BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16598_g1_i1 len=347 path=[2162:0-346]

Length=347
                                                                      Score     E

ref|XP_006842053.1|  hypothetical protein AMTR_s00078p00029420        59.3    2e-08   
emb|CDP10425.1|  unnamed protein product                              57.4    6e-08   
gb|KDO80209.1|  hypothetical protein CISIN_1g028980mg                 57.0    9e-08   
ref|XP_002285328.1|  PREDICTED: axial regulator YABBY 5 isoform X1    56.6    1e-07   Vitis vinifera
ref|XP_006450897.1|  hypothetical protein CICLE_v10009560mg           56.2    1e-07   
ref|XP_006450898.1|  hypothetical protein CICLE_v10009560mg           55.8    1e-07   
ref|XP_006450896.1|  hypothetical protein CICLE_v10009560mg           56.2    1e-07   
ref|XP_006450895.1|  hypothetical protein CICLE_v10009560mg           56.6    1e-07   
gb|KDO80207.1|  hypothetical protein CISIN_1g028980mg                 56.2    1e-07   
ref|XP_010656451.1|  PREDICTED: axial regulator YABBY 5 isoform X2    56.2    2e-07   
ref|XP_002308074.1|  plant-specific transcription factor YABBY fa...  55.5    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_004173724.1|  PREDICTED: axial regulator YABBY 5-like          55.1    4e-07   
ref|XP_004139305.1|  PREDICTED: axial regulator YABBY 5-like          55.1    5e-07   
ref|XP_008457474.1|  PREDICTED: axial regulator YABBY 5               54.7    5e-07   
ref|XP_007155017.1|  hypothetical protein PHAVU_003G166100g           54.7    5e-07   
dbj|BAF65259.1|  YABBY like transcription factor                      53.1    6e-07   Chloranthus serratus
ref|XP_011078402.1|  PREDICTED: axial regulator YABBY 5               53.5    1e-06   
gb|ACJ85113.1|  unknown                                               53.5    1e-06   Medicago truncatula
ref|XP_003609353.1|  YABBY protein                                    53.5    1e-06   
ref|XP_009762054.1|  PREDICTED: axial regulator YABBY 5-like isof...  52.8    2e-06   
ref|XP_010313779.1|  PREDICTED: axial regulator YABBY 5-like isof...  52.8    2e-06   
ref|XP_007202630.1|  hypothetical protein PRUPE_ppa012028mg           53.1    2e-06   
ref|XP_009762052.1|  PREDICTED: axial regulator YABBY 5-like isof...  53.1    2e-06   
ref|XP_008242786.1|  PREDICTED: axial regulator YABBY 5               52.8    2e-06   
ref|XP_004508482.1|  PREDICTED: axial regulator YABBY 5-like          53.1    2e-06   
gb|KCW80170.1|  hypothetical protein EUGRSUZ_C01515                   52.0    2e-06   
dbj|BAF65258.1|  FILAMENTOUS FLOWER like protein                      51.6    2e-06   Nymphaea colorata
ref|XP_004251722.1|  PREDICTED: axial regulator YABBY 5-like isof...  52.8    2e-06   
ref|XP_003542627.1|  PREDICTED: axial regulator YABBY 5-like          52.8    3e-06   
ref|XP_006600135.1|  PREDICTED: uncharacterized protein LOC100499...  52.4    3e-06   
ref|NP_001238347.1|  uncharacterized protein LOC100499942             52.8    3e-06   
ref|XP_006345225.1|  PREDICTED: axial regulator YABBY 5-like          52.8    3e-06   
gb|KCW80169.1|  hypothetical protein EUGRSUZ_C01515                   52.0    3e-06   
ref|XP_004173692.1|  PREDICTED: axial regulator YABBY 5-like          52.4    3e-06   
gb|KDO80208.1|  hypothetical protein CISIN_1g028980mg                 52.8    4e-06   
ref|XP_010048072.1|  PREDICTED: axial regulator YABBY 5               52.0    4e-06   
ref|XP_010254434.1|  PREDICTED: axial regulator YABBY 5-like          52.0    5e-06   
ref|XP_010250140.1|  PREDICTED: axial regulator YABBY 5-like isof...  51.6    6e-06   
ref|XP_010250139.1|  PREDICTED: axial regulator YABBY 5-like isof...  52.0    6e-06   
ref|XP_010250138.1|  PREDICTED: axial regulator YABBY 5-like isof...  52.0    6e-06   
ref|XP_006594909.1|  PREDICTED: putative axial regulator YABBY 2-...  51.6    6e-06   
ref|XP_007150002.1|  hypothetical protein PHAVU_005G117600g           51.6    7e-06   
ref|XP_006358281.1|  PREDICTED: axial regulator YABBY 5-like          51.6    7e-06   
ref|XP_003540284.1|  PREDICTED: putative axial regulator YABBY 2-...  51.6    7e-06   
ref|NP_001276158.1|  uncharacterized protein LOC100785458             51.6    7e-06   
ref|XP_003543399.1|  PREDICTED: putative axial regulator YABBY 2-...  51.6    7e-06   
ref|XP_006594908.1|  PREDICTED: putative axial regulator YABBY 2-...  51.6    7e-06   
ref|XP_007150001.1|  hypothetical protein PHAVU_005G117600g           51.6    7e-06   
gb|AID67113.1|  YAB5 protein                                          51.2    8e-06   
gb|AID67112.1|  YAB5 protein                                          51.2    8e-06   
gb|AID67114.1|  YAB5 protein                                          51.2    8e-06   
gb|KDP42970.1|  hypothetical protein JCGZ_23912                       51.2    9e-06   
ref|XP_004242778.1|  PREDICTED: axial regulator YABBY 5               51.2    9e-06   
gb|AID67111.1|  YAB5 protein                                          51.2    9e-06   
gb|EYU34994.1|  hypothetical protein MIMGU_mgv1a014582mg              50.8    9e-06   
ref|XP_009622268.1|  PREDICTED: axial regulator YABBY 5-like isof...  51.2    1e-05   
gb|EYU34993.1|  hypothetical protein MIMGU_mgv1a014582mg              50.8    1e-05   
ref|XP_009622269.1|  PREDICTED: axial regulator YABBY 5-like isof...  50.4    1e-05   
ref|XP_009785258.1|  PREDICTED: axial regulator YABBY 5               50.8    1e-05   
ref|XP_008449608.1|  PREDICTED: putative axial regulator YABBY 2      50.8    1e-05   
ref|XP_011088989.1|  PREDICTED: putative axial regulator YABBY 2      50.8    1e-05   
dbj|BAF65256.1|  FILAMENTOUS FLOWER like protein                      50.1    1e-05   Brasenia schreberi
ref|XP_004287301.1|  PREDICTED: axial regulator YABBY 5-like          50.8    1e-05   
dbj|BAF65262.1|  FILAMENTOUS FLOWER like protein                      49.7    1e-05   Cabomba caroliniana
ref|XP_010473042.1|  PREDICTED: axial regulator YABBY 5-like          50.1    2e-05   
ref|NP_001280989.1|  putative axial regulator YABBY 2                 50.4    2e-05   
ref|XP_009378607.1|  PREDICTED: putative axial regulator YABBY 2 ...  50.1    2e-05   
ref|XP_008382120.1|  PREDICTED: putative axial regulator YABBY 2 ...  50.4    2e-05   
ref|XP_009378606.1|  PREDICTED: putative axial regulator YABBY 2 ...  50.4    2e-05   
gb|ACU19358.1|  unknown                                               50.1    2e-05   Glycine max [soybeans]
ref|XP_007021796.1|  Plant-specific transcription factor YABBY fa...  49.7    2e-05   
ref|XP_010510888.1|  PREDICTED: axial regulator YABBY 5               49.7    2e-05   
ref|XP_010417805.1|  PREDICTED: axial regulator YABBY 5-like          49.7    3e-05   
ref|XP_009133935.1|  PREDICTED: axial regulator YABBY 5               49.7    3e-05   
ref|XP_007021795.1|  Plant-specific transcription factor YABBY fa...  49.7    3e-05   
ref|XP_006295133.1|  hypothetical protein CARUB_v10024208mg           49.7    3e-05   
ref|XP_008382119.1|  PREDICTED: putative axial regulator YABBY 2 ...  50.1    3e-05   
emb|CDX83239.1|  BnaA03g22670D                                        49.3    3e-05   
ref|XP_007013479.1|  Plant-specific transcription factor YABBY fa...  49.7    3e-05   
ref|XP_010557599.1|  PREDICTED: axial regulator YABBY 5-like          49.7    3e-05   
emb|CDY38528.1|  BnaC03g26690D                                        49.3    3e-05   
ref|XP_008382121.1|  PREDICTED: putative axial regulator YABBY 2 ...  50.1    3e-05   
gb|AAS10179.1|  YABBY2-like transcription factor YAB2                 49.7    3e-05   Antirrhinum majus [garden snapdragon]
gb|KHG24875.1|  Axial regulator YABBY 5 -like protein                 49.7    3e-05   
ref|XP_009364015.1|  PREDICTED: axial regulator YABBY 5-like          49.7    4e-05   
ref|XP_002324648.2|  hypothetical protein POPTR_0018s12990g           49.7    4e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006409726.1|  hypothetical protein EUTSA_v10017320mg           49.3    4e-05   
ref|NP_001281031.1|  axial regulator YABBY 5                          49.7    4e-05   
ref|XP_007015607.1|  Plant-specific transcription factor YABBY fa...  49.3    4e-05   
ref|XP_006409724.1|  hypothetical protein EUTSA_v10017320mg           48.9    5e-05   
ref|XP_007013480.1|  Plant-specific transcription factor YABBY fa...  49.3    5e-05   
ref|XP_010105229.1|  hypothetical protein L484_012344                 49.3    5e-05   
ref|XP_010687959.1|  PREDICTED: axial regulator YABBY 5               49.7    5e-05   
gb|KHG14718.1|  Axial regulator YABBY 5 -like protein                 49.3    5e-05   
ref|NP_850080.1|  axial regulator YABBY 5                             48.9    6e-05   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD83708.1|  filamentous flower like protein                      49.7    7e-05   Nuphar japonica
gb|AAS10178.1|  YABBY-like transcription factor PROLONGATA            48.9    7e-05   Antirrhinum majus [garden snapdragon]
gb|KDO48951.1|  hypothetical protein CISIN_1g029862mg                 48.9    7e-05   
ref|XP_002878987.1|  plant-specific transcription factor yabby fa...  48.5    7e-05   
ref|XP_006424060.1|  hypothetical protein CICLE_v100293541mg          48.1    8e-05   
ref|XP_009148101.1|  PREDICTED: putative axial regulator YABBY 2 ...  48.9    8e-05   
ref|XP_009148102.1|  PREDICTED: putative axial regulator YABBY 2 ...  48.5    8e-05   
ref|XP_006424061.1|  hypothetical protein CICLE_v100293541mg          48.1    8e-05   
ref|XP_006487833.1|  PREDICTED: putative axial regulator YABBY 2-...  48.5    8e-05   
gb|KDO48950.1|  hypothetical protein CISIN_1g029862mg                 48.5    8e-05   
ref|XP_011020144.1|  PREDICTED: axial regulator YABBY 5-like          48.5    8e-05   
ref|XP_006487832.1|  PREDICTED: putative axial regulator YABBY 2-...  48.5    8e-05   
gb|KDO48952.1|  hypothetical protein CISIN_1g029862mg                 48.5    8e-05   
gb|KDO48953.1|  hypothetical protein CISIN_1g029862mg                 48.1    1e-04   
ref|XP_003596925.1|  YABBY protein                                    48.5    1e-04   
ref|XP_007207250.1|  hypothetical protein PRUPE_ppa011880m2g          48.1    1e-04   
gb|KDP32424.1|  hypothetical protein JCGZ_13349                       48.1    1e-04   
ref|XP_006487834.1|  PREDICTED: putative axial regulator YABBY 2-...  48.1    1e-04   
ref|XP_007207251.1|  hypothetical protein PRUPE_ppa011880m2g          47.8    1e-04   
ref|XP_011017779.1|  PREDICTED: axial regulator YABBY 5-like          48.1    1e-04   
ref|XP_004241356.1|  PREDICTED: putative axial regulator YABBY 2 ...  47.8    2e-04   
ref|XP_010322450.1|  PREDICTED: putative axial regulator YABBY 2 ...  47.8    2e-04   
emb|CAJ38404.1|  abaxial cell fate / YABBY                            46.6    2e-04   Plantago major [cart-track plant]
ref|XP_006361110.1|  PREDICTED: putative axial regulator YABBY 2-...  47.8    2e-04   
gb|EYU30547.1|  hypothetical protein MIMGU_mgv1a016431mg              46.6    2e-04   
gb|ABK95415.1|  unknown                                               47.4    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_011044615.1|  PREDICTED: putative axial regulator YABBY 2 ...  47.4    2e-04   
ref|XP_007132510.1|  hypothetical protein PHAVU_011G100300g           47.4    3e-04   
ref|XP_004487438.1|  PREDICTED: putative axial regulator YABBY 2-...  47.4    3e-04   
ref|XP_011044616.1|  PREDICTED: putative axial regulator YABBY 2 ...  47.4    3e-04   
gb|AID67137.1|  YAB2 protein                                          47.4    3e-04   
ref|XP_009607228.1|  PREDICTED: axial regulator YABBY 5-like isof...  46.6    3e-04   
gb|AID67133.1|  YAB2 protein                                          47.4    3e-04   
gb|AID67136.1|  YAB2 protein                                          47.4    3e-04   
gb|AID67135.1|  YAB2 protein                                          47.4    3e-04   
gb|AFY26892.1|  YABBY2-like transcription factor YAB2                 47.0    3e-04   
ref|XP_010247865.1|  PREDICTED: putative axial regulator YABBY 2 ...  47.0    3e-04   
gb|EYU25970.1|  hypothetical protein MIMGU_mgv1a015670mg              46.6    3e-04   
ref|XP_004171895.1|  PREDICTED: axial regulator YABBY 5-like          46.6    3e-04   
ref|XP_010475645.1|  PREDICTED: putative axial regulator YABBY 2      47.0    3e-04   
dbj|BAF65260.1|  YABBY like transcription factor                      45.4    3e-04   Chloranthus serratus
ref|XP_010458084.1|  PREDICTED: putative axial regulator YABBY 2      47.0    3e-04   
ref|XP_008444049.1|  PREDICTED: axial regulator YABBY 5-like          47.0    3e-04   
ref|XP_010557447.1|  PREDICTED: putative axial regulator YABBY 2      47.0    3e-04   
ref|XP_006303358.1|  hypothetical protein CARUB_v10010384mg           47.0    3e-04   
gb|AID67134.1|  YAB2 protein                                          47.0    3e-04   
ref|NP_001077490.1|  transcription factor YABBY family protein        47.0    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010533151.1|  PREDICTED: axial regulator YABBY 5               46.6    3e-04   
ref|XP_010488902.1|  PREDICTED: putative axial regulator YABBY 2      47.0    3e-04   
ref|XP_002299655.2|  hypothetical protein POPTR_0001s22180g           47.4    4e-04   Populus trichocarpa [western balsam poplar]
ref|XP_002889696.1|  hypothetical protein ARALYDRAFT_470907           47.0    4e-04   
dbj|BAJ83624.1|  YAB5-like YABBY protein                              46.6    4e-04   
ref|XP_004291524.1|  PREDICTED: putative axial regulator YABBY 2-...  47.4    4e-04   
ref|XP_008385589.1|  PREDICTED: putative axial regulator YABBY 2 ...  47.0    4e-04   
ref|XP_004150030.1|  PREDICTED: axial regulator YABBY 5-like          47.0    4e-04   
ref|XP_008385588.1|  PREDICTED: putative axial regulator YABBY 2 ...  47.0    4e-04   
gb|ACN59437.1|  YAB2-1                                                46.2    4e-04   Dimocarpus longan [longan]
ref|XP_011044613.1|  PREDICTED: axial regulator YABBY 5-like isof...  47.0    4e-04   
emb|CDX97491.1|  BnaC08g13560D                                        46.6    4e-04   
ref|XP_010247861.1|  PREDICTED: putative axial regulator YABBY 2 ...  46.6    4e-04   
gb|ACN59438.1|  YAB2-2                                                46.2    4e-04   Dimocarpus longan [longan]
gb|ACN59440.1|  YAB2-5                                                45.1    4e-04   Dimocarpus longan [longan]
emb|CDY31142.1|  BnaA08g26920D                                        46.2    4e-04   
ref|XP_009607227.1|  PREDICTED: axial regulator YABBY 5-like isof...  46.6    4e-04   
ref|XP_010247851.1|  PREDICTED: putative axial regulator YABBY 2 ...  46.6    5e-04   
ref|XP_010521623.1|  PREDICTED: putative axial regulator YABBY 2      46.6    5e-04   
ref|XP_011044614.1|  PREDICTED: axial regulator YABBY 5-like isof...  46.6    5e-04   
ref|XP_009368867.1|  PREDICTED: axial regulator YABBY 5-like          46.2    5e-04   
ref|XP_010259025.1|  PREDICTED: protein YABBY 4-like                  47.0    5e-04   
ref|XP_010031587.1|  PREDICTED: putative axial regulator YABBY 2 ...  46.2    5e-04   
ref|XP_010031588.1|  PREDICTED: putative axial regulator YABBY 2 ...  45.8    5e-04   
ref|XP_010090516.1|  hypothetical protein L484_017140                 46.6    5e-04   
gb|KFK43154.1|  hypothetical protein AALP_AA1G086900                  46.2    6e-04   
ref|XP_009110891.1|  PREDICTED: putative axial regulator YABBY 2 ...  46.2    6e-04   
ref|XP_009110892.1|  PREDICTED: putative axial regulator YABBY 2 ...  46.2    6e-04   
ref|XP_011024889.1|  PREDICTED: putative axial regulator YABBY 2 ...  45.8    6e-04   
ref|XP_006388657.1|  hypothetical protein POPTR_0127s002012g          45.1    6e-04   
gb|KCW50948.1|  hypothetical protein EUGRSUZ_J00587                   46.2    6e-04   
ref|XP_010031584.1|  PREDICTED: putative axial regulator YABBY 2 ...  46.2    6e-04   
ref|XP_010031586.1|  PREDICTED: putative axial regulator YABBY 2 ...  46.2    6e-04   
ref|XP_011024888.1|  PREDICTED: putative axial regulator YABBY 2 ...  45.8    7e-04   
ref|XP_010031585.1|  PREDICTED: putative axial regulator YABBY 2 ...  46.2    7e-04   
ref|XP_006417685.1|  hypothetical protein EUTSA_v10008858mg           46.2    7e-04   
emb|CDP15572.1|  unnamed protein product                              46.2    7e-04   
ref|XP_009798278.1|  PREDICTED: axial regulator YABBY 5-like          46.2    7e-04   
gb|EPS57324.1|  hypothetical protein M569_17494                       44.7    7e-04   
emb|CAN70664.1|  hypothetical protein VITISV_008108                   45.8    7e-04   Vitis vinifera
ref|XP_006417684.1|  hypothetical protein EUTSA_v10008858mg           46.2    7e-04   
ref|XP_010263069.1|  PREDICTED: putative axial regulator YABBY 2 ...  45.8    7e-04   
ref|XP_010263070.1|  PREDICTED: putative axial regulator YABBY 2 ...  45.8    8e-04   
ref|XP_004140176.1|  PREDICTED: putative axial regulator YABBY 2-...  45.8    8e-04   
ref|XP_010263071.1|  PREDICTED: putative axial regulator YABBY 2 ...  45.8    8e-04   
gb|AAV74414.1|  filamentous flower-like yabby protein                 44.7    8e-04   Tropaeolum majus
gb|EYU31965.1|  hypothetical protein MIMGU_mgv1a013346mg              46.6    8e-04   
ref|XP_011090395.1|  PREDICTED: axial regulator YABBY 1               46.2    8e-04   
ref|XP_010651636.1|  PREDICTED: putative axial regulator YABBY 2 ...  45.8    8e-04   
ref|XP_009118373.1|  PREDICTED: putative axial regulator YABBY 2 ...  45.8    8e-04   
ref|XP_009118372.1|  PREDICTED: putative axial regulator YABBY 2 ...  45.8    8e-04   
emb|CDY22681.1|  BnaC08g43150D                                        45.8    8e-04   
ref|XP_009762053.1|  PREDICTED: axial regulator YABBY 5-like isof...  46.2    9e-04   
ref|XP_010651637.1|  PREDICTED: putative axial regulator YABBY 2 ...  45.8    9e-04   
ref|XP_002277937.1|  PREDICTED: putative axial regulator YABBY 2 ...  45.8    9e-04   Vitis vinifera
ref|XP_002515880.1|  Axial regulator YABBY2, putative                 45.8    9e-04   Ricinus communis
ref|XP_010651638.1|  PREDICTED: putative axial regulator YABBY 2 ...  45.8    9e-04   
gb|KDP25628.1|  hypothetical protein JCGZ_20784                       46.2    0.001   
emb|CDX95059.1|  BnaC05g06120D                                        45.8    0.001   
ref|XP_008230525.1|  PREDICTED: putative axial regulator YABBY 2 ...  45.8    0.001   
ref|XP_008385587.1|  PREDICTED: putative axial regulator YABBY 2 ...  46.2    0.001   



>ref|XP_006842053.1| hypothetical protein AMTR_s00078p00029420 [Amborella trichopoda]
 gb|ERN03728.1| hypothetical protein AMTR_s00078p00029420 [Amborella trichopoda]
Length=221

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 2/37 (5%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLMLD+   QPKL   +G+GK L
Sbjct  178  TAAKNWAHFPHIHFGLMLDTTKKQPKLD--QGSGKHL  212



>emb|CDP10425.1| unnamed protein product [Coffea canephora]
Length=194

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 32/37 (86%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML++ NN+PKLG  E + KRL
Sbjct  152  TAAKNWAHFPHIHFGLMLET-NNKPKLG--EDSEKRL  185



>gb|KDO80209.1| hypothetical protein CISIN_1g028980mg [Citrus sinensis]
 gb|KDO80210.1| hypothetical protein CISIN_1g028980mg [Citrus sinensis]
Length=179

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML++ NNQPKL   + +G RL
Sbjct  137  TAAKNWAHFPHIHFGLMLEA-NNQPKLD--DASGNRL  170



>ref|XP_002285328.1| PREDICTED: axial regulator YABBY 5 isoform X1 [Vitis vinifera]
 emb|CBI28225.3| unnamed protein product [Vitis vinifera]
Length=185

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML++ NNQPKL   EG+ K L
Sbjct  143  TAAKNWAHFPHIHFGLMLET-NNQPKLD--EGSEKHL  176



>ref|XP_006450897.1| hypothetical protein CICLE_v10009560mg [Citrus clementina]
 gb|ESR64137.1| hypothetical protein CICLE_v10009560mg [Citrus clementina]
 gb|KDO80211.1| hypothetical protein CISIN_1g028980mg [Citrus sinensis]
Length=145

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML++ NNQPKL   + +G RL
Sbjct  103  TAAKNWAHFPHIHFGLMLEA-NNQPKLD--DASGNRL  136



>ref|XP_006450898.1| hypothetical protein CICLE_v10009560mg [Citrus clementina]
 gb|ESR64138.1| hypothetical protein CICLE_v10009560mg [Citrus clementina]
 gb|KDO80212.1| hypothetical protein CISIN_1g028980mg [Citrus sinensis]
Length=138

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML++ NNQPKL   + +G RL
Sbjct  96   TAAKNWAHFPHIHFGLMLEA-NNQPKLD--DASGNRL  129



>ref|XP_006450896.1| hypothetical protein CICLE_v10009560mg [Citrus clementina]
 ref|XP_006475869.1| PREDICTED: axial regulator YABBY 5-like isoform X2 [Citrus sinensis]
 gb|ESR64136.1| hypothetical protein CICLE_v10009560mg [Citrus clementina]
 gb|KDO80206.1| hypothetical protein CISIN_1g028980mg [Citrus sinensis]
Length=190

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML++ NNQPKL   + +G RL
Sbjct  148  TAAKNWAHFPHIHFGLMLEA-NNQPKLD--DASGNRL  181



>ref|XP_006450895.1| hypothetical protein CICLE_v10009560mg [Citrus clementina]
 ref|XP_006475868.1| PREDICTED: axial regulator YABBY 5-like isoform X1 [Citrus sinensis]
 gb|ESR64135.1| hypothetical protein CICLE_v10009560mg [Citrus clementina]
 gb|KDO80205.1| hypothetical protein CISIN_1g028980mg [Citrus sinensis]
Length=197

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML++ NNQPKL   + +G RL
Sbjct  155  TAAKNWAHFPHIHFGLMLEA-NNQPKLD--DASGNRL  188



>gb|KDO80207.1| hypothetical protein CISIN_1g028980mg [Citrus sinensis]
Length=189

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML++ NNQPKL   + +G RL
Sbjct  147  TAAKNWAHFPHIHFGLMLEA-NNQPKLD--DASGNRL  180



>ref|XP_010656451.1| PREDICTED: axial regulator YABBY 5 isoform X2 [Vitis vinifera]
Length=184

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 31/37 (84%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML++ NNQPKL   EG+ K L
Sbjct  142  TAAKNWAHFPHIHFGLMLET-NNQPKLD--EGSEKHL  175



>ref|XP_002308074.1| plant-specific transcription factor YABBY family protein [Populus 
trichocarpa]
 gb|EEE91597.1| plant-specific transcription factor YABBY family protein [Populus 
trichocarpa]
Length=188

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML++NN   +  V +G+ KRL
Sbjct  146  TAAKNWAHFPHIHFGLMLETNN---QTKVDDGSEKRL  179



>ref|XP_004173724.1| PREDICTED: axial regulator YABBY 5-like, partial [Cucumis sativus]
Length=163

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 5/45 (11%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL--CKGLQY  130
            TAAKNWAHFPHIHFGLMLD+NN Q K   ++G+ K L    GL Y
Sbjct  122  TAAKNWAHFPHIHFGLMLDTNNLQSK---NDGSEKHLMSVSGLHY  163



>ref|XP_004139305.1| PREDICTED: axial regulator YABBY 5-like [Cucumis sativus]
Length=192

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 5/45 (11%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL--CKGLQY  130
            TAAKNWAHFPHIHFGLMLD+NN Q K   ++G+ K L    GL Y
Sbjct  151  TAAKNWAHFPHIHFGLMLDTNNLQSK---NDGSEKHLMSVSGLHY  192



>ref|XP_008457474.1| PREDICTED: axial regulator YABBY 5 [Cucumis melo]
Length=194

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 5/45 (11%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL--CKGLQY  130
            TAAKNWAHFPHIHFGLMLD+NN Q K   ++G+ K L    GL Y
Sbjct  153  TAAKNWAHFPHIHFGLMLDTNNLQTK---NDGSEKHLMSVSGLHY  194



>ref|XP_007155017.1| hypothetical protein PHAVU_003G166100g [Phaseolus vulgaris]
 gb|ESW27011.1| hypothetical protein PHAVU_003G166100g [Phaseolus vulgaris]
Length=186

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSE  94
            TAAKNWAHFPHIHFGLMLDSNN      VSE
Sbjct  144  TAAKNWAHFPHIHFGLMLDSNNQAKMENVSE  174



>dbj|BAF65259.1| YABBY like transcription factor [Chloranthus serratus]
Length=72

 Score = 53.1 bits (126),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML++NN   ++ + EG+ K L
Sbjct  29   TAAKNWAHFPHIHFGLMLETNN---QIKLDEGSEKHL  62



>ref|XP_011078402.1| PREDICTED: axial regulator YABBY 5 [Sesamum indicum]
Length=183

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 3/35 (9%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGLML++NN   +  V+EG+GK
Sbjct  141  TAAKNWAHFPHIHFGLMLETNN---QAFVNEGSGK  172



>gb|ACJ85113.1| unknown [Medicago truncatula]
 gb|AFK33376.1| unknown [Medicago truncatula]
Length=191

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 28/37 (76%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML+SNN      VSE   KRL
Sbjct  149  TAAKNWAHFPHIHFGLMLESNNQAKIENVSE---KRL  182



>ref|XP_003609353.1| YABBY protein [Medicago truncatula]
 gb|AES91550.1| plant-specific transcription factor YABBY family protein [Medicago 
truncatula]
Length=191

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 28/37 (76%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML+SNN      VSE   KRL
Sbjct  149  TAAKNWAHFPHIHFGLMLESNNQAQIENVSE---KRL  182



>ref|XP_009762054.1| PREDICTED: axial regulator YABBY 5-like isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009762055.1| PREDICTED: axial regulator YABBY 5-like isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009762057.1| PREDICTED: axial regulator YABBY 5-like isoform X3 [Nicotiana 
sylvestris]
Length=156

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGL L++  NQ KLG SE   K +
Sbjct  107  TAAKNWAHFPHIHFGLTLET-KNQAKLGASENAEKHI  142



>ref|XP_010313779.1| PREDICTED: axial regulator YABBY 5-like isoform X2 [Solanum lycopersicum]
Length=138

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHI FGLML++ +NQ KLG SE   K
Sbjct  89   TAAKNWAHFPHIQFGLMLET-DNQAKLGASENKEK  122



>ref|XP_007202630.1| hypothetical protein PRUPE_ppa012028mg [Prunus persica]
 gb|EMJ03829.1| hypothetical protein PRUPE_ppa012028mg [Prunus persica]
Length=187

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGLML++ NNQPKL
Sbjct  145  TAAKNWAHFPHIHFGLMLET-NNQPKL  170



>ref|XP_009762052.1| PREDICTED: axial regulator YABBY 5-like isoform X1 [Nicotiana 
sylvestris]
Length=203

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGL L++  NQ KLG SE   K +
Sbjct  154  TAAKNWAHFPHIHFGLTLET-KNQAKLGASENAEKHI  189



>ref|XP_008242786.1| PREDICTED: axial regulator YABBY 5 [Prunus mume]
Length=188

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGLML++ NNQPKL
Sbjct  146  TAAKNWAHFPHIHFGLMLET-NNQPKL  171



>ref|XP_004508482.1| PREDICTED: axial regulator YABBY 5-like [Cicer arietinum]
Length=191

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 28/37 (76%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML++NN      VSE   KRL
Sbjct  149  TAAKNWAHFPHIHFGLMLETNNQAKMENVSE---KRL  182



>gb|KCW80170.1| hypothetical protein EUGRSUZ_C01515 [Eucalyptus grandis]
Length=110

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 1/27 (4%)
 Frame = +2

Query  2   TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
           TAAKNWAHFPHIHFGLMLD NNNQ K+
Sbjct  68  TAAKNWAHFPHIHFGLMLD-NNNQAKM  93



>dbj|BAF65258.1| FILAMENTOUS FLOWER like protein [Nymphaea colorata]
Length=87

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRLCKGL  124
            TAAKNWAHFPHIHFGLM D N  +  L   EG    L  G 
Sbjct  36   TAAKNWAHFPHIHFGLMADQNMKKTNLRQQEGDDMILSDGF  76



>ref|XP_004251722.1| PREDICTED: axial regulator YABBY 5-like isoform X1 [Solanum lycopersicum]
Length=191

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHI FGLML++ +NQ KLG SE   K +
Sbjct  142  TAAKNWAHFPHIQFGLMLET-DNQAKLGASENKEKLI  177



>ref|XP_003542627.1| PREDICTED: axial regulator YABBY 5-like [Glycine max]
 gb|KHN22110.1| Axial regulator YABBY 5 [Glycine soja]
Length=186

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSE  94
            TAAKNWAHFPHIHFGLML+SNN      VSE
Sbjct  144  TAAKNWAHFPHIHFGLMLESNNQVKMENVSE  174



>ref|XP_006600135.1| PREDICTED: uncharacterized protein LOC100499942 isoform X1 [Glycine 
max]
Length=161

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSE  94
            TAAKNWAHFPHIHFGLML+SNN      VSE
Sbjct  119  TAAKNWAHFPHIHFGLMLESNNQAKMDNVSE  149



>ref|NP_001238347.1| uncharacterized protein LOC100499942 [Glycine max]
 gb|ACU14291.1| unknown [Glycine max]
 gb|KHN15080.1| Axial regulator YABBY 5 [Glycine soja]
Length=186

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSE  94
            TAAKNWAHFPHIHFGLML+SNN      VSE
Sbjct  144  TAAKNWAHFPHIHFGLMLESNNQAKMDNVSE  174



>ref|XP_006345225.1| PREDICTED: axial regulator YABBY 5-like [Solanum tuberosum]
Length=194

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHI FGLML++ +NQ KLG SE   K +
Sbjct  145  TAAKNWAHFPHIQFGLMLET-DNQAKLGASENKEKLI  180



>gb|KCW80169.1| hypothetical protein EUGRSUZ_C01515 [Eucalyptus grandis]
Length=132

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGLMLD NNNQ K+
Sbjct  90   TAAKNWAHFPHIHFGLMLD-NNNQAKM  115



>ref|XP_004173692.1| PREDICTED: axial regulator YABBY 5-like, partial [Cucumis sativus]
Length=179

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGV  88
            TAAKNWAHFPHIHFGLMLD+NN Q K  V
Sbjct  151  TAAKNWAHFPHIHFGLMLDTNNLQSKNDV  179



>gb|KDO80208.1| hypothetical protein CISIN_1g028980mg [Citrus sinensis]
Length=201

 Score = 52.8 bits (125),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 26/27 (96%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGLML++ NNQPKL
Sbjct  148  TAAKNWAHFPHIHFGLMLEA-NNQPKL  173



>ref|XP_010048072.1| PREDICTED: axial regulator YABBY 5 [Eucalyptus grandis]
 ref|XP_010048073.1| PREDICTED: axial regulator YABBY 5 [Eucalyptus grandis]
 gb|KCW80166.1| hypothetical protein EUGRSUZ_C01515 [Eucalyptus grandis]
 gb|KCW80167.1| hypothetical protein EUGRSUZ_C01515 [Eucalyptus grandis]
Length=184

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/27 (89%), Positives = 25/27 (93%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGLMLD NNNQ K+
Sbjct  142  TAAKNWAHFPHIHFGLMLD-NNNQAKM  167



>ref|XP_010254434.1| PREDICTED: axial regulator YABBY 5-like [Nelumbo nucifera]
Length=184

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 30/37 (81%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML+ N+NQ KL   EG+ + L
Sbjct  142  TAAKNWAHFPHIHFGLMLE-NSNQAKLD--EGSDRHL  175



>ref|XP_010250140.1| PREDICTED: axial regulator YABBY 5-like isoform X3 [Nelumbo nucifera]
Length=187

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML+ N NQ KL   EG+ + L
Sbjct  144  TAAKNWAHFPHIHFGLMLE-NKNQAKLD--EGSDRHL  177



>ref|XP_010250139.1| PREDICTED: axial regulator YABBY 5-like isoform X2 [Nelumbo nucifera]
Length=196

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML+ N NQ KL   EG+ + L
Sbjct  153  TAAKNWAHFPHIHFGLMLE-NKNQAKLD--EGSDRHL  186



>ref|XP_010250138.1| PREDICTED: axial regulator YABBY 5-like isoform X1 [Nelumbo nucifera]
Length=197

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML+ N NQ KL   EG+ + L
Sbjct  154  TAAKNWAHFPHIHFGLMLE-NKNQAKLD--EGSDRHL  187



>ref|XP_006594909.1| PREDICTED: putative axial regulator YABBY 2-like isoform X3 [Glycine 
max]
Length=179

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL   +GT K
Sbjct  141  TAAKNWAHFPHIHFGLKLD-GNKQAKLDQGDGTQK  174



>ref|XP_007150002.1| hypothetical protein PHAVU_005G117600g [Phaseolus vulgaris]
 gb|ESW21996.1| hypothetical protein PHAVU_005G117600g [Phaseolus vulgaris]
Length=178

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL   +GT K
Sbjct  140  TAAKNWAHFPHIHFGLKLD-GNKQAKLDQGDGTQK  173



>ref|XP_006358281.1| PREDICTED: axial regulator YABBY 5-like [Solanum tuberosum]
Length=179

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 1/29 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGV  88
            TAAKNWAHFPHIHFGLML+S NNQ KL  
Sbjct  147  TAAKNWAHFPHIHFGLMLES-NNQAKLAC  174



>ref|XP_003540284.1| PREDICTED: putative axial regulator YABBY 2-like isoformX1 [Glycine 
max]
Length=179

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL   +GT K
Sbjct  141  TAAKNWAHFPHIHFGLKLD-GNKQAKLDQGDGTQK  174



>ref|NP_001276158.1| uncharacterized protein LOC100785458 [Glycine max]
 gb|ACU19400.1| unknown [Glycine max]
 gb|KHN17995.1| Putative axial regulator YABBY 2 [Glycine soja]
Length=181

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL   +GT K
Sbjct  143  TAAKNWAHFPHIHFGLKLD-GNKQAKLDQGDGTQK  176



>ref|XP_003543399.1| PREDICTED: putative axial regulator YABBY 2-like isoformX1 [Glycine 
max]
Length=181

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL   +GT K
Sbjct  143  TAAKNWAHFPHIHFGLKLD-GNKQAKLDQGDGTQK  176



>ref|XP_006594908.1| PREDICTED: putative axial regulator YABBY 2-like isoform X2 [Glycine 
max]
 gb|KHN36513.1| Putative axial regulator YABBY 2 [Glycine soja]
Length=188

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL   +GT K
Sbjct  150  TAAKNWAHFPHIHFGLKLD-GNKQAKLDQGDGTQK  183



>ref|XP_007150001.1| hypothetical protein PHAVU_005G117600g [Phaseolus vulgaris]
 gb|ESW21995.1| hypothetical protein PHAVU_005G117600g [Phaseolus vulgaris]
Length=185

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL   +GT K
Sbjct  147  TAAKNWAHFPHIHFGLKLD-GNKQAKLDQGDGTQK  180



>gb|AID67113.1| YAB5 protein [Solanum aethiopicum]
Length=183

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 1/29 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGV  88
            TAAKNWAHFPHIHFGLML+S NNQ KL  
Sbjct  151  TAAKNWAHFPHIHFGLMLES-NNQAKLAC  178



>gb|AID67112.1| YAB5 protein [Solanum sisymbriifolium]
Length=183

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 1/29 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGV  88
            TAAKNWAHFPHIHFGLML+S NNQ KL  
Sbjct  151  TAAKNWAHFPHIHFGLMLES-NNQAKLAC  178



>gb|AID67114.1| YAB5 protein [Solanum virginianum]
Length=182

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 1/29 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGV  88
            TAAKNWAHFPHIHFGLML+S NNQ KL  
Sbjct  150  TAAKNWAHFPHIHFGLMLES-NNQAKLAC  177



>gb|KDP42970.1| hypothetical protein JCGZ_23912 [Jatropha curcas]
Length=193

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 26/39 (67%), Gaps = 4/39 (10%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG----VSEGTGK  106
            TAAKNWAHFPHIHFGL LD NN   KL       EGT K
Sbjct  143  TAAKNWAHFPHIHFGLKLDGNNKHAKLDHQAFAGEGTQK  181



>ref|XP_004242778.1| PREDICTED: axial regulator YABBY 5 [Solanum lycopersicum]
Length=180

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 1/29 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGV  88
            TAAKNWAHFPHIHFGLML+S NNQ KL  
Sbjct  148  TAAKNWAHFPHIHFGLMLES-NNQAKLAC  175



>gb|AID67111.1| YAB5 protein [Solanum melongena]
 gb|AID67115.1| YAB5 protein [Solanum torvum]
Length=182

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 1/29 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGV  88
            TAAKNWAHFPHIHFGLML+S NNQ KL  
Sbjct  150  TAAKNWAHFPHIHFGLMLES-NNQAKLAC  177



>gb|EYU34994.1| hypothetical protein MIMGU_mgv1a014582mg [Erythranthe guttata]
Length=141

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 2/35 (6%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGLML++ N   KL   EG+ K
Sbjct  98   TAAKNWAHFPHIHFGLMLETTNQTAKLN--EGSEK  130



>ref|XP_009622268.1| PREDICTED: axial regulator YABBY 5-like isoform X1 [Nicotiana 
tomentosiformis]
Length=187

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 1/29 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGV  88
            TAAKNWAHFPHIHFGLML+S NNQ KL  
Sbjct  152  TAAKNWAHFPHIHFGLMLES-NNQAKLSC  179



>gb|EYU34993.1| hypothetical protein MIMGU_mgv1a014582mg [Erythranthe guttata]
Length=185

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 2/35 (6%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGLML++ N   KL   EG+ K
Sbjct  142  TAAKNWAHFPHIHFGLMLETTNQTAKLN--EGSEK  174



>ref|XP_009622269.1| PREDICTED: axial regulator YABBY 5-like isoform X2 [Nicotiana 
tomentosiformis]
Length=141

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 1/29 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGV  88
            TAAKNWAHFPHIHFGLML+S NNQ KL  
Sbjct  106  TAAKNWAHFPHIHFGLMLES-NNQAKLSC  133



>ref|XP_009785258.1| PREDICTED: axial regulator YABBY 5 [Nicotiana sylvestris]
Length=186

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 1/29 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGV  88
            TAAKNWAHFPHIHFGLML+S NNQ KL  
Sbjct  151  TAAKNWAHFPHIHFGLMLES-NNQAKLSC  178



>ref|XP_008449608.1| PREDICTED: putative axial regulator YABBY 2 [Cucumis melo]
Length=174

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPK  79
            TAAKNWAHFPHIHFGL LD NN Q K
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNNKQTK  174



>ref|XP_011088989.1| PREDICTED: putative axial regulator YABBY 2 [Sesamum indicum]
 ref|XP_011088990.1| PREDICTED: putative axial regulator YABBY 2 [Sesamum indicum]
Length=185

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 27/41 (66%), Gaps = 4/41 (10%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL----GVSEGTGKRL  112
            TAAKNWAHFPHIHFGL L+ N    KL      +EGT K L
Sbjct  143  TAAKNWAHFPHIHFGLKLEGNKQAAKLDHQVAAAEGTEKSL  183



>dbj|BAF65256.1| FILAMENTOUS FLOWER like protein [Brasenia schreberi]
Length=133

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRLCKGL  124
             AAKNWAHFPHIHFGLM D N  +  L   EG    L +GL
Sbjct  82   AAAKNWAHFPHIHFGLMADQNIKKTNLCQQEGDDLILSEGL  122



>ref|XP_004287301.1| PREDICTED: axial regulator YABBY 5-like [Fragaria vesca subsp. 
vesca]
Length=186

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML++ NNQ KL    G+ K L
Sbjct  145  TAAKNWAHFPHIHFGLMLET-NNQAKLD--NGSEKHL  178



>dbj|BAF65262.1| FILAMENTOUS FLOWER like protein [Cabomba caroliniana]
Length=82

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    AAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRLCKGL  124
            AAKNWAHFPHIHFGLM D N  +  L   EG    L +GL
Sbjct  32   AAKNWAHFPHIHFGLMGDQNIKKTNLRQQEGDDLILSEGL  71



>ref|XP_010473042.1| PREDICTED: axial regulator YABBY 5-like [Camelina sativa]
Length=164

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 1/28 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG  85
            TAAKNWAHFPHIHFGLML+S N Q KL 
Sbjct  138  TAAKNWAHFPHIHFGLMLES-NKQAKLA  164



>ref|NP_001280989.1| putative axial regulator YABBY 2 [Malus domestica]
 gb|ADL36868.1| YABBY domain class transcription factor [Malus domestica]
Length=194

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 4/38 (11%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVS---EGTGK  106
            TAAKNWAHFPHIHFGL LD+ N +PKL  +   EGT K
Sbjct  153  TAAKNWAHFPHIHFGLKLDA-NREPKLDQAFAGEGTQK  189



>ref|XP_009378607.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Pyrus 
x bretschneideri]
Length=190

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 4/38 (11%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVS---EGTGK  106
            TAAKNWAHFPHIHFGL LD+ N +PKL  +   EGT K
Sbjct  149  TAAKNWAHFPHIHFGLKLDA-NREPKLDQAFAGEGTQK  185



>ref|XP_008382120.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Malus 
domestica]
Length=196

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 4/38 (11%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVS---EGTGK  106
            TAAKNWAHFPHIHFGL LD+ N +PKL  +   EGT K
Sbjct  155  TAAKNWAHFPHIHFGLKLDA-NREPKLDQAFAGEGTQK  191



>ref|XP_009378606.1| PREDICTED: putative axial regulator YABBY 2 isoform X1 [Pyrus 
x bretschneideri]
Length=192

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 4/38 (11%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVS---EGTGK  106
            TAAKNWAHFPHIHFGL LD+ N +PKL  +   EGT K
Sbjct  151  TAAKNWAHFPHIHFGLKLDA-NREPKLDQAFAGEGTQK  187



>gb|ACU19358.1| unknown [Glycine max]
Length=186

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 21/23 (91%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNN  70
            TAAKNWAHFPHIHFGLML+SNN 
Sbjct  144  TAAKNWAHFPHIHFGLMLESNNQ  166



>ref|XP_007021796.1| Plant-specific transcription factor YABBY family protein, putative 
isoform 2 [Theobroma cacao]
 gb|EOY13321.1| Plant-specific transcription factor YABBY family protein, putative 
isoform 2 [Theobroma cacao]
Length=161

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWA FPHIHFGLML++ +NQPKL
Sbjct  123  TAAKNWARFPHIHFGLMLET-DNQPKL  148



>ref|XP_010510888.1| PREDICTED: axial regulator YABBY 5 [Camelina sativa]
Length=164

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 1/28 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG  85
            TAAKNWAHFPHIHFGLML+S N Q KL 
Sbjct  138  TAAKNWAHFPHIHFGLMLES-NKQAKLA  164



>ref|XP_010417805.1| PREDICTED: axial regulator YABBY 5-like [Camelina sativa]
Length=164

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 1/28 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG  85
            TAAKNWAHFPHIHFGLML+S N Q KL 
Sbjct  138  TAAKNWAHFPHIHFGLMLES-NKQAKLA  164



>ref|XP_009133935.1| PREDICTED: axial regulator YABBY 5 [Brassica rapa]
 ref|XP_009133936.1| PREDICTED: axial regulator YABBY 5 [Brassica rapa]
Length=164

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 1/28 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG  85
            TAAKNWAHFPHIHFGLML+S N Q KL 
Sbjct  138  TAAKNWAHFPHIHFGLMLES-NKQAKLA  164



>ref|XP_007021795.1| Plant-specific transcription factor YABBY family protein isoform 
1 [Theobroma cacao]
 gb|EOY13320.1| Plant-specific transcription factor YABBY family protein isoform 
1 [Theobroma cacao]
Length=181

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWA FPHIHFGLML++ +NQPKL
Sbjct  143  TAAKNWARFPHIHFGLMLET-DNQPKL  168



>ref|XP_006295133.1| hypothetical protein CARUB_v10024208mg [Capsella rubella]
 ref|XP_006295134.1| hypothetical protein CARUB_v10024208mg [Capsella rubella]
 gb|EOA28031.1| hypothetical protein CARUB_v10024208mg [Capsella rubella]
 gb|EOA28032.1| hypothetical protein CARUB_v10024208mg [Capsella rubella]
Length=164

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 1/28 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG  85
            TAAKNWAHFPHIHFGLML+S N Q KL 
Sbjct  138  TAAKNWAHFPHIHFGLMLES-NKQAKLA  164



>ref|XP_008382119.1| PREDICTED: putative axial regulator YABBY 2 isoform X1 [Malus 
domestica]
Length=197

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 4/38 (11%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVS---EGTGK  106
            TAAKNWAHFPHIHFGL LD+ N +PKL  +   EGT K
Sbjct  156  TAAKNWAHFPHIHFGLKLDA-NREPKLDQAFAGEGTQK  192



>emb|CDX83239.1| BnaA03g22670D [Brassica napus]
Length=164

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 1/28 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG  85
            TAAKNWAHFPHIHFGLML+S N Q KL 
Sbjct  138  TAAKNWAHFPHIHFGLMLES-NKQAKLA  164



>ref|XP_007013479.1| Plant-specific transcription factor YABBY family protein isoform 
1 [Theobroma cacao]
 gb|EOY31098.1| Plant-specific transcription factor YABBY family protein isoform 
1 [Theobroma cacao]
Length=184

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNN  67
            TAAKNWAHFPHIHFGLML++NN
Sbjct  142  TAAKNWAHFPHIHFGLMLETNN  163



>ref|XP_010557599.1| PREDICTED: axial regulator YABBY 5-like [Tarenaya hassleriana]
Length=171

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 1/28 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG  85
            TAAKNWAHFPHIHFGLML+ NN Q KL 
Sbjct  145  TAAKNWAHFPHIHFGLMLE-NNKQAKLA  171



>emb|CDY38528.1| BnaC03g26690D [Brassica napus]
Length=164

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 1/28 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG  85
            TAAKNWAHFPHIHFGLML+S N Q KL 
Sbjct  138  TAAKNWAHFPHIHFGLMLES-NKQAKLA  164



>ref|XP_008382121.1| PREDICTED: putative axial regulator YABBY 2 isoform X3 [Malus 
domestica]
Length=195

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 29/38 (76%), Gaps = 4/38 (11%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVS---EGTGK  106
            TAAKNWAHFPHIHFGL LD+ N +PKL  +   EGT K
Sbjct  154  TAAKNWAHFPHIHFGLKLDA-NREPKLDQAFAGEGTQK  190



>gb|AAS10179.1| YABBY2-like transcription factor YAB2 [Antirrhinum majus]
Length=186

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 30/43 (70%), Gaps = 4/43 (9%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL---GVSEGTGKRLCKG  121
            TAAKNWAHFPHIHFGL LDS N Q KL    V+ G+G  + + 
Sbjct  138  TAAKNWAHFPHIHFGLKLDS-NKQAKLQDHSVAGGSGTTMARA  179



>gb|KHG24875.1| Axial regulator YABBY 5 -like protein [Gossypium arboreum]
Length=182

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 25/27 (93%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWA FPHIHFGLML++ +NQPKL
Sbjct  144  TAAKNWARFPHIHFGLMLET-DNQPKL  169



>ref|XP_009364015.1| PREDICTED: axial regulator YABBY 5-like [Pyrus x bretschneideri]
Length=188

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGLML++ NNQ KL
Sbjct  146  TAAKNWAHFPHIHFGLMLEA-NNQAKL  171



>ref|XP_002324648.2| hypothetical protein POPTR_0018s12990g [Populus trichocarpa]
 gb|EEF03213.2| hypothetical protein POPTR_0018s12990g [Populus trichocarpa]
Length=188

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHI FGLML++ NNQ KL   +G+ K L
Sbjct  146  TAAKNWAHFPHIQFGLMLET-NNQAKLD--DGSDKHL  179



>ref|XP_006409726.1| hypothetical protein EUTSA_v10017320mg [Eutrema salsugineum]
 gb|ESQ51179.1| hypothetical protein EUTSA_v10017320mg [Eutrema salsugineum]
Length=170

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 1/28 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG  85
            TAAKNWAHFPHIHFGLML+S N Q K+ 
Sbjct  144  TAAKNWAHFPHIHFGLMLES-NKQAKIA  170



>ref|NP_001281031.1| axial regulator YABBY 5 [Malus domestica]
 gb|ADL36869.1| YABBY domain class transcription factor [Malus domestica]
Length=188

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGLML++ NNQ KL
Sbjct  146  TAAKNWAHFPHIHFGLMLEA-NNQAKL  171



>ref|XP_007015607.1| Plant-specific transcription factor YABBY family protein isoform 
1 [Theobroma cacao]
 gb|EOY33226.1| Plant-specific transcription factor YABBY family protein isoform 
1 [Theobroma cacao]
Length=182

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 27/37 (73%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL--GVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL    +EGT K
Sbjct  142  TAAKNWAHFPHIHFGLKLD-GNKQAKLDQAFAEGTQK  177



>ref|XP_006409724.1| hypothetical protein EUTSA_v10017320mg [Eutrema salsugineum]
 ref|XP_006409725.1| hypothetical protein EUTSA_v10017320mg [Eutrema salsugineum]
 dbj|BAJ34377.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51177.1| hypothetical protein EUTSA_v10017320mg [Eutrema salsugineum]
 gb|ESQ51178.1| hypothetical protein EUTSA_v10017320mg [Eutrema salsugineum]
Length=164

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 1/28 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG  85
            TAAKNWAHFPHIHFGLML+S N Q K+ 
Sbjct  138  TAAKNWAHFPHIHFGLMLES-NKQAKIA  164



>ref|XP_007013480.1| Plant-specific transcription factor YABBY family protein isoform 
2, partial [Theobroma cacao]
 gb|EOY31099.1| Plant-specific transcription factor YABBY family protein isoform 
2, partial [Theobroma cacao]
Length=181

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNN  67
            TAAKNWAHFPHIHFGLML++NN
Sbjct  160  TAAKNWAHFPHIHFGLMLETNN  181



>ref|XP_010105229.1| hypothetical protein L484_012344 [Morus notabilis]
 gb|EXC04107.1| hypothetical protein L484_012344 [Morus notabilis]
Length=195

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 28/37 (76%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML + NNQ KL    G+ K L
Sbjct  152  TAAKNWAHFPHIHFGLMLKT-NNQTKLD--NGSEKHL  185



>ref|XP_010687959.1| PREDICTED: axial regulator YABBY 5 [Beta vulgaris subsp. vulgaris]
Length=204

 Score = 49.7 bits (117),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGLML++ NNQ KL
Sbjct  162  TAAKNWAHFPHIHFGLMLET-NNQAKL  187



>gb|KHG14718.1| Axial regulator YABBY 5 -like protein [Gossypium arboreum]
Length=186

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGLML++ NNQ KL
Sbjct  144  TAAKNWAHFPHIHFGLMLEA-NNQTKL  169



>ref|NP_850080.1| axial regulator YABBY 5 [Arabidopsis thaliana]
 ref|NP_850081.1| axial regulator YABBY 5 [Arabidopsis thaliana]
 sp|Q8GW46.1|YAB5_ARATH RecName: Full=Axial regulator YABBY 5 [Arabidopsis thaliana]
 dbj|BAC43665.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39962.1| At2g26580 [Arabidopsis thaliana]
 gb|AEC07860.1| axial regulator YABBY 5 [Arabidopsis thaliana]
 gb|AEC07861.1| axial regulator YABBY 5 [Arabidopsis thaliana]
Length=164

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 1/28 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG  85
            TAAKNWAHFPHIHFGLML+S N Q K+ 
Sbjct  138  TAAKNWAHFPHIHFGLMLES-NKQAKIA  164



>dbj|BAD83708.1| filamentous flower like protein [Nuphar japonica]
Length=246

 Score = 49.7 bits (117),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRLCKGL  124
            TAAKNWAHFPHIHFGLM D N  +  L   EG    +  G 
Sbjct  162  TAAKNWAHFPHIHFGLMADQNMEKSNLQQQEGNDLIISNGF  202



>gb|AAS10178.1| YABBY-like transcription factor PROLONGATA [Antirrhinum majus]
Length=186

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 2/35 (6%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGLML++ N Q K+ ++EG+ K
Sbjct  144  TAAKNWAHFPHIHFGLMLET-NTQAKV-LNEGSEK  176



>gb|KDO48951.1| hypothetical protein CISIN_1g029862mg [Citrus sinensis]
Length=184

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 27/39 (69%), Gaps = 5/39 (13%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL----GVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL      +EGT K
Sbjct  142  TAAKNWAHFPHIHFGLKLDG-NKQAKLDKAAAYAEGTQK  179



>ref|XP_002878987.1| plant-specific transcription factor yabby family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH55246.1| plant-specific transcription factor yabby family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=167

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 1/28 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG  85
            +AAKNWAHFPHIHFGLML+S N Q KL 
Sbjct  141  SAAKNWAHFPHIHFGLMLES-NKQAKLA  167



>ref|XP_006424060.1| hypothetical protein CICLE_v100293541mg, partial [Citrus clementina]
 gb|ESR37300.1| hypothetical protein CICLE_v100293541mg, partial [Citrus clementina]
Length=163

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 27/39 (69%), Gaps = 5/39 (13%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL----GVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL      +EGT K
Sbjct  121  TAAKNWAHFPHIHFGLKLD-GNKQAKLDKAAAYAEGTQK  158



>ref|XP_009148101.1| PREDICTED: putative axial regulator YABBY 2 isoform X1 [Brassica 
rapa]
 emb|CDX93561.1| BnaA06g04870D [Brassica napus]
Length=190

 Score = 48.9 bits (115),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPK  79
            TAAKNWAHFPHIHFGL LD NN + K
Sbjct  150  TAAKNWAHFPHIHFGLKLDGNNKKGK  175



>ref|XP_009148102.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Brassica 
rapa]
Length=189

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 22/26 (85%), Gaps = 0/26 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPK  79
            TAAKNWAHFPHIHFGL LD NN + K
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNNKKGK  174



>ref|XP_006424061.1| hypothetical protein CICLE_v100293541mg, partial [Citrus clementina]
 gb|ESR37301.1| hypothetical protein CICLE_v100293541mg, partial [Citrus clementina]
Length=161

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 27/39 (69%), Gaps = 5/39 (13%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL----GVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL      +EGT K
Sbjct  119  TAAKNWAHFPHIHFGLKLD-GNKQAKLDKAAAYAEGTQK  156



>ref|XP_006487833.1| PREDICTED: putative axial regulator YABBY 2-like isoform X2 [Citrus 
sinensis]
Length=184

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 27/39 (69%), Gaps = 5/39 (13%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL----GVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL      +EGT K
Sbjct  142  TAAKNWAHFPHIHFGLKLD-GNKQAKLDKAAAYAEGTQK  179



>gb|KDO48950.1| hypothetical protein CISIN_1g029862mg [Citrus sinensis]
Length=186

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 27/39 (69%), Gaps = 5/39 (13%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL----GVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL      +EGT K
Sbjct  144  TAAKNWAHFPHIHFGLKLD-GNKQAKLDKAAAYAEGTQK  181



>ref|XP_011020144.1| PREDICTED: axial regulator YABBY 5-like [Populus euphratica]
Length=188

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 28/37 (76%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML +N+   +  V +G+ K L
Sbjct  146  TAAKNWAHFPHIHFGLMLGTNS---QTKVDDGSEKHL  179



>ref|XP_006487832.1| PREDICTED: putative axial regulator YABBY 2-like isoform X1 [Citrus 
sinensis]
Length=186

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 27/39 (69%), Gaps = 5/39 (13%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL----GVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL      +EGT K
Sbjct  144  TAAKNWAHFPHIHFGLKLD-GNKQAKLDKAAAYAEGTQK  181



>gb|KDO48952.1| hypothetical protein CISIN_1g029862mg [Citrus sinensis]
Length=184

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 27/39 (69%), Gaps = 5/39 (13%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL----GVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL      +EGT K
Sbjct  142  TAAKNWAHFPHIHFGLKLD-GNKQAKLDKAAAYAEGTQK  179



>gb|KDO48953.1| hypothetical protein CISIN_1g029862mg [Citrus sinensis]
Length=174

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 27/39 (69%), Gaps = 5/39 (13%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL----GVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL      +EGT K
Sbjct  132  TAAKNWAHFPHIHFGLKLDG-NKQAKLDKAAAYAEGTQK  169



>ref|XP_003596925.1| YABBY protein [Medicago truncatula]
 gb|AES67176.1| plant-specific transcription factor YABBY family protein [Medicago 
truncatula]
 gb|AFK35891.1| unknown [Medicago truncatula]
Length=195

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 27/37 (73%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL--GVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  + Q KL  GV E T K
Sbjct  155  TAAKNWAHFPHIHFGLKLD-GSKQAKLDHGVGEATQK  190



>ref|XP_007207250.1| hypothetical protein PRUPE_ppa011880m2g, partial [Prunus persica]
 gb|EMJ08449.1| hypothetical protein PRUPE_ppa011880m2g, partial [Prunus persica]
Length=168

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 6/40 (15%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL-----GVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  + QPKL     G  +GT K
Sbjct  125  TAAKNWAHFPHIHFGLKLD-GSKQPKLDQTFAGGDQGTQK  163



>gb|KDP32424.1| hypothetical protein JCGZ_13349 [Jatropha curcas]
Length=185

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNN  70
            TAAKNWAH+PHIHFGLML++NN 
Sbjct  143  TAAKNWAHYPHIHFGLMLETNNQ  165



>ref|XP_006487834.1| PREDICTED: putative axial regulator YABBY 2-like isoform X3 [Citrus 
sinensis]
Length=181

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 27/39 (69%), Gaps = 5/39 (13%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL----GVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q KL      +EGT K
Sbjct  139  TAAKNWAHFPHIHFGLKLDG-NKQAKLDKAAAYAEGTQK  176



>ref|XP_007207251.1| hypothetical protein PRUPE_ppa011880m2g, partial [Prunus persica]
 gb|EMJ08450.1| hypothetical protein PRUPE_ppa011880m2g, partial [Prunus persica]
Length=166

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 6/40 (15%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL-----GVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  + QPKL     G  +GT K
Sbjct  123  TAAKNWAHFPHIHFGLKLD-GSKQPKLDQTFAGGDQGTQK  161



>ref|XP_011017779.1| PREDICTED: axial regulator YABBY 5-like [Populus euphratica]
Length=188

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 29/37 (78%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHI FGLML++ +NQ KL   +G+ K L
Sbjct  146  TAAKNWAHFPHIQFGLMLET-SNQTKLD--DGSDKHL  179



>ref|XP_004241356.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Solanum 
lycopersicum]
Length=192

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 26/42 (62%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG-VSEGTGKRLCKGL  124
            TAAKNWAHFPHIHFGL LD N    KL     G G +   GL
Sbjct  150  TAAKNWAHFPHIHFGLKLDGNKQTNKLDHAVAGEGPQKTIGL  191



>ref|XP_010322450.1| PREDICTED: putative axial regulator YABBY 2 isoform X1 [Solanum 
lycopersicum]
Length=193

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 26/42 (62%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG-VSEGTGKRLCKGL  124
            TAAKNWAHFPHIHFGL LD N    KL     G G +   GL
Sbjct  151  TAAKNWAHFPHIHFGLKLDGNKQTNKLDHAVAGEGPQKTIGL  192



>emb|CAJ38404.1| abaxial cell fate / YABBY [Plantago major]
Length=124

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNN  70
            TAAKNWAHFPHIHFGL LD N +
Sbjct  79   TAAKNWAHFPHIHFGLKLDGNKS  101



>ref|XP_006361110.1| PREDICTED: putative axial regulator YABBY 2-like [Solanum tuberosum]
Length=191

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 26/42 (62%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG-VSEGTGKRLCKGL  124
            TAAKNWAHFPHIHFGL LD N    KL     G G +   GL
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNKQTNKLDHAVAGEGPQKTIGL  190



>gb|EYU30547.1| hypothetical protein MIMGU_mgv1a016431mg [Erythranthe guttata]
Length=122

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRLCK  118
             AAKNWAHFPHIHFGLM D    +P +   EG    + K
Sbjct  69   AAAKNWAHFPHIHFGLMPDQPVKKPNVCQQEGDDHVMMK  107



>gb|ABK95415.1| unknown [Populus trichocarpa]
Length=191

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSN  64
            TAAKNWAHFPHIHFGL LDSN
Sbjct  143  TAAKNWAHFPHIHFGLKLDSN  163



>ref|XP_011044615.1| PREDICTED: putative axial regulator YABBY 2 isoform X3 [Populus 
euphratica]
Length=191

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSN  64
            TAAKNWAHFPHIHFGL LDSN
Sbjct  143  TAAKNWAHFPHIHFGLKLDSN  163



>ref|XP_007132510.1| hypothetical protein PHAVU_011G100300g [Phaseolus vulgaris]
 gb|ESW04504.1| hypothetical protein PHAVU_011G100300g [Phaseolus vulgaris]
Length=183

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            +AAKNWAHFPHIHFGL LD  N+Q KL   E   K
Sbjct  145  SAAKNWAHFPHIHFGLKLD-GNSQAKLDQGEAAEK  178



>ref|XP_004487438.1| PREDICTED: putative axial regulator YABBY 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004487439.1| PREDICTED: putative axial regulator YABBY 2-like isoform X2 [Cicer 
arietinum]
Length=184

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 27/37 (73%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL--GVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  + Q KL  GV + T K
Sbjct  144  TAAKNWAHFPHIHFGLKLD-GSKQAKLDHGVGDATQK  179



>ref|XP_011044616.1| PREDICTED: putative axial regulator YABBY 2 isoform X4 [Populus 
euphratica]
Length=189

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSN  64
            TAAKNWAHFPHIHFGL LDSN
Sbjct  141  TAAKNWAHFPHIHFGLKLDSN  161



>gb|AID67137.1| YAB2 protein, partial [Solanum mammosum]
Length=192

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 25/40 (63%), Gaps = 3/40 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG---VSEGTGKRL  112
            TAAKNWAHFPHIHFGL LD N    KL      EG  K +
Sbjct  150  TAAKNWAHFPHIHFGLKLDGNKQTNKLDHAVAGEGPQKSI  189



>ref|XP_009607228.1| PREDICTED: axial regulator YABBY 5-like isoform X2 [Nicotiana 
tomentosiformis]
Length=137

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 1/31 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSE  94
            TAAKNWAHFPHIHFGL L++  NQ KL  +E
Sbjct  91   TAAKNWAHFPHIHFGLTLET-KNQAKLENAE  120



>gb|AID67133.1| YAB2 protein, partial [Solanum melongena]
 gb|AID67138.1| YAB2 protein, partial [Solanum torvum]
Length=191

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 26/40 (65%), Gaps = 3/40 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVS---EGTGKRL  112
            TAAKNWAHFPHIHFGL LD N    KL  S   EG  K +
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNKQTNKLDHSVAGEGPQKSI  188



>gb|AID67136.1| YAB2 protein, partial [Solanum aethiopicum]
Length=191

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 26/40 (65%), Gaps = 3/40 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVS---EGTGKRL  112
            TAAKNWAHFPHIHFGL LD N    KL  S   EG  K +
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNKQTNKLDHSVAGEGPQKSI  188



>gb|AID67135.1| YAB2 protein, partial [Solanum virginianum]
Length=191

 Score = 47.4 bits (111),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 25/40 (63%), Gaps = 3/40 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG---VSEGTGKRL  112
            TAAKNWAHFPHIHFGL LD N    KL      EG  K +
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNKQTNKLDHAVAGEGPQKSI  188



>gb|AFY26892.1| YABBY2-like transcription factor YAB2 [Morella rubra]
Length=181

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 25/37 (68%), Gaps = 4/37 (11%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNN----NQPKLGVSEGT  100
            TAAKNWAHFPHIHFGL LD N     +Q   G  +GT
Sbjct  138  TAAKNWAHFPHIHFGLKLDGNKQAKLDQTLAGSDQGT  174



>ref|XP_010247865.1| PREDICTED: putative axial regulator YABBY 2 isoform X3 [Nelumbo 
nucifera]
Length=169

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVS-EGTGKRLCKGL  124
            TAAKNWAHFPHIHFGL LD N +  +L  +  G G +  +G 
Sbjct  127  TAAKNWAHFPHIHFGLTLDGNKHVQQLDEAIAGEGPKKTQGF  168



>gb|EYU25970.1| hypothetical protein MIMGU_mgv1a015670mg [Erythranthe guttata]
Length=149

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  N Q K+     T K
Sbjct  112  TAAKNWAHFPHIHFGLKLDG-NKQAKVSGEAATKK  145



>ref|XP_004171895.1| PREDICTED: axial regulator YABBY 5-like, partial [Cucumis sativus]
Length=167

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFP IHFGLML++ NNQ KL
Sbjct  126  TAAKNWAHFPRIHFGLMLET-NNQVKL  151



>ref|XP_010475645.1| PREDICTED: putative axial regulator YABBY 2 [Camelina sativa]
Length=188

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD N    +L  +  + K
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNKKGKQLDQTVASQK  183



>dbj|BAF65260.1| YABBY like transcription factor [Chloranthus serratus]
Length=70

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +2

Query  2   TAAKNWAHFPHIHFGLMLDSNNN  70
           TAAKNWAHFPHIHFGL LD +N 
Sbjct  29  TAAKNWAHFPHIHFGLTLDGSNQ  51



>ref|XP_010458084.1| PREDICTED: putative axial regulator YABBY 2 [Camelina sativa]
Length=188

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD N    +L  +  + K
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNKKGKQLDQTVASQK  183



>ref|XP_008444049.1| PREDICTED: axial regulator YABBY 5-like [Cucumis melo]
Length=191

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFP IHFGLML++ NNQ KL
Sbjct  150  TAAKNWAHFPRIHFGLMLET-NNQVKL  175



>ref|XP_010557447.1| PREDICTED: putative axial regulator YABBY 2 [Tarenaya hassleriana]
Length=189

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGL LD N    +L
Sbjct  150  TAAKNWAHFPHIHFGLKLDGNKQGKQL  176



>ref|XP_006303358.1| hypothetical protein CARUB_v10010384mg [Capsella rubella]
 gb|EOA36256.1| hypothetical protein CARUB_v10010384mg [Capsella rubella]
Length=188

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD N    +L  +  + K
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNKKGKQLDQTVASQK  183



>gb|AID67134.1| YAB2 protein, partial [Solanum sisymbriifolium]
Length=191

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGL LD N    KL
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNKQTNKL  175



>ref|NP_001077490.1| transcription factor YABBY family protein [Arabidopsis thaliana]
 sp|Q9XFB0.1|YAB2_ARATH RecName: Full=Putative axial regulator YABBY 2 [Arabidopsis thaliana]
 gb|AAD33716.1|AF136539_1 YABBY2 [Arabidopsis thaliana]
 gb|AEE28295.1| transcription factor YABBY family protein [Arabidopsis thaliana]
Length=184

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVS  91
            TAAKNWAHFPHIHFGL LD N    +L  S
Sbjct  145  TAAKNWAHFPHIHFGLKLDGNKKGKQLDQS  174



>ref|XP_010533151.1| PREDICTED: axial regulator YABBY 5 [Tarenaya hassleriana]
Length=174

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 1/28 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG  85
            TAAKNWAHFPHIHFGLML+ NN   KL 
Sbjct  148  TAAKNWAHFPHIHFGLMLE-NNKHAKLA  174



>ref|XP_010488902.1| PREDICTED: putative axial regulator YABBY 2 [Camelina sativa]
Length=188

 Score = 47.0 bits (110),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD N    +L  +  + K
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNKKGKQLDQTVASQK  183



>ref|XP_002299655.2| hypothetical protein POPTR_0001s22180g [Populus trichocarpa]
 gb|EEE84460.2| hypothetical protein POPTR_0001s22180g [Populus trichocarpa]
Length=206

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/21 (95%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSN  64
            TAAKNWAHFPHIHFGL LDSN
Sbjct  158  TAAKNWAHFPHIHFGLKLDSN  178



>ref|XP_002889696.1| hypothetical protein ARALYDRAFT_470907 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65955.1| hypothetical protein ARALYDRAFT_470907 [Arabidopsis lyrata subsp. 
lyrata]
Length=184

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVS  91
            TAAKNWAHFPHIHFGL LD N    +L  S
Sbjct  145  TAAKNWAHFPHIHFGLKLDGNKKGKQLDQS  174



>dbj|BAJ83624.1| YAB5-like YABBY protein [Cabomba caroliniana]
Length=174

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 25/37 (68%), Gaps = 3/37 (8%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRL  112
            TAAKNWAHFPHIHFGLML+   N  K    E T K L
Sbjct  132  TAAKNWAHFPHIHFGLMLE---NSRKEKFDEVTDKLL  165



>ref|XP_004291524.1| PREDICTED: putative axial regulator YABBY 2-like [Fragaria vesca 
subsp. vesca]
Length=234

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 27/39 (69%), Gaps = 5/39 (13%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLG----VSEGTGK  106
            TAAKNWAHFPHIHFGL L+S N Q KL       EGT K
Sbjct  191  TAAKNWAHFPHIHFGLKLES-NKQAKLDNQTFAGEGTQK  228



>ref|XP_008385589.1| PREDICTED: putative axial regulator YABBY 2 isoform X4 [Malus 
domestica]
Length=184

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 22/26 (85%), Gaps = 1/26 (4%)
 Frame = +2

Query  5    AAKNWAHFPHIHFGLMLDSNNNQPKL  82
            AAKNWAHFPHIHFGL LD  N QPKL
Sbjct  151  AAKNWAHFPHIHFGLKLDX-NKQPKL  175



>ref|XP_004150030.1| PREDICTED: axial regulator YABBY 5-like [Cucumis sativus]
Length=193

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFP IHFGLML++ NNQ KL
Sbjct  152  TAAKNWAHFPRIHFGLMLET-NNQVKL  177



>ref|XP_008385588.1| PREDICTED: putative axial regulator YABBY 2 isoform X3 [Malus 
domestica]
Length=186

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 22/26 (85%), Gaps = 1/26 (4%)
 Frame = +2

Query  5    AAKNWAHFPHIHFGLMLDSNNNQPKL  82
            AAKNWAHFPHIHFGL LD  N QPKL
Sbjct  153  AAKNWAHFPHIHFGLKLDX-NKQPKL  177



>gb|ACN59437.1| YAB2-1 [Dimocarpus longan]
Length=152

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 22/27 (81%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGL LD  N Q KL
Sbjct  111  TAAKNWAHFPHIHFGLKLD-GNKQGKL  136



>ref|XP_011044613.1| PREDICTED: axial regulator YABBY 5-like isoform X1 [Populus euphratica]
Length=198

 Score = 47.0 bits (110),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNN  67
            TAAKNWAHFPHIHFGL LDSN 
Sbjct  150  TAAKNWAHFPHIHFGLKLDSNK  171



>emb|CDX97491.1| BnaC08g13560D [Brassica napus]
Length=189

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/30 (70%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVS  91
            TAAKNWAHFPHIHFGL LD N    +L  S
Sbjct  150  TAAKNWAHFPHIHFGLKLDGNKKGKQLDQS  179



>ref|XP_010247861.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Nelumbo 
nucifera]
Length=182

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVS-EGTGKRLCKGL  124
            TAAKNWAHFPHIHFGL LD N +  +L  +  G G +  +G 
Sbjct  140  TAAKNWAHFPHIHFGLTLDGNKHVQQLDEAIAGEGPKKTQGF  181



>gb|ACN59438.1| YAB2-2 [Dimocarpus longan]
Length=152

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 22/27 (81%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGL LD  N Q KL
Sbjct  111  TAAKNWAHFPHIHFGLKLD-GNKQGKL  136



>gb|ACN59440.1| YAB2-5 [Dimocarpus longan]
 gb|ACN59441.1| YAB2-6 [Dimocarpus longan]
Length=71

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 22/27 (81%), Gaps = 1/27 (4%)
 Frame = +2

Query  2   TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
           TAAKNWAHFPHIHFGL LD  N Q KL
Sbjct  30  TAAKNWAHFPHIHFGLKLD-GNKQGKL  55



>emb|CDY31142.1| BnaA08g26920D [Brassica napus]
Length=158

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGL LD N    +L
Sbjct  119  TAAKNWAHFPHIHFGLKLDGNKKGKQL  145



>ref|XP_009607227.1| PREDICTED: axial regulator YABBY 5-like isoform X1 [Nicotiana 
tomentosiformis]
Length=184

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 1/31 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSE  94
            TAAKNWAHFPHIHFGL L++  NQ KL  +E
Sbjct  138  TAAKNWAHFPHIHFGLTLET-KNQAKLENAE  167



>ref|XP_010247851.1| PREDICTED: putative axial regulator YABBY 2 isoform X1 [Nelumbo 
nucifera]
Length=184

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 1/42 (2%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVS-EGTGKRLCKGL  124
            TAAKNWAHFPHIHFGL LD N +  +L  +  G G +  +G 
Sbjct  142  TAAKNWAHFPHIHFGLTLDGNKHVQQLDEAIAGEGPKKTQGF  183



>ref|XP_010521623.1| PREDICTED: putative axial regulator YABBY 2 [Tarenaya hassleriana]
Length=186

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGL LD N    +L
Sbjct  151  TAAKNWAHFPHIHFGLKLDGNKQGKQL  177



>ref|XP_011044614.1| PREDICTED: axial regulator YABBY 5-like isoform X2 [Populus euphratica]
Length=196

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNN  67
            TAAKNWAHFPHIHFGL LDSN 
Sbjct  148  TAAKNWAHFPHIHFGLKLDSNK  169



>ref|XP_009368867.1| PREDICTED: axial regulator YABBY 5-like [Pyrus x bretschneideri]
Length=174

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 24/27 (89%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFP IHFGLML++ N+Q KL
Sbjct  146  TAAKNWAHFPRIHFGLMLET-NSQAKL  171



>ref|XP_010259025.1| PREDICTED: protein YABBY 4-like [Nelumbo nucifera]
Length=211

 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +2

Query  5    AAKNWAHFPHIHFGLMLDSNNNQPKLGVSEG  97
            AAKNWAHFPHIHFGLM D    +P +   EG
Sbjct  161  AAKNWAHFPHIHFGLMPDQTVKKPNVRQQEG  191



>ref|XP_010031587.1| PREDICTED: putative axial regulator YABBY 2 isoform X4 [Eucalyptus 
grandis]
 gb|KCW50949.1| hypothetical protein EUGRSUZ_J00587 [Eucalyptus grandis]
Length=158

 Score = 46.2 bits (108),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 26/39 (67%), Gaps = 4/39 (10%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNN----NQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD N     +Q   G  +GT K
Sbjct  115  TAAKNWAHFPHIHFGLKLDGNKQGKADQAIAGDHQGTHK  153



>ref|XP_010031588.1| PREDICTED: putative axial regulator YABBY 2 isoform X5 [Eucalyptus 
grandis]
Length=156

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 26/39 (67%), Gaps = 4/39 (10%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNN----NQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD N     +Q   G  +GT K
Sbjct  113  TAAKNWAHFPHIHFGLKLDGNKQGKADQAIAGDHQGTHK  151



>ref|XP_010090516.1| hypothetical protein L484_017140 [Morus notabilis]
 gb|EXB39665.1| hypothetical protein L484_017140 [Morus notabilis]
Length=190

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 23/28 (82%), Gaps = 1/28 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLD-SNNNQPKL  82
            TAAKNWAHFPHIHFGL LD + N Q KL
Sbjct  144  TAAKNWAHFPHIHFGLKLDGTKNKQAKL  171



>gb|KFK43154.1| hypothetical protein AALP_AA1G086900 [Arabis alpina]
Length=184

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGL LD N    +L
Sbjct  145  TAAKNWAHFPHIHFGLKLDGNKKGKQL  171



>ref|XP_009110891.1| PREDICTED: putative axial regulator YABBY 2 isoform X1 [Brassica 
rapa]
Length=188

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGL LD N    +L
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNKKGKQL  175



>ref|XP_009110892.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Brassica 
rapa]
Length=187

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGL LD N    +L
Sbjct  148  TAAKNWAHFPHIHFGLKLDGNKKGKQL  174



>ref|XP_011024889.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Populus 
euphratica]
Length=164

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNN  67
            TAAKNWAHFPHIHFGL LDS+ 
Sbjct  141  TAAKNWAHFPHIHFGLKLDSDK  162



>ref|XP_006388657.1| hypothetical protein POPTR_0127s002012g, partial [Populus trichocarpa]
 gb|ERP47571.1| hypothetical protein POPTR_0127s002012g, partial [Populus trichocarpa]
Length=99

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2   TAAKNWAHFPHIHFGLMLDSNN  67
           TAAKNWAHFPHIHFGL LDS+ 
Sbjct  76  TAAKNWAHFPHIHFGLKLDSDK  97



>gb|KCW50948.1| hypothetical protein EUGRSUZ_J00587 [Eucalyptus grandis]
Length=183

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 26/39 (67%), Gaps = 4/39 (10%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNN----NQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD N     +Q   G  +GT K
Sbjct  140  TAAKNWAHFPHIHFGLKLDGNKQGKADQAIAGDHQGTHK  178



>ref|XP_010031584.1| PREDICTED: putative axial regulator YABBY 2 isoform X1 [Eucalyptus 
grandis]
 gb|KCW50947.1| hypothetical protein EUGRSUZ_J00587 [Eucalyptus grandis]
Length=191

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 26/39 (67%), Gaps = 4/39 (10%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNN----NQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD N     +Q   G  +GT K
Sbjct  148  TAAKNWAHFPHIHFGLKLDGNKQGKADQAIAGDHQGTHK  186



>ref|XP_010031586.1| PREDICTED: putative axial regulator YABBY 2 isoform X3 [Eucalyptus 
grandis]
 gb|KCW50945.1| hypothetical protein EUGRSUZ_J00587 [Eucalyptus grandis]
Length=188

 Score = 46.2 bits (108),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 26/39 (67%), Gaps = 4/39 (10%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNN----NQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD N     +Q   G  +GT K
Sbjct  145  TAAKNWAHFPHIHFGLKLDGNKQGKADQAIAGDHQGTHK  183



>ref|XP_011024888.1| PREDICTED: putative axial regulator YABBY 2 isoform X1 [Populus 
euphratica]
Length=165

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNN  67
            TAAKNWAHFPHIHFGL LDS+ 
Sbjct  142  TAAKNWAHFPHIHFGLKLDSDK  163



>ref|XP_010031585.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Eucalyptus 
grandis]
 gb|KCW50946.1| hypothetical protein EUGRSUZ_J00587 [Eucalyptus grandis]
Length=189

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 26/39 (67%), Gaps = 4/39 (10%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNN----NQPKLGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD N     +Q   G  +GT K
Sbjct  146  TAAKNWAHFPHIHFGLKLDGNKQGKADQAIAGDHQGTHK  184



>ref|XP_006417685.1| hypothetical protein EUTSA_v10008858mg [Eutrema salsugineum]
 dbj|BAJ34412.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36038.1| hypothetical protein EUTSA_v10008858mg [Eutrema salsugineum]
Length=189

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGL LD N    +L
Sbjct  150  TAAKNWAHFPHIHFGLKLDGNKKGKQL  176



>emb|CDP15572.1| unnamed protein product [Coffea canephora]
Length=186

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGL +D N    KL
Sbjct  143  TAAKNWAHFPHIHFGLKVDGNKQANKL  169



>ref|XP_009798278.1| PREDICTED: axial regulator YABBY 5-like [Nicotiana sylvestris]
 gb|AII20188.1| FAS protein [Nicotiana tabacum]
Length=190

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 23/27 (85%), Gaps = 1/27 (4%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGL L+S N Q KL
Sbjct  149  TAAKNWAHFPHIHFGLKLES-NKQAKL  174



>gb|EPS57324.1| hypothetical protein M569_17494, partial [Genlisea aurea]
Length=92

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +2

Query  2   TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEG  97
            AAKNWAHFPHIHFGLM D    +P +   +G
Sbjct  37  AAAKNWAHFPHIHFGLMPDQPLKKPNICQQDG  68



>emb|CAN70664.1| hypothetical protein VITISV_008108 [Vitis vinifera]
Length=178

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNN  70
            TAAKNWAHFPHIHFGL LD N  
Sbjct  137  TAAKNWAHFPHIHFGLKLDGNKQ  159



>ref|XP_006417684.1| hypothetical protein EUTSA_v10008858mg [Eutrema salsugineum]
 gb|ESQ36037.1| hypothetical protein EUTSA_v10008858mg [Eutrema salsugineum]
Length=188

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGL LD N    +L
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNKKGKQL  175



>ref|XP_010263069.1| PREDICTED: putative axial regulator YABBY 2 isoform X1 [Nelumbo 
nucifera]
Length=184

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSN  64
            TAAKNWAHFPHIHFGL LD N
Sbjct  143  TAAKNWAHFPHIHFGLTLDGN  163



>ref|XP_010263070.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Nelumbo 
nucifera]
Length=183

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSN  64
            TAAKNWAHFPHIHFGL LD N
Sbjct  142  TAAKNWAHFPHIHFGLTLDGN  162



>ref|XP_004140176.1| PREDICTED: putative axial regulator YABBY 2-like [Cucumis sativus]
 ref|XP_004156064.1| PREDICTED: putative axial regulator YABBY 2-like [Cucumis sativus]
 gb|KGN48059.1| hypothetical protein Csa_6G426940 [Cucumis sativus]
Length=173

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNN  70
            TAAKNWAHFPHIHFGL LD N  
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNKQ  171



>ref|XP_010263071.1| PREDICTED: putative axial regulator YABBY 2 isoform X3 [Nelumbo 
nucifera]
Length=182

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSN  64
            TAAKNWAHFPHIHFGL LD N
Sbjct  141  TAAKNWAHFPHIHFGLTLDGN  161



>gb|AAV74414.1| filamentous flower-like yabby protein, partial [Tropaeolum majus]
Length=80

 Score = 44.7 bits (104),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    AAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRLCKGL  124
            AAKNWAHFPHIHFGLM D    +  +   EG    + +G 
Sbjct  30   AAKNWAHFPHIHFGLMPDQTIKKTNVRQQEGEDVLMKEGF  69



>gb|EYU31965.1| hypothetical protein MIMGU_mgv1a013346mg [Erythranthe guttata]
Length=223

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEG  97
             AAKNWAHFPHIHFGLM D    +P +   EG
Sbjct  171  AAAKNWAHFPHIHFGLMPDQPVKKPNVCQQEG  202



>ref|XP_011090395.1| PREDICTED: axial regulator YABBY 1 [Sesamum indicum]
Length=212

 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSEG  97
             AAKNWAHFPHIHFGLM D    +P +   EG
Sbjct  161  AAAKNWAHFPHIHFGLMPDQPVKKPNVCQQEG  192



>ref|XP_010651636.1| PREDICTED: putative axial regulator YABBY 2 isoform X1 [Vitis 
vinifera]
Length=184

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNN  70
            TAAKNWAHFPHIHFGL LD N  
Sbjct  143  TAAKNWAHFPHIHFGLKLDGNKQ  165



>ref|XP_009118373.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Brassica 
rapa]
Length=187

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGL LD N    +L
Sbjct  148  TAAKNWAHFPHIHFGLKLDGNKKGKQL  174



>ref|XP_009118372.1| PREDICTED: putative axial regulator YABBY 2 isoform X1 [Brassica 
rapa]
 emb|CDY06316.1| BnaA09g48870D [Brassica napus]
Length=188

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGL LD N    +L
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNKKGKQL  175



>emb|CDY22681.1| BnaC08g43150D [Brassica napus]
Length=188

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKL  82
            TAAKNWAHFPHIHFGL LD N    +L
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNKKGKQL  175



>ref|XP_009762053.1| PREDICTED: axial regulator YABBY 5-like isoform X2 [Nicotiana 
sylvestris]
Length=200

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 25/31 (81%), Gaps = 1/31 (3%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPKLGVSE  94
            TAAKNWAHFPHIHFGL L++  NQ KL  +E
Sbjct  154  TAAKNWAHFPHIHFGLTLET-KNQAKLENAE  183



>ref|XP_010651637.1| PREDICTED: putative axial regulator YABBY 2 isoform X3 [Vitis 
vinifera]
Length=182

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNN  70
            TAAKNWAHFPHIHFGL LD N  
Sbjct  141  TAAKNWAHFPHIHFGLKLDGNKQ  163



>ref|XP_002277937.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Vitis 
vinifera]
 emb|CBI24407.3| unnamed protein product [Vitis vinifera]
Length=183

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNN  70
            TAAKNWAHFPHIHFGL LD N  
Sbjct  142  TAAKNWAHFPHIHFGLKLDGNKQ  164



>ref|XP_002515880.1| Axial regulator YABBY2, putative [Ricinus communis]
 gb|EEF46549.1| Axial regulator YABBY2, putative [Ricinus communis]
Length=190

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/21 (90%), Positives = 19/21 (90%), Gaps = 0/21 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSN  64
            TAAKNWAHFPHIHFGL LD N
Sbjct  142  TAAKNWAHFPHIHFGLKLDGN  162



>ref|XP_010651638.1| PREDICTED: putative axial regulator YABBY 2 isoform X4 [Vitis 
vinifera]
Length=181

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNN  70
            TAAKNWAHFPHIHFGL LD N  
Sbjct  140  TAAKNWAHFPHIHFGLKLDGNKQ  162



>gb|KDP25628.1| hypothetical protein JCGZ_20784 [Jatropha curcas]
Length=213

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = +2

Query  5    AAKNWAHFPHIHFGLMLDSNNNQPKLGVSEGTGKRLCK  118
            AAKNWAHFPHIHFGLM D    +  +   EG+   L K
Sbjct  162  AAKNWAHFPHIHFGLMPDQTVKKTNMRQQEGSDDVLMK  199



>emb|CDX95059.1| BnaC05g06120D [Brassica napus]
Length=188

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/23 (83%), Positives = 19/23 (83%), Gaps = 0/23 (0%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNN  70
            TAAKNWAHFPHIHFGL LD N  
Sbjct  149  TAAKNWAHFPHIHFGLKLDGNKK  171



>ref|XP_008230525.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Prunus 
mume]
Length=190

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 27/40 (68%), Gaps = 6/40 (15%)
 Frame = +2

Query  2    TAAKNWAHFPHIHFGLMLDSNNNQPK-----LGVSEGTGK  106
            TAAKNWAHFPHIHFGL LD  + QPK      G  +GT K
Sbjct  147  TAAKNWAHFPHIHFGLKLD-GSKQPKPDQTFAGGDQGTQK  185



>ref|XP_008385587.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Malus 
domestica]
Length=217

 Score = 46.2 bits (108),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 22/26 (85%), Gaps = 1/26 (4%)
 Frame = +2

Query  5    AAKNWAHFPHIHFGLMLDSNNNQPKL  82
            AAKNWAHFPHIHFGL LD  N QPKL
Sbjct  184  AAKNWAHFPHIHFGLKLDX-NKQPKL  208



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510027850688