EW    R  F +KNKTL A FK   +      
Sbjct  185   NNFRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRIAFVRKNKTLAAAFKSTAV------  238

Query  1142  lqemkeDQESVE-----DCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheell  1306
                    QE +E      CSL + S + E  S  E I  +L+  GF +KR   +  ++ +
Sbjct  239   -------QELLEKNYKIHCSLHNIS-VPENFSIAEKIEGVLTETGFSEKRARSMDIDDFM  290

Query  1307  hllslFNQSGISF  1345
              LL  FN  GI F
Sbjct  291   ALLHGFNSQGIHF  303



>ref|NP_001116194.1| DIM1 dimethyladenosine transferase 1 homolog [Xenopus (Silurana) 
tropicalis]
 gb|AAI60444.1| LOC779588 protein [Xenopus (Silurana) tropicalis]
Length=306

 Score =   231 bits (590),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 131/313 (42%), Positives = 182/313 (58%), Gaps = 19/313 (6%)
 Frame = +2

Query  422   DGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLK  601
             +   RR  E +   +      GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+K
Sbjct  7     EKKTRRHQEVKSQGVLFNTVLGQHILKNPLIVNSIIDKAAIRPTDVVLEVGPGTGNMTMK  66

Query  602   LVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGI  781
             L+  A+RV+A E+D R+V  L KR     +  KL V+  D LKT+ P FDL VAN+PY I
Sbjct  67    LLEKAKRVVACELDTRLVAELQKRVQGSAVASKLQVMVGDVLKTDLPFFDLCVANLPYQI  126

Query  782   SSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSK  961
             SSP + KL+     +R A L+ Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K
Sbjct  127   SSPFVFKLLLHRPFFRCAVLMFQREFALRLVAKPGDKLYCRLSINTQLLARVDHIMKVGK  186

Query  962   RDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmk  1141
              +F P PKV+SSVV+I PK   P +N  EW    R  F +KNKTL A FK   +      
Sbjct  187   NNFRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRIAFVRKNKTLAAAFKSTAV------  240

Query  1142  lqemkeDQESVE-----DCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheell  1306
                    QE +E      CSL + S + E  S  E I  +L+  GF +KR   +  ++ +
Sbjct  241   -------QELLEKNYKIHCSLHNIS-VPENFSIAEKIEGVLTETGFSEKRARSMDIDDFM  292

Query  1307  hllslFNQSGISF  1345
              LL  FN  GI F
Sbjct  293   ALLHGFNSQGIHF  305



>ref|XP_009408036.1| PREDICTED: probable dimethyladenosine transferase [Musa acuminata 
subsp. malaccensis]
Length=357

 Score =   233 bits (594),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 140/329 (43%), Positives = 201/329 (61%), Gaps = 39/329 (12%)
 Frame = +2

Query  476   KSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMV  655
             KS+GQH+L NP+++++IV KS + PTD VLEIGPGTGNLT KL+  A+ V+A+E+D RMV
Sbjct  28    KSKGQHILKNPKLVETIVQKSGIKPTDVVLEIGPGTGNLTKKLLEVAKSVVAVELDPRMV  87

Query  656   EILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSA  835
               LN+R        +L V+  D LK E P FD+ VANIPY ISSPL  KL+    A+R A
Sbjct  88    LELNRRFQGTPHSSRLKVIQGDVLKCELPYFDICVANIPYQISSPLTFKLLAHHPAFRCA  147

Query  836   TLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHP  1015
              ++ Q+EFA RL+ANPGD+ + RL+VN +L+A V  ++ V + +F P PKVDSSVV+I P
Sbjct  148   VIMFQREFAMRLVANPGDNLYCRLSVNTQLLARVSHLLKVGRNNFRPPPKVDSSVVRIEP  207

Query  1016  KASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr------------llmelmklqemke  1159
             +  +P V+  EW    R CF +KNKTLG+ F+QK               ++L + ++M+E
Sbjct  208   RRPLPPVSFKEWDGLMRLCFNRKNKTLGSIFRQKSVLSLLEKNYKTLQALQLTRKEQMEE  267

Query  1160  DQESVEDCSLQSG---------------------------SEIIELASFREMIINILSSG  1258
             D+ S ED ++ +                             E+ E +SF++ ++ +L  G
Sbjct  268   DKVSSEDVAVLANMVEDLGMGNNSDEKDDEEMEVEDTDMVGEVSEGSSFKDKVLGVLRQG  327

Query  1259  GFDDKRPSKlsheellhllslFNQSGISF  1345
              F +KR +KL+  + L LLSLFN+ GI F
Sbjct  328   DFAEKRAAKLTQVDFLCLLSLFNKEGIHF  356



>ref|XP_007201224.1| hypothetical protein PRUPE_ppa008081mg [Prunus persica]
 gb|EMJ02423.1| hypothetical protein PRUPE_ppa008081mg [Prunus persica]
Length=346

 Score =   232 bits (592),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 139/326 (43%), Positives = 193/326 (59%), Gaps = 29/326 (9%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS +  TD +LEIGPGTGNLT KL+   +RVIA+
Sbjct  20    QGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVILEIGPGTGNLTKKLLEVGKRVIAV  79

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV  L +R     L  +L V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  80    EIDARMVLELQRRFQGTPLSSRLQVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLKH  139

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R A ++ Q+EFA RL+A PGD  + RL VN +L++ V  ++ V + +F P PKVDS
Sbjct  140   QPAFRCAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLLSRVSHLLKVGRNNFRPPPKVDS  199

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrl-------lmelmklqem  1153
             SVV+I P+    +VN  EW  F R CF +KNKTLG+ F+QK +          L  L   
Sbjct  200   SVVRIEPRKPPFEVNQKEWDGFLRICFNRKNKTLGSIFRQKSVINLLEKNYKTLQALNLA  259

Query  1154  keDQESVEDCS----------------------LQSGSEIIELASFREMIINILSSGGFD  1267
                Q ++ED +                      ++ G+   E++ F++ ++++L   GF+
Sbjct  260   PAQQGALEDTNDVMDFSDEDIEMNDDGVDDGMEVEDGNAEGEVSEFKKKVLSVLMKAGFE  319

Query  1268  DKRPSKlsheellhllslFNQSGISF  1345
              +R SKL  ++ L LLS FN+ GI F
Sbjct  320   GERSSKLKLQQFLDLLSEFNKDGIHF  345



>emb|CDX95724.1| BnaC03g26050D [Brassica napus]
Length=342

 Score =   232 bits (592),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 154/233 (66%), Gaps = 5/233 (2%)
 Frame = +2

Query  425   GNVRRKIENQEANIY-----LLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGN  589
             G +R++     +N Y       KS+GQH+L NP ++DSIV K+ +  TD +LEIGPGTGN
Sbjct  4     GKIRKEKPKAPSNHYQGGISFHKSKGQHILKNPLLVDSIVQKAGIKSTDVILEIGPGTGN  63

Query  590   LTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANI  769
             LT KL+ A + VIA+E+D RMV  L +R       ++L V+  D LKTE PRFD+ VANI
Sbjct  64    LTKKLLEAGKEVIAVELDSRMVLELQRRFQGTPYSNRLKVIQGDVLKTELPRFDICVANI  123

Query  770   PYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVM  949
             PY ISSPL  KL+F   ++R A ++ Q+EFA R +A PGD+ + RL+VN +L A V  ++
Sbjct  124   PYQISSPLTFKLLFHPTSFRCAVIMYQREFAMRHVAQPGDNLYCRLSVNTQLYARVSHLL  183

Query  950   DVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
              V K +F P PKVDSSVV+I P+   P VN  EW  F R CF +KNKTLG+ F
Sbjct  184   KVGKNNFRPPPKVDSSVVRIEPRKPQPQVNKKEWDGFLRVCFIRKNKTLGSIF  236



>ref|XP_006660422.1| PREDICTED: probable dimethyladenosine transferase-like [Oryza 
brachyantha]
Length=357

 Score =   233 bits (593),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 147/330 (45%), Positives = 199/330 (60%), Gaps = 40/330 (12%)
 Frame = +2

Query  476   KSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAER-VIAIEIDKRM  652
             KS+GQH+L NP ++DSIV K+ + PTDTVLEIGPGTGNLT +L+ A  + V+A+E+D RM
Sbjct  27    KSKGQHILRNPALVDSIVDKAGLKPTDTVLEIGPGTGNLTKRLLQAGVKAVVAVELDPRM  86

Query  653   VEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRS  832
             V  LN+R     L  +L ++  D LK + P FD+ VANIPY ISSPL  KL+     +R 
Sbjct  87    VLELNRRFQGDPLSSRLKIIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLSHRPIFRC  146

Query  833   ATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIH  1012
             A ++ Q+EFA RL+A PGDS + RL+VNV+L++ V  ++ V + +F P PKVDSSVV+I 
Sbjct  147   AVIMFQREFAMRLVAQPGDSLYCRLSVNVQLLSRVSHLLKVGRNNFRPPPKVDSSVVRIE  206

Query  1013  PKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQE--------  1168
             P+  +P V+  EW    R CF +KNKTLGA FKQKR+L  L K  +  +  +        
Sbjct  207   PRKPLPPVSFKEWDGLVRLCFNRKNKTLGAMFKQKRVLELLEKNYKTMQSLQLTSGAETA  266

Query  1169  --------------SVEDCSLQSGSE-----------------IIELASFREMIINILSS  1255
                            V+D +L++G E                     ASF+E I  IL  
Sbjct  267   EEKMSADDVALLSNMVDDLNLETGYENDDDDDDEMEMDDADMAAESRASFKEKITGILQQ  326

Query  1256  GGFDDKRPSKlsheellhllslFNQSGISF  1345
             G F +KR SKLS  + L+LLSLFN++GI F
Sbjct  327   GDFAEKRASKLSQVDFLYLLSLFNKAGIHF  356



>ref|XP_006661664.1| PREDICTED: probable dimethyladenosine transferase-like, partial 
[Oryza brachyantha]
Length=341

 Score =   232 bits (591),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 147/327 (45%), Positives = 203/327 (62%), Gaps = 37/327 (11%)
 Frame = +2

Query  476   KSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAER-VIAIEIDKRM  652
             KS+GQH+L NP ++DSIV K+ + PTDTVLEIGPGTGNLT +L+ A  + V+A+E+D RM
Sbjct  14    KSKGQHILRNPALVDSIVEKAGLKPTDTVLEIGPGTGNLTKRLLQAGVKAVVAVELDPRM  73

Query  653   VEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRS  832
             V  LN+R     L  +L ++  D LK + P FD+ VANIPY ISSPL  KL+     +R 
Sbjct  74    VLELNRRFQGDPLSSRLKIIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLSHRPIFRC  133

Query  833   ATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIH  1012
             A ++ Q+EFA RL+A PGDS + RL+VNV+L++ V  ++ V + +F P PKVDSSVV+I 
Sbjct  134   AVIMFQREFAMRLVAQPGDSLYCRLSVNVQLLSRVSHLLKVGRNNFRPPPKVDSSVVRIE  193

Query  1013  PKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrll------melmklqemkeDQES-  1171
             P+  +P V+  +W    R CF +KNKTLGA FKQKR+L       + M+  ++  D E  
Sbjct  194   PRKPLPPVSFKQWDGLVRLCFNRKNKTLGAIFKQKRVLELLEKNYKTMQSLQLTSDTEKG  253

Query  1172  --------------VEDCSLQSGSEIIEL---------------ASFREMIINILSSGGF  1264
                           V+D +L++G E  +                ASF+E I+ IL  G F
Sbjct  254   EKLSADDVALLSDMVDDLNLETGYENDDDDEMEMDDADMVAESRASFKEKIMGILQQGDF  313

Query  1265  DDKRPSKlsheellhllslFNQSGISF  1345
              +KR SKLS  + L+LLSLFN++GI F
Sbjct  314   AEKRASKLSQVDFLYLLSLFNKAGIHF  340



>gb|KFM23756.1| putative dimethyladenosine transferase [Auxenochlorella protothecoides]
Length=317

 Score =   231 bits (588),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 133/303 (44%), Positives = 185/303 (61%), Gaps = 2/303 (1%)
 Frame = +2

Query  437   RKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAA  616
             +K+    + I   KS+GQH+L NP V+ SIV KS +  TD VLEIGPGTGNLT+KL+  A
Sbjct  16    KKVAKGFSGIEFHKSKGQHILKNPLVVQSIVDKSGLKSTDVVLEIGPGTGNLTMKLLEKA  75

Query  617   ERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLL  796
             +RV+A+E+D RMV  L +R A       L ++  D +K + P FD+ VANIPY ISSPL 
Sbjct  76    KRVVAVELDPRMVLELQRRVAGTPHSASLQIIHGDVMKVDLPYFDVCVANIPYQISSPLT  135

Query  797   AKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLP  976
              KL+    A+R+A ++ Q EFA RL+A PGD  ++RL VN +L++ V  ++ V K +F P
Sbjct  136   FKLLSHRPAFRAAVIMYQHEFAMRLVARPGDPLYSRLTVNTQLLSRVHHLLKVGKNNFRP  195

Query  977   CPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemk  1156
              PKVDSSVV+I P+   P +N  EW    R CF +KNKTL A F+Q   L +L +   + 
Sbjct  196   PPKVDSSVVRIEPRNPPPPINFLEWDGLIRLCFGRKNKTLSALFRQSTTLHQLEENYLLS  255

Query  1157  eDQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSG  1336
                        +      E   F++ ++ +L  GGF D R +KLS +E L LL+ FN++G
Sbjct  256   NALAKAAQPRRKKRGRASE--EFKQKVLGVLQGGGFSDWRAAKLSQDEFLALLAAFNRAG  313

Query  1337  ISF  1345
             I F
Sbjct  314   IHF  316



>gb|EYU45154.1| hypothetical protein MIMGU_mgv1a009179mg [Erythranthe guttata]
Length=350

 Score =   231 bits (590),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 146/352 (41%), Positives = 203/352 (58%), Gaps = 40/352 (11%)
 Frame = +2

Query  395   GGRSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIG  574
             GG+   E+  G       + +  I   KS+GQH+L NP ++DSIV KS +  TD +LEIG
Sbjct  3     GGKFKKEKPPGGA-----HFQGGIPFHKSKGQHILKNPLLVDSIVQKSGIKSTDIILEIG  57

Query  575   PGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDL  754
             PGTGNLT KL+ A + VIA+E+D RMV  L +R        +L V+  D LK + P FD+
Sbjct  58    PGTGNLTKKLLEAGKSVIAVELDPRMVLELQRRFQGTPFSSRLKVIQGDVLKCDLPYFDI  117

Query  755   MVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAD  934
              VANIPY ISSPL  KL+     +R A ++ Q+EFA RL+A PGDS + RL+VN +L++ 
Sbjct  118   CVANIPYQISSPLTFKLLAHRPLFRCAVIMFQREFAMRLVAQPGDSLYCRLSVNTQLLSR  177

Query  935   VEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkq  1114
             V  ++ V + +F P PKVDSSVV+I P+  +P VN  EW    R CF +KNKTLGA F+Q
Sbjct  178   VNHLLKVGRNNFRPPPKVDSSVVRIEPRKPLPPVNFKEWDGLVRICFNRKNKTLGALFRQ  237

Query  1115  krllmelmklqemkeD-QESVEDCSLQSGSEIIELA------------------------  1219
             K +L  L K  +  +  Q + ED S  +   +   A                        
Sbjct  238   KTVLNMLEKNYKTLQALQLTPEDFSADAEMAVCVSALGDTLGDMNMDKDEDEDDDEDEEM  297

Query  1220  ----------SFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
                       +F+E ++++L  GGF+DKR SKL+  + +HLLSLFN++GI F
Sbjct  298   EIDDKDAKSNAFKEKVLSVLKLGGFEDKRSSKLAQADFMHLLSLFNKAGIHF  349



>ref|XP_007153382.1| hypothetical protein PHAVU_003G030300g [Phaseolus vulgaris]
 gb|ESW25376.1| hypothetical protein PHAVU_003G030300g [Phaseolus vulgaris]
Length=349

 Score =   231 bits (589),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 143/329 (43%), Positives = 194/329 (59%), Gaps = 32/329 (10%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS + PTD VLEIGPGTGNLT KL+ AA++VIA+
Sbjct  20    QGGISFHKSKGQHILKNPLLVDSIVQKSGLKPTDVVLEIGPGTGNLTKKLLEAAKKVIAV  79

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV  L +R       ++L+V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  80    EIDPRMVLELQRRFQGTAHSNRLTVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLNH  139

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
                +R+A ++ Q+EFA RL+A P D  + RL VN +L A V  ++ V + +F P PKVDS
Sbjct  140   QPVFRAAIIMFQREFAMRLVAQPDDKLYCRLTVNTQLHARVSHLLKVGRNNFRPPPKVDS  199

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESV  1174
             SVV+I P+    +V   EW  F R CF +KNKTLG+ F+QK ++  L K        E  
Sbjct  200   SVVRIEPRKPRIEVKQKEWDGFLRICFNRKNKTLGSIFRQKSVISLLEKNYRTVRALELG  259

Query  1175  EDCSLQSGSEIIELASFRE--------------------------------MIINILSSG  1258
             +  SL+     ++ ASF E                                 ++ +L  G
Sbjct  260   QKDSLKEADTKMDFASFGEDQGMEMDDDEADDNEMEVEDGEADDVQSEFKNKVLGVLKEG  319

Query  1259  GFDDKRPSKlsheellhllslFNQSGISF  1345
              F++KR SKL+ +E L+LLSLFN++GI F
Sbjct  320   DFEEKRSSKLTLQEFLYLLSLFNKAGIHF  348



>ref|XP_008235202.1| PREDICTED: probable dimethyladenosine transferase [Prunus mume]
Length=346

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 137/326 (42%), Positives = 193/326 (59%), Gaps = 29/326 (9%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS +  TD +LEIGPGTGNLT KL+   +RVIA+
Sbjct  20    QGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVILEIGPGTGNLTKKLLEVGKRVIAV  79

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV  L +R     L  +L V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  80    EIDARMVLELQRRFQGTPLSSRLQVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLKH  139

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R A ++ Q+EFA RL+A PGD  + RL VN +L++ V  ++ V + +F P PKVDS
Sbjct  140   QPAFRCAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLLSRVSHLLKVGRNNFRPPPKVDS  199

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrl-------lmelmklqem  1153
             SVV++ P+    +VN +EW  F R CF +KNKTLG+ F+QK +          L  L   
Sbjct  200   SVVRLEPRKPPFEVNQNEWDGFLRICFNRKNKTLGSIFRQKSVINLLEKNYKTLQALNLA  259

Query  1154  keDQESVEDC----------------------SLQSGSEIIELASFREMIINILSSGGFD  1267
                Q ++ED                        ++ G+   E++ F++ ++++L   GF+
Sbjct  260   PAQQGALEDIDDVMDFSDEDIEMNDDGVDDGMEVEDGNAEGEVSEFKKKVLSVLMKAGFE  319

Query  1268  DKRPSKlsheellhllslFNQSGISF  1345
              +R SKL  ++ L LLS FN+ G+ F
Sbjct  320   GERSSKLKLQQFLDLLSEFNKDGVHF  345



>ref|XP_003400619.1| PREDICTED: probable dimethyladenosine transferase-like [Bombus 
terrestris]
Length=306

 Score =   229 bits (584),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 130/312 (42%), Positives = 182/312 (58%), Gaps = 11/312 (4%)
 Frame = +2

Query  410   HEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGN  589
             H +    + +++  Q   I    + GQH+L NP V+ S+V K+ V PTD VLEIGPGTGN
Sbjct  5     HTQKTTRIHKEVAKQ--GILFNTNIGQHILKNPLVIQSMVEKAAVRPTDVVLEIGPGTGN  62

Query  590   LTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANI  769
             +T+KL+  A++VIA E+D RMV  L KR        KL ++  D LKT+ P FDL VANI
Sbjct  63    MTVKLLDKAKKVIACELDARMVAELQKRVQGTIYQSKLQIMIGDVLKTDLPFFDLCVANI  122

Query  770   PYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVM  949
             PY ISSPL+ KL+     +R A L+ Q+EFA RL+A PGD  + RL++N +L+A V+ +M
Sbjct  123   PYQISSPLVFKLLLHRPLFRCAVLMFQREFAERLVAKPGDKLYCRLSINTQLLARVDLLM  182

Query  950   DVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllm  1129
              V K +F P PKV+S+VV+I P+   P +N  EW   TR  F +KNKTL A F       
Sbjct  183   KVGKNNFRPPPKVESNVVRIEPRNPPPPINYQEWDGLTRIAFVRKNKTLSAAF-------  235

Query  1130  elmklqemkeDQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellh  1309
                       ++     CSL +  EI E  + +EMI +IL     ++KR   +  ++ + 
Sbjct  236   -KQTTVLTMLEKNYKLHCSL-NNKEIPEGFNIKEMINDILQKADAENKRARTMDIDDFIS  293

Query  1310  llslFNQSGISF  1345
             LL  FN  G+ F
Sbjct  294   LLHAFNAQGVHF  305



>ref|XP_002680934.1| predicted protein [Naegleria gruberi]
 gb|EFC48190.1| predicted protein [Naegleria gruberi]
Length=308

 Score =   229 bits (583),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 133/310 (43%), Positives = 191/310 (62%), Gaps = 14/310 (5%)
 Frame = +2

Query  434   RRKIENQEAN------IYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLT  595
             R+ ++N +A       I   KS GQH+L NP V+D ++ K+ + PTDTVLEIGPGTGN+T
Sbjct  6     RQHLKNSQATAGRTQGIQFQKSFGQHILINPGVIDHVIEKACIQPTDTVLEIGPGTGNMT  65

Query  596   LKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPY  775
             +KL+  A++VIAIE+D RMV  L KR     L  KL ++ +DALK E P FDL +AN+PY
Sbjct  66    VKLLQKAKKVIAIEVDPRMVVELKKRVQGTALESKLQIIHKDALKVELPYFDLCIANLPY  125

Query  776   GISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDV  955
              ISSP+  KL+    ++R A L+ Q+EFA+RL+A PGD+ + RL+VN +L+A  + V+ V
Sbjct  126   QISSPITFKLLAHQPSFRVAYLMYQREFAQRLVAKPGDNLYCRLSVNTQLLARCDHVVKV  185

Query  956   SKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmel  1135
             SK  F P PKV+SS+V+I PK   P +N  EW    R  F ++NK LG+ FK K+LL  L
Sbjct  186   SKNSFRPPPKVESSIVRIEPKNPPPPINFLEWDGLARILFQRRNKQLGSVFKNKKLLKLL  245

Query  1136  mklqemkeDQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhll  1315
              +  +  E ++ V     +           R++I   L      DKRP K+  +++L LL
Sbjct  246   GENYKQTETKKKVNMNEYEQ--------KVRDIIAETLEELQMTDKRPCKMDQDDILSLL  297

Query  1316  slFNQSGISF  1345
             +  N+ G+ F
Sbjct  298   TRLNEQGVHF  307



>ref|NP_001064257.1| Os10g0183900 [Oryza sativa Japonica Group]
 gb|ABG65951.1| dimethyladenosine transferase, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26171.1| Os10g0183900 [Oryza sativa Japonica Group]
 dbj|BAG94264.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC66655.1| hypothetical protein OsI_32926 [Oryza sativa Indica Group]
Length=364

 Score =   231 bits (588),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 148/335 (44%), Positives = 204/335 (61%), Gaps = 38/335 (11%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAER-VIA  631
             +  I   KS+GQH+L NP ++DSIV K+ + PTDTVLEIGPGTGNLT +L+ A  + V+A
Sbjct  29    QGGIPFEKSKGQHILRNPALVDSIVEKAGLKPTDTVLEIGPGTGNLTKRLLQAGVKAVVA  88

Query  632   IEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVF  811
             +E+D RMV  LN+R     L  +L V+  D LK + P FD+ VANIPY ISSPL  KL+ 
Sbjct  89    VELDPRMVLELNRRFQGDPLASRLKVIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLS  148

Query  812   GANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
                 +R A ++ Q+EFA RL+A PGDS + RL+VNV+L++ V  ++ V + +F P PKVD
Sbjct  149   HRPIFRCAVIMFQREFAMRLVAQPGDSLYCRLSVNVQLLSRVSHLLKVGRNNFRPPPKVD  208

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrll------melmklqem  1153
             SSVV+I P+  +P V+  EW    R CF +KNKTLGA FKQKR+L       + M+  ++
Sbjct  209   SSVVRIEPRKPLPPVSFKEWDGLVRLCFNRKNKTLGAIFKQKRVLELLEKNYKTMQSLQL  268

Query  1154  keDQES----------------VEDCSLQSG--------------SEIIE-LASFREMII  1240
               D E                 V+D +++S                 ++E  A F+E I+
Sbjct  269   TSDAEKGEEKMSPDDVALLSSMVDDMNMESSYENDDDDEMEMDDADMVVESRACFKEKIM  328

Query  1241  NILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
              IL  G F +KR SKLS  + L+LLSLFN++GI F
Sbjct  329   GILQQGDFAEKRASKLSQVDFLYLLSLFNKAGIHF  363



>ref|XP_006492328.1| PREDICTED: probable dimethyladenosine transferase-like [Citrus 
sinensis]
Length=359

 Score =   230 bits (587),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 142/334 (43%), Positives = 196/334 (59%), Gaps = 39/334 (12%)
 Frame = +2

Query  458   ANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIE  637
               I   KS+GQH+L NP +++SIV K+ +  TD +LEIGPGTGNLT KL+ A + VIA+E
Sbjct  26    GGISFHKSKGQHILKNPLLVESIVQKAGIKSTDVILEIGPGTGNLTKKLLEAGKMVIAVE  85

Query  638   IDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGA  817
             +D RMV  L +R       ++L V+  D LKT+ P FD+ VANIPY ISSPL  KL+F  
Sbjct  86    LDSRMVLELQRRFQSTPYSNRLKVIQGDVLKTDLPYFDICVANIPYQISSPLTFKLLFHQ  145

Query  818   NAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSS  997
              A+R A ++ QKEFA RL+A PGD  + RL+VN +L A V  ++ V K +F P PKVDSS
Sbjct  146   PAFRCAIIMFQKEFAMRLVAQPGDKLYCRLSVNTQLHARVSHLLKVGKNNFRPPPKVDSS  205

Query  998   VVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVE  1177
             VV+I P+   P VN  EW  F R CF +KNKTL + F+ K +L  L K     +  +S +
Sbjct  206   VVRIEPRKPRPQVNPVEWDGFLRICFIRKNKTLSSIFRLKNVLSMLEKNYRTLQALQSSQ  265

Query  1178  DCSLQSGSEI--------------------------------------IELASFREMIIN  1243
             + SL   +EI                                       E++ F++ ++ 
Sbjct  266   NSSL-GNTEIGMDTPSLGDSNGDQSMGVDDGSDDEMDVEDDDGDSDVEGEVSEFKDKVLA  324

Query  1244  ILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             +L  G F++KR SKL+ +E L+LLSLFN++GI F
Sbjct  325   VLREGQFEEKRASKLTQQEFLYLLSLFNKAGIHF  358



>gb|KDO87006.1| hypothetical protein CISIN_1g018261mg [Citrus sinensis]
Length=359

 Score =   230 bits (587),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 142/334 (43%), Positives = 196/334 (59%), Gaps = 39/334 (12%)
 Frame = +2

Query  458   ANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIE  637
               I   KS+GQH+L NP +++SIV K+ +  TD +LEIGPGTGNLT KL+ A + VIA+E
Sbjct  26    GGISFHKSKGQHILKNPLLVESIVQKAGIKSTDVILEIGPGTGNLTKKLLEAGKMVIAVE  85

Query  638   IDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGA  817
             +D RMV  L +R       ++L V+  D LKT+ P FD+ VANIPY ISSPL  KL+F  
Sbjct  86    LDSRMVLELQRRFQSTPYSNRLKVIQGDVLKTDLPYFDICVANIPYQISSPLTFKLLFHQ  145

Query  818   NAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSS  997
              A+R A ++ QKEFA RL+A PGD  + RL+VN +L A V  ++ V K +F P PKVDSS
Sbjct  146   PAFRCAIIMFQKEFAMRLVAQPGDKLYCRLSVNTQLHARVSHLLKVGKNNFRPPPKVDSS  205

Query  998   VVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVE  1177
             VV+I P+   P VN  EW  F R CF +KNKTL + F+ K +L  L K     +  +S +
Sbjct  206   VVRIEPRKPRPQVNPVEWDGFLRICFIRKNKTLSSIFRLKNVLSMLEKNYRTLQALQSSQ  265

Query  1178  DCSLQSGSEI--------------------------------------IELASFREMIIN  1243
             + SL   +EI                                       E++ F++ ++ 
Sbjct  266   NSSL-GNTEIGTDTPSLGDSNGDQSMGVDDGSDDEMDVEDDDGDSDVEGEVSEFKDKVLA  324

Query  1244  ILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             +L  G F++KR SKL+ +E L+LLSLFN++GI F
Sbjct  325   VLREGQFEEKRASKLTQQEFLYLLSLFNKAGIHF  358



>ref|XP_011084280.1| PREDICTED: probable dimethyladenosine transferase [Sesamum indicum]
Length=355

 Score =   230 bits (586),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 139/330 (42%), Positives = 193/330 (58%), Gaps = 33/330 (10%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSI+ KS +  TD +LEIGPGTGNLT KL+ A + VIA+
Sbjct  25    QGGIPFHKSKGQHILKNPLLVDSIIQKSGIKSTDIILEIGPGTGNLTKKLLEAGKSVIAV  84

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L +R        +L V+  D LK + P FD+ VANIPY ISSPL  KL+  
Sbjct  85    ELDPRMVLELERRFQGTPYSSRLKVIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLSH  144

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
                +R A ++ Q+EFA RL+A PGD+ + RL+VN +L+A V  ++ V + +F P PKVDS
Sbjct  145   RPLFRCAVIMFQREFAMRLVAQPGDTLYCRLSVNTQLLARVNHLLKVGRNNFRPPPKVDS  204

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr----------llmelmkl  1144
             SVV+I P+  +P VN  EW    R CF +KNKTLG+ F+QK            L  L   
Sbjct  205   SVVRIEPRKPLPPVNFKEWDGLVRICFNRKNKTLGSLFRQKTVLSLLEKNYKTLQALQLT  264

Query  1145  qemkeDQESVEDCSLQSGSEIIEL-----------------------ASFREMIINILSS  1255
              E   D + +  C    G  + +L                       + F++ ++++L  
Sbjct  265   SEGFSDDKEMAMCVTALGDTLGDLSMDADEGKDDDEDMEMDDGETKASDFKDKVLDVLKL  324

Query  1256  GGFDDKRPSKlsheellhllslFNQSGISF  1345
             GGF+DKR SKLS  + +HLLSLFN++GI F
Sbjct  325   GGFEDKRASKLSQADFMHLLSLFNKAGIHF  354



>ref|XP_002529134.1| dimethyladenosine transferase, putative [Ricinus communis]
 gb|EEF33247.1| dimethyladenosine transferase, putative [Ricinus communis]
Length=350

 Score =   230 bits (586),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 140/330 (42%), Positives = 198/330 (60%), Gaps = 31/330 (9%)
 Frame = +2

Query  449   NQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVI  628
             + +  I   KS+GQH+L NP ++D+IV KS +  TD +LEIGPGTGNLT KL+ A + VI
Sbjct  20    HYQGGISFHKSKGQHILKNPLLVDTIVEKSGIKSTDVILEIGPGTGNLTKKLLEAGKMVI  79

Query  629   AIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLV  808
             A+E+D RMV  L +R     + ++L V+  D LKT+ P FD+ VANIPY ISSPL  KL+
Sbjct  80    AVELDPRMVLELQRRFQGTPMSNRLKVIQGDVLKTDLPYFDICVANIPYQISSPLTFKLL  139

Query  809   FGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKV  988
                 ++R A ++ Q+EFA RL+A PGD+ + RL+VN +L A V  ++ V K +F P PKV
Sbjct  140   NHQPSFRCAIIMFQREFAMRLVAQPGDTLYCRLSVNTQLYARVSHLLKVGKNNFRPPPKV  199

Query  989   DSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQE  1168
             DSSVV+I P+   P VN  EW  F R CF +KNKTLG+ F+ K +L  L K  +  +   
Sbjct  200   DSSVVRIEPRKPRPQVNAKEWDGFIRICFIRKNKTLGSIFRIKNVLSLLEKNYKTLQALH  259

Query  1169  SVEDCSLQ-----------------------SGSEI-IE-------LASFREMIINILSS  1255
             S ++ S +                       SG E+ +E       ++ F+E ++ +L  
Sbjct  260   SSQNASYEAADMDISGLGDCKEDQSMELDDGSGDEMEVEDGDADSGMSEFKEKVLAVLKE  319

Query  1256  GGFDDKRPSKlsheellhllslFNQSGISF  1345
               F ++R SKL+ EE L+LLS FN +GI F
Sbjct  320   RNFYERRSSKLTQEEFLYLLSRFNMAGIHF  349



>ref|XP_002602632.1| hypothetical protein BRAFLDRAFT_225323 [Branchiostoma floridae]
 gb|EEN58644.1| hypothetical protein BRAFLDRAFT_225323 [Branchiostoma floridae]
Length=306

 Score =   228 bits (582),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 130/305 (43%), Positives = 181/305 (59%), Gaps = 9/305 (3%)
 Frame = +2

Query  434   RRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSA  613
             R   E Q+  I   K  GQH+L NP V+DS+V K+ + PTDTVLEIGPGTGNLT+K++  
Sbjct  11    RTHQEVQKQGIGFNKQFGQHILKNPLVVDSMVEKAALRPTDTVLEIGPGTGNLTMKMIDR  70

Query  614   AERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPL  793
              ++VIA EID R+V  L KR        KL ++  DALKT+ P FD+ VANIPY ISSPL
Sbjct  71    VKKVIACEIDPRLVAELQKRVQGTPSAHKLQMMVGDALKTDLPFFDICVANIPYQISSPL  130

Query  794   LAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFL  973
             + KL+     +R A L+ Q+EFA+RL+A PGD  + RL++NV+L+A V+ +M + + +F 
Sbjct  131   VFKLLLHRPFFRCAILMFQREFAQRLVAPPGDKLYCRLSLNVQLLARVDHLMKIGRNNFR  190

Query  974   PCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqem  1153
             P PKV+SSVV++ PK   P +N  EW    R  F +KNKTLGA F               
Sbjct  191   PPPKVESSVVRLEPKNPPPPINFQEWDGMVRIAFLRKNKTLGAAF--------KNSKVLS  242

Query  1154  keDQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQS  1333
               ++     CS  +   I E    ++ + +IL +   D KR   +  ++ L +L  FN S
Sbjct  243   LLEKNYRIHCSF-NNIPISEDFDMKQKVTDILETNSLDKKRARSMDIDDFLGVLHAFNSS  301

Query  1334  GISFH  1348
             GI F+
Sbjct  302   GIHFN  306



>ref|XP_005107724.1| PREDICTED: probable dimethyladenosine transferase-like [Aplysia 
californica]
Length=309

 Score =   228 bits (581),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 122/299 (41%), Positives = 184/299 (62%), Gaps = 9/299 (3%)
 Frame = +2

Query  452   QEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIA  631
             Q   I      GQH+L NP ++ S+V K+ + PTD VLE+GPGTGN+T++L+   ++V+A
Sbjct  20    QRQGISFRTEIGQHILKNPMIVTSMVEKAALRPTDVVLEVGPGTGNMTVRLLEKVKKVVA  79

Query  632   IEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVF  811
              E+D RMV  ++KR        KL V+  D LKTE P FD+ VAN+PY ISSP   KL+ 
Sbjct  80    CEVDPRMVAEIHKRVQGTPEAPKLQVMVGDVLKTELPFFDVCVANLPYQISSPFTFKLLL  139

Query  812   GANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
                 +RSA L+ Q+EFA+RL+A PGD  + RL+VN +L+A V+ +M V K +F P PKV+
Sbjct  140   HRPFFRSAVLMFQREFAQRLVAQPGDKLYCRLSVNTQLLARVDHLMKVGKNNFRPPPKVE  199

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQES  1171
             SSVV+I P+   P +N  EW    R CF++KNKT+GA+F                 ++  
Sbjct  200   SSVVRIEPRNPPPPINFKEWDGLIRICFSRKNKTIGASF--------KFSKVLEILEKNY  251

Query  1172  VEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISFH  1348
                CS+++   + E  + ++ ++ +L  GGF++KR   +S ++ + LL+LFN++G  F 
Sbjct  252   RVSCSVRN-IPVPEDFNVKDRVVELLQKGGFEEKRARSMSIDDFIELLNLFNEAGFHFQ  309



>ref|XP_003570045.1| PREDICTED: probable dimethyladenosine transferase [Brachypodium 
distachyon]
Length=355

 Score =   229 bits (585),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 144/334 (43%), Positives = 203/334 (61%), Gaps = 37/334 (11%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAER-VIA  631
             +  I   KS+GQH+L NP ++DSI+ K+ + PTDTVLEIGPGTGNLT +L+ A  + V+A
Sbjct  21    QGGIPFEKSKGQHILKNPALVDSIIAKAGLKPTDTVLEIGPGTGNLTKRLLEAGVKAVVA  80

Query  632   IEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVF  811
             +E+D RMV  L++R   H L  ++ V+  D LK + P FD+ VANIPY ISSPL  KL+ 
Sbjct  81    VELDPRMVLELSRRFQGHPLLAQMQVIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLS  140

Query  812   GANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
                 +R A ++ Q+EFA RL+A PGD+ + RL+VNV+L++ V  ++ V + +F P PKVD
Sbjct  141   HPPIFRCAVIMFQREFAMRLVAQPGDTLYCRLSVNVQLLSRVSHLLKVGRNNFRPPPKVD  200

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrll------melmklqem  1153
             SSVV+I P+  +P V+  EW    R CF +KNKTLGA FKQKR+L       + M+  ++
Sbjct  201   SSVVRIEPRKPLPPVSFKEWDGLVRVCFNRKNKTLGAIFKQKRVLELLEKNYKTMQSLQL  260

Query  1154  keDQE----------------SVEDCSLQSGSEIIEL--------------ASFREMIIN  1243
              +D E                 VED S+++  E  +               AS +E I+ 
Sbjct  261   AQDSEMGEEKMSPDDVAVLANMVEDLSMETCDEKEDDEMEMDDADMAGDGRASLKEKIMG  320

Query  1244  ILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
              L  G F DKR SKLS  + L+ LSLFN++G+ F
Sbjct  321   TLQQGDFADKRSSKLSQVDFLYSLSLFNKAGVHF  354



>ref|XP_004300457.1| PREDICTED: probable dimethyladenosine transferase-like [Fragaria 
vesca subsp. vesca]
Length=343

 Score =   229 bits (584),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 137/325 (42%), Positives = 196/325 (60%), Gaps = 33/325 (10%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS + PTD +LEIGPGTGNLT KL+ A ++VIA+
Sbjct  23    QGGISFHKSKGQHILKNPLLVDSIVQKSGIKPTDVILEIGPGTGNLTKKLLEAGKKVIAV  82

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV  L +R     L ++L ++  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  83    EIDARMVLELQRRFQGTPLSNRLQIIQGDVLKTELPYFDICVANIPYQISSPLTFKLLHH  142

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R A ++ QKEFA RL+A PGD  + RL VN + +A V  ++ V + +F P PKVDS
Sbjct  143   KPAFRCAIIMFQKEFAMRLIAQPGDKLYCRLTVNTQRLAQVSHLLKVGRNNFRPPPKVDS  202

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemke-----  1159
             SVV+I P+    +VN  EW  F R CF +KNKTLG+ F+QK++L  L K  +  +     
Sbjct  203   SVVRIEPRKQF-EVNEKEWDGFLRICFNRKNKTLGSIFRQKKVLSLLEKNYKTLQALNLN  261

Query  1160  -DQESVEDCSLQSGSEII----------------------ELASFREMIINILSSGGFDD  1270
              DQ+     +++  ++++                      E + F+E ++ +L    F++
Sbjct  262   PDQQG----AMEETNDVMQFEDMEMDDDEADDEMEVEEGGETSEFKEKVLKVLKDNDFEN  317

Query  1271  KRPSKlsheellhllslFNQSGISF  1345
             +R SKL   E + LL+ F ++GI F
Sbjct  318   ERSSKLKLREFVTLLAEFCKAGIHF  342



>emb|CDJ87454.1| Ribosomal RNA adenine methylase transferase domain containing 
protein [Haemonchus contortus]
Length=305

 Score =   228 bits (580),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 127/290 (44%), Positives = 181/290 (62%), Gaps = 9/290 (3%)
 Frame = +2

Query  482   RGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEI  661
             +GQH+L NP +++SI+ KS +  TDTVLE+GPGTGNLT+K++  A++V+A EID RMV  
Sbjct  25    KGQHILKNPGIVNSIIEKSALKSTDTVLEVGPGTGNLTVKMLEVAKKVVAYEIDPRMVAE  84

Query  662   LNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATL  841
             L KR     L +KL V   D +K E+P FD+ VAN+PY ISSP + KL+      R A L
Sbjct  85    LKKRVMATPLQNKLEVRHGDVMKAEWPFFDVCVANLPYQISSPFVFKLLLQRPLPRYAVL  144

Query  842   LLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKA  1021
             + QKEFA RL+A PGD ++ RL+VNV+L+A VE +M + + +F P PKVDS+V++I PK 
Sbjct  145   MFQKEFADRLIAKPGDKDYCRLSVNVQLLARVEHLMKIKRTEFRPPPKVDSAVIRIAPKN  204

Query  1022  SIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGS  1201
               P +N DEW    R CF +KNK L + F         +       ++   + CSL +  
Sbjct  205   PPPPINFDEWEGMLRLCFLRKNKKLLSIF--------KLNNVTELIEKNHQKLCSLLNKP  256

Query  1202  EIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISFHG  1351
              I +  + +++I + L   GF +KR   +S E+ L LL  FN++GI FH 
Sbjct  257   -IPKDFNVKKLIEDTLVEAGFAEKRARSMSIEQFLALLLAFNKAGIHFHS  305



>ref|XP_003493975.1| PREDICTED: probable dimethyladenosine transferase-like [Bombus 
impatiens]
Length=306

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 127/287 (44%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP V+ S+V K+ V PTD VLEIGPGTGN+T+KL+  A++VIA E+D RMV  L
Sbjct  28    GQHILKNPLVIQSMVEKAAVRPTDVVLEIGPGTGNMTVKLLDKAKKVIACELDVRMVAEL  87

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
              KR        KL ++  D LKT+ P FDL VANIPY ISSPL+ KL+     +R A L+
Sbjct  88    QKRVQGTIYQSKLQIMIGDVLKTDLPFFDLCVANIPYQISSPLVFKLLLHRPLFRCAVLM  147

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+S+VV+I P+  
Sbjct  148   FQREFAERLVAKPGDKLYCRLSINTQLLARVDLLMKVGKNNFRPPPKVESNVVRIEPRNP  207

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW   TR  F +KNKTL A F                 ++     CSL +  E
Sbjct  208   PPPINYQEWDGLTRIAFVRKNKTLSAAF--------KQTTVLTMLEKNYKLHCSL-NNKE  258

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  + +EMI +IL     ++KR   +  ++ + LL  FN  G+ F
Sbjct  259   IPEGFNIKEMINDILQIADAENKRARTMDIDDFISLLHAFNAQGVHF  305



>gb|AGT79993.1| dimethyladenosine transferase [Aphis gossypii]
Length=303

 Score =   227 bits (579),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 179/295 (61%), Gaps = 9/295 (3%)
 Frame = +2

Query  464   IYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEID  643
             I   K  GQH+L NP ++  +V KS +LPTDTVLEIGPGTGNLT+KL+   + V+A EID
Sbjct  18    IMFKKDFGQHILKNPLIIQGMVEKSALLPTDTVLEIGPGTGNLTVKLLERVKTVVACEID  77

Query  644   KRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANA  823
              R+V  L KR       +KL +   D LK+E P F++ VANIPY ISSPL+ KL+     
Sbjct  78    VRLVAELKKRVMNTPYQNKLQIRVGDVLKSELPFFNVCVANIPYQISSPLVFKLLLHRPF  137

Query  824   YRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVV  1003
             +R A L+ Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+S+VV
Sbjct  138   FRCAVLMFQREFAYRLVAKPGDKLYCRLSINTQLLARVDLIMKVGKNNFRPPPKVESNVV  197

Query  1004  KIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDC  1183
             +I P+   P +N  EW   TR  F++KNKTLGA F              +  ++     C
Sbjct  198   RIEPRNPPPPINFKEWDGLTRIAFSRKNKTLGAIF--------KQNAVAVTLEKNYRVYC  249

Query  1184  SLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISFH  1348
             SL++  EI E    ++ + ++L+   F +KR  K+  +E + LL  FN+ GI F 
Sbjct  250   SLKN-QEIAEDFDIKQKLDDVLNKNDFCEKRARKMDIDEFIELLLAFNKEGIHFQ  303



>gb|ACO10705.1| Probable dimethyladenosine transferase [Caligus rogercresseyi]
Length=313

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 127/287 (44%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP ++DSI+ KS + PTDTVLEIGPGTGNLT KL+   +RVI IE+D RMV  +
Sbjct  35    GQHILKNPAIVDSIIDKSGLRPTDTVLEIGPGTGNLTAKLLQVVKRVIVIEVDPRMVSEI  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
              KR        KL ++  DA+KT+ P FD+ VAN+PY ISSPL+ KL+     +R+A L+
Sbjct  95    QKRFQHSPHRPKLEILVGDAIKTDLPFFDVCVANVPYQISSPLVFKLLIHRPFFRAAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  F RL++N +L++ V  ++ V + +F P PKV+SSVV+I  K  
Sbjct  155   FQREFALRLIAPPGDKLFCRLSINTQLLSTVHHLLKVGRNNFRPPPKVESSVVRIEHKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW   TR CF +KNKTLGA F              M  D+      SL+    
Sbjct  215   PPPINFKEWDGLTRICFVRKNKTLGAAF--------SQTPVLMTLDKNYRTHLSLKE-EM  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             + E  S +++I  +L S  F +KR   +  ++ + LL  FN  GI F
Sbjct  266   VPEEFSIKDLIEEVLESIDFKEKRGRTMDIDDFMKLLHAFNAKGIHF  312



>ref|XP_004230304.1| PREDICTED: probable dimethyladenosine transferase [Solanum lycopersicum]
Length=354

 Score =   229 bits (583),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 138/329 (42%), Positives = 190/329 (58%), Gaps = 32/329 (10%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS +  TD +LEIGPGTGNLT KL+ A + VIA+
Sbjct  25    QGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVILEIGPGTGNLTKKLLEAGKSVIAV  84

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L +R     L ++L V+  D LK + P FD+ VANIPY ISSPL  KL+  
Sbjct  85    ELDPRMVLELQRRFQGTPLSNRLKVIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLAH  144

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
                +R+A ++ Q+EFA RL+A PGD+ + RL+VN +L+A V  ++ V K +F P PKVDS
Sbjct  145   RPLFRAAVIMFQREFAMRLVAQPGDTLYCRLSVNTQLLARVSHLLKVGKNNFRPPPKVDS  204

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqk-----------rllmelmk  1141
             SVV+I P+  +  VN  EW    R CF +KNKT+G+ F+QK            L      
Sbjct  205   SVVRIEPRGPLTPVNFKEWDGLVRICFNRKNKTIGSIFRQKSVLNILEKNYRTLQALQFS  264

Query  1142  lqemkeDQESVEDCSLQSGS---------------------EIIELASFREMIINILSSG  1258
              +    D E   D S    S                        + A F+E ++ +L  G
Sbjct  265   EKAPSNDMEMALDVSTLGESFGDLSMDADDGNDDDDIEMDDGDTKRAEFKERVLAVLKEG  324

Query  1259  GFDDKRPSKlsheellhllslFNQSGISF  1345
              F++KR SKL+  + +HLLSLFN++GI F
Sbjct  325   NFEEKRSSKLAQADFMHLLSLFNKAGIHF  353



>gb|ACO14626.1| Probable dimethyladenosine transferase [Caligus clemensi]
Length=313

 Score =   227 bits (579),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 126/289 (44%), Positives = 171/289 (59%), Gaps = 9/289 (3%)
 Frame = +2

Query  479   SRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVE  658
             S GQH+L NP V+DSI+ KS + PTDTVLEIGPGTGNLT KL+   +RVI  E+D RMV 
Sbjct  33    SLGQHILKNPAVVDSIIEKSGLRPTDTVLEIGPGTGNLTAKLLDKVKRVIVCEVDPRMVA  92

Query  659   ILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSAT  838
              L KR        KL ++  DA+KTE P FD+ VAN+PY ISSPL+ KL+     +R A 
Sbjct  93    ELQKRFQHSPFKPKLEILVGDAIKTELPFFDVCVANVPYQISSPLVFKLLLHRPFFRCAV  152

Query  839   LLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPK  1018
             L+ Q+EFA RL+A PGD  + RL++N +L++ V  ++ V + +F P PKV+SSVV+I  K
Sbjct  153   LMFQREFAMRLIAAPGDKLYCRLSINTQLLSTVHHLLKVGRNNFRPPPKVESSVVRIEHK  212

Query  1019  ASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSG  1198
                P +N  EW   TR CF +KNKTLGA F              +  D+      SL   
Sbjct  213   NPPPPINFKEWDGLTRICFVRKNKTLGAAF--------SQTPVLLTLDKNYRTHLSLNE-  263

Query  1199  SEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
               + E  S +++I  +L S  F +KR   +  ++ + L   FN  G+ F
Sbjct  264   EMVPEDFSIKKLIEEVLDSIDFKEKRARTMDIDDFMKLQHAFNSKGVHF  312



>ref|XP_006344757.1| PREDICTED: probable dimethyladenosine transferase-like [Solanum 
tuberosum]
Length=354

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 138/329 (42%), Positives = 191/329 (58%), Gaps = 32/329 (10%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS +  TD +LEIGPGTGNLT KL+ A + VIA+
Sbjct  25    QGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVILEIGPGTGNLTKKLLEAGKSVIAV  84

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L +R     L ++L V+  D LK + P FD+ VANIPY ISSPL  KL+  
Sbjct  85    ELDPRMVLELQRRFQGTPLSNRLKVIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLAH  144

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
                +R+A ++ Q+EFA RL+A PGD+ + RL+VN +L+A V  ++ V K +F P PKVDS
Sbjct  145   RPLFRAAVIMFQREFAMRLVAQPGDTLYCRLSVNTQLLARVSHLLKVGKNNFRPPPKVDS  204

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqk-----------rllmelmk  1141
             SVV+I P+  +  VN  EW    R CF +KNKT+G+ F+QK            L      
Sbjct  205   SVVRIEPRGPLTPVNFKEWDGLVRICFNRKNKTIGSIFRQKSVLNILEKNYRTLQALQFS  264

Query  1142  lqemkeDQESVEDCSLQSGS---------------------EIIELASFREMIINILSSG  1258
              +   +D E   D S    S                        + A F+E ++ +L  G
Sbjct  265   EKAPSDDMEMALDVSTLGESFGDLSMDADDGNDDDDIEMDDGDTKRAEFKEKVLAVLKEG  324

Query  1259  GFDDKRPSKlsheellhllslFNQSGISF  1345
              F++KR SKL+  + +HLLSLFN++GI F
Sbjct  325   NFEEKRSSKLAQADFMHLLSLFNKAGIHF  353



>ref|XP_006444487.1| hypothetical protein CICLE_v10020794mg [Citrus clementina]
 gb|ESR57727.1| hypothetical protein CICLE_v10020794mg [Citrus clementina]
Length=359

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 141/334 (42%), Positives = 195/334 (58%), Gaps = 39/334 (12%)
 Frame = +2

Query  458   ANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIE  637
               I   KS+GQH+L NP +++SIV K+ +  TD +LEIGPGTGNLT KL+   + VIA+E
Sbjct  26    GGISFHKSKGQHILKNPLLVESIVQKAGIKSTDVILEIGPGTGNLTKKLLEVGKMVIAVE  85

Query  638   IDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGA  817
             +D RMV  L +R       ++L V+  D LKT+ P FD+ VANIPY ISSPL  KL+F  
Sbjct  86    LDSRMVLELQRRFQSTPYSNRLKVIQGDVLKTDLPYFDICVANIPYQISSPLTFKLLFHQ  145

Query  818   NAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSS  997
              A+R A ++ QKEFA RL+A PGD  + RL+VN +L A V  ++ V K +F P PKVDSS
Sbjct  146   PAFRCAIIMFQKEFAMRLVAQPGDKLYCRLSVNTQLHARVSHLLKVGKNNFRPPPKVDSS  205

Query  998   VVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVE  1177
             VV+I P+   P VN  EW  F R CF +KNKTL + F+ K +L  L K     +  +S +
Sbjct  206   VVRIEPRKPRPQVNPVEWDGFLRICFIRKNKTLSSIFRLKNVLSMLEKNYRTLQALQSSQ  265

Query  1178  DCSLQSGSEI--------------------------------------IELASFREMIIN  1243
             + SL   +EI                                       E++ F++ ++ 
Sbjct  266   NSSL-GNTEIGTDTPSLGDSNGDQSMGVDDGSDDEMDVEDDDGDSDVEGEVSEFKDKVLA  324

Query  1244  ILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             +L  G F++KR SKL+ +E L+LLSLFN++GI F
Sbjct  325   VLREGQFEEKRASKLTQQEFLYLLSLFNKAGIHF  358



>ref|XP_006564915.1| PREDICTED: probable dimethyladenosine transferase-like [Apis 
mellifera]
Length=306

 Score =   227 bits (578),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 172/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP V+ S+V K+ V PTD VLEIGPGTGN+T+KL+  A++VIA E+D RMV  L
Sbjct  28    GQHILKNPLVIQSMVEKAAVRPTDVVLEIGPGTGNMTIKLLDKAKKVIACELDTRMVAEL  87

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
              KR        KL ++  D LKT+ P FDL VANIPY ISSPL+ KL+     +R A L+
Sbjct  88    QKRVQGTAYQSKLQIMIGDVLKTDLPFFDLCVANIPYQISSPLVFKLLLHRPMFRCAILM  147

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+S+VV+I P+  
Sbjct  148   FQREFAERLVAKPGDKLYCRLSINTQLLARVDLLMKVGKNNFRPPPKVESNVVRIEPRNP  207

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW   TR  F +KNKTL A F                 ++     CSL +   
Sbjct  208   PPPINYQEWDGLTRIAFVRKNKTLSAAF--------KQTTVLTMLEKNYKLHCSL-NNKI  258

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  + ++MI +IL     ++KR   +  ++ + LL  FN  G+ F
Sbjct  259   ITEGFNIKDMISDILQKADAENKRARTMDIDDFISLLHAFNAKGVHF  305



>ref|XP_002320304.1| hypothetical protein POPTR_0014s11630g [Populus trichocarpa]
 gb|EEE98619.1| hypothetical protein POPTR_0014s11630g [Populus trichocarpa]
Length=353

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 153/238 (64%), Gaps = 0/238 (0%)
 Frame = +2

Query  395   GGRSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIG  574
             GG+   E+          + +  I   KS+GQH+L NP ++DSIV KS +  TD VLEIG
Sbjct  3     GGKIRKEKPSSRGAPSSNHYQGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVVLEIG  62

Query  575   PGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDL  754
             PGTGNLT KL+ A + V+AIE+D RMV  L +R       ++L V+  D LKT+ P FD+
Sbjct  63    PGTGNLTKKLLEAGKMVVAIELDPRMVLELQRRFQGTAFSNRLKVIQGDVLKTDLPYFDI  122

Query  755   MVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAD  934
              VANIPY ISSPL  KL+    ++R A ++ Q+EFA RL+A PGD+ + RL+VN +L A 
Sbjct  123   CVANIPYQISSPLTFKLLNHQPSFRCAIIMFQREFAMRLVAQPGDTLYCRLSVNTQLYAR  182

Query  935   VEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             V  ++ V K +F P PKVDSSVV+I P+   P VN  EW  F R CF +KNKTLG+ F
Sbjct  183   VSHLLKVGKNNFRPPPKVDSSVVRIEPRKPRPQVNPKEWDGFIRICFIRKNKTLGSIF  240



>ref|XP_003598143.1| Dimethyladenosine transferase [Medicago truncatula]
 gb|AES68394.1| dimethyladenosine transferase [Medicago truncatula]
Length=351

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 140/331 (42%), Positives = 197/331 (60%), Gaps = 35/331 (11%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++D+IV KS +  TD VLEIGPGTGNLT KL+ A ++VIA+
Sbjct  21    QGGISFHKSKGQHILKNPLLVDTIVQKSGIKTTDVVLEIGPGTGNLTKKLLEAGKKVIAV  80

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV  LNKR  +     +L+V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  81    EIDPRMVLELNKRF-QGTPSSRLTVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLKH  139

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R A ++ Q+EFA RL+A PGD  + RL VN +L A +  ++ V + +F P PKVDS
Sbjct  140   QPAFRCAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLHARISHLLKVGRNNFRPPPKVDS  199

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESV  1174
             SVV+I PK    +VN  EW  F R CF +KNKTLGA F+QK ++  L K  +  +  +  
Sbjct  200   SVVRIEPKKPRHEVNQKEWDGFLRICFNRKNKTLGAIFRQKNVISMLEKNYKTVQALKLS  259

Query  1175  EDCSLQSGSEIIELAS----------------------------------FREMIINILS  1252
             ++  L+     ++ ++                                  F++ ++ +L 
Sbjct  260   QEGLLKEADTKVDFSNFADFVDDQGMEMDDDGVDDNDEDEMDVEDGGPSEFKDKVLGVLK  319

Query  1253  SGGFDDKRPSKlsheellhllslFNQSGISF  1345
              G +++KR SKL+  E ++LLSLFN+SGI F
Sbjct  320   EGDYEEKRSSKLTLLEFIYLLSLFNKSGIHF  350



>ref|XP_002953877.1| hypothetical protein VOLCADRAFT_106150 [Volvox carteri f. nagariensis]
 gb|EFJ44906.1| hypothetical protein VOLCADRAFT_106150 [Volvox carteri f. nagariensis]
Length=384

 Score =   229 bits (584),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 154/233 (66%), Gaps = 5/233 (2%)
 Frame = +2

Query  425   GNVRRKIENQEAN-----IYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGN  589
             G +++K   +E N     +   KS+GQH+L NP V+ +IV K+ V  TD VLEIGPGTGN
Sbjct  15    GGIQKKTNRKEGNTGVSGLEFHKSKGQHILKNPLVVQAIVDKAGVKSTDVVLEIGPGTGN  74

Query  590   LTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANI  769
             LT+KL+  A++VIAIE+D RMV  L +R       + L ++  D ++ E P FDL VANI
Sbjct  75    LTVKLLEKAKKVIAIELDPRMVLELQRRVQGTAYANNLQIIHGDFMRVELPYFDLCVANI  134

Query  770   PYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVM  949
             PY ISSPL  KL+    A+R+A ++ Q EFA RL+A PGD  ++RLAVN +L+A V  ++
Sbjct  135   PYNISSPLTFKLLAHRPAFRAAVIMYQHEFAMRLVAKPGDQLYSRLAVNTQLLARVSHLL  194

Query  950   DVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
              V K +F P PKVDSSVV+I P+   P VN  EW    R CF++KNKTLGA F
Sbjct  195   KVGKNNFRPPPKVDSSVVRIEPRHPPPPVNFLEWDGLVRLCFSRKNKTLGAIF  247



>gb|KHN44950.1| Putative dimethyladenosine transferase [Glycine soja]
Length=352

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 140/330 (42%), Positives = 197/330 (60%), Gaps = 32/330 (10%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV K+ V  TD +LEIGPGTGNLT KL+ A ++VIA+
Sbjct  23    QGGISFHKSKGQHILKNPLLVDSIVEKAGVKSTDVILEIGPGTGNLTKKLLEAGKKVIAV  82

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV  L +R       ++L+V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  83    EIDPRMVLELQRRFQGTPHSNRLTVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLKH  142

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R+A ++ Q+EFA RL+A PGD  + RL VN +L A V  ++ V + +F P PKVDS
Sbjct  143   EPAFRAAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLHARVFHLLKVGRNNFRPPPKVDS  202

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESV  1174
             SVV+I P+    +V   EW  F R CF +KNKTLG+ F+QK ++  L K        E  
Sbjct  203   SVVRIEPRKPRIEVKQKEWDGFLRICFNRKNKTLGSIFRQKSVISLLEKNYRTVRALELG  262

Query  1175  EDCSLQSGSEIIELAS--------------------------------FREMIINILSSG  1258
             ++ SL+     ++ +S                                F++ ++ +L  G
Sbjct  263   QEDSLKEVDAKMDFSSFGDDQGMEMDDDGADDDEMEVEDGEAEEVQSEFKDKVLGVLKEG  322

Query  1259  GFDDKRPSKlsheellhllslFNQSGISFH  1348
              F++KR SKL+ +E L+LLSLFN++GI F+
Sbjct  323   DFEEKRSSKLTLQEFLYLLSLFNKTGIHFY  352



>ref|XP_003542423.1| PREDICTED: probable dimethyladenosine transferase-like [Glycine 
max]
Length=352

 Score =   228 bits (580),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 140/330 (42%), Positives = 197/330 (60%), Gaps = 32/330 (10%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV K+ V  TD +LEIGPGTGNLT KL+ A ++VIA+
Sbjct  23    QGGISFHKSKGQHILKNPLLVDSIVEKAGVKSTDVILEIGPGTGNLTKKLLEAGKKVIAV  82

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV  L +R       ++L+V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  83    EIDPRMVLELQRRFQGTPHSNRLTVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLKH  142

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R+A ++ Q+EFA RL+A PGD  + RL VN +L A V  ++ V + +F P PKVDS
Sbjct  143   EPAFRAAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLHARVFHLLKVGRNNFRPPPKVDS  202

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESV  1174
             SVV+I P+    +V   EW  F R CF +KNKTLG+ F+QK ++  L K        E  
Sbjct  203   SVVRIEPRKPRIEVKQKEWDGFLRICFNRKNKTLGSIFRQKSVISLLEKNYRTVRALELG  262

Query  1175  EDCSLQSGSEIIELAS--------------------------------FREMIINILSSG  1258
             ++ SL+     ++ +S                                F++ ++ +L  G
Sbjct  263   QEDSLKEVDAKMDFSSFGDDRGMEMDDDGADDDEMEVEDGEADEVQSEFKDKVLGVLKEG  322

Query  1259  GFDDKRPSKlsheellhllslFNQSGISFH  1348
              F++KR SKL+ +E L+LLSLFN++GI F+
Sbjct  323   DFEEKRSSKLTLQEFLYLLSLFNKTGIHFY  352



>ref|XP_004583791.1| PREDICTED: probable dimethyladenosine transferase [Ochotona princeps]
Length=308

 Score =   226 bits (576),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 129/304 (42%), Positives = 182/304 (60%), Gaps = 10/304 (3%)
 Frame = +2

Query  434   RRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSA  613
             RR+++N    +   K  GQH+L NP V++SI+ K+ + PTD VLE+GPGTGN+T+KL+  
Sbjct  14    RRELKN-AGGLMFNKGIGQHILKNPLVVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEK  72

Query  614   AERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPL  793
             A++VIA E+D R+V  L+KR     +  KL V+  D LKT+ P FD  VAN+PY ISSP 
Sbjct  73    AKKVIACELDPRLVAELHKRVQGTPMASKLQVMVGDVLKTDLPFFDACVANLPYQISSPF  132

Query  794   LAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFL  973
             + KL+     +R A L+ Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F 
Sbjct  133   VFKLLLHRPFFRCAVLMFQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFR  192

Query  974   PCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqem  1153
             P PKV+SSVV+I PK   P +N  EW    R  F +KNKTL A F             + 
Sbjct  193   PPPKVESSVVRIEPKNPPPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQ  244

Query  1154  keDQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQS  1333
               ++     CS+ +   I E  S  + I  IL+S GF DKR   +  ++ + LL  FN+ 
Sbjct  245   LLEKNYRIHCSMHN-IIIPEDFSIADKIQQILTSTGFSDKRARTMDIDDFIRLLHGFNEE  303

Query  1334  GISF  1345
             GI F
Sbjct  304   GIHF  307



>ref|XP_011073653.1| PREDICTED: probable dimethyladenosine transferase [Sesamum indicum]
Length=356

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 136/330 (41%), Positives = 194/330 (59%), Gaps = 33/330 (10%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSI+ KS +  TD +LEIGPGTGNLT KL+ A + VIA+
Sbjct  26    QGGIPFHKSKGQHILKNPLLVDSIIQKSGIKSTDVILEIGPGTGNLTKKLLEAGKSVIAV  85

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L +R        +L V+  D LK + P FD+ VANIPY ISSPL  KL+  
Sbjct  86    ELDPRMVLELQRRFQGTPYSSRLKVIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLSH  145

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
                +R A ++ Q+EFA RL+A PGD+ + RL+VN +L+A V  ++ V + +F P PKVDS
Sbjct  146   RPLFRCAVIMFQREFAMRLVAQPGDTLYCRLSVNTQLLARVNHLLKVGRNNFRPPPKVDS  205

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr----------llmelmkl  1144
             SVV+I P+  +P +N  EW    R CF +KNKTLG+ F+QK            L  L   
Sbjct  206   SVVRIEPRKPLPPMNFKEWDGLVRICFNRKNKTLGSLFRQKTVLSLLEKNYKTLQALQLT  265

Query  1145  qemkeDQESVEDCSLQSGSEIIEL-----------------------ASFREMIINILSS  1255
              E   D + +  C    G  + +L                       ++F++ ++++L  
Sbjct  266   SEEFSDDKEMAMCVSALGDTLGDLSMDADEGKDDDEDMEMDDGETKASNFKDKVLSVLKL  325

Query  1256  GGFDDKRPSKlsheellhllslFNQSGISF  1345
             GGF++KR SKL+  + +HLLSLFN++GI F
Sbjct  326   GGFEEKRASKLTQADFMHLLSLFNKAGIHF  355



>gb|KHN26450.1| Putative dimethyladenosine transferase [Glycine soja]
Length=352

 Score =   228 bits (580),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 141/329 (43%), Positives = 196/329 (60%), Gaps = 32/329 (10%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV K+ V  TD +LEIGPGTGNLT KL+ A ++VIAI
Sbjct  23    QGGISFHKSKGQHILKNPLLVDSIVEKAGVKSTDVILEIGPGTGNLTKKLLEAGKKVIAI  82

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV  L +R       ++L+V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  83    EIDPRMVLELQRRFQGTPHSNRLTVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLKH  142

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R+A ++ Q+EFA RL+A PGD  + RL VN +L A V  ++ V + +F P PKVDS
Sbjct  143   EPAFRAAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLHARVFHLLKVGRNNFRPPPKVDS  202

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESV  1174
             SVV+I P+    +V   EW  F R CF +KNKTLG+ F+QK ++  L K        E  
Sbjct  203   SVVRIEPRKPRIEVKQKEWDGFLRICFNRKNKTLGSIFRQKSVISLLEKNYRTVRALELG  262

Query  1175  EDCSLQSGSEIIELAS--------------------------------FREMIINILSSG  1258
             ++ SL+     ++ +S                                F++ ++ +L  G
Sbjct  263   QEDSLKEVDAKMDFSSFGDDQGMEMDDDGADDDEMEVEDGEADEVQSEFKDKVLGVLKEG  322

Query  1259  GFDDKRPSKlsheellhllslFNQSGISF  1345
              F++KR SKL+ +E L+LLSLFN++GI F
Sbjct  323   DFEEKRSSKLTLQEFLYLLSLFNKAGIHF  351



>ref|XP_009617800.1| PREDICTED: probable dimethyladenosine transferase [Nicotiana 
tomentosiformis]
Length=356

 Score =   227 bits (579),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 138/333 (41%), Positives = 195/333 (59%), Gaps = 40/333 (12%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSI+ K+ +  TD +LEIGPGTGNLT KL+ A + VIA+
Sbjct  27    QGGISFHKSKGQHILKNPLLVDSIIQKAGIKSTDVILEIGPGTGNLTKKLLEAGKSVIAV  86

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L +R     L ++L V+  D LK + P FD+ VANIPY ISSPL  KL+  
Sbjct  87    ELDPRMVLELQRRFQGTPLSNRLKVIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLAH  146

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
                +R+A ++ Q+EFA RL+A PGD+ + RL+VN +L+A V  ++ V K +F P PKVDS
Sbjct  147   RPLFRAAVIMFQREFAMRLVAQPGDTLYCRLSVNTQLLARVSHLLKVGKNNFRPPPKVDS  206

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESV  1174
             SVV+I P+  +  VN  EW    R CF +KNKT+G+ F+QK +L  L K     +  +  
Sbjct  207   SVVRIEPRKPLAPVNFKEWDGLVRICFNRKNKTIGSIFRQKSVLSLLEKNYRTLQALQLA  266

Query  1175  EDCSLQSGSEIIELA------------------------------------SFREMIINI  1246
             E+      SE +E+A                                     F+E ++ +
Sbjct  267   ENVP----SEDMEMALDVSALGETFGDLSMDADDEKDDDEMEVDDGDAKRSEFKEKVLAV  322

Query  1247  LSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             L  G F+DKR SKL+  + +HLLSLFN++GI F
Sbjct  323   LKEGKFEDKRSSKLTQADFMHLLSLFNKAGIHF  355



>ref|XP_006581054.1| PREDICTED: uncharacterized protein LOC100819707 isoform X1 [Glycine 
max]
 ref|XP_006581055.1| PREDICTED: uncharacterized protein LOC100819707 isoform X2 [Glycine 
max]
Length=352

 Score =   227 bits (579),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 141/329 (43%), Positives = 196/329 (60%), Gaps = 32/329 (10%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV K+ V  TD +LEIGPGTGNLT KL+ A ++VIAI
Sbjct  23    QGGISFHKSKGQHILKNPLLVDSIVEKAGVKSTDVILEIGPGTGNLTKKLLEAGKKVIAI  82

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV  L +R       ++L+V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  83    EIDPRMVLELQRRFQGTPHSNRLTVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLKH  142

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R+A ++ Q+EFA RL+A PGD  + RL VN +L A V  ++ V + +F P PKVDS
Sbjct  143   EPAFRAAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLHARVFHLLKVGRNNFRPPPKVDS  202

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESV  1174
             SVV+I P+    +V   EW  F R CF +KNKTLG+ F+QK ++  L K        E  
Sbjct  203   SVVRIEPRKPRIEVKQKEWDGFLRICFNRKNKTLGSIFRQKSVISLLEKNYRTVRALELG  262

Query  1175  EDCSLQSGSEIIELAS--------------------------------FREMIINILSSG  1258
             ++ SL+     ++ +S                                F++ ++ +L  G
Sbjct  263   QEDSLKEVDAKMDFSSFGDDQGMEMDDDGADDDEMEVEDGEADEVQSEFKDKVLGVLKEG  322

Query  1259  GFDDKRPSKlsheellhllslFNQSGISF  1345
              F++KR SKL+ +E L+LLSLFN++GI F
Sbjct  323   DFEEKRSSKLTLQEFLYLLSLFNKAGIHF  351



>ref|XP_009804609.1| PREDICTED: probable dimethyladenosine transferase [Nicotiana 
sylvestris]
Length=354

 Score =   227 bits (579),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 138/333 (41%), Positives = 195/333 (59%), Gaps = 40/333 (12%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV K+ +  TD +LEIGPGTGNLT KL+ A + VIA+
Sbjct  25    QGGISFHKSKGQHILKNPLLVDSIVQKAGIKSTDVILEIGPGTGNLTKKLLEAGKSVIAV  84

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L +R     L ++L V+  D LK + P FD+ VANIPY ISSPL  KL+  
Sbjct  85    ELDPRMVLELQRRFQGTPLSNRLKVIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLAH  144

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
                +R+A ++ Q+EFA RL+A PGD+ + RL+VN +L+A V  ++ V K +F P PKVDS
Sbjct  145   RPLFRAAVIMFQREFAMRLVAQPGDTLYCRLSVNTQLLARVSHLLKVGKNNFRPPPKVDS  204

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESV  1174
             SVV+I P+  +  VN  EW    R CF +KNKT+G+ F+QK +L  L K     +  +  
Sbjct  205   SVVRIEPRKPLAPVNFKEWDGLVRICFNRKNKTIGSIFRQKSVLSLLEKNYRTLQALQLA  264

Query  1175  EDCSLQSGSEIIELA------------------------------------SFREMIINI  1246
             E+      SE +E+A                                     F+E ++ +
Sbjct  265   ENVP----SEDVEMALDVSALGETFGDLSMDADDEKDDDEMEVDDGDAKRSEFKEKVLAV  320

Query  1247  LSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             L  G ++DKR SKL+  + +HLLSLFN++GI F
Sbjct  321   LKEGKYEDKRSSKLTQADFMHLLSLFNKAGIHF  353



>gb|EPR78579.1| Dimethyladenosine transferase [Spraguea lophii 42_110]
Length=269

 Score =   224 bits (571),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 154/212 (73%), Gaps = 3/212 (1%)
 Frame = +2

Query  476   KSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMV  655
             KS GQH+L NP ++DSIV KSN+ PTDT+LEIG GTGNLTLKL+  A++VI  E D+R+ 
Sbjct  8     KSLGQHILKNPGIIDSIVNKSNIEPTDTILEIGAGTGNLTLKLLEKAKKVICYEKDERLA  67

Query  656   EILNKRAA-EHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRS  832
               L KR + +  L  KL ++  DALK EFP FD+ ++NIPY ISSPL+ KL+     +RS
Sbjct  68    SELIKRVSLQPKLYSKLKLIVGDALKAEFPHFDMCISNIPYQISSPLIFKLL--KYNFRS  125

Query  833   ATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIH  1012
               LL+Q EFA+RL+A PG S+++R++V+V+L+A VE V+ VSK++F P PKVDSSV+KI 
Sbjct  126   CVLLVQYEFAQRLVAKPGSSDYSRISVSVQLLAKVENVLKVSKKNFNPPPKVDSSVIKIK  185

Query  1013  PKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             P+ S P +N+ E+      CF +KNKTL + F
Sbjct  186   PRFSKPQINVKEFENMVSKCFLRKNKTLRSVF  217



>ref|NP_001156188.1| dimethyladenosine transferase-like [Acyrthosiphon pisum]
 dbj|BAH71955.1| ACYPI005364 [Acyrthosiphon pisum]
Length=303

 Score =   225 bits (574),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 126/295 (43%), Positives = 181/295 (61%), Gaps = 9/295 (3%)
 Frame = +2

Query  464   IYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEID  643
             I   K  GQH+L NP ++  +V KS +LPTDTVLEIGPGTGNLT+KL+   + VIA EID
Sbjct  18    IMFKKDFGQHILKNPLIIQGMVEKSALLPTDTVLEIGPGTGNLTVKLLERVKTVIACEID  77

Query  644   KRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANA  823
              R+V  L KR       +KL +   D LK+E P F+++VANIPY ISSPL+ KL+     
Sbjct  78    VRLVAELKKRVMNTPYQNKLQIRVGDVLKSELPFFNVLVANIPYQISSPLVFKLLLHRPF  137

Query  824   YRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVV  1003
             +R A L+ Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+S+VV
Sbjct  138   FRCAVLMFQREFAYRLVAKPGDKLYCRLSINTQLLARVDLIMKVGKNNFRPPPKVESNVV  197

Query  1004  KIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDC  1183
             +I P+   P +N +EW   TR  F++KNKTLGA F              +  ++     C
Sbjct  198   RIEPRNPPPPINFNEWDGLTRIAFSRKNKTLGAIF--------KQNAVAVTLEKNYRVYC  249

Query  1184  SLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISFH  1348
             SL++  +I +    ++ + ++L+   F DKR  K+  +E + LL  F++ GI F 
Sbjct  250   SLKN-QKIEDDFDIKQKLDDVLNKNDFCDKRARKMDIDEFIELLLAFHKEGIHFQ  303



>ref|XP_002714103.1| PREDICTED: probable dimethyladenosine transferase isoform X1 
[Oryctolagus cuniculus]
Length=308

 Score =   225 bits (574),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 128/290 (44%), Positives = 174/290 (60%), Gaps = 9/290 (3%)
 Frame = +2

Query  476   KSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMV  655
             K  GQH+L NP V++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V
Sbjct  27    KGIGQHILKNPLVVNSIIEKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLV  86

Query  656   EILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSA  835
               L+KR     L  KL V+  D LKTE P FD  VAN+PY ISSP + KL+     +R A
Sbjct  87    AELHKRVQGTPLASKLQVMVGDVLKTELPFFDTCVANLPYQISSPFVFKLLLHRPFFRCA  146

Query  836   TLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHP  1015
              L+ Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I P
Sbjct  147   VLMFQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEP  206

Query  1016  KASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQS  1195
             K   P +N  EW    R  F +KNKTL A F             +   ++     CS+ +
Sbjct  207   KNPPPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN  258

Query  1196  GSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
                I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  259   -IIIPEDFSIADKIQQILTSTGFSDKRARTMDIDDFIRLLHGFNAEGIHF  307



>ref|XP_010024069.1| PREDICTED: probable dimethyladenosine transferase [Eucalyptus 
grandis]
 gb|KCW60488.1| hypothetical protein EUGRSUZ_H03223 [Eucalyptus grandis]
Length=356

 Score =   227 bits (578),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 144/330 (44%), Positives = 198/330 (60%), Gaps = 33/330 (10%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS + PTD VLEIGPGTGNLT KL+ A + V+A+
Sbjct  26    QGGISFHKSKGQHILKNPLLVDSIVQKSGIKPTDVVLEIGPGTGNLTKKLLDAGKSVVAV  85

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L +R        +L V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  86    ELDPRMVLELQRRFQGTPYSHRLKVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLNH  145

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
                +R A ++ Q+EFA RL+A PGD+ + RL+ N +L A V  ++ V + +F P PKVDS
Sbjct  146   QPPFRCAVIMFQREFAMRLVAQPGDNLYCRLSANTQLRARVSHLLKVGRNNFRPPPKVDS  205

Query  995   SVVKIHPKASIPDVNL-DEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeD-QE  1168
             SVV+I P+   PD NL  E+    R CF +KNKTLG+ F+QK +L  + K  +  +   +
Sbjct  206   SVVRIEPRKPAPDSNLVREFDGLMRICFNRKNKTLGSIFRQKTMLSVMEKNYKTLQALHQ  265

Query  1169  SVEDCSLQS----------------GSEII---------------ELASFREMIINILSS  1255
             S  + S  S                G EI                E++ F+E ++N+L  
Sbjct  266   SQSNLSGDSKVGMDGLDFGDNGDDLGMEIDDGGDNEMELEDGDAGEVSEFKEKVLNVLKE  325

Query  1256  GGFDDKRPSKlsheellhllslFNQSGISF  1345
             G F++KR SKL+ +E L+LLSLFN++GI F
Sbjct  326   GDFEEKRSSKLTQQEFLYLLSLFNKAGIHF  355



>ref|XP_006618433.1| PREDICTED: probable dimethyladenosine transferase-like [Apis 
dorsata]
Length=306

 Score =   225 bits (573),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 172/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP V+ S+V K+ V PTD VLEIGPGTGN+T+KL+  A++VIA E+D RMV  L
Sbjct  28    GQHILKNPLVIQSMVEKAAVRPTDVVLEIGPGTGNMTIKLLDKAKKVIACELDTRMVAEL  87

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
              KR        KL ++  D LKT+ P FDL VANIPY ISSPL+ KL+     +R A L+
Sbjct  88    QKRVQGTIYQSKLQIMIGDVLKTDLPFFDLCVANIPYQISSPLVFKLLLHRPMFRCAILM  147

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+S+VV+I P+  
Sbjct  148   FQREFAERLVAKPGDKLYCRLSINTQLLARVDLLMKVGKNNFRPPPKVESNVVRIEPRNP  207

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW   TR  F +KNKTL A F                 ++     CSL +   
Sbjct  208   PPPINYQEWDGLTRIAFVRKNKTLSAAF--------KQTTVLTMLEKNYKLHCSL-NNKI  258

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  + ++MI +IL     ++KR   +  ++ + LL  FN  G+ F
Sbjct  259   ITEGFNIKDMINDILQKADAENKRARTMDIDDFISLLHAFNSKGVHF  305



>ref|XP_008783008.1| PREDICTED: probable dimethyladenosine transferase [Phoenix dactylifera]
Length=349

 Score =   226 bits (577),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 141/327 (43%), Positives = 196/327 (60%), Gaps = 37/327 (11%)
 Frame = +2

Query  476   KSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMV  655
             KS+GQH+L NP ++++IV KS + PTD VLEIGPGTGNLT KL+  A+ V+AIE+D RMV
Sbjct  22    KSKGQHILKNPMLVETIVQKSGIKPTDVVLEIGPGTGNLTKKLLEVAKSVVAIELDPRMV  81

Query  656   EILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSA  835
               LN+R        +L  +  D LK + P FD+ VANIPY ISSPL  KL+     +R A
Sbjct  82    LELNRRFQGTPHSSRLKAIQGDVLKYDLPYFDICVANIPYQISSPLTFKLLSHRPLFRCA  141

Query  836   TLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHP  1015
              ++ Q+EFA RL+A PGDS + RL+VN +L+A V  ++ V + +F P PKVDSSVV+I P
Sbjct  142   VIMFQREFAMRLVAKPGDSLYCRLSVNTQLLARVSHLLKVGRNNFRPPPKVDSSVVRIEP  201

Query  1016  KASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeD-----------  1162
             +  +P VN  EW    R CF +KNKTLG+ F+QK +L  L K  +  +            
Sbjct  202   RKPLPPVNFKEWDGMVRLCFNRKNKTLGSIFRQKSVLSLLEKNYKTLQALQLSQKGQMED  261

Query  1163  -----------QESVEDCSLQ-SGSEIIEL--------------ASFREMIINILSSGGF  1264
                         + VED S++ +G +  E+              A F+E ++ +L  G F
Sbjct  262   DNVAPNDVAVLADMVEDLSVEDNGKDDEEMEVDDADMVGGGGEGADFKEKVLGVLRQGDF  321

Query  1265  DDKRPSKlsheellhllslFNQSGISF  1345
              +KR SKL+  + L+LLSLFN++GI F
Sbjct  322   LEKRSSKLTQVDFLYLLSLFNKAGIHF  348



>ref|XP_008443786.1| PREDICTED: probable dimethyladenosine transferase [Cucumis melo]
 ref|XP_008443787.1| PREDICTED: probable dimethyladenosine transferase [Cucumis melo]
Length=349

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 142/327 (43%), Positives = 193/327 (59%), Gaps = 30/327 (9%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS +  TD +LEIGPGTGNLT KL+   + VIA+
Sbjct  22    QGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVILEIGPGTGNLTKKLLECGKMVIAV  81

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L +R  +     +L V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  82    ELDPRMVLELQRRFQDTPYSSRLKVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLNH  141

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R A ++ Q+EFA RL+A PGD  + RL VN +L+A V  ++ V K +F P PKVDS
Sbjct  142   QPAFRCAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLLARVSHLLKVGKNNFRPPPKVDS  201

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeD----  1162
             SVV+I P+    +V   EW  F R CF +KNKTLG+ F+QK +L  L K  +        
Sbjct  202   SVVRIEPRKPRIEVKQKEWDGFLRICFNRKNKTLGSIFRQKSVLSLLEKNYKTLCSLNIL  261

Query  1163  ------------QESVEDCSLQ--------------SGSEIIELASFREMIINILSSGGF  1264
                           S ED S++                +E  E + F+  ++ +L  G F
Sbjct  262   QQGSAGNDDSAFDYSNEDQSMEVDEDGDDEEMDMEDGDAEEGEASEFKGKVMGVLKEGDF  321

Query  1265  DDKRPSKlsheellhllslFNQSGISF  1345
             ++KR SKL+ +E L+LLSLFN++GI F
Sbjct  322   EEKRSSKLTLQEFLYLLSLFNKAGIHF  348



>ref|XP_009378710.1| PREDICTED: probable dimethyladenosine transferase [Pyrus x bretschneideri]
Length=345

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 146/218 (67%), Gaps = 0/218 (0%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS +  TD +LEIGPGTGNLT KL+ A +RVIA+
Sbjct  20    QGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVILEIGPGTGNLTKKLLEAGKRVIAV  79

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV  L +R       ++L V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  80    EIDARMVLELQRRFQGTPHSNRLQVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLKH  139

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R A ++ Q+EFA RL+A PGD  + RL VN +L++ V  ++ V + +F P PKVDS
Sbjct  140   QPAFRCAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLLSRVSHLLKVGRNNFRPPPKVDS  199

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             SVV+I P+     VN  EW  F R CF +KNKTLG+ F
Sbjct  200   SVVRIEPRKPALQVNQKEWDGFLRICFNRKNKTLGSIF  237



>ref|XP_003702828.1| PREDICTED: probable dimethyladenosine transferase-like [Megachile 
rotundata]
Length=306

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 171/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP V+ S+V K+ + PTD VLEIGPGTGN+T+KL+  A++VIA E+D RMV  L
Sbjct  28    GQHILKNPLVIQSMVEKAALRPTDVVLEIGPGTGNMTVKLLDKAKKVIACEVDTRMVAEL  87

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
              KR        KL ++  D LKT+ P FDL VANIPY ISSPL+ KL+     +R A L+
Sbjct  88    QKRVQGTPYQPKLQIMIGDVLKTDLPFFDLCVANIPYQISSPLVFKLLLHRPLFRCAVLM  147

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+S+VV+I P+  
Sbjct  148   FQREFAERLVAKPGDKLYCRLSINTQLLARVDLLMKVGKNNFRPPPKVESNVVRIEPRNP  207

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P VN  EW   TR  F +KNKTL A F                 ++     CSL + + 
Sbjct  208   PPPVNYQEWDGLTRIAFVRKNKTLSAVF--------KQTTVLTMLEKNYKLHCSLNNKA-  258

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E    +E+I  IL     ++KR   +  ++ + +L  FN  G+ F
Sbjct  259   IPEGFDIKELISKILQKADAENKRARTMDIDDFISILHAFNTEGVHF  305



>gb|ELK31210.1| Putative dimethyladenosine transferase [Myotis davidii]
 gb|EPQ02549.1| Putative dimethyladenosine transferase [Myotis brandtii]
Length=285

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  7     GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  66

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  67    HKRVQGTPLASKLQVLVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  126

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  127   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  186

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  187   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-TI  237

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  238   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  284



>ref|XP_008053327.1| PREDICTED: probable dimethyladenosine transferase isoform X1 
[Tarsius syrichta]
Length=313

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/287 (44%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP V++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLVVNSIIEKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAVLM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ S + 
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHS-TV  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S    I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIANKIQQILTSTGFSDKRARSMDIDDFIGLLHGFNAEGIHF  312



>gb|KIH60645.1| dimethyladenosine transferase [Ancylostoma duodenale]
Length=272

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 146/209 (70%), Gaps = 0/209 (0%)
 Frame = +2

Query  482   RGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEI  661
             +GQH+L NP +++SI+ KS + PTDTVLE+GPGTGNLT+K++  A++VIA EID RM+  
Sbjct  25    KGQHILKNPGIVNSIIEKSALKPTDTVLEVGPGTGNLTVKMLECAKKVIACEIDPRMIAE  84

Query  662   LNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATL  841
             L KR     L +KL V   D +K E+P FD+ VAN+PY ISSP + KL+      R A L
Sbjct  85    LKKRVLATPLQNKLEVRAGDVMKAEWPFFDVCVANLPYQISSPFVFKLLLHRPLPRYAVL  144

Query  842   LLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKA  1021
             + QKEFA RL+A PGD ++ RL+VNV+L+A VE +M + + +F P PKVDS+VV+I PK 
Sbjct  145   MFQKEFADRLIAKPGDKDYCRLSVNVQLLAKVEHLMKIKRTEFRPPPKVDSAVVRIAPKN  204

Query  1022  SIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
               P +N +EW    R CF +KNKTL + F
Sbjct  205   PPPPINFEEWEGMLRLCFLRKNKTLLSIF  233



>ref|XP_005319638.1| PREDICTED: probable dimethyladenosine transferase [Ictidomys 
tridecemlineatus]
Length=312

 Score =   224 bits (572),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/287 (44%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  34    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDTRLVAEL  93

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  94    HKRVQGTPLASKLQVMVGDVLKTDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAILM  153

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  154   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  213

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CSL +   
Sbjct  214   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSLHN-IV  264

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  265   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  311



>ref|XP_004016997.1| PREDICTED: probable dimethyladenosine transferase [Ovis aries]
Length=285

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  7     GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  66

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  67    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  126

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  127   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  186

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  187   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSIHNMI-  237

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  238   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  284



>ref|XP_007515190.1| dimethyladenosine transferase [Bathycoccus prasinos]
 emb|CCO14069.1| dimethyladenosine transferase [Bathycoccus prasinos]
Length=338

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 128/308 (42%), Positives = 188/308 (61%), Gaps = 14/308 (5%)
 Frame = +2

Query  464   IYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEID  643
             I  LKS GQH+L NP ++DSI+ KS    TD  LEIGPGTGNLT+KL+   ++V+AIE D
Sbjct  33    IQFLKSYGQHILKNPAIVDSIIQKSGAKSTDVALEIGPGTGNLTMKLLETCKKVVAIEYD  92

Query  644   KRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANA  823
              RMV  L +R        KL ++  D +K E P FD+ VAN+PY ISSPL  KL+     
Sbjct  93    ARMVLELQRRVQGSPYQSKLEIIQGDFMKVELPYFDVCVANVPYQISSPLTFKLLSHRPQ  152

Query  824   YRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVV  1003
             +RSATL+ Q+EFA R++A  GD+++ RLAVN +L+A  + ++ V K +F P PKVDSSVV
Sbjct  153   FRSATLMFQREFAMRMVAKAGDAQYCRLAVNTQLLAKTQHILKVGKNNFRPPPKVDSSVV  212

Query  1004  KIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrl-------lmelmklqemkeD  1162
             +I P+     VN  EW    R CF +KNKTLG  F+ K +        +    ++    D
Sbjct  213   RIEPRKPPVQVNFREWDGLIRLCFGRKNKTLGGIFRTKTVLELLTKNYLTFKAVKVNLLD  272

Query  1163  QESVEDCSLQSGS-----EIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFN  1327
              +++E    ++ +     E+ +    +E+I  +L++ G+ + R SK++ ++ L LL++FN
Sbjct  273   DDAMELAEEEANNKEKRQEVKD--HVKELIEKVLNTNGYVEMRSSKMTQDDFLQLLAVFN  330

Query  1328  QSGISFHG  1351
             + GI F G
Sbjct  331   EHGIHFVG  338



>gb|KDR21683.1| putative dimethyladenosine transferase [Zootermopsis nevadensis]
Length=306

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/294 (43%), Positives = 174/294 (59%), Gaps = 9/294 (3%)
 Frame = +2

Query  464   IYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEID  643
             I  +K+ GQH+L NP ++ S+V KS + PTD  LEIGPGTGN+T+KL+   +RV+A EID
Sbjct  21    ILFIKNFGQHILKNPLIIQSMVDKSALRPTDVALEIGPGTGNMTIKLLEKTKRVVACEID  80

Query  644   KRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANA  823
              R+V  L KR        KL ++  D LKTE P FD+ VANIPY ISSPL+ KL+     
Sbjct  81    PRLVAELQKRVQGTPYQSKLQIMIGDVLKTELPFFDVCVANIPYQISSPLVFKLLLHRPF  140

Query  824   YRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVV  1003
             +R A ++ Q+EFA+RL+A PGD  + RL+VN +L+A V+ VM V K +F P PKV+SSVV
Sbjct  141   FRCAIIMFQREFAQRLVAKPGDQLYCRLSVNTQLLARVDIVMKVGKNNFRPPPKVESSVV  200

Query  1004  KIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDC  1183
             ++ P+   P +N  EW   TR  F +KNKTL A F                 ++     C
Sbjct  201   RLEPRNPPPPINFTEWDGLTRIAFVRKNKTLSAAF--------KQTPVIAALEKNYQIHC  252

Query  1184  SLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             SL S   + +  + ++ + NIL S   + KR   +  ++ + LL  FN  GI F
Sbjct  253   SL-SNVNVPDNFNMKQKVDNILKSCESESKRARSMDIDDFMMLLHAFNTEGIHF  305



>ref|XP_005971997.1| PREDICTED: probable dimethyladenosine transferase [Pantholops 
hodgsonii]
Length=285

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  7     GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  66

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  67    HKRVQGTALASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  126

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  127   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  186

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  187   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  237

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  238   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  284



>ref|XP_003782781.1| PREDICTED: probable dimethyladenosine transferase [Otolemur garnettii]
Length=313

 Score =   224 bits (571),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSIHN-TV  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_010929034.1| PREDICTED: probable dimethyladenosine transferase [Elaeis guineensis]
Length=350

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 137/328 (42%), Positives = 188/328 (57%), Gaps = 38/328 (12%)
 Frame = +2

Query  476   KSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMV  655
             KS+GQH+L NP ++++IV KS + PTD VLEIGPGTGNLT KL+  A+ V+AIE+D RMV
Sbjct  22    KSKGQHILKNPMLVETIVQKSGIKPTDVVLEIGPGTGNLTKKLLEVAKSVVAIELDHRMV  81

Query  656   EILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSA  835
               LN+R        +L V+  D LK + P FD+ VANIPY ISSPL  KL+     +R A
Sbjct  82    LELNRRFQGTPHSSRLKVIQGDVLKYDLPYFDICVANIPYQISSPLTFKLLSHRPLFRCA  141

Query  836   TLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHP  1015
              ++ Q+EFA RL+A PGDS + RL+VN +L+A V  ++ V + +F P PKVDSSVV+I P
Sbjct  142   VIMFQREFAMRLVAKPGDSLYCRLSVNTQLLARVSHLLKVGRNNFRPPPKVDSSVVRIEP  201

Query  1016  KASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllm-----elmklqemkeDQESVED  1180
             +  +P VN  EW    R CF +KNKTL + F+QK +L                 +E +ED
Sbjct  202   RKPLPPVNFKEWDGLVRLCFNRKNKTLSSIFRQKSVLSLLEKNYKTLQALQLSQKEQMED  261

Query  1181  CSLQSGSEII---------------------------------ELASFREMIINILSSGG  1261
               +      +                                 E A F+E ++ +L  G 
Sbjct  262   DKVAPNDVAVLADMVEDINMEDNYGKDDDEMEVEDVDMVGGGGEGADFKEKVLEVLRQGD  321

Query  1262  FDDKRPSKlsheellhllslFNQSGISF  1345
             F +KR SKL+  + L+LLSLFN++GI F
Sbjct  322   FLEKRASKLTQVDFLYLLSLFNKAGIHF  349



>ref|XP_004422920.1| PREDICTED: probable dimethyladenosine transferase [Ceratotherium 
simum simum]
Length=313

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-TI  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_010964550.1| PREDICTED: probable dimethyladenosine transferase [Camelus bactrianus]
 ref|XP_010973215.1| PREDICTED: probable dimethyladenosine transferase [Camelus dromedarius]
Length=313

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-TI  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNTEGIHF  312



>ref|XP_006188264.1| PREDICTED: probable dimethyladenosine transferase [Camelus ferus]
Length=313

 Score =   224 bits (571),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-TI  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNTEGIHF  312



>ref|XP_008160079.1| PREDICTED: probable dimethyladenosine transferase [Eptesicus 
fuscus]
Length=312

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  34    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  93

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  94    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  153

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  154   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  213

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  214   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-TI  264

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  265   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  311



>ref|NP_079723.1| probable dimethyladenosine transferase [Mus musculus]
 sp|Q9D0D4.1|DIM1_MOUSE RecName: Full=Probable dimethyladenosine transferase; AltName: 
Full=DIM1 dimethyladenosine transferase 1 homolog; AltName: 
Full=DIM1 dimethyladenosine transferase 1-like; AltName: Full=Probable 
18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase; 
AltName: Full=Probable 18S rRNA dimethylase; 
AltName: Full=Probable S-adenosylmethionine-6-N',N'-adenosyl(rRNA) 
dimethyltransferase [Mus musculus]
 dbj|BAB27687.1| unnamed protein product [Mus musculus]
 gb|AAH19799.1| DIM1 dimethyladenosine transferase 1-like (S. cerevisiae) [Mus 
musculus]
 dbj|BAE36330.1| unnamed protein product [Mus musculus]
 gb|EDL18475.1| RIKEN cDNA 1500031M22, isoform CRA_b [Mus musculus]
Length=313

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 175/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LK++ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVLVGDVLKSDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+Q+ + 
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVQN-TV  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_005065625.1| PREDICTED: probable dimethyladenosine transferase [Mesocricetus 
auratus]
Length=313

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LK+E P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVLVGDVLKSELPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  215   PPPINFQEWDGLVRIAFVRKNKTLSAAF--------KSSAVQQLLERNYRIHCSVHN-TV  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_006081480.1| PREDICTED: probable dimethyladenosine transferase [Myotis lucifugus]
Length=312

 Score =   224 bits (570),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  34    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  93

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  94    HKRVQGTPLASKLQVLVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  153

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  154   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  213

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  214   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-TI  264

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  265   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  311



>ref|XP_009418145.1| PREDICTED: probable dimethyladenosine transferase [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   225 bits (573),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 147/211 (70%), Gaps = 0/211 (0%)
 Frame = +2

Query  476   KSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMV  655
             KS+GQH+L NP ++++IV KS + PTD VLEIGPGTGNLT KL+  A+ V+A+E+D RMV
Sbjct  23    KSKGQHILKNPMLVETIVHKSGIKPTDVVLEIGPGTGNLTKKLLEVAKSVVAVELDPRMV  82

Query  656   EILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSA  835
               LN+R        +L ++  D LK E P FD+ VANIPY ISSPL  KL+    A+R A
Sbjct  83    LELNRRFQGTPHSSRLKLIEGDVLKCELPYFDMCVANIPYQISSPLTFKLLAHRPAFRCA  142

Query  836   TLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHP  1015
              ++ Q+EFA RL+ANPGD+ + RL+VN +L+A V  ++ V + +F P PKVDSSVV+I P
Sbjct  143   VIMFQREFAMRLVANPGDALYCRLSVNTQLLARVSHLLKVGRNNFRPPPKVDSSVVRIEP  202

Query  1016  KASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             +  +P V+  EW    R CF +KNKTLG+ F
Sbjct  203   RRPLPPVSFKEWDGLVRLCFNRKNKTLGSIF  233



>ref|XP_004142540.1| PREDICTED: probable dimethyladenosine transferase-like [Cucumis 
sativus]
 gb|KGN66758.1| hypothetical protein Csa_1G679560 [Cucumis sativus]
Length=349

 Score =   225 bits (573),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 142/327 (43%), Positives = 193/327 (59%), Gaps = 30/327 (9%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS +  TD +LEIGPGTGNLT KL+   + VIA+
Sbjct  22    QGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVILEIGPGTGNLTKKLLECGKMVIAV  81

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L +R  +     +L V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  82    ELDPRMVLELQRRFQDTPYSSRLKVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLNH  141

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R A ++ Q+EFA RL+A PGD  + RL VN +L+A V  ++ V K +F P PKVDS
Sbjct  142   QPAFRCAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLLARVSHLLKVGKNNFRPPPKVDS  201

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemke-----  1159
             SVV+I P+    +V   EW  F R CF +KNKTLG+ F+QK +L  L K  +        
Sbjct  202   SVVRIEPRKPRIEVKQKEWDGFLRICFNRKNKTLGSIFRQKSVLSLLEKNYKTLCSLNIL  261

Query  1160  ------DQESVEDCSLQSGS-------------------EIIELASFREMIINILSSGGF  1264
                   + +S  D S +  S                   E  E + F+  ++ +L  G F
Sbjct  262   QQGSGGNDDSALDYSNEDQSMEVDEDGDEEEMDMEDGDAEEGEASEFKGKVMGVLKEGDF  321

Query  1265  DDKRPSKlsheellhllslFNQSGISF  1345
             ++KR SKL+ +E L+LLSLFN++GI F
Sbjct  322   EEKRSSKLTLQEFLYLLSLFNKAGIHF  348



>ref|XP_009339780.1| PREDICTED: probable dimethyladenosine transferase [Pyrus x bretschneideri]
Length=345

 Score =   224 bits (572),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 146/218 (67%), Gaps = 0/218 (0%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS +  TD +LEIGPGTGNLT KL+ A +RVIA+
Sbjct  20    QGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVILEIGPGTGNLTKKLLEAGKRVIAV  79

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV  L +R       ++L V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  80    EIDARMVLELQRRFQGTPHSNRLQVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLKH  139

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R A ++ Q+EFA RL+A PGD  + RL VN +L++ V  ++ V + +F P PKVDS
Sbjct  140   QPAFRCAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLLSRVSHLLKVGRNNFRPPPKVDS  199

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             SVV+I P+     VN  EW  F R CF +KNKTLG+ F
Sbjct  200   SVVRIEPRKPALLVNQKEWDGFLRICFNRKNKTLGSIF  237



>ref|XP_007079974.1| PREDICTED: probable dimethyladenosine transferase isoform X2 
[Panthera tigris altaica]
Length=285

 Score =   223 bits (567),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  7     GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  66

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  67    HKRVQGTPLASKLQVLVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  126

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  127   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  186

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  187   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  237

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  238   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  284



>ref|XP_004678333.1| PREDICTED: probable dimethyladenosine transferase [Condylura 
cristata]
Length=313

 Score =   224 bits (570),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  215   PPPINFREWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-TV  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_004155690.1| PREDICTED: probable dimethyladenosine transferase-like [Cucumis 
sativus]
Length=349

 Score =   224 bits (572),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 140/335 (42%), Positives = 187/335 (56%), Gaps = 46/335 (14%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS +  TD +LEIGPGTGNLT KL+   + VIA+
Sbjct  22    QGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVILEIGPGTGNLTKKLLECGKMVIAV  81

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L +R  +     +L V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  82    ELDPRMVLELQRRFQDTPYSSRLKVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLNH  141

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R A ++ Q+EFA RL+A PGD  + RL VN +L+A V  ++ V K +F P PKVDS
Sbjct  142   QPAFRCAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLLARVSHLLKVGKNNFRPPPKVDS  201

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESV  1174
             SVV+I P+    +V   EW  F R CF +KNKTLG+ F          K      ++   
Sbjct  202   SVVRIEPRKPRIEVKQKEWDGFLRICFNRKNKTLGSIF--------RQKSVLSLLEKNYK  253

Query  1175  EDCS---LQSGS-----------------------------------EIIELASFREMII  1240
               CS   LQ GS                                   E  E + F+  ++
Sbjct  254   TLCSLNILQQGSGGNDDSALNYSNEDQSMEVDEDGDEEEMDMEDGDAEEGEASEFKGKVM  313

Query  1241  NILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
              +L  G F++KR SKL+ +E L+LLSLFN++GI F
Sbjct  314   GVLKEGDFEEKRSSKLTLQEFLYLLSLFNKAGIHF  348



>ref|XP_003059014.1| hypothetical protein MICPUCDRAFT_58407 [Micromonas pusilla CCMP1545]
 gb|EEH57469.1| hypothetical protein MICPUCDRAFT_58407 [Micromonas pusilla CCMP1545]
Length=380

 Score =   226 bits (575),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/229 (50%), Positives = 151/229 (66%), Gaps = 2/229 (1%)
 Frame = +2

Query  428   NVRRKIENQEA--NIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLK  601
             +V++K   Q A   I  LKS GQH+L NP ++++IV K  V  TD VLEIGPGTGNLT++
Sbjct  14    HVKKKGAQQAAYQGIQFLKSYGQHILKNPMIVNAIVEKGGVKSTDVVLEIGPGTGNLTMR  73

Query  602   LVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGI  781
             L+  A++VIAIE D RMV  L +R +    G  L ++  D LK + P FD+ +AN PY I
Sbjct  74    LLETAKKVIAIEFDPRMVVELERRVSGTPHGHNLKIISGDFLKVDLPYFDVCIANCPYQI  133

Query  782   SSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSK  961
             SSPL+ KL+     +RSATL+ Q+EFA RL  NPGD  + RL+VN +L+A    ++ V K
Sbjct  134   SSPLVFKLLSHRPMFRSATLMFQREFAMRLCVNPGDPLYCRLSVNAQLLARTTHILKVGK  193

Query  962   RDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
              +F P PKVDSSVV+I P++ + DVN  EW    R CF +KNKTLG  F
Sbjct  194   NNFRPPPKVDSSVVRIEPRSPMIDVNFREWDGLVRLCFGRKNKTLGGIF  242



>ref|XP_011041285.1| PREDICTED: probable dimethyladenosine transferase [Populus euphratica]
Length=353

 Score =   224 bits (572),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/238 (48%), Positives = 151/238 (63%), Gaps = 0/238 (0%)
 Frame = +2

Query  395   GGRSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIG  574
             GG+   E+          + +  I   KS+GQH+L NP ++DSIV KS +  TD VLEIG
Sbjct  3     GGKIRKEKPSSRGAPSSNHYQGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVVLEIG  62

Query  575   PGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDL  754
             PGTGNLT KL+   + V+AIE+D RMV  L +R       ++L V+  D LKT+ P FD+
Sbjct  63    PGTGNLTKKLLEVGKMVVAIELDPRMVLELQRRFQGTPFSNRLKVIQGDVLKTDLPYFDI  122

Query  755   MVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAD  934
              VANIPY ISSPL  KL+     +R A ++ Q+EFA RL+A PGD+ + RL+VN +L A 
Sbjct  123   CVANIPYQISSPLTFKLLNHQPFFRCAIIMFQREFAMRLVAQPGDTLYCRLSVNTQLYAR  182

Query  935   VEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             V  ++ V K +F P PKVDSSVV+I P+   P VN  EW  F R CF +KNKTLG+ F
Sbjct  183   VSHLLKVGKNNFRPPPKVDSSVVRIEPRKPRPQVNPKEWDGFIRICFIRKNKTLGSIF  240



>ref|XP_006231965.1| PREDICTED: probable dimethyladenosine transferase isoform X1 
[Rattus norvegicus]
 ref|XP_006231967.1| PREDICTED: probable dimethyladenosine transferase isoform X1 
[Rattus norvegicus]
 gb|EDM10285.1| similar to RIKEN cDNA 1500031M22 (predicted), isoform CRA_a [Rattus 
norvegicus]
Length=313

 Score =   223 bits (569),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 127/315 (40%), Positives = 184/315 (58%), Gaps = 14/315 (4%)
 Frame = +2

Query  401   RSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPG  580
             R + +E  G ++R        +      GQH+L NP +++SI+ K+ + PTD VLE+GPG
Sbjct  12    RRDRQEQRGELKR-----AGGLMFNTGIGQHILKNPLIVNSIIDKAALRPTDVVLEVGPG  66

Query  581   TGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMV  760
             TGN+T+KL+  A++V+A E+D R+V  L+KR     L  KL V+  D LK++ P FD  V
Sbjct  67    TGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPLASKLQVLVGDVLKSDLPFFDACV  126

Query  761   ANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVE  940
             AN+PY ISSP + KL+     +R A L+ Q+EFA RL+A PGD  + RL++N +L+A V+
Sbjct  127   ANLPYQISSPFVFKLLLHRPFFRCAILMFQREFALRLVAKPGDKLYCRLSINTQLLARVD  186

Query  941   FVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr  1120
              +M V K +F P PKV+SSVV+I PK   P +N  EW    R  F +KNKTL A F    
Sbjct  187   HLMKVGKNNFRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRITFVRKNKTLSAAF----  242

Query  1121  llmelmklqemkeDQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlshee  1300
                      +   ++     CS+Q+ + I E  S  + I  IL++ GF DKR   +  ++
Sbjct  243   ----KSSAVQQLLEKNYRIHCSVQN-TVIPEDFSIADKIQQILTNTGFSDKRARSMDIDD  297

Query  1301  llhllslFNQSGISF  1345
              + LL  FN  GI F
Sbjct  298   FIRLLHGFNAEGIHF  312



>ref|XP_008386722.1| PREDICTED: probable dimethyladenosine transferase [Malus domestica]
Length=345

 Score =   224 bits (572),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 146/218 (67%), Gaps = 0/218 (0%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS +  TD +LEIGPGTGNLT KL+ A +RVIA+
Sbjct  20    QGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVILEIGPGTGNLTKKLLEAGKRVIAV  79

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV  L +R       ++L V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  80    EIDARMVLELQRRFQGTPHSNRLQVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLKH  139

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R A ++ Q+EFA RL+A PGD  + RL VN +L++ V  ++ V + +F P PKVDS
Sbjct  140   QPAFRCAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLLSRVSHLLKVGRNNFRPPPKVDS  199

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             SVV+I P+     VN  EW  F R CF +KNKTLG+ F
Sbjct  200   SVVRIEPRKPALLVNQKEWDGFLRICFNRKNKTLGSIF  237



>ref|XP_010038164.1| PREDICTED: probable dimethyladenosine transferase [Eucalyptus 
grandis]
 gb|KCW49970.1| hypothetical protein EUGRSUZ_K03428 [Eucalyptus grandis]
Length=353

 Score =   224 bits (572),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 142/329 (43%), Positives = 195/329 (59%), Gaps = 32/329 (10%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS +  TD VLEIGPGTGNLT KL+ A + V+A+
Sbjct  24    QGGISFHKSKGQHILKNPLLVDSIVQKSGIKTTDVVLEIGPGTGNLTKKLLDAGKSVVAV  83

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L +R        +L V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  84    ELDPRMVLELQRRFQGTPYSHRLKVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLNH  143

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
                +R A ++ Q+EFA RL+A PGD+ + RL+ N +L A V  ++ V K +F P PKVDS
Sbjct  144   QPPFRCAVIMFQREFAMRLVAQPGDNLYCRLSTNTQLHARVSHLLKVGKNNFRPPPKVDS  203

Query  995   SVVKIHPKASIPDVNL-DEWWAFTRTCFTKKNKTLGATFkqkr--llmelmklqemkeDQ  1165
             SVV+I P+   PD NL  E+    R CF +KNKTLG+ F+QK    +ME          Q
Sbjct  204   SVVRIEPRKPAPDANLVREFDGLMRICFNRKNKTLGSIFRQKTILSVMEKNYKTLQALHQ  263

Query  1166  ESV-------------------EDCSLQ---SGSEII-------ELASFREMIINILSSG  1258
               +                   +D  ++    G E+        E++ F+E ++N+L  G
Sbjct  264   SQINLSGDSNIGTDSLDFGDNRDDLGMEIDDGGDEMELEDGDAGEVSEFKEKVLNVLKEG  323

Query  1259  GFDDKRPSKlsheellhllslFNQSGISF  1345
              F++KR SKL+ +E L+LLSLFN++GI F
Sbjct  324   DFEEKRSSKLTQQEFLYLLSLFNKAGIHF  352



>gb|EFN63666.1| Probable dimethyladenosine transferase [Camponotus floridanus]
Length=263

 Score =   221 bits (564),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 145/211 (69%), Gaps = 0/211 (0%)
 Frame = +2

Query  476   KSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMV  655
             KS+GQH+L NP ++ S+V K+ + PTD VLEIGPGTGN+T+K++  A++VIA EID RMV
Sbjct  22    KSKGQHILKNPLIIQSMVEKAALKPTDVVLEIGPGTGNMTVKMLEKAKKVIACEIDPRMV  81

Query  656   EILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSA  835
               L KR        KL ++  D LK++ P FDL VANIPY ISSPL+ KL+     +R A
Sbjct  82    AELQKRVQGTVYQSKLQIMVGDVLKSDLPFFDLCVANIPYQISSPLIFKLLSHRPIFRCA  141

Query  836   TLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHP  1015
              L+ Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+S+VV+I P
Sbjct  142   VLMFQREFAERLVAKPGDKLYCRLSINTQLLARVDMLMKVGKNNFRPPPKVESNVVRIEP  201

Query  1016  KASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             +   P +N  EW   TR  F +KNKTL ATF
Sbjct  202   RNPPPPINYQEWDGLTRIAFIRKNKTLSATF  232



>ref|XP_004499616.1| PREDICTED: probable dimethyladenosine transferase-like [Cicer 
arietinum]
Length=352

 Score =   224 bits (572),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 140/334 (42%), Positives = 200/334 (60%), Gaps = 39/334 (12%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             ++ I   KS+GQH+L NP ++DSIV KS +  TD VLEIGPGTGNLT KL+ A ++VIA+
Sbjct  20    QSGITFHKSKGQHILKNPLLVDSIVQKSGIKSTDIVLEIGPGTGNLTKKLLDAGKKVIAV  79

Query  635   EIDKRMVEILNKRAAEHGL-GDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVF  811
             E+D RM+  L+KR    G+   +L+++  D LKTE P FD+ VANIPY ISSPL  KL+ 
Sbjct  80    EVDPRMILELHKRF--QGVPSSRLTIIQGDVLKTELPYFDICVANIPYQISSPLTFKLLN  137

Query  812   GANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVD  991
                A+R A ++ Q+EFA RL+A PGD  + RL VN +L + +  ++ V K +F P PKVD
Sbjct  138   HQPAFRCAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLHSRISHLLKVGKNNFRPPPKVD  197

Query  992   SSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQES  1171
             SSVV+I P+    +VN  EW  F R CF +KNKTLGA F+QK ++  L K  +  +  + 
Sbjct  198   SSVVRIEPRKPRIEVNQKEWDGFLRICFNRKNKTLGAIFRQKNVISLLEKNYKTVQALKI  257

Query  1172  VEDCSLQSGSEIIEL------------------------------------ASFREMIIN  1243
              ++ SL+     ++                                     + F++ ++ 
Sbjct  258   SQEGSLKETDTKVDFSDFTNFGDDQGMEMDDDGVDDDDEMDVEDGGADEVQSEFKDKVLG  317

Query  1244  ILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             +L  G F++KR SKLS +E L+LLSLFN++GI F
Sbjct  318   VLKEGDFEEKRSSKLSLQEFLYLLSLFNKAGIHF  351



>ref|XP_010087246.1| putative dimethyladenosine transferase [Morus notabilis]
 gb|EXB28596.1| putative dimethyladenosine transferase [Morus notabilis]
Length=355

 Score =   224 bits (572),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 142/353 (40%), Positives = 200/353 (57%), Gaps = 37/353 (10%)
 Frame = +2

Query  395   GGRSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIG  574
             GG++  E+   N       Q   I   KS+GQH+L NP+++DSIV K+ +  TDT+LEIG
Sbjct  3     GGKARKEKPKPNAAAHAPYQ-GGISFHKSKGQHILKNPQLVDSIVQKAGIKTTDTILEIG  61

Query  575   PGTGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDL  754
             PGTGNLT KL+ A + VIA+E+D RMV  L +R     L ++L V+  D LKT+ P FD+
Sbjct  62    PGTGNLTKKLLEAGKAVIAVEVDPRMVLELQRRFQGTPLSNRLKVIKGDVLKTDLPYFDI  121

Query  755   MVANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVAD  934
              VANIPY ISSPL  KL+    ++R A ++ Q+EFA RL+A PGD  + RL VN +L+A 
Sbjct  122   CVANIPYQISSPLTFKLLNHQPSFRCAIIMFQREFAMRLVAQPGDKVYCRLTVNTQLLAR  181

Query  935   VEFVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkq  1114
             V  ++ V K +F   PKVDSSVV+I P+    +V   EW  F R CF +KNKTLG+ F+Q
Sbjct  182   VSHLLKVGKNNFRSPPKVDSSVVRIEPRKPRIEVKQKEWDGFLRICFNRKNKTLGSIFRQ  241

Query  1115  krllm-----elmklqemkeDQESVED-------------------------------CS  1186
             K ++                 Q  +ED                                 
Sbjct  242   KSVVTLLEKNYKTVQALKLSGQGLMEDNDNKMDFSRLGDNNEDLNMDVDDDDDGAEEEME  301

Query  1187  LQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             ++ G    E + F++ ++ +L  G F++KR SKL+ +E L+LLSLFN++GI F
Sbjct  302   VEDGDVEGEPSEFKDKVLAVLKEGDFEEKRSSKLTLQEFLYLLSLFNKAGIHF  354



>ref|XP_006231964.1| PREDICTED: probable dimethyladenosine transferase isoform X2 
[Rattus norvegicus]
Length=323

 Score =   223 bits (569),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 127/315 (40%), Positives = 184/315 (58%), Gaps = 14/315 (4%)
 Frame = +2

Query  401   RSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPG  580
             R + +E  G ++R        +      GQH+L NP +++SI+ K+ + PTD VLE+GPG
Sbjct  22    RRDRQEQRGELKR-----AGGLMFNTGIGQHILKNPLIVNSIIDKAALRPTDVVLEVGPG  76

Query  581   TGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMV  760
             TGN+T+KL+  A++V+A E+D R+V  L+KR     L  KL V+  D LK++ P FD  V
Sbjct  77    TGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPLASKLQVLVGDVLKSDLPFFDACV  136

Query  761   ANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVE  940
             AN+PY ISSP + KL+     +R A L+ Q+EFA RL+A PGD  + RL++N +L+A V+
Sbjct  137   ANLPYQISSPFVFKLLLHRPFFRCAILMFQREFALRLVAKPGDKLYCRLSINTQLLARVD  196

Query  941   FVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr  1120
              +M V K +F P PKV+SSVV+I PK   P +N  EW    R  F +KNKTL A F    
Sbjct  197   HLMKVGKNNFRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRITFVRKNKTLSAAF----  252

Query  1121  llmelmklqemkeDQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlshee  1300
                      +   ++     CS+Q+ + I E  S  + I  IL++ GF DKR   +  ++
Sbjct  253   ----KSSAVQQLLEKNYRIHCSVQN-TVIPEDFSIADKIQQILTNTGFSDKRARSMDIDD  307

Query  1301  llhllslFNQSGISF  1345
              + LL  FN  GI F
Sbjct  308   FIRLLHGFNAEGIHF  322



>ref|XP_004416079.1| PREDICTED: probable dimethyladenosine transferase [Odobenus rosmarus 
divergens]
Length=313

 Score =   223 bits (568),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVLVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSIHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_004623115.1| PREDICTED: probable dimethyladenosine transferase [Octodon degus]
Length=313

 Score =   223 bits (568),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L +KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLANKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSNAVQQLLEKNYRIHCSIHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_007079973.1| PREDICTED: probable dimethyladenosine transferase isoform X1 
[Panthera tigris altaica]
Length=313

 Score =   223 bits (568),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVLVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|NP_001272529.1| dimethyladenosine transferase 1-like protein [Capra hircus]
 gb|AER59665.1| dimethyladenosine transferase 1-like protein [Capra hircus]
Length=313

 Score =   223 bits (568),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSIHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>gb|EZA52464.1| putative dimethyladenosine transferase [Cerapachys biroi]
Length=313

 Score =   223 bits (568),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 143/209 (68%), Gaps = 0/209 (0%)
 Frame = +2

Query  482   RGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEI  661
             +GQH+L NP ++ S++ KS + PTD VLEIGPGTGNLT+KL+  A+RV+A EID R+V  
Sbjct  27    KGQHILKNPLIIQSMIDKSGIKPTDVVLEIGPGTGNLTVKLLEKAKRVLAYEIDPRLVAE  86

Query  662   LNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATL  841
             L KR        KL +V  D LK+  PRFDL +ANIPY ISSPL+ KL+    +++ A L
Sbjct  87    LQKRTQGTAFQSKLEIVIGDVLKSNLPRFDLCIANIPYKISSPLVFKLLAHRPSFKCAIL  146

Query  842   LLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKA  1021
             +LQ+EFA RL+A PGD  + RL+VN +L+A V  +M V K +F P PKV+S+VV+I PK 
Sbjct  147   MLQREFAERLVAKPGDKLYCRLSVNTQLLARVHMLMKVGKNNFRPPPKVESNVVRIEPKD  206

Query  1022  SIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
                 VN  EW A TR  F +KNKTL A F
Sbjct  207   QALPVNYKEWDALTRIAFNRKNKTLSAAF  235



>ref|XP_006906118.1| PREDICTED: probable dimethyladenosine transferase [Pteropus alecto]
Length=313

 Score =   223 bits (567),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIEKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV++ PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRLEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSIHN-TI  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_003462759.1| PREDICTED: probable dimethyladenosine transferase [Cavia porcellus]
Length=313

 Score =   223 bits (567),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSIHN-TI  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S    I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIANKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_006927818.1| PREDICTED: probable dimethyladenosine transferase isoform X2 
[Felis catus]
Length=285

 Score =   222 bits (565),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  7     GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  66

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  67    HKRVQGTPLASKLQVLVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  126

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P P+V+SSVV+I PK  
Sbjct  127   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPRVESSVVRIEPKNP  186

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  187   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  237

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  238   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  284



>ref|XP_008689603.1| PREDICTED: probable dimethyladenosine transferase isoform X2 
[Ursus maritimus]
Length=285

 Score =   222 bits (565),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  7     GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  66

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  67    HKRVQGTPLASKLQVLVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  126

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  127   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  186

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  187   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  237

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S G+ DKR   +  ++ + LL  FN  GI F
Sbjct  238   IPEDFSIADKIQQILTSTGYSDKRARSMDIDDFIRLLHGFNAEGIHF  284



>ref|NP_496061.2| Protein E02H1.1 [Caenorhabditis elegans]
 sp|Q09522.2|DIM1_CAEEL RecName: Full=Probable dimethyladenosine transferase; AltName: 
Full=Probable 18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase; 
AltName: Full=Probable 18S rRNA dimethylase; 
AltName: Full=Probable S-adenosylmethionine-6-N',N'-adenosyl(rRNA) 
dimethyltransferase [Caenorhabditis elegans]
 emb|CAA87382.2| Protein E02H1.1 [Caenorhabditis elegans]
Length=308

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 129/293 (44%), Positives = 182/293 (62%), Gaps = 19/293 (6%)
 Frame = +2

Query  482   RGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEI  661
             +GQH+L NP V+++IV KS +  TDTVLE+GPGTGNLT+K++  A+ VIA EID RM+  
Sbjct  28    KGQHILKNPGVVNAIVEKSALKATDTVLEVGPGTGNLTVKMLEVAKTVIACEIDPRMIAE  87

Query  662   LNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATL  841
             + KR     L +KL V   D +K E+P FD+ VAN+PY ISSP + KL+      R A L
Sbjct  88    VKKRVMGTPLQNKLQVNGGDVMKMEWPFFDVCVANLPYQISSPFVQKLLLHRPLPRYAVL  147

Query  842   LLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKA  1021
             + QKEFA RL+A PGD +++RL+VNV+L+A VE +M V + +F P PKVDS+VV+I PK 
Sbjct  148   MFQKEFADRLVARPGDKDYSRLSVNVQLLAKVEMLMKVKRTEFRPPPKVDSAVVRIAPKN  207

Query  1022  SIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVED-----CS  1186
               P VN  EW    R CF +KNKTL A F+   ++             E +ED     CS
Sbjct  208   PPPPVNFVEWEGLLRLCFMRKNKTLMAIFRLSNVI-------------EVIEDNFRKVCS  254

Query  1187  LQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
              ++   I +  + +++I   L++ G+ + R  K+  E+ L LL  FN++ I F
Sbjct  255   FKN-KPIPKDLNMKKVIEETLTASGYGESRARKMRVEDFLALLLAFNKADIHF  306



>ref|XP_005392699.1| PREDICTED: probable dimethyladenosine transferase [Chinchilla 
lanigera]
Length=313

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP V++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLVVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSIHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_007222323.1| hypothetical protein PRUPE_ppa008082mg [Prunus persica]
 ref|XP_008218867.1| PREDICTED: probable dimethyladenosine transferase [Prunus mume]
 ref|XP_008218868.1| PREDICTED: probable dimethyladenosine transferase [Prunus mume]
 gb|EMJ23522.1| hypothetical protein PRUPE_ppa008082mg [Prunus persica]
Length=346

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/218 (51%), Positives = 146/218 (67%), Gaps = 0/218 (0%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV KS +  TD +LEIGPGTGNLT KL+   +RVIA+
Sbjct  20    QGGISFHKSKGQHILKNPLLVDSIVQKSGIKSTDVILEIGPGTGNLTKKLLEVGKRVIAV  79

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV  L +R       ++L V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  80    EIDARMVLELQRRFQGTPHSNRLQVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLKH  139

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R A ++ Q+EFA RL+A PGD  + RL VN +L++ V  ++ V + +F P PKVDS
Sbjct  140   QPAFRCAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLLSRVSHLLKVGRNNFRPPPKVDS  199

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             SVV+I P+    +VN  EW  F R CF +KNKTLG+ F
Sbjct  200   SVVRIEPRKPPFEVNQKEWDGFLRICFNRKNKTLGSIF  237



>ref|NP_001099878.2| probable dimethyladenosine transferase [Rattus norvegicus]
 gb|AAI58730.1| DIM1 dimethyladenosine transferase 1-like (S. cerevisiae) [Rattus 
norvegicus]
Length=313

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 127/315 (40%), Positives = 183/315 (58%), Gaps = 14/315 (4%)
 Frame = +2

Query  401   RSNHEEDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPG  580
             R + +E  G ++R        +      GQH+L NP +++SI+ K+ + PTD VLE+GPG
Sbjct  12    RRDRQEQRGELKR-----AGGLMFNTGIGQHILKNPLIVNSIIDKAALRPTDVVLEVGPG  66

Query  581   TGNLTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMV  760
             TGN+T+KL+  A++V+A E+D R+V  L+KR     L  KL V+  D LK++ P FD  V
Sbjct  67    TGNMTVKLLEKAKKVVACELDPRLVAELHKRVQGTPLASKLQVLVGDVLKSDLPFFDACV  126

Query  761   ANIPYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVE  940
             AN+PY ISSP + KL+     +R A L+ Q+EFA RL A PGD  + RL++N +L+A V+
Sbjct  127   ANLPYQISSPFVFKLLLHRPFFRCAILMFQREFALRLAAKPGDKLYCRLSINTQLLARVD  186

Query  941   FVMDVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkr  1120
              +M V K +F P PKV+SSVV+I PK   P +N  EW    R  F +KNKTL A F    
Sbjct  187   HLMKVGKNNFRPPPKVESSVVRIEPKNPPPPINFQEWDGLVRITFVRKNKTLSAAF----  242

Query  1121  llmelmklqemkeDQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlshee  1300
                      +   ++     CS+Q+ + I E  S  + I  IL++ GF DKR   +  ++
Sbjct  243   ----KSSAVQQLLEKNYRIHCSVQN-TVIPEDFSIADKIQQILTNTGFSDKRARSMDIDD  297

Query  1301  llhllslFNQSGISF  1345
              + LL  FN  GI F
Sbjct  298   FIRLLHGFNAEGIHF  312



>ref|XP_007949747.1| PREDICTED: probable dimethyladenosine transferase [Orycteropus 
afer afer]
Length=314

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/287 (43%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R++  L
Sbjct  36    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLIAEL  95

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  96    HKRVQGTSLASKLQVMVGDVLKTDLPFFDTCVANLPYQISSPFIFKLLLHRPFFRCAILM  155

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  156   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  215

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  216   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSIHN-TI  266

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL++ GF DKR   +  ++ + LL  FN  GI F
Sbjct  267   IPEDFSIADKIQQILTNTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  313



>ref|XP_005659022.1| PREDICTED: probable dimethyladenosine transferase isoform X1 
[Sus scrofa]
 ref|XP_005659023.1| PREDICTED: probable dimethyladenosine transferase isoform X2 
[Sus scrofa]
Length=285

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  7     GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  66

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  +L V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  67    HKRVQGTPLASRLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  126

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  127   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  186

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  187   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  237

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  238   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  284



>ref|XP_003496259.1| PREDICTED: probable dimethyladenosine transferase isoform X1 
[Cricetulus griseus]
 gb|EGV92064.1| putative dimethyladenosine transferase [Cricetulus griseus]
 gb|ERE84032.1| putative dimethyladenosine transferase-like protein [Cricetulus 
griseus]
Length=313

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LK++ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVLVGDVLKSDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  215   PPPINFQEWDGLVRIAFVRKNKTLSAAF--------KSSAVQQLLERNYRIHCSVHN-TV  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_001689703.1| dimethyladenosine transferase [Chlamydomonas reinhardtii]
 gb|EDP09441.1| dimethyladenosine transferase [Chlamydomonas reinhardtii]
Length=352

 Score =   224 bits (570),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 141/331 (43%), Positives = 191/331 (58%), Gaps = 24/331 (7%)
 Frame = +2

Query  425   GNVRRKIENQEAN-----IYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGN  589
             G V++K + +  N     +   KS+GQH+L NP V+ +IV K+ V  TD VLEIGPGTGN
Sbjct  21    GGVQKKSQKKGPNTGVSGLEFHKSKGQHILRNPLVVQAIVDKAGVKSTDVVLEIGPGTGN  80

Query  590   LTLKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANI  769
             LT+KL+  A++VIA+E+D RMV  L +R       + L ++  D ++ E P FDL VANI
Sbjct  81    LTVKLLEKAKKVIAVELDPRMVLELQRRVQGTPYANNLQIIHGDFMRVELPYFDLCVANI  140

Query  770   PYGISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVM  949
             PY ISSPL  KL+    A+R+A ++ Q EFA RL+A  GD+ ++RLAVN +L+A V  ++
Sbjct  141   PYNISSPLTFKLLAHRPAFRAAVIMYQHEFAMRLVAKAGDNLYSRLAVNTQLLARVSHLL  200

Query  950   DVSKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllm  1129
              V K +F P PKVDSSVV+I P+   P VN  EW    R CF++KNKTLGA FKQ   L 
Sbjct  201   KVGKNNFRPPPKVDSSVVRIEPRHPPPPVNFLEWDGLVRLCFSRKNKTLGAIFKQTNTLQ  260

Query  1130  elmklqemkeDQESVEDCSLQSGSEIIELA-------------------SFREMIINILS  1252
              L       +D     D        +   A                    F+E+++ +L 
Sbjct  261   ALETNWRTYQDDAMDGDDDNDDAMTVDGGAGGGGGGGRGGRRAGGKVSPEFKELVMKVLE  320

Query  1253  SGGFDDKRPSKlsheellhllslFNQSGISF  1345
               G D  R SK+S EE L LL+LFN +GI F
Sbjct  321   DNGLDTNRSSKMSQEEFLQLLALFNAAGIHF  351



>ref|XP_010334886.1| PREDICTED: probable dimethyladenosine transferase isoform X2 
[Saimiri boliviensis boliviensis]
Length=285

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  7     GQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  66

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     +  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  67    HKRVQGTPMASKLQVLVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  126

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  127   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  186

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  187   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  237

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  238   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  284



>ref|XP_009239016.1| PREDICTED: probable dimethyladenosine transferase isoform X2 
[Pongo abelii]
Length=285

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  7     GQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  66

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     +  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  67    HKRVQGTPVASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAILM  126

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  127   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  186

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  187   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  237

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I +IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  238   IPEDFSIADKIQHILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  284



>ref|XP_005356821.1| PREDICTED: probable dimethyladenosine transferase [Microtus ochrogaster]
Length=313

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LK++ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVLVGDVLKSDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLERNYRIHCSVHN-TV  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_004608527.1| PREDICTED: probable dimethyladenosine transferase [Sorex araneus]
Length=313

 Score =   222 bits (566),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R++  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLIAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     +  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPVASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSIHN-TI  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_004498555.1| PREDICTED: probable dimethyladenosine transferase-like isoform 
X1 [Cicer arietinum]
Length=352

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 138/333 (41%), Positives = 198/333 (59%), Gaps = 37/333 (11%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             ++ I   KS+GQH+L NP ++D+IV KS +  TD VLEIGPGTGNLT KL+ A ++VIA+
Sbjct  20    QSGITFHKSKGQHILKNPLLVDTIVQKSGIKTTDIVLEIGPGTGNLTKKLLDAGKKVIAV  79

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             E+D RMV  L+KR  +     +L+V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  80    EVDPRMVLELHKRF-QGTPSTRLTVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLNH  138

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R A ++ Q+EFA RL+A PGD  + RL VN +L + +  ++ V + +F P PKVDS
Sbjct  139   QPAFRCAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLHSRISHLLKVGRNNFRPPPKVDS  198

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESV  1174
             SVV+I P+    +VN  EW  F R CF +KNKTLGA F+QK ++  L    +  +  +  
Sbjct  199   SVVRIEPRKPRIEVNQKEWDGFLRICFNRKNKTLGAIFRQKNVISLLENNYKTVQALKIS  258

Query  1175  EDCSLQSGSEIIEL------------------------------------ASFREMIINI  1246
             ++ SL+     ++                                     + F++ ++ +
Sbjct  259   QEGSLKETDTKVDFSDFTDFGDDQGMEMDDDRVDDDDEMDVEDGGADEVQSEFKDKVLGV  318

Query  1247  LSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             L  G F++KR SKLS +E L+LLSLFN++GI F
Sbjct  319   LKEGDFEEKRSSKLSLQEFLYLLSLFNKAGIHF  351



>ref|XP_001493943.1| PREDICTED: probable dimethyladenosine transferase [Equus caballus]
 ref|XP_008538830.1| PREDICTED: probable dimethyladenosine transferase [Equus przewalskii]
Length=313

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLAGKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQRLLEKNYRIHCSVHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_008577803.1| PREDICTED: probable dimethyladenosine transferase [Galeopterus 
variegatus]
Length=313

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPLFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-TI  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILISTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_003981054.1| PREDICTED: probable dimethyladenosine transferase isoform X1 
[Felis catus]
Length=313

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVLVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P P+V+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPRVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_009206739.1| PREDICTED: probable dimethyladenosine transferase isoform X2 
[Papio anubis]
Length=285

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  7     GQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  66

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     +  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  67    HKRVQGTPVASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAILM  126

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  127   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  186

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  187   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  237

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  238   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  284



>ref|XP_001636433.1| predicted protein [Nematostella vectensis]
 gb|EDO44370.1| predicted protein [Nematostella vectensis]
Length=308

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/287 (45%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP V+ S+V K+ +  TDTVLEIGPGTGNLT+KL+  +++VIA E+D RMV  L
Sbjct  30    GQHILKNPLVITSLVDKAGLRSTDTVLEIGPGTGNLTVKLLEQSKKVIACELDPRMVAEL  89

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
              KR     L  KLSV+  D LKT+ P FD+ VAN+PY ISSP + KL+     +R A L+
Sbjct  90    QKRVQGTPLQSKLSVMVGDVLKTDLPFFDVCVANLPYQISSPFVFKLLLHRPFFRCAVLM  149

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA+RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  150   FQREFAQRLIAKPGDKLYCRLSINTQLLARVDHIMKVGKNNFRPPPKVESSVVRIEPKNP  209

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P VN  EW    R  F +KNKTL A F          +      ++     CSL +G  
Sbjct  210   PPPVNFKEWDGLVRIAFVRKNKTLSACF--------NSRPVLEVLEKNYKIHCSL-NGIM  260

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             +      +E I  ILS    D KR   +  ++ L LL+LFN +GI F
Sbjct  261   VDSDFDMKEKIQQILSESENDKKRARTMDIDDFLALLTLFNSNGIHF  307



>ref|XP_004744652.1| PREDICTED: probable dimethyladenosine transferase isoform X2 
[Mustela putorius furo]
 ref|XP_004789786.1| PREDICTED: probable dimethyladenosine transferase isoform X2 
[Mustela putorius furo]
Length=313

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVLVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLERNYRIHCSVHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_002916330.1| PREDICTED: probable dimethyladenosine transferase-like [Ailuropoda 
melanoleuca]
 ref|XP_008689602.1| PREDICTED: probable dimethyladenosine transferase isoform X1 
[Ursus maritimus]
Length=313

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVLVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S G+ DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGYSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_008854553.1| PREDICTED: probable dimethyladenosine transferase isoform X2 
[Nannospalax galili]
Length=285

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 122/287 (43%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  7     GQHILKNPLIVNSIIEKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  66

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LK++ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  67    HKRVQGTPLASKLQVLVGDVLKSDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAILM  126

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I P+  
Sbjct  127   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPRNP  186

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  187   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-TV  237

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  238   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  284



>ref|XP_007130480.1| PREDICTED: probable dimethyladenosine transferase isoform X1 
[Physeter catodon]
Length=313

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  35    GQHVLKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDLRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_002428215.1| dimethyladenosine transferase, putative [Pediculus humanus corporis]
 gb|EEB15477.1| dimethyladenosine transferase, putative [Pediculus humanus corporis]
Length=306

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 128/290 (44%), Positives = 172/290 (59%), Gaps = 9/290 (3%)
 Frame = +2

Query  476   KSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMV  655
             KS GQH+L NP V+ ++V K+ +  TD VLEIGPGTGN+T+KL+  A++VIA E+D RMV
Sbjct  25    KSAGQHILKNPLVIQNMVEKAALKSTDIVLEIGPGTGNMTVKLLDKAKKVIACEVDVRMV  84

Query  656   EILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSA  835
               L KR        KL ++  D LK+E P F+  VANIPY ISSPL+ KL+     +R A
Sbjct  85    AELQKRVQCTPYQSKLEIIVGDVLKSELPFFNACVANIPYQISSPLVFKLLLHRPFFRCA  144

Query  836   TLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHP  1015
              L+ QKEFA RL+A PGD  + RL++N +L+A V+ VM V+K +F P PKV+SSVV+I P
Sbjct  145   ILMFQKEFAHRLVAKPGDKLYCRLSINTQLLARVDIVMKVAKNNFRPPPKVESSVVRIEP  204

Query  1016  KASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQS  1195
             +   P +   EW   TR  F +KNKTLGA F                 ++  +  CSL +
Sbjct  205   RNPPPPIQFKEWDGLTRIAFLRKNKTLGAAF--------RQTSVLAVLEKNYMIHCSL-N  255

Query  1196  GSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
               EI    + +E I  IL   G D KR   +  ++ L +L  FN  GI F
Sbjct  256   NIEIPNNFNIKEKIEPILEKIGADSKRARTMDIDDFLSVLYAFNAEGIHF  305



>ref|XP_007451233.1| PREDICTED: probable dimethyladenosine transferase [Lipotes vexillifer]
Length=310

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  32    GQHVLKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDIRLVAEL  91

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  92    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  151

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  152   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  211

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  212   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  262

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  263   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  309



>ref|XP_006731288.1| PREDICTED: probable dimethyladenosine transferase [Leptonychotes 
weddellii]
Length=313

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 172/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A+ VIA E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKTVIACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVLVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSIHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_003925860.1| PREDICTED: probable dimethyladenosine transferase isoform X1 
[Saimiri boliviensis boliviensis]
Length=313

 Score =   222 bits (565),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     +  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPMASKLQVLVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>pdb|1ZQ9|A Chain A, Crystal Structure Of Human Dimethyladenosine Transferase
 pdb|1ZQ9|B Chain B, Crystal Structure Of Human Dimethyladenosine Transferase
Length=285

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  7     GQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  66

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     +  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  67    HKRVQGTPVASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAILM  126

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  127   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  186

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  187   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  237

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  238   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  284



>ref|XP_004275240.1| PREDICTED: probable dimethyladenosine transferase isoform 2 [Orcinus 
orca]
 ref|XP_004329094.1| PREDICTED: probable dimethyladenosine transferase isoform 2 [Tursiops 
truncatus]
Length=313

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  35    GQHVLKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDVRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_004374612.1| PREDICTED: probable dimethyladenosine transferase [Trichechus 
manatus latirostris]
Length=313

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP V++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLVVNSIIDKAALRPTDVVLEVGPGTGNMTIKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTSLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-TI  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I +  S  + I  IL++ GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPDDFSIADKIQQILTNTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|NP_001231242.1| probable dimethyladenosine transferase [Sus scrofa]
Length=313

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  +L V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASRLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_007176118.1| PREDICTED: probable dimethyladenosine transferase isoform X1 
[Balaenoptera acutorostrata scammoni]
Length=313

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 125/287 (44%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++VIA E+D R+V  L
Sbjct  35    GQHVLKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVIACELDLRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAVLM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>gb|EHJ76049.1| dimethyladenosine transferase [Danaus plexippus]
Length=306

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 127/310 (41%), Positives = 178/310 (57%), Gaps = 11/310 (4%)
 Frame = +2

Query  416   EDDGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLT  595
             E    V  +I  Q   I   K  GQH+L NP ++ S++ K+ + PTD  LEIGPGTGN+T
Sbjct  7     EKKSRVHNEIAKQ--GIQFNKDFGQHILKNPLIITSMLDKAGLRPTDVALEIGPGTGNMT  64

Query  596   LKLVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPY  775
             +K++   ++VIA EID R+V  L KR        KL ++  D LKTE P FD+ VANIPY
Sbjct  65    IKMLDRVKKVIACEIDTRLVAELQKRVQGTPYQAKLQILVGDVLKTELPFFDICVANIPY  124

Query  776   GISSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDV  955
              ISSPL+ KL+     +R A L+ Q+EFA+RL+A PGD  + RL++N +L+A V+ +M V
Sbjct  125   QISSPLVFKLLLHRPFFRCAVLMFQQEFAQRLVAKPGDKLYCRLSINTQLLARVDMLMKV  184

Query  956   SKRDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmel  1135
              K +F P PKV+SSVV+I P+   P +N  EW   TR  F +KNKTL A+F         
Sbjct  185   GKNNFRPPPKVESSVVRIEPRNPPPPINFVEWDGLTRIAFVRKNKTLSASF--------K  236

Query  1136  mklqemkeDQESVEDCSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhll  1315
                     ++     CSL +  EI E    ++ I +IL++   D  R   +  ++ + LL
Sbjct  237   QSTTLAVLEKNYKVHCSLHN-KEIPEDFDIKQKIQDILTTAEADQMRARTMDVDDFMKLL  295

Query  1316  slFNQSGISF  1345
               FN  GI F
Sbjct  296   HAFNSEGIHF  305



>ref|XP_001955370.1| GF16271 [Drosophila ananassae]
 gb|EDV43931.1| GF16271 [Drosophila ananassae]
Length=306

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/229 (48%), Positives = 149/229 (65%), Gaps = 0/229 (0%)
 Frame = +2

Query  422   DGNVRRKIENQEANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLK  601
             +   R   E Q+  I   K  GQH+L NP V+ S++ K+ + PTD VLEIGPGTGN+T++
Sbjct  7     EKKTRIHTEVQKQGIVFNKDFGQHILKNPLVITSMLEKAALRPTDVVLEIGPGTGNMTVR  66

Query  602   LVSAAERVIAIEIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGI  781
             ++  A++VIA EID R+   L KR     L  KL V+  D LK E P FDL +AN+PY I
Sbjct  67    MLEKAKKVIACEIDTRLAAELQKRVQATPLQPKLQVLIGDFLKAELPFFDLCIANVPYQI  126

Query  782   SSPLLAKLVFGANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSK  961
             SSPL+ KL+     +R A L+ Q+EFA+RL+A PGD  + RL++N +L+A V+ +M V K
Sbjct  127   SSPLIFKLLLHRPLFRCAVLMFQREFAQRLVAKPGDKLYCRLSINTQLLARVDMLMKVGK  186

Query  962   RDFLPCPKVDSSVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
              +F P PKV+SSVV++ PK   P VN  EW   TR  F +KNKTL ATF
Sbjct  187   NNFKPPPKVESSVVRLEPKNPPPPVNFTEWDGLTRIAFLRKNKTLAATF  235



>ref|XP_003408103.1| PREDICTED: probable dimethyladenosine transferase [Loxodonta 
africana]
Length=313

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LK + P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVMVGDVLKADLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CSL + + 
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSLHN-TI  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL++ GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTNTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_002629730.1| Hypothetical protein CBG00961 [Caenorhabditis briggsae]
 emb|CAP22289.1| Protein CBG00961 [Caenorhabditis briggsae]
Length=308

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 128/293 (44%), Positives = 182/293 (62%), Gaps = 19/293 (6%)
 Frame = +2

Query  482   RGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEI  661
             +GQH+L NP V+++IV KS +  TDTVLE+GPGTGNLT+K++  A+ VIA EID RM+  
Sbjct  28    KGQHILKNPGVVNAIVEKSALKSTDTVLEVGPGTGNLTVKMLEVAKTVIACEIDPRMIAE  87

Query  662   LNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATL  841
             + KR     L  KL V   D +K E+P FD+ VAN+PY ISSP + KL+      R A L
Sbjct  88    VKKRVMGTPLQTKLQVNGGDVMKQEWPFFDVCVANLPYQISSPFVQKLLLHRPLPRYAVL  147

Query  842   LLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKA  1021
             + QKEFA RL+A PGD +++RL+VNV+L+A VE +M V + +F P PKVDS+VV+I PK 
Sbjct  148   MFQKEFADRLVARPGDKDYSRLSVNVQLLAKVEMLMKVKRTEFRPPPKVDSAVVRIAPKN  207

Query  1022  SIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVED-----CS  1186
               P VN  EW    R CF +KNKTL A F+   ++             E +ED     CS
Sbjct  208   PPPPVNFVEWEGLLRLCFMRKNKTLLAIFRLSNVI-------------EVIEDNYRKVCS  254

Query  1187  LQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             +++   + +  + +++I   L++ G+ + R  K+  E+ L LL  FN++ I F
Sbjct  255   MKN-KPLPKDFNMKKLIEETLTASGYAENRARKMRVEDFLALLLAFNKADIHF  306



>ref|NP_001242880.1| uncharacterized protein LOC100819707 [Glycine max]
 gb|ACU18732.1| unknown [Glycine max]
Length=308

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 113/218 (52%), Positives = 147/218 (67%), Gaps = 0/218 (0%)
 Frame = +2

Query  455   EANIYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAI  634
             +  I   KS+GQH+L NP ++DSIV K+ V  TD +LEIGPGTGNLT KL+ A ++VIAI
Sbjct  23    QGGISFHKSKGQHILKNPLLVDSIVEKAGVKSTDVILEIGPGTGNLTKKLLEAGKKVIAI  82

Query  635   EIDKRMVEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFG  814
             EID RMV  L +R       ++L+V+  D LKTE P FD+ VANIPY ISSPL  KL+  
Sbjct  83    EIDPRMVLELQRRFQGTPHSNRLTVIQGDVLKTELPYFDICVANIPYQISSPLTFKLLKH  142

Query  815   ANAYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDS  994
               A+R+A ++ Q+EFA RL+A PGD  + RL VN +L A V  ++ V + +F P PKVDS
Sbjct  143   EPAFRAAIIMFQREFAMRLVAQPGDKLYCRLTVNTQLHARVFHLLKVGRNNFRPPPKVDS  202

Query  995   SVVKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATF  1108
             SVV+I P+    +V   EW  F R CF +KNKTLG+ F
Sbjct  203   SVVRIEPRKPRIEVKQKEWDGFLRICFNRKNKTLGSIF  240



>ref|XP_002815639.1| PREDICTED: probable dimethyladenosine transferase isoform X1 
[Pongo abelii]
Length=313

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     +  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPVASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I +IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQHILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_001419390.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97683.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=320

 Score =   221 bits (564),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 130/295 (44%), Positives = 184/295 (62%), Gaps = 15/295 (5%)
 Frame = +2

Query  464   IYLLKSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEID  643
             I  LKS GQH+L NP ++++IV K+ V  TD VLEIGPGTGNLT KL+ A ++VIA+E D
Sbjct  39    IQFLKSFGQHILKNPAIVNAIVDKAGVKSTDVVLEIGPGTGNLTTKLLDACKKVIAVEFD  98

Query  644   KRMVEILNKRA-AEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGAN  820
              RMV  L +R  ++     +L ++  D LK + P FD+ VAN+PY ISSPL+ KL+    
Sbjct  99    PRMVLELRRRVQSDPAQNSRLEIIQGDFLKVDLPYFDVCVANVPYQISSPLIFKLLAHRP  158

Query  821   AYRSATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSV  1000
              +RSATL+ Q+EFA RL+A PGD+ + RL+VN +L+A  + ++ V K +F P PKVDSSV
Sbjct  159   MFRSATLMFQREFAMRLVAPPGDALYCRLSVNTQLLARTQHILKVGKNNFRPPPKVDSSV  218

Query  1001  VKIHPKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVED  1180
             V+I P+     VN  EW    R CF +KNKTLG  F+ K +L  L       +  + V D
Sbjct  219   VRIEPRHPQIPVNFKEWDGLVRFCFGRKNKTLGGIFRTKNVLELLTNNFRTYKALQVVPD  278

Query  1181  CSLQSGSEIIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
                            +++I ++L++ GF + R SK+S ++ L LL++FN  GI F
Sbjct  279   K--------------KQLIEDVLATDGFGEMRSSKMSQDDFLRLLAVFNSKGIHF  319



>ref|XP_007971844.1| PREDICTED: probable dimethyladenosine transferase [Chlorocebus 
sabaeus]
Length=313

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     +  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPVASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_002806669.1| PREDICTED: LOW QUALITY PROTEIN: probable dimethyladenosine transferase 
[Callithrix jacchus]
Length=313

 Score =   221 bits (563),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     +  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPVASKLQVLVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>dbj|BAE26964.1| unnamed protein product [Mus musculus]
Length=313

 Score =   221 bits (563),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A  +D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACGLDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LK++ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVLVGDVLKSDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+Q+ + 
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVQN-TV  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_006876251.1| PREDICTED: probable dimethyladenosine transferase [Chrysochloris 
asiatica]
Length=313

 Score =   221 bits (563),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/287 (43%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVMVGDVLKTDLPFFDACVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-TI  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL++ GF DKR   +  ++ + LL  FN  G+ F
Sbjct  266   IPEDFSIADKIQQILTNTGFSDKRARSMDIDDFIRLLHGFNAEGVHF  312



>ref|XP_008854547.1| PREDICTED: probable dimethyladenosine transferase isoform X1 
[Nannospalax galili]
Length=313

 Score =   221 bits (563),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/287 (43%), Positives = 174/287 (61%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIVNSIIEKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     L  KL V+  D LK++ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPLASKLQVLVGDVLKSDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I P+  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPRNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ + + 
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-TV  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_010383496.1| PREDICTED: probable dimethyladenosine transferase isoform X3 
[Rhinopithecus roxellana]
Length=285

 Score =   220 bits (560),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 172/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  7     GQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  66

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR        KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  67    HKRVQGTPAASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAILM  126

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  127   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  186

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  187   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  237

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  238   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  284



>gb|EMT07530.1| Putative dimethyladenosine transferase [Aegilops tauschii]
Length=485

 Score =   226 bits (576),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 200/324 (62%), Gaps = 36/324 (11%)
 Frame = +2

Query  476   KSRGQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAER-VIAIEIDKRM  652
             KS+GQH+L NP ++DSI+ K+ + PTDTVLEIGPGTGNLT +L+ A  + V+A+E+D RM
Sbjct  26    KSKGQHILRNPALVDSIIAKAGLKPTDTVLEIGPGTGNLTKRLLEAGVKAVVAVELDPRM  85

Query  653   VEILNKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRS  832
             V  L++R   H L  +L V+  D LK + P FD+ VANIPY ISSPL  KL+     +R 
Sbjct  86    VLELSRRFQGHPLSSRLKVIQGDVLKCDLPYFDICVANIPYQISSPLTFKLLSHRPIFRC  145

Query  833   ATLLLQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIH  1012
             A ++ Q+EFA RL+A PGD+ + RL+VNV+L++ V  ++ V + +F P PKVDSSVV+I 
Sbjct  146   AVIMFQREFAMRLVAQPGDTLYCRLSVNVQLLSRVSHLLKVGRNNFRPPPKVDSSVVRIE  205

Query  1013  PKASIPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeD----QES---  1171
             P+  +P V+  EW    R CF +KNKTLG+ FKQKR+L  L K  +  +     Q+S   
Sbjct  206   PRKPLPPVSFKEWDGLVRICFNRKNKTLGSLFKQKRVLELLEKNYKTMQSLQLAQDSGTG  265

Query  1172  ---------------VEDCSLQSGSEIIEL-------------ASFREMIINILSSGGFD  1267
                            VED S+++  E  +               SF+E I+ IL  G F 
Sbjct  266   EEKMSPYDVALLANMVEDLSMETSDEKEDDDMEMDDADAADGRTSFKEKIMGILQQGDFA  325

Query  1268  DKRPSKlsheellhllslFNQSGI  1339
             +KR SKLS  + L+LLSLFN++ +
Sbjct  326   EKRSSKLSQVDFLYLLSLFNKAAL  349



>ref|NP_055288.1| probable dimethyladenosine transferase [Homo sapiens]
 ref|XP_517743.2| PREDICTED: probable dimethyladenosine transferase [Pan troglodytes]
 ref|XP_003827467.1| PREDICTED: probable dimethyladenosine transferase [Pan paniscus]
 ref|XP_003899764.1| PREDICTED: probable dimethyladenosine transferase isoform X1 
[Papio anubis]
 sp|Q9UNQ2.1|DIM1_HUMAN RecName: Full=Probable dimethyladenosine transferase; AltName: 
Full=DIM1 dimethyladenosine transferase 1 homolog; AltName: 
Full=DIM1 dimethyladenosine transferase 1-like; AltName: Full=Probable 
18S rRNA (adenine(1779)-N(6)/adenine(1780)-N(6))-dimethyltransferase; 
AltName: Full=Probable 18S rRNA dimethylase; 
AltName: Full=Probable S-adenosylmethionine-6-N',N'-adenosyl(rRNA) 
dimethyltransferase [Homo sapiens]
 gb|AAC97955.1| putative dimethyladenosine transferase [Homo sapiens]
 gb|AAH10874.1| DIM1 dimethyladenosine transferase 1-like (S. cerevisiae) [Homo 
sapiens]
 gb|EAW51385.1| dimethyladenosine transferase, isoform CRA_b [Homo sapiens]
 gb|ABM82408.1| dimethyladenosine transferase [synthetic construct]
 gb|ABM85595.1| dimethyladenosine transferase [synthetic construct]
 gb|ABM85767.1| dimethyladenosine transferase [synthetic construct]
 dbj|BAJ20361.1| DIM1 dimethyladenosine transferase 1-like [synthetic construct]
 gb|EHH26524.1| Putative dimethyladenosine transferase [Macaca mulatta]
 gb|EHH61619.1| Putative dimethyladenosine transferase [Macaca fascicularis]
 gb|AIC56244.1| DIMT1, partial [synthetic construct]
Length=313

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     +  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPVASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



>ref|XP_003266024.1| PREDICTED: probable dimethyladenosine transferase [Nomascus leucogenys]
Length=313

 Score =   221 bits (562),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 173/287 (60%), Gaps = 9/287 (3%)
 Frame = +2

Query  485   GQHLLTNPRVLDSIVGKSNVLPTDTVLEIGPGTGNLTLKLVSAAERVIAIEIDKRMVEIL  664
             GQH+L NP +++SI+ K+ + PTD VLE+GPGTGN+T+KL+  A++V+A E+D R+V  L
Sbjct  35    GQHILKNPLIINSIIDKAALRPTDVVLEVGPGTGNMTVKLLEKAKKVVACELDPRLVAEL  94

Query  665   NKRAAEHGLGDKLSVVCQDALKTEFPRFDLMVANIPYGISSPLLAKLVFGANAYRSATLL  844
             +KR     +  KL V+  D LKT+ P FD  VAN+PY ISSP + KL+     +R A L+
Sbjct  95    HKRVQGTPVASKLQVLVGDVLKTDLPFFDTCVANLPYQISSPFVFKLLLHRPFFRCAILM  154

Query  845   LQKEFARRLLANPGDSEFNRLAVNVKLVADVEFVMDVSKRDFLPCPKVDSSVVKIHPKAS  1024
              Q+EFA RL+A PGD  + RL++N +L+A V+ +M V K +F P PKV+SSVV+I PK  
Sbjct  155   FQREFALRLVAKPGDKLYCRLSINTQLLARVDHLMKVGKNNFRPPPKVESSVVRIEPKNP  214

Query  1025  IPDVNLDEWWAFTRTCFTKKNKTLGATFkqkrllmelmklqemkeDQESVEDCSLQSGSE  1204
              P +N  EW    R  F +KNKTL A F             +   ++     CS+ +   
Sbjct  215   PPPINFQEWDGLVRITFVRKNKTLSAAF--------KSSAVQQLLEKNYRIHCSVHN-II  265

Query  1205  IIELASFREMIINILSSGGFDDKRPSKlsheellhllslFNQSGISF  1345
             I E  S  + I  IL+S GF DKR   +  ++ + LL  FN  GI F
Sbjct  266   IPEDFSIADKIQQILTSTGFSDKRARSMDIDDFIRLLHGFNAEGIHF  312



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4791649556738