BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16592_g1_i1 len=517 path=[752:0-280 129:281-322 1074:323-417
1169:418-516]

Length=517
                                                                      Score     E

gb|AFJ04517.1|  low-molecular-weight cysteine-rich 69                 80.9    1e-16   
gb|ABO36637.1|  defensin protein                                      80.9    1e-16   Solanum lycopersicum
ref|XP_009610211.1|  PREDICTED: defensin J1-2                         80.9    2e-16   
ref|XP_009351646.1|  PREDICTED: defensin Ec-AMP-D2-like               80.5    2e-16   
gb|ADK87340.1|  defensin                                              80.5    2e-16   
ref|NP_001234872.1|  gamma-thionin precursor                          80.1    2e-16   
gb|AAL35366.1|AF442388_1  defensin protein precursor                  80.5    2e-16   Capsicum annuum
gb|ABO36641.1|  defensin protein                                      80.1    2e-16   Solanum pimpinellifolium [currant tomato]
ref|XP_009784025.1|  PREDICTED: defensin J1-2                         80.1    3e-16   
gb|ACM90159.1|  low-molecular-weight cysteine-rich 69                 79.3    5e-16   Jatropha curcas
gb|KHN06998.1|  Defensin-like protein                                 79.3    6e-16   
dbj|BAA95697.1|  thionin like protein                                 79.0    6e-16   Nicotiana tabacum [American tobacco]
ref|XP_009593293.1|  PREDICTED: defensin-like protein P322            79.0    6e-16   
ref|XP_008340514.1|  PREDICTED: defensin Ec-AMP-D2-like               79.0    8e-16   
gb|ACS96442.1|  defensin                                              78.6    9e-16   Jatropha curcas
ref|XP_004242747.1|  PREDICTED: defensin-like protein                 78.6    9e-16   
ref|XP_008389119.1|  PREDICTED: defensin Ec-AMP-D2-like               78.6    9e-16   
ref|XP_007156391.1|  hypothetical protein PHAVU_003G282500g           78.6    1e-15   
ref|XP_010910081.1|  PREDICTED: defensin Ec-AMP-D2-like               78.6    1e-15   
gb|ACB32234.1|  gamma-thionin/defensin                                78.6    1e-15   Solanum chacoense
sp|O65740.1|DEF2_CAPAN  RecName: Full=Defensin J1-2; Flags: Precu...  78.6    1e-15   Capsicum annuum
ref|XP_009769843.1|  PREDICTED: defensin-like protein P322            78.6    1e-15   
ref|NP_178319.1|  defensin-like protein 2                             78.2    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010043884.1|  PREDICTED: defensin Ec-AMP-D2-like               78.2    1e-15   
gb|ADK91098.1|  PCP17C2                                               77.4    1e-15   
ref|XP_006292781.1|  hypothetical protein CARUB_v10019030mg           77.8    2e-15   
ref|NP_001148158.1|  LOC100281766 precursor                           77.8    2e-15   Zea mays [maize]
ref|XP_003630422.1|  Defensin                                         77.4    2e-15   
ref|XP_006395808.1|  hypothetical protein EUTSA_v10005229mg           77.4    2e-15   
ref|XP_010502227.1|  PREDICTED: defensin-like protein 2               77.4    3e-15   
ref|XP_007137817.1|  hypothetical protein PHAVU_009G158100g           79.0    3e-15   
ref|XP_003630421.1|  Defensin                                         77.4    3e-15   
gb|KHN23780.1|  Defensin SD2                                          77.4    3e-15   
gb|AHA50471.1|  defensin-like protein 4                               77.0    3e-15   
ref|XP_003526900.1|  PREDICTED: defensin-like protein 6-like          77.0    3e-15   
ref|XP_006420697.1|  hypothetical protein CICLE_v10006362mg           77.0    3e-15   
ref|NP_001234987.1|  protease inhibitor precursor                     77.0    4e-15   
gb|AAL85480.1|  defensin protein 1                                    77.0    4e-15   Prunus persica
ref|XP_007223891.1|  hypothetical protein PRUPE_ppa014246mg           77.0    4e-15   
ref|XP_006585876.1|  PREDICTED: defensin-like protein-like            78.2    4e-15   
ref|XP_006649329.1|  PREDICTED: defensin J1-2-like                    77.0    4e-15   
ref|XP_006367978.1|  PREDICTED: defensin-like protein P322-like       77.0    4e-15   
ref|XP_006367121.1|  PREDICTED: defensin J1-2-like                    76.3    6e-15   
ref|XP_009604566.1|  PREDICTED: defensin J1-2-like                    76.3    6e-15   
ref|XP_009614488.1|  PREDICTED: defensin J1-2-like                    76.3    6e-15   
gb|ADQ43196.1|  unknown                                               76.3    6e-15   
ref|XP_003628978.1|  Defensin                                         76.3    6e-15   
ref|XP_003629332.1|  Defensin                                         76.3    8e-15   
ref|XP_010513972.1|  PREDICTED: defensin-like protein 2               75.9    9e-15   
ref|XP_003628977.1|  Defensin                                         75.9    1e-14   
ref|XP_002459605.1|  hypothetical protein SORBIDRAFT_02g007410        75.9    1e-14   Sorghum bicolor [broomcorn]
gb|ACN93800.1|  defensin precursor                                    75.5    1e-14   Vigna unguiculata
sp|P82659.1|DFSD2_HELAN  RecName: Full=Defensin SD2; AltName: Ful...  75.5    1e-14   Helianthus annuus
gb|AFE88173.1|  g-thionin                                             75.5    2e-14   
ref|XP_006359487.1|  PREDICTED: defensin-like protein-like            75.1    2e-14   
gb|AHA50472.1|  defensin-like protein 5                               75.1    2e-14   
ref|XP_007033927.1|  Scorpion toxin-like knottin superfamily protein  76.6    2e-14   
ref|XP_007033370.1|  Scorpion toxin-like knottin superfamily protein  75.1    2e-14   
gb|AFK44299.1|  unknown                                               75.1    2e-14   
ref|XP_006292136.1|  hypothetical protein CARUB_v10018340mg           74.7    2e-14   
ref|XP_008349481.1|  PREDICTED: defensin Ec-AMP-D2-like               74.7    3e-14   
ref|XP_004297787.1|  PREDICTED: defensin-like protein 2-like          74.7    3e-14   
gb|AHA50473.1|  defensin-like protein 6                               74.3    3e-14   
gb|AFK47422.1|  unknown                                               74.3    4e-14   
gb|ADK91116.1|  PCP17C2                                               73.6    4e-14   
ref|XP_009792224.1|  PREDICTED: defensin-like protein P322            74.3    4e-14   
gb|AAL15885.1|AF417297_1  putative gamma-thionin                      74.3    4e-14   Castanea sativa
ref|XP_010250779.1|  PREDICTED: defensin Ec-AMP-D2-like               74.3    4e-14   
ref|XP_009354384.1|  PREDICTED: defensin Ec-AMP-D2-like               74.3    4e-14   
gb|KHG09995.1|  Defensin-like protein 1                               73.9    5e-14   
gb|AAS13434.1|  defensin                                              73.2    5e-14   Nicotiana attenuata
gb|ADK36631.1|  defensin-like protein                                 73.2    6e-14   
ref|XP_007159918.1|  hypothetical protein PHAVU_002G278600g           73.9    6e-14   
gb|AGT51229.1|  defensin                                              73.9    6e-14   
ref|XP_009129168.1|  PREDICTED: defensin-like protein 1               73.6    6e-14   
gb|AAS65426.1|  Kunitz-type trypsin inhibitor                         73.9    6e-14   Ipomoea batatas [batate]
ref|XP_002274353.1|  PREDICTED: defensin Ec-AMP-D2                    73.6    6e-14   Vitis vinifera
ref|XP_003599384.1|  Defensin                                         73.6    7e-14   
ref|XP_004297786.1|  PREDICTED: defensin-like protein 2-like          73.6    7e-14   
ref|XP_010671291.1|  PREDICTED: defensin Ec-AMP-D2-like               73.6    7e-14   
ref|XP_006394251.1|  hypothetical protein EUTSA_v10005235mg           73.2    8e-14   
ref|XP_006359486.1|  PREDICTED: defensin-like protein-like            73.6    8e-14   
ref|XP_006395809.1|  hypothetical protein EUTSA_v10005228mg           73.6    8e-14   
ref|XP_003628979.1|  Defensin                                         73.6    8e-14   
ref|XP_009599356.1|  PREDICTED: defensin-like protein                 73.2    1e-13   
ref|XP_004242748.1|  PREDICTED: defensin-like protein                 73.2    1e-13   
ref|XP_009413079.1|  PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|P...  73.2    1e-13   
ref|XP_011084089.1|  PREDICTED: defensin Ec-AMP-D2-like               72.8    1e-13   
gb|KEH35661.1|  Defensin                                              72.8    1e-13   
ref|XP_010319372.1|  PREDICTED: defensin Ec-AMP-D2-like               72.8    1e-13   
ref|XP_002459603.1|  hypothetical protein SORBIDRAFT_02g007390        72.8    1e-13   Sorghum bicolor [broomcorn]
ref|XP_009114206.1|  PREDICTED: defensin-like protein 1               72.8    2e-13   
ref|XP_011070574.1|  PREDICTED: defensin J1-2-like                    72.4    2e-13   
ref|XP_002875115.1|  hypothetical protein ARALYDRAFT_484136           72.8    2e-13   
gb|AIT42147.1|  defensin-like protein                                 72.8    2e-13   
gb|AIT42153.1|  defensin-like protein                                 72.8    2e-13   
ref|NP_178321.1|  defensin-like protein 1                             72.4    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006466198.1|  PREDICTED: defensin-like protein 6-like          72.4    2e-13   
gb|AIT42150.1|  defensin-like protein                                 72.0    2e-13   
ref|NP_178320.1|  defensin-like protein 4                             72.4    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004151187.1|  PREDICTED: defensin J1-2-like                    72.4    2e-13   
gb|AIT42152.1|  defensin-like protein                                 72.4    2e-13   
gb|ABS72000.1|  putative defensin protein 1                           71.6    2e-13   Olea europaea
gb|AGT51228.1|  defensin                                              72.0    2e-13   
ref|XP_010513973.1|  PREDICTED: defensin-like protein 1               72.0    2e-13   
gb|AIA67010.1|  defensin                                              72.4    2e-13   
ref|XP_010495961.1|  PREDICTED: defensin-like protein 1               72.0    2e-13   
ref|XP_004242750.1|  PREDICTED: defensin-like protein P322            72.0    2e-13   
gb|ABA81896.1|  putative defensin                                     72.0    2e-13   Aquilegia formosa
gb|ABA86586.1|  putative defensin 1                                   72.0    2e-13   Aquilegia formosa
ref|XP_004509606.1|  PREDICTED: defensin J1-2-like                    72.0    3e-13   
ref|XP_009101273.1|  PREDICTED: defensin-like protein 2               72.0    3e-13   
emb|CDY48618.1|  BnaC09g20670D                                        72.0    3e-13   
ref|XP_009800136.1|  PREDICTED: defensin J1-2-like                    72.0    3e-13   
gb|EMT03365.1|  Defensin-like protein 1                               72.0    3e-13   
gb|KGN62247.1|  hypothetical protein Csa_2G340400                     72.4    3e-13   
ref|XP_006426420.1|  hypothetical protein CICLE_v10026887mg           71.6    3e-13   
ref|XP_008793609.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X1    72.0    3e-13   
sp|Q40901.1|DEF_PETIN  RecName: Full=Defensin-like protein; AltNa...  71.6    3e-13   Petunia integrifolia [violet-flowered petunia]
ref|XP_006359485.1|  PREDICTED: defensin-like protein-like            72.0    3e-13   
gb|ADB02899.1|  gamma-thionin PPT precursor defensin 1-like protein   72.0    3e-13   
gb|AAA91049.1|  protease inhibitor II                                 71.6    4e-13   Brassica rapa
gb|ABA86589.1|  putative defensin 1                                   71.2    4e-13   Aquilegia pyrenaica
ref|XP_008793610.1|  PREDICTED: defensin Ec-AMP-D1-like isoform X2    71.6    4e-13   
gb|AAG17880.1|AF293407_1  Kunitz trypsin inhibitor protein            71.2    5e-13   Phaseolus coccineus [scarlet runner bean]
ref|XP_007137816.1|  hypothetical protein PHAVU_009G158000g           71.2    5e-13   
ref|XP_006426419.1|  hypothetical protein CICLE_v10026887mg           71.2    5e-13   
ref|XP_006301968.1|  hypothetical protein CARUB_v10022448mg           71.2    5e-13   
ref|XP_010908980.1|  PREDICTED: defensin Ec-AMP-D1-like               71.2    5e-13   
ref|XP_009802655.1|  PREDICTED: defensin-like protein                 71.2    5e-13   
gb|AAG38520.1|AF283535_1  proteinase inhibitor se60-like protein      70.9    6e-13   Citrus x paradisi [grapefruit]
ref|XP_008437687.1|  PREDICTED: defensin J1-2-like                    71.2    6e-13   
gb|KDP32807.1|  hypothetical protein JCGZ_12099                       71.2    6e-13   
ref|XP_008466730.1|  PREDICTED: defensin J1-2-like                    70.9    6e-13   
ref|NP_001048853.1|  Os03g0130300                                     71.2    6e-13   Oryza sativa Japonica Group [Japonica rice]
gb|KGN49760.1|  hypothetical protein Csa_5G114570                     70.9    6e-13   
ref|XP_009351645.1|  PREDICTED: defensin Ec-AMP-D2-like               70.5    9e-13   
gb|EYU30124.1|  hypothetical protein MIMGU_mgv1a017438mg              70.5    1e-12   
emb|CAA79164.1|  seed-specific low molecular weight sulfur-rich p...  70.1    1e-12   Glycine max [soybeans]
gb|AGT51227.1|  defensin                                              70.1    1e-12   
ref|XP_002325735.1|  hypothetical protein POPTR_0019s00770g           70.1    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_002272913.2|  PREDICTED: defensin-like protein 1 isoform X1    70.1    1e-12   Vitis vinifera
gb|KHN16909.1|  Defensin J1-2                                         70.1    2e-12   
ref|XP_007159919.1|  hypothetical protein PHAVU_002G278700g           69.7    2e-12   
ref|XP_010270777.1|  PREDICTED: defensin-like protein                 69.7    2e-12   
gb|AIT42149.1|  defensin-like protein                                 69.7    2e-12   
gb|ABA86587.1|  putative defensin 1                                   69.7    2e-12   Aquilegia chrysantha
ref|XP_006392063.1|  hypothetical protein EUTSA_v10023787mg           69.7    2e-12   
ref|XP_010653029.1|  PREDICTED: defensin-like protein 1 isoform X2    69.3    2e-12   
gb|KEH35658.1|  low-molecular-weight cysteine-rich protein            68.6    2e-12   
ref|XP_004503014.1|  PREDICTED: defensin-like protein 6-like isof...  69.3    3e-12   
ref|XP_002325734.2|  defensin-like family protein                     69.3    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011001252.1|  PREDICTED: defensin-like protein 1               68.9    3e-12   
ref|XP_004503015.1|  PREDICTED: defensin-like protein 6-like isof...  68.9    4e-12   
ref|XP_009769844.1|  PREDICTED: defensin-like protein P322            68.9    4e-12   
ref|XP_006586320.1|  PREDICTED: defensin-like protein-like            68.6    4e-12   
ref|XP_007045354.1|  Defensin-like protein isoform 2                  68.6    4e-12   
ref|XP_007045353.1|  Defensin-like protein isoform 1                  68.6    5e-12   
gb|KHN09675.1|  Defensin-like protein                                 68.2    5e-12   
ref|XP_009768915.1|  PREDICTED: defensin-like protein isoform X2      68.6    5e-12   
ref|NP_176302.2|  defensin-like protein                               68.6    5e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007226225.1|  hypothetical protein PRUPE_ppa016594mg           68.6    5e-12   
ref|XP_002459604.1|  hypothetical protein SORBIDRAFT_02g007400        68.6    6e-12   Sorghum bicolor [broomcorn]
ref|XP_009768914.1|  PREDICTED: defensin-like protein isoform X1      68.6    6e-12   
ref|XP_009593292.1|  PREDICTED: defensin-like protein P322            68.2    6e-12   
gb|ABK93231.1|  unknown                                               68.2    6e-12   Populus trichocarpa [western balsam poplar]
dbj|BAK07823.1|  predicted protein                                    68.9    6e-12   
gb|ABK28445.1|  unknown                                               68.2    6e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AIA67012.1|  defensin                                              68.2    7e-12   
ref|XP_002886566.1|  protease inhibitor II                            68.2    7e-12   
gb|AIA67013.1|  defensin                                              68.2    7e-12   
gb|AAM62652.1|  protease inhibitor II                                 67.8    9e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010088525.1|  Defensin-like protein 2                          67.8    1e-11   
ref|XP_009614667.1|  PREDICTED: defensin-like protein                 67.8    1e-11   
ref|XP_004509603.1|  PREDICTED: defensin-like protein-like            67.4    1e-11   
gb|AFW90621.1|  protease inhibitor-related protein                    67.4    1e-11   
gb|AIT42148.1|  defensin-like protein                                 67.4    1e-11   
gb|AAG51654.1|AC018908_20  unknown protein; 87272-87105               67.0    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|EMS65298.1|  Defensin-like protein 1                               67.4    1e-11   
gb|ACJ26760.1|  protease inhibitor-related protein                    67.0    2e-11   Solanum tuberosum [potatoes]
dbj|BAH29762.1|  defensin-like cystein-rich peptide                   67.0    2e-11   Torenia fournieri [bluewings]
emb|CAN69975.1|  hypothetical protein VITISV_020776                   67.0    2e-11   Vitis vinifera
gb|AHA50468.1|  defensin-like protein 2                               67.0    2e-11   
emb|CDP10467.1|  unnamed protein product                              67.4    2e-11   
sp|P20346.1|DF322_SOLTU  RecName: Full=Defensin-like protein P322...  67.0    2e-11   Solanum tuberosum [potatoes]
ref|XP_011001251.1|  PREDICTED: defensin-like protein 1               66.6    2e-11   
gb|EPS66510.1|  kunitz trypsin inhibitor protein                      66.6    2e-11   
ref|XP_003562142.1|  PREDICTED: defensin Ec-AMP-D1-like               67.0    2e-11   
sp|P83399.1|DEF1_VIGUN  RecName: Full=Defensin-like protein 1; Al...  65.9    2e-11   Vigna unguiculata
ref|XP_004985852.1|  PREDICTED: defensin SD2-like                     66.6    3e-11   
gb|AHA50470.1|  defensin-like protein 1                               66.2    3e-11   
ref|XP_010064921.1|  PREDICTED: uncharacterized protein LOC104452094  67.8    3e-11   
ref|XP_007226630.1|  hypothetical protein PRUPE_ppa022845mg           66.6    3e-11   
gb|EEC76838.1|  hypothetical protein OsI_14993                        66.2    3e-11   Oryza sativa Indica Group [Indian rice]
gb|KCW70075.1|  hypothetical protein EUGRSUZ_F03380                   66.2    3e-11   
ref|XP_002513261.1|  8.4 kDa sulfur-rich protein precursor, putative  66.2    4e-11   Ricinus communis
emb|CDP10468.1|  unnamed protein product                              66.2    4e-11   
gb|KFK26328.1|  hypothetical protein AALP_AA8G233400                  66.2    4e-11   
ref|XP_004503912.1|  PREDICTED: defensin-like protein-like            65.5    5e-11   
ref|XP_002468581.1|  hypothetical protein SORBIDRAFT_01g048380        65.1    1e-10   Sorghum bicolor [broomcorn]
sp|P86518.1|DEF1_ECHCG  RecName: Full=Defensin Ec-AMP-D1              63.9    1e-10   
ref|NP_001052199.1|  Os04g0189400                                     65.5    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011099999.1|  PREDICTED: defensin Ec-AMP-D2-like               64.3    2e-10   
gb|EPS67569.1|  gamma-thionin                                         63.5    2e-10   
sp|P86519.1|DEF2_ECHCG  RecName: Full=Defensin Ec-AMP-D2              63.5    2e-10   
ref|XP_004509604.1|  PREDICTED: defensin-like protein P322-like       64.3    2e-10   
dbj|BAB64929.1|  defensin-like protein                                63.9    3e-10   Pyrus pyrifolia [sha li]
ref|XP_009351647.1|  PREDICTED: defensin-like protein 1               63.9    3e-10   
ref|XP_004147317.1|  PREDICTED: defensin-like protein-like            63.5    3e-10   
gb|AIA67015.1|  defensin                                              63.5    3e-10   
emb|CAH58740.1|  defensin                                             63.2    3e-10   Plantago major [cart-track plant]
ref|XP_006384382.1|  hypothetical protein POPTR_0004s14520g           63.2    3e-10   
dbj|BAK07043.1|  predicted protein                                    63.9    4e-10   
ref|XP_008340513.1|  PREDICTED: defensin-like protein 1               63.5    4e-10   
gb|EMT11359.1|  Defensin-like protein P322                            63.2    4e-10   
ref|XP_010675152.1|  PREDICTED: defensin-like protein 1 isoform X1    63.2    4e-10   
ref|XP_010675153.1|  PREDICTED: defensin-like protein 1 isoform X2    62.8    5e-10   
ref|NP_201171.1|  defensin-like protein 6                             62.4    7e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009590912.1|  PREDICTED: defensin-like protein 1               62.4    7e-10   
ref|XP_009397593.1|  PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|P...  62.4    8e-10   
ref|XP_007202863.1|  hypothetical protein PRUPE_ppa015550mg           62.4    9e-10   
ref|XP_009780051.1|  PREDICTED: defensin-like protein 1               62.0    9e-10   
dbj|BAK07467.1|  predicted protein                                    62.0    9e-10   
ref|XP_010260874.1|  PREDICTED: defensin D2-like                      62.0    9e-10   
ref|XP_009357110.1|  PREDICTED: defensin Ec-AMP-D1-like               62.0    1e-09   
ref|XP_009631841.1|  PREDICTED: defensin-like protein 1               61.6    1e-09   
ref|XP_007203287.1|  hypothetical protein PRUPE_ppa025677mg           62.0    1e-09   
ref|XP_007156390.1|  hypothetical protein PHAVU_003G282400g           61.6    2e-09   
gb|EYU27577.1|  hypothetical protein MIMGU_mgv1a024490mg              61.2    2e-09   
ref|XP_002865329.1|  hypothetical protein ARALYDRAFT_917107           61.2    2e-09   
gb|EMT30046.1|  Defensin-like protein P322                            61.2    2e-09   
gb|AIA67014.1|  defensin                                              60.8    2e-09   
ref|XP_009763849.1|  PREDICTED: defensin-like protein 1               60.8    2e-09   
ref|XP_008780828.1|  PREDICTED: defensin-like protein 1               60.8    2e-09   
ref|XP_009389205.1|  PREDICTED: defensin Tk-AMP-D2-like               60.8    3e-09   
gb|ACM50880.1|  defensin                                              60.1    3e-09   Capsicum frutescens [bird pepper]
ref|XP_008389118.1|  PREDICTED: defensin-like protein 1               60.8    3e-09   
sp|Q43413.1|DEF1_CAPAN  RecName: Full=Defensin J1-1; Flags: Precu...  60.5    4e-09   Capsicum annuum
gb|AAW33979.1|  proteinase inhibitor SE60-like protein                60.1    4e-09   Ammopiptanthus mongolicus
sp|P82781.2|DEF03_ARATH  RecName: Full=Putative defensin-like pro...  60.1    4e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CDY39856.1|  BnaC02g42620D                                        60.1    4e-09   
ref|XP_007202934.1|  hypothetical protein PRUPE_ppa016748mg           60.5    4e-09   
ref|XP_002864860.1|  predicted protein                                60.1    5e-09   
gb|EMS68062.1|  Defensin Tm-AMP-D1.2                                  59.7    6e-09   
gb|EMT03363.1|  hypothetical protein F775_43918                       60.1    6e-09   
sp|Q07502.1|DEF_SOYBN  RecName: Full=Defensin-like protein; AltNa...  59.7    6e-09   Glycine max [soybeans]
gb|KHG06821.1|  Defensin-like protein                                 59.7    8e-09   
ref|XP_003581056.1|  PREDICTED: defensin Ec-AMP-D1-like               59.3    1e-08   
gb|EMS54459.1|  Defensin Tk-AMP-D5                                    58.9    1e-08   
gb|EMS52277.1|  Defensin Tk-AMP-D1.1                                  58.9    1e-08   
gb|ACV84382.1|  defensin precursor                                    58.9    1e-08   Triticum turgidum subsp. durum
ref|NP_001150374.1|  low-molecular-weight cysteine-rich protein L...  58.9    1e-08   Zea mays [maize]
gb|ADQ43197.1|  unknown                                               58.5    1e-08   
gb|AGT51230.1|  defensin                                              58.5    1e-08   
gb|AAP80654.1|AF479035_1  proteinase inhibitor Rgpi9                  58.9    1e-08   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004972594.1|  PREDICTED: defensin-like protein 21-like         58.9    2e-08   
gb|ABX84377.1|  amylase inhibitor-like protein                        58.9    2e-08   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ86109.1|  predicted protein                                    58.5    2e-08   
gb|EMT03364.1|  Defensin SD2                                          58.5    2e-08   
gb|ABX84378.1|  amylase inhibitor-like protein                        58.5    2e-08   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006367122.1|  PREDICTED: defensin J1-2-like                    58.2    2e-08   
gb|ABW99097.1|  defensin                                              57.8    2e-08   Capsicum chinense [Scotch bonnet]
sp|P84965.1|DEF11_TRIKH  RecName: Full=Defensin Tk-AMP-D1.1           57.8    2e-08   Triticum kiharae
gb|EMS65297.1|  Defensin SD2                                          58.5    2e-08   
ref|XP_008667949.1|  PREDICTED: LOC100281986 isoform X1               62.4    2e-08   
ref|XP_009101271.1|  PREDICTED: defensin-like protein 10              58.2    2e-08   
gb|ADQ43198.1|  unknown                                               58.5    2e-08   
ref|XP_007203247.1|  hypothetical protein PRUPE_ppa019504mg           58.5    2e-08   
ref|XP_007202809.1|  hypothetical protein PRUPE_ppa014119mg           58.2    3e-08   
gb|AIA67009.1|  defensin                                              58.2    3e-08   
gb|EMS53152.1|  Defensin-like protein 2                               57.8    3e-08   
gb|EMT16291.1|  Defensin SD2                                          58.2    3e-08   
ref|XP_004954814.1|  PREDICTED: defensin SD2-like                     57.8    4e-08   
gb|AAF72043.1|  defensin CUA1                                         57.0    4e-08   Helianthus annuus
ref|XP_007204040.1|  hypothetical protein PRUPE_ppa021088mg           57.4    4e-08   
dbj|BAD25504.1|  hypothetical protein                                 57.8    4e-08   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK06284.1|  predicted protein                                    58.2    4e-08   
gb|AIA67000.1|  defensin                                              57.8    4e-08   
gb|EMT22729.1|  Defensin Tk-AMP-D2                                    57.4    5e-08   
gb|EMT11361.1|  Defensin Tk-AMP-D6                                    57.4    5e-08   
sp|P84966.1|DEF5_TRIKH  RecName: Full=Defensin Tk-AMP-D5              56.6    6e-08   
ref|NP_001031462.1|  low-molecular-weight cysteine-rich 75            57.4    6e-08   
ref|XP_002451983.1|  hypothetical protein SORBIDRAFT_04g012170        57.0    6e-08   
gb|AAF66592.1|  defensin                                              56.2    6e-08   
sp|P84969.1|DEF61_TRIKH  RecName: Full=Defensin Tk-AMP-D6.1           56.2    7e-08   
ref|XP_003581053.1|  PREDICTED: defensin Tk-AMP-D5-like               56.6    7e-08   
gb|AAL14240.1|  proteinase inhibitor                                  56.2    8e-08   
ref|XP_010228361.1|  PREDICTED: defensin Tk-AMP-D1.1-like             56.6    9e-08   
sp|P84967.1|DEF6_TRIKH  RecName: Full=Defensin Tk-AMP-D6              55.8    9e-08   
emb|CAA65045.1|  defensin                                             56.2    1e-07   
ref|NP_001148374.1|  LOC100281986 precursor                           56.2    1e-07   
gb|EMT22728.1|  Defensin Tm-AMP-D1.2                                  56.2    1e-07   
gb|ACV84384.1|  defensin precursor                                    56.2    1e-07   
gb|ACB20518.1|  defensin precursor                                    56.2    1e-07   
ref|XP_008669654.1|  PREDICTED: defensin Ec-AMP-D1-like               55.8    1e-07   
ref|XP_002446148.1|  hypothetical protein SORBIDRAFT_06g002510        55.8    1e-07   
ref|NP_001147137.1|  LOC100280744 precursor                           55.8    1e-07   
ref|XP_006410329.1|  hypothetical protein EUTSA_v10017942mg           55.8    2e-07   
gb|AIA66989.1|  defensin                                              55.8    2e-07   
gb|EMT22726.1|  Defensin Tm-AMP-D1.2                                  55.8    2e-07   
dbj|BAD25506.1|  hypothetical protein                                 55.8    2e-07   
gb|AIA66999.1|  defensin                                              55.5    2e-07   
ref|XP_008240819.1|  PREDICTED: defensin Ec-AMP-D1-like               55.5    2e-07   
gb|AIA66993.1|  defensin                                              55.5    3e-07   
gb|AIA66987.1|  defensin                                              55.5    3e-07   
dbj|BAJ89304.1|  predicted protein                                    55.1    3e-07   
ref|XP_010246429.1|  PREDICTED: defensin-like protein                 55.1    3e-07   
gb|AIA67011.1|  defensin                                              54.7    3e-07   
gb|EMT22721.1|  Defensin Tk-AMP-D2                                    54.7    4e-07   
gb|ACG30752.1|  low-molecular-weight cysteine-rich protein LCR69 ...  54.7    4e-07   
ref|XP_009370221.1|  PREDICTED: defensin-like protein 2               54.7    4e-07   
gb|ACQ90609.1|  defensin-like protein                                 54.7    5e-07   
ref|XP_011070575.1|  PREDICTED: defensin Ec-AMP-D2-like               54.7    5e-07   
emb|CEJ09690.1|  Defensin protein                                     54.3    5e-07   
gb|ACV84385.1|  defensin precursor                                    54.3    6e-07   
gb|EMS54457.1|  Defensin Tk-AMP-D4                                    54.3    6e-07   
ref|XP_002452484.1|  hypothetical protein SORBIDRAFT_04g026670        54.3    6e-07   
ref|XP_006395807.1|  hypothetical protein EUTSA_v10005233mg           54.3    6e-07   
gb|KHN31219.1|  Defensin-like protein 1                               53.5    6e-07   
gb|AIA66992.1|  defensin                                              54.3    6e-07   
ref|XP_008240820.1|  PREDICTED: defensin Ec-AMP-D1-like               54.3    6e-07   
gb|EMS52097.1|  Defensin Tk-AMP-D1                                    54.3    6e-07   
ref|XP_011070576.1|  PREDICTED: defensin Ec-AMP-D1-like               54.3    7e-07   
emb|CDM85870.1|  unnamed protein product                              53.9    7e-07   
gb|ACV84379.1|  defensin precursor                                    54.3    7e-07   
ref|XP_010240717.1|  PREDICTED: uncharacterized protein LOC104585502  55.1    7e-07   
gb|EMT06279.1|  Defensin-like protein 2                               54.3    7e-07   
gb|AIA66994.1|  defensin                                              54.3    7e-07   
ref|XP_006292846.1|  hypothetical protein CARUB_v10019106mg           53.9    7e-07   
dbj|BAC10287.1|  defensin                                             53.9    8e-07   
gb|EMT02837.1|  Defensin J1-2                                         53.9    8e-07   
dbj|BAK04559.1|  predicted protein                                    53.9    8e-07   
gb|ABM89231.1|  defensin                                              53.9    9e-07   
gb|EMT18782.1|  Defensin-like protein                                 57.4    9e-07   
ref|XP_004509637.1|  PREDICTED: defensin J1-2-like                    53.1    9e-07   
gb|AIA66990.1|  defensin                                              53.5    1e-06   
gb|ACG25019.1|  low-molecular-weight cysteine-rich protein LCR69 ...  53.5    1e-06   
ref|NP_001147001.1|  LOC100280611 precursor                           53.5    1e-06   
gb|KFK33428.1|  hypothetical protein AALP_AA5G011900                  53.5    1e-06   
gb|AIA67004.1|  defensin                                              53.5    1e-06   
ref|NP_178322.1|  defensin-like protein 10                            53.5    1e-06   
ref|XP_002875116.1|  hypothetical protein ARALYDRAFT_904442           53.5    1e-06   
ref|XP_003575412.1|  PREDICTED: defensin Tm-AMP-D1.2-like             53.1    1e-06   
gb|EMT26158.1|  Defensin-like protein                                 53.1    1e-06   
ref|XP_004975165.1|  PREDICTED: defensin-like protein 2-like          53.1    1e-06   
gb|ACV84381.1|  defensin precursor                                    53.1    2e-06   
gb|AIA67007.1|  defensin                                              53.1    2e-06   
gb|EMS62517.1|  Defensin SD2                                          53.1    2e-06   
ref|XP_004509602.1|  PREDICTED: defensin-1-like                       53.1    2e-06   
sp|P84964.1|DEF12_TRIMO  RecName: Full=Defensin Tm-AMP-D1.2           52.4    2e-06   
ref|XP_006295860.1|  hypothetical protein CARUB_v10024990mg           52.8    2e-06   
ref|XP_006647552.1|  PREDICTED: defensin-like protein P322-like       52.8    2e-06   
ref|XP_004975163.1|  PREDICTED: defensin-like protein-like            52.8    2e-06   
ref|NP_001047493.1|  Os02g0629800                                     52.8    2e-06   
sp|P84968.1|DEF2_TRIKH  RecName: Full=Defensin Tk-AMP-D2              52.0    2e-06   
ref|XP_009598624.1|  PREDICTED: defensin-like protein                 53.1    2e-06   
ref|XP_004976259.1|  PREDICTED: defensin-like protein-like            52.8    2e-06   
dbj|BAD25113.1|  hypothetical protein                                 52.8    3e-06   
gb|ACG49007.1|  hypothetical protein                                  52.0    3e-06   
ref|XP_008340512.1|  PREDICTED: defensin-like protein 1               52.8    3e-06   
ref|XP_011086331.1|  PREDICTED: putative defensin-like protein 3      53.1    3e-06   
ref|XP_004250638.1|  PREDICTED: defensin-like protein                 52.8    3e-06   
sp|P84971.1|DEF4_TRIKH  RecName: Full=Defensin Tk-AMP-D4              51.6    3e-06   
dbj|BAD25507.1|  hypothetical protein                                 52.8    3e-06   
ref|XP_009608875.1|  PREDICTED: defensin-like protein                 52.4    3e-06   
ref|NP_001172824.1|  Os02g0172500                                     52.4    3e-06   
ref|XP_002862935.1|  low-molecular-weight cysteine-rich 76            52.0    3e-06   
sp|P81008.1|DEF1_MAIZE  RecName: Full=Defensin-like protein 1; Al...  51.6    4e-06   
emb|CEJ09689.1|  Defensin protein                                     52.0    4e-06   
gb|EYU27578.1|  hypothetical protein MIMGU_mgv1a026683mg              51.6    4e-06   
gb|EMS64594.1|  Defensin Tm-AMP-D1.2                                  52.0    4e-06   
ref|XP_006339360.1|  PREDICTED: defensin-like protein-like            52.4    4e-06   
ref|NP_001172823.1|  Os02g0171900                                     55.5    5e-06   
gb|AGC82207.1|  defensin                                              51.6    5e-06   
ref|XP_004250637.1|  PREDICTED: defensin-like protein                 52.0    5e-06   
ref|XP_002879355.1|  hypothetical protein ARALYDRAFT_482123           51.2    5e-06   
gb|ACV84383.1|  defensin precursor                                    51.6    5e-06   
ref|XP_008385108.1|  PREDICTED: defensin-like protein 2               51.6    6e-06   
ref|XP_008389117.1|  PREDICTED: defensin Tk-AMP-D1.1-like             51.6    6e-06   
gb|EMS56168.1|  Defensin-like protein 6                               51.6    6e-06   
gb|EMT11360.1|  Defensin Tk-AMP-D4                                    51.2    7e-06   
gb|AIA67016.1|  defensin                                              51.2    7e-06   
gb|AFQ69079.1|  defensin precursor                                    51.2    7e-06   
gb|EMT17852.1|  hypothetical protein F775_43789                       51.2    8e-06   
sp|P20230.1|DEF1_HORVU  RecName: Full=Defensin-like protein 1; Al...  50.4    8e-06   
sp|P84963.1|DEF1_TRIKH  RecName: Full=Defensin Tk-AMP-D1              50.4    9e-06   
ref|XP_009353671.1|  PREDICTED: defensin-like protein 2               51.2    9e-06   
gb|EYU40734.1|  hypothetical protein MIMGU_mgv11b023365mg             50.8    1e-05   
ref|XP_009793542.1|  PREDICTED: defensin-like protein                 51.2    1e-05   
emb|CAD41436.1|  OSJNBa0019D11.21                                     50.8    1e-05   
sp|Q8GTM0.1|DEF_NICAL  RecName: Full=Flower-specific defensin; Al...  51.2    1e-05   
dbj|BAB64931.1|  defensin-like protein                                50.4    1e-05   
ref|XP_009351648.1|  PREDICTED: defensin-like protein 1               50.8    1e-05   
sp|P20159.1|DEF2_WHEAT  RecName: Full=Defensin-like protein 2; Al...  50.1    1e-05   
ref|XP_009345976.1|  PREDICTED: defensin-like protein 2               50.8    1e-05   
gb|ABK25062.1|  unknown                                               50.4    1e-05   
ref|XP_009353672.1|  PREDICTED: defensin-like protein 2               50.4    1e-05   
emb|CAA62761.1|  putative gamma-thionin protein                       50.4    1e-05   
ref|XP_002446801.1|  hypothetical protein SORBIDRAFT_06g022870        50.4    1e-05   
ref|XP_009345992.1|  PREDICTED: defensin-like protein 2               50.4    1e-05   
gb|AFD01290.1|  defensin 3                                            50.4    1e-05   
gb|ABK20960.1|  unknown                                               50.4    1e-05   
ref|XP_008360020.1|  PREDICTED: defensin-like protein 2               50.4    1e-05   
emb|CEJ09688.1|  Defensin protein                                     50.4    1e-05   
emb|CDY04774.1|  BnaC05g18150D                                        51.2    1e-05   
gb|EMS49334.1|  Defensin-like protein                                 50.1    2e-05   
ref|XP_003573542.1|  PREDICTED: defensin-like protein 3               50.1    2e-05   
ref|XP_003525155.1|  PREDICTED: uncharacterized LOC100306228          50.1    2e-05   
ref|XP_004976260.1|  PREDICTED: defensin-like protein-like            50.1    2e-05   
ref|XP_004954696.1|  PREDICTED: uncharacterized protein LOC101753160  52.0    2e-05   
gb|ACV84380.1|  defensin precursor                                    50.1    2e-05   
gb|KHN17432.1|  Defensin-like protein                                 49.7    2e-05   
sp|Q09198.1|DEF21_SORBI  RecName: Full=Defensin-like protein 21; ...  49.3    2e-05   
ref|NP_001031460.1|  low-molecular-weight cysteine-rich 76            50.1    2e-05   
sp|A4L7R8.1|DEF2_PINSY  RecName: Full=Defensin-2; Flags: Precursor    50.1    2e-05   
ref|XP_007033367.1|  Scorpion toxin-like knottin superfamily protein  49.7    2e-05   
gb|KFK33429.1|  hypothetical protein AALP_AA5G012100                  50.4    2e-05   
ref|XP_009137059.1|  PREDICTED: LOW QUALITY PROTEIN: defensin-lik...  49.3    2e-05   
ref|XP_010038383.1|  PREDICTED: uncharacterized protein LOC104426904  52.0    3e-05   
sp|P21924.1|DEF2_SORBI  RecName: Full=Defensin-like protein 2; Al...  49.3    3e-05   
ref|XP_009383785.1|  PREDICTED: defensin-like protein 1               49.7    3e-05   
gb|EMT03877.1|  Defensin Tk-AMP-D3                                    49.7    3e-05   
gb|AAN40688.1|  putative plant defensin SPI1B                         49.7    3e-05   
sp|P21925.2|DEF3_SORBI  RecName: Full=Defensin-like protein 3; Al...  48.9    3e-05   
sp|P84970.1|DEF3_TRIKH  RecName: Full=Defensin Tk-AMP-D3              48.9    3e-05   
gb|EAY86781.1|  hypothetical protein OsI_08161                        52.8    3e-05   
gb|AIC35288.1|  defensin 4                                            49.3    3e-05   
ref|XP_009338353.1|  PREDICTED: defensin-like protein 2               49.7    3e-05   
ref|XP_006365640.1|  PREDICTED: defensin-like protein-like            49.7    3e-05   
gb|AFW58880.1|  low-molecular-weight cysteine-rich protein LCR70      49.3    4e-05   
ref|XP_004976261.1|  PREDICTED: defensin-like protein P322-like       49.3    4e-05   
dbj|BAA21114.1|  gamma-thionin                                        49.7    4e-05   
emb|CAH65876.1|  OSIGBa0160I04.2                                      48.9    5e-05   
gb|ABU40984.1|  putative flower-specific thionin                      49.3    5e-05   
ref|NP_001149230.1|  LOC100282852 precursor                           48.9    5e-05   
sp|A4L7R7.1|DEF1_PINSY  RecName: Full=Defensin-1; Flags: Precursor    48.9    5e-05   
gb|EMT00351.1|  Defensin-like protein                                 48.9    5e-05   
ref|XP_010245186.1|  PREDICTED: defensin-like protein 1               48.5    6e-05   
sp|P20158.1|DEF1_WHEAT  RecName: Full=Defensin-like protein 1; Al...  48.1    6e-05   
gb|AAR84643.1|  defensin                                              48.5    7e-05   
gb|ABK23404.1|  unknown                                               48.5    7e-05   
sp|P81571.1|DEFD2_SPIOL  RecName: Full=Defensin D2; AltName: Full...  47.8    7e-05   
ref|XP_004242654.1|  PREDICTED: defensin-like protein                 48.9    8e-05   
gb|ABK21016.1|  unknown                                               48.5    8e-05   
gb|ABK23037.1|  unknown                                               48.1    9e-05   
ref|XP_010481691.1|  PREDICTED: putative defensin-like protein 9      48.1    1e-04   
ref|XP_009779973.1|  PREDICTED: defensin-like protein                 48.1    1e-04   
ref|XP_011086335.1|  PREDICTED: defensin-like protein 1               48.1    1e-04   
gb|ACI02057.1|  fabatin precursor                                     47.8    1e-04   
ref|XP_009355482.1|  PREDICTED: defensin Tk-AMP-D1.1-like             47.8    1e-04   
gb|KCW85902.1|  hypothetical protein EUGRSUZ_B02619                   47.4    2e-04   
ref|XP_004953175.1|  PREDICTED: defensin-like protein 2-like          47.4    2e-04   
ref|XP_009793541.1|  PREDICTED: defensin-like protein                 47.8    2e-04   
ref|XP_009355481.1|  PREDICTED: defensin Tk-AMP-D1.1-like             47.4    2e-04   
pdb|1MR4|A  Chain A, Solution Structure Of Nad1 From Nicotiana Alata  46.6    2e-04   
ref|XP_008387251.1|  PREDICTED: uncharacterized protein LOC103449700  50.1    2e-04   
gb|ACG41256.1|  low-molecular-weight cysteine-rich protein LCR70 ...  47.4    2e-04   
gb|EAY84990.1|  hypothetical protein OsI_06352                        47.0    2e-04   
ref|XP_006422269.1|  hypothetical protein CICLE_v10005867mg           49.3    3e-04   
gb|KDO61571.1|  hypothetical protein CISIN_1g029977mg                 48.5    3e-04   
ref|XP_003094134.1|  hypothetical protein CRE_14288                   46.2    3e-04   
gb|ACU14316.1|  unknown                                               46.6    3e-04   
gb|AIC35289.1|  defensin 5.1                                          46.6    4e-04   
gb|AAU04859.1|  defensin precursor                                    46.6    4e-04   
gb|EMT30409.1|  hypothetical protein F775_14678                       45.8    4e-04   
ref|XP_002875117.1|  hypothetical protein ARALYDRAFT_322553           46.2    4e-04   
ref|NP_001152704.1|  low-molecular-weight cysteine-rich protein L...  46.6    4e-04   
gb|EYU27579.1|  hypothetical protein MIMGU_mgv1a023110mg              46.6    5e-04   
ref|XP_009342667.1|  PREDICTED: defensin-like protein 2               46.2    5e-04   
ref|XP_004953176.1|  PREDICTED: defensin-like protein-like            46.2    6e-04   
ref|XP_004954695.1|  PREDICTED: defensin-like protein-like            46.2    6e-04   
ref|NP_001172723.1|  Os01g0932825                                     46.2    8e-04   
gb|AEW08922.1|  hypothetical protein CL2287Contig1_03                 45.4    8e-04   
ref|XP_010229304.1|  PREDICTED: defensin Tk-AMP-D1.1-like             45.4    8e-04   
sp|P81457.1|DEF2_VICFA  RecName: Full=Defensin-like protein 2; Al...  45.1    8e-04   
ref|XP_009630513.1|  PREDICTED: defensin-like protein 1               45.8    9e-04   
ref|XP_011095738.1|  PREDICTED: extensin-like                         47.8    9e-04   
ref|XP_007214706.1|  hypothetical protein PRUPE_ppb018272mg           45.4    0.001   



>gb|AFJ04517.1| low-molecular-weight cysteine-rich 69 [Vernicia fordii]
Length=73

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            M E R CESQSHKFKG C S  NCASVC +EGFTGG CRG R RCFCTR C
Sbjct  23   MTEARTCESQSHKFKGTCLSETNCASVCKTEGFTGGDCRGLRRRCFCTRNC  73



>gb|ABO36637.1| defensin protein [Solanum lycopersicum]
Length=76

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  185  KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             MRI VE R CESQSH+FKG C S  NCASVC +EGF+GG CRGFR RCFCTR C
Sbjct  23   PMRI-VEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  76



>ref|XP_009610211.1| PREDICTED: defensin J1-2 [Nicotiana tomentosiformis]
Length=77

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = +2

Query  140  VIPlllllllPSFDEKMRIMV-EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRG  316
            V+  + L+L+  F  +M  MV E R CESQSH+FKG C+S +NCASVC +EGF GGHCRG
Sbjct  7    VVATVFLMLMLVFATEMGPMVAEARTCESQSHRFKGLCFSKSNCASVCHTEGFYGGHCRG  66

Query  317  FRHRCFCTREC  349
            FR RCFCTR C
Sbjct  67   FRRRCFCTRHC  77



>ref|XP_009351646.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ EGR CESQS KFKG C S +NCASVC +EGF GGHCRGFR RCFCT+ C
Sbjct  27   MLAEGRTCESQSRKFKGACLSRSNCASVCQTEGFPGGHCRGFRRRCFCTKHC  78



>gb|ADK87340.1| defensin [Pyrus pyrifolia]
 gb|AGC00408.1| defensin 1 [Pyrus pyrifolia]
Length=78

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ EGR CESQS KFKG C S +NCASVC +EGF GGHCRGFR RCFCT+ C
Sbjct  27   MLAEGRTCESQSRKFKGACLSRSNCASVCQTEGFPGGHCRGFRRRCFCTKHC  78



>ref|NP_001234872.1| gamma-thionin precursor [Solanum lycopersicum]
 emb|CAB42006.1| gamma-thionin [Solanum lycopersicum]
Length=72

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  185  KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             MRI VE R CESQSH+FKG C S  NCASVC +EGF+GG CRGFR RCFCTR C
Sbjct  19   PMRI-VEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  72



>gb|AAL35366.1|AF442388_1 defensin protein precursor [Capsicum annuum]
 gb|AAR90845.1| defensin precursor [Capsicum annuum]
Length=78

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 43/55 (78%), Gaps = 1/55 (2%)
 Frame = +2

Query  185  KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             MRI VE R CESQSH+FKG C S  NCASVC +EGF+GG CRGFR RCFCTR C
Sbjct  25   PMRI-VEARTCESQSHRFKGVCASETNCASVCQTEGFSGGDCRGFRRRCFCTRPC  78



>gb|ABO36641.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            +VE R CESQSH+FKG C S  NCASVC +EGF+GG CRGFR RCFCTR C
Sbjct  26   IVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  76



>ref|XP_009784025.1| PREDICTED: defensin J1-2 [Nicotiana sylvestris]
Length=77

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 45/59 (76%), Gaps = 1/59 (2%)
 Frame = +2

Query  176  FDEKMRIMV-EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            F  +M  MV E R CESQSH+FKG C S +NCASVC +EGF GGHCRGFR RCFCTR C
Sbjct  19   FANEMGPMVAEARTCESQSHRFKGLCISKSNCASVCHTEGFNGGHCRGFRRRCFCTRHC  77



>gb|ACM90159.1| low-molecular-weight cysteine-rich 69 [Jatropha curcas]
 gb|KDP32806.1| hypothetical protein JCGZ_12098 [Jatropha curcas]
Length=77

 Score = 79.3 bits (194),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            M E R CESQSHKFKG C S  NCA+VC +EGFTGG CRG R RCFCTR C
Sbjct  27   MAEARTCESQSHKFKGTCLSETNCANVCKTEGFTGGDCRGLRRRCFCTRHC  77



>gb|KHN06998.1| Defensin-like protein [Glycine soja]
Length=84

 Score = 79.3 bits (194),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CESQSH+FKG C S  NC SVC +EGF+GGHCRGF  RCFCT+EC
Sbjct  27   MVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHCRGFSRRCFCTKEC  78



>dbj|BAA95697.1| thionin like protein [Nicotiana tabacum]
Length=78

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R CESQSH+FKG C   +NCA+VCL+EGF+GG CRGFR RCFCTR C
Sbjct  28   IAEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFCTRPC  78



>ref|XP_009593293.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R CESQSH+FKG C   +NCA+VCL+EGF+GG CRGFR RCFCTR C
Sbjct  28   IAEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFCTRPC  78



>ref|XP_008340514.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=78

 Score = 79.0 bits (193),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ EGR CESQS KFKG C S  NCASVC +EGF GG+CRGFR RCFCT+ C
Sbjct  27   LLAEGRTCESQSRKFKGTCLSKTNCASVCQTEGFPGGNCRGFRRRCFCTKHC  78



>gb|ACS96442.1| defensin [Jatropha curcas]
Length=77

 Score = 78.6 bits (192),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            M E R CESQ+HKFKG C S  NCA+VC +EGFTGG CRG R RCFCTR C
Sbjct  27   MAEARTCESQTHKFKGTCLSETNCANVCKTEGFTGGDCRGLRRRCFCTRHC  77



>ref|XP_004242747.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36635.1| defensin protein [Solanum lycopersicum]
 gb|ABO36640.1| defensin protein [Solanum pimpinellifolium]
Length=76

 Score = 78.6 bits (192),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            VE R CESQSH FKG C S  NC SVC +EGFTGG+CRGFR RCFCTR C
Sbjct  27   VEARTCESQSHHFKGNCLSDTNCGSVCRTEGFTGGNCRGFRRRCFCTRNC  76



>ref|XP_008389119.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
Length=77

 Score = 78.6 bits (192),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ EGR C+SQSH+FKG C S +NCA+VC +EGF GGHCRGFR RCFCT+ C
Sbjct  26   MVAEGRTCDSQSHRFKGSCVSKSNCATVCQTEGFRGGHCRGFRRRCFCTKHC  77



>ref|XP_007156391.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
 gb|ADR30067.1| defensin D2 [Phaseolus vulgaris]
 gb|ESW28385.1| hypothetical protein PHAVU_003G282500g [Phaseolus vulgaris]
Length=78

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  191  RIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            R++ E R CESQSH+FKG C S  NCASVC +E F+GGHCRGFR RCFCT+ C
Sbjct  26   RMVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRGFRRRCFCTKHC  78



>ref|XP_010910081.1| PREDICTED: defensin Ec-AMP-D2-like [Elaeis guineensis]
Length=77

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E   +MVE R CESQSHKFKG C   +NCA+VC +EGF GG CRGFR RCFCT+ C
Sbjct  21   SEMATMMVEARTCESQSHKFKGPCLRASNCANVCKTEGFHGGKCRGFRRRCFCTKHC  77



>gb|ACB32234.1| gamma-thionin/defensin [Solanum chacoense]
Length=76

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            +VE R CESQSH+FKG C S  NCASVC +EGF+GG CRG R RCFCTR C
Sbjct  26   IVEARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGLRRRCFCTRPC  76



>sp|O65740.1|DEF2_CAPAN RecName: Full=Defensin J1-2; Flags: Precursor [Capsicum annuum]
 emb|CAA65046.1| unnamed protein product [Capsicum annuum]
Length=74

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  131  LSIVIPlllllllPSFDEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHC  310
             S VI  + L+++  F   M  + E R CESQSH+FKG C+S +NC SVC +EGF GGHC
Sbjct  4    FSKVIATIFLMMMLVFATGM--VAEARTCESQSHRFKGLCFSKSNCGSVCHTEGFNGGHC  61

Query  311  RGFRHRCFCTREC  349
            RGFR RCFCTR C
Sbjct  62   RGFRRRCFCTRHC  74



>ref|XP_009769843.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 78.6 bits (192),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             + E R CESQSH+FKG C   +NCA+VCL+EGF+GG CRGFR RCFCTR C
Sbjct  27   TIAEARTCESQSHRFKGPCSRDSNCATVCLTEGFSGGDCRGFRRRCFCTRPC  78



>ref|NP_178319.1| defensin-like protein 2 [Arabidopsis thaliana]
 sp|Q39182.1|DEF02_ARATH RecName: Full=Defensin-like protein 2; AltName: Full=Low-molecular-weight 
cysteine-rich protein 69; Short=Protein LCR69; 
AltName: Full=Plant defensin 2.2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK44170.1|AF370355_1 putative protease inhibitor II [Arabidopsis thaliana]
 emb|CAA48892.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAC97223.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAX39303.1| defensin-like protein [Arabidopsis thaliana]
 gb|AEC05546.1| defensin-like protein 2 [Arabidopsis thaliana]
Length=77

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CESQSH+FKG C S +NCA+VC +EGF GG+CRGFR RCFCTR C
Sbjct  26   VTVEARTCESQSHRFKGTCVSASNCANVCHNEGFVGGNCRGFRRRCFCTRHC  77



>ref|XP_010043884.1| PREDICTED: defensin Ec-AMP-D2-like [Eucalyptus grandis]
 gb|KCW85903.1| hypothetical protein EUGRSUZ_B02620 [Eucalyptus grandis]
Length=77

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 50/71 (70%), Gaps = 1/71 (1%)
 Frame = +2

Query  140  VIPlllllllPSFDEKMRIMV-EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRG  316
            +IP  L+++L     +M  MV E R CESQS +FKG C S  NCASVC +EGF GGHCRG
Sbjct  7    LIPAALIVMLLLVATEMEPMVVEARTCESQSQRFKGACVSKTNCASVCQTEGFHGGHCRG  66

Query  317  FRHRCFCTREC  349
            FR RCFCT+ C
Sbjct  67   FRRRCFCTKHC  77



>gb|ADK91098.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91099.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91100.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91101.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91102.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91103.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91104.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91105.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91106.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91107.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91108.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91109.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91110.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91111.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91112.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91113.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91114.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91115.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91117.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91118.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91119.1| PCP17C2 [Arabidopsis halleri]
 gb|ADK91120.1| PCP17C2 [Arabidopsis halleri]
Length=55

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CESQSH+FKG C S +NCA+VC +EGF GG+CRGFR RCFCTR C
Sbjct  4    VTVEARTCESQSHRFKGTCVSASNCANVCHNEGFIGGNCRGFRRRCFCTRNC  55



>ref|XP_006292781.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
 gb|EOA25679.1| hypothetical protein CARUB_v10019030mg [Capsella rubella]
Length=77

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CES+SH+FKG+C+S  NC +VC +EGFTGG+CRGFR RCFCTR C
Sbjct  26   VTVEARTCESKSHRFKGKCFSETNCKNVCHNEGFTGGNCRGFRRRCFCTRHC  77



>ref|NP_001148158.1| LOC100281766 precursor [Zea mays]
 ref|NP_001152925.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG25111.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG29960.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG46032.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACG49139.1| flower-specific gamma-thionin precursor [Zea mays]
 gb|ACN27540.1| unknown [Zea mays]
 tpg|DAA60145.1| TPA: flower-specific gamma-thionin [Zea mays]
Length=78

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             MV  R CESQS +FKG C   ANCA+VCL+EGFTGG C+G RHRCFCTR+C
Sbjct  27   TMVSARKCESQSFRFKGPCSRDANCANVCLTEGFTGGVCKGLRHRCFCTRDC  78



>ref|XP_003630422.1| Defensin [Medicago truncatula]
 gb|AET04898.1| Defensin MtDef4.7 [Medicago truncatula]
Length=74

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             EGR CESQSHKFKG C S +NC SVC  EGF GG CRG RHRCFCTR C
Sbjct  25   AEGRRCESQSHKFKGPCVSDSNCGSVCRGEGFIGGDCRGVRHRCFCTRNC  74



>ref|XP_006395808.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
 gb|ACQ90607.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33094.1| hypothetical protein EUTSA_v10005229mg [Eutrema salsugineum]
Length=77

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CES+SH+FKG+C S  NC +VC +EGFTGG+CRGFR RCFCTR C
Sbjct  26   VTVEARKCESKSHRFKGKCLSETNCKNVCHNEGFTGGNCRGFRRRCFCTRNC  77



>ref|XP_010502227.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CESQSH+FKG+C+S  NC +VC +EGF+GG+CRGFR RCFCTR C
Sbjct  26   VTVEARTCESQSHRFKGKCFSETNCRNVCHNEGFSGGNCRGFRRRCFCTRYC  77



>ref|XP_007137817.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
 gb|ESW09811.1| hypothetical protein PHAVU_009G158100g [Phaseolus vulgaris]
Length=145

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = +2

Query  182  EKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             +M +  EGR CES+SH+FKG C S  NCASVC  EGFTGG+CRGFR RCFCTR C
Sbjct  90   SQMMVQTEGRHCESKSHRFKGMCLSDRNCASVCHLEGFTGGNCRGFRRRCFCTRHC  145



>ref|XP_003630421.1| Defensin [Medicago truncatula]
 gb|AET04897.1| Defensin MtDef4.6 [Medicago truncatula]
Length=74

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
              EGR CES+SHKFKG C   +NCASVC  EGFTGG CRGFR RCFCTR C
Sbjct  24   TAEGRRCESKSHKFKGPCSRDSNCASVCRGEGFTGGDCRGFRRRCFCTRNC  74



>gb|KHN23780.1| Defensin SD2 [Glycine soja]
Length=79

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CESQSH+FKG C S  NC SVC +E FTGGHCRGFR RCFCT+ C
Sbjct  28   MVAEARTCESQSHRFKGPCLSDTNCGSVCRTERFTGGHCRGFRRRCFCTKHC  79



>gb|AHA50471.1| defensin-like protein 4 [Citrullus lanatus]
Length=75

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            I+VE R+CES SH FKG C+S  NC ++C +EGFTGGHCRGFR RCFCT+ C
Sbjct  23   IVVEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGHCRGFRRRCFCTKHC  74



>ref|XP_003526900.1| PREDICTED: defensin-like protein 6-like [Glycine max]
 gb|ACU20671.1| unknown [Glycine max]
 gb|KHN09676.1| Defensin-like protein 6 [Glycine soja]
Length=73

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  176  FDEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
               +M +  EGR CES+SH+FKG C S  NCASVC  EGFTGG CRGFR RCFCTR C
Sbjct  16   LSSQMVVQTEGRHCESKSHRFKGMCLSKHNCASVCHLEGFTGGKCRGFRRRCFCTRHC  73



>ref|XP_006420697.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 ref|XP_006470884.1| PREDICTED: defensin-like protein-like [Citrus sinensis]
 gb|ESR33937.1| hypothetical protein CICLE_v10006362mg [Citrus clementina]
 gb|KDO53542.1| hypothetical protein CISIN_1g034999mg [Citrus sinensis]
Length=76

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E R+CESQSH+FKG C S +NCA+VC +EGF GGHCRGFR RCFCT+ C
Sbjct  27   AEARICESQSHRFKGPCVSKSNCAAVCQTEGFHGGHCRGFRRRCFCTKRC  76



>ref|NP_001234987.1| protease inhibitor precursor [Glycine max]
 gb|AAC97524.1| protease inhibitor [Glycine max]
Length=79

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CESQSH+FKG C S  NC SVC +E FTGGHCRGFR RCFCT+ C
Sbjct  28   MVAEARTCESQSHRFKGPCLSDTNCGSVCRTERFTGGHCRGFRRRCFCTKHC  79



>gb|AAL85480.1| defensin protein 1 [Prunus persica]
Length=79

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CESQS++FKG C S +NCASVC +EGF GGHCRGFR RCFCT+ C
Sbjct  28   MVAEARTCESQSNRFKGTCVSTSNCASVCQTEGFPGGHCRGFRRRCFCTKHC  79



>ref|XP_007223891.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
 ref|XP_008220985.1| PREDICTED: defensin Ec-AMP-D2-like [Prunus mume]
 gb|EMJ25090.1| hypothetical protein PRUPE_ppa014246mg [Prunus persica]
Length=78

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CESQS++FKG C S +NCASVC +EGF GGHCRGFR RCFCT+ C
Sbjct  27   MVAEARTCESQSNRFKGTCVSTSNCASVCQTEGFPGGHCRGFRRRCFCTKHC  78



>ref|XP_006585876.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=127

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTRECPHH  358
            ++ E R CESQSH+FKG C S  NC SVC +EGF+GGHCRGF  RCFCT+E  ++
Sbjct  27   MVAEARTCESQSHRFKGPCLSDTNCGSVCRTEGFSGGHCRGFSRRCFCTKEYDNY  81



>ref|XP_006649329.1| PREDICTED: defensin J1-2-like [Oryza brachyantha]
Length=80

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CESQSH+F G C   +NCASVC +EGFTGGHCRGFR RCFCT+ C
Sbjct  29   MVAEARTCESQSHRFNGVCVRSSNCASVCSTEGFTGGHCRGFRRRCFCTKPC  80



>ref|XP_006367978.1| PREDICTED: defensin-like protein P322-like [Solanum tuberosum]
Length=79

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 2/60 (3%)
 Frame = +2

Query  176  FDEKMRIM--VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             D KM  M  +E R+CES S +FKG C +  NCASVC +EGFTGG CRG R RCFCT+EC
Sbjct  19   MDTKMGPMRIIEARICESPSQRFKGPCLTDRNCASVCETEGFTGGDCRGLRRRCFCTKEC  78



>ref|XP_006367121.1| PREDICTED: defensin J1-2-like [Solanum tuberosum]
Length=74

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CESQS +FKG C+S +NC SVC +EGF+GGHCRGFR RCFCTR C
Sbjct  23   MIAEARTCESQSRRFKGLCFSKSNCGSVCHTEGFSGGHCRGFRRRCFCTRHC  74



>ref|XP_009604566.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +2

Query  176  FDEKMRIMV-EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            F  +M  MV E R CESQSH+FKG C   +NCA+VC +EGF GGHCRGFR RCFCT+ C
Sbjct  19   FATEMGTMVAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRGFRRRCFCTKHC  77



>ref|XP_009614488.1| PREDICTED: defensin J1-2-like [Nicotiana tomentosiformis]
Length=77

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 44/59 (75%), Gaps = 1/59 (2%)
 Frame = +2

Query  176  FDEKMRIMV-EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            F  +M  MV E R CESQSH+FKG C   +NCA+VC +EGF GGHCRGFR RCFCT+ C
Sbjct  19   FATEMGTMVAEARTCESQSHRFKGPCVRKSNCAAVCQTEGFHGGHCRGFRRRCFCTKHC  77



>gb|ADQ43196.1| unknown [Eutrema parvulum]
Length=76

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CESQSH+FKG+C S  NC +VC +EGF GG CRGFR RCFCTR C
Sbjct  25   VTVEARTCESQSHRFKGKCLSDGNCGNVCHNEGFGGGKCRGFRRRCFCTRNC  76



>ref|XP_003628978.1| Defensin [Medicago truncatula]
 ref|XP_003636615.1| Defensin [Medicago truncatula]
 gb|AET03454.1| Defensin MtDef4.3 [Medicago truncatula]
Length=77

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            MV  R CE+ S+ FKG C+S  NCASVC +EGF GGHC+GFR RCFCT+ C
Sbjct  27   MVAARTCETPSNSFKGACFSDTNCASVCQTEGFPGGHCKGFRQRCFCTKPC  77



>ref|XP_003629332.1| Defensin [Medicago truncatula]
 gb|AET03808.1| Defensin MtDef4.5 [Medicago truncatula]
Length=81

 Score = 76.3 bits (186),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++VE R C SQSH FKG C S  NCA+VCL+EGFT G CRGFR RCFC++ C
Sbjct  27   MVVEARKCLSQSHSFKGLCLSDQNCATVCLTEGFTDGRCRGFRQRCFCSKPC  78



>ref|XP_010513972.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
 ref|XP_010495963.1| PREDICTED: defensin-like protein 2 [Camelina sativa]
Length=77

 Score = 75.9 bits (185),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 43/52 (83%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CES+SH+FKG+C+S  NC +VC +EGF+GG+CRGFR RCFCTR C
Sbjct  26   VTVEARTCESKSHRFKGKCFSETNCRNVCHNEGFSGGNCRGFRRRCFCTRHC  77



>ref|XP_003628977.1| Defensin [Medicago truncatula]
 ref|XP_003636614.1| Defensin [Medicago truncatula]
 gb|AET03453.1| Defensin MtDef4.2 [Medicago truncatula]
 gb|AFK35827.1| unknown [Medicago truncatula]
Length=76

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CESQSHKFKG C S  NCASVC +E F+GGHCRGFR RCFCT  C
Sbjct  25   MVAEARTCESQSHKFKGPCASDHNCASVCQTERFSGGHCRGFRRRCFCTTHC  76



>ref|XP_002459605.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
 gb|EER96126.1| hypothetical protein SORBIDRAFT_02g007410 [Sorghum bicolor]
Length=78

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            M   R CES S KF+G C   ANCASVCL+EGFTGG C+G RHRCFCTR+C
Sbjct  28   MALARKCESPSLKFRGPCSRDANCASVCLTEGFTGGECKGLRHRCFCTRDC  78



>gb|ACN93800.1| defensin precursor [Vigna unguiculata]
Length=78

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CESQSH+FKG C S  NCASVC +E F+GGHCRGFR RC CT+ C
Sbjct  27   MVAEARTCESQSHRFKGPCVSDTNCASVCRTERFSGGHCRGFRRRCLCTKHC  78



>sp|P82659.1|DFSD2_HELAN RecName: Full=Defensin SD2; AltName: Full=Flower-specific gamma-thionin; 
Flags: Precursor [Helianthus annuus]
 gb|AAF66591.1|AF141131_1 defensin [Helianthus annuus]
 gb|AAF72042.1|AF178634_1 defensin SD2 [Helianthus annuus]
Length=78

 Score = 75.5 bits (184),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/52 (69%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++VE R CESQSHKFKG C S  NCA+VC SE F+GG CRGFR RCFCT  C
Sbjct  27   LVVEARTCESQSHKFKGTCLSDTNCANVCHSERFSGGKCRGFRRRCFCTTHC  78



>gb|AFE88173.1| g-thionin [Panax ginseng]
Length=75

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/50 (72%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             EGR CESQSHKFKG C S  NCA+VC +EGF GG CRGFR RCFCT  C
Sbjct  26   AEGRTCESQSHKFKGTCASGTNCANVCKTEGFPGGKCRGFRRRCFCTTHC  75



>ref|XP_006359487.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=76

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            VE R CES+SH FKG+C S  NC SVC +EGFTGG+CRG R RCFCTR C
Sbjct  27   VEARTCESKSHHFKGKCLSDTNCGSVCHTEGFTGGNCRGLRQRCFCTRNC  76



>gb|AHA50472.1| defensin-like protein 5 [Citrullus lanatus]
Length=74

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            I+VE R+CES SH FKG C+S  NC ++C +EGFTGG CRGFR RCFCT+ C
Sbjct  22   IVVEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGVCRGFRRRCFCTKPC  73



>ref|XP_007033927.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04853.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=141

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = +2

Query  203  EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            EGR+CES+SHKFKG C    NCA VC +EGF+GG CRGFRHRCFCT+ C
Sbjct  93   EGRVCESKSHKFKGPCLGDHNCALVCRNEGFSGGRCRGFRHRCFCTKLC  141



>ref|XP_007033370.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
 gb|EOY04296.1| Scorpion toxin-like knottin superfamily protein [Theobroma cacao]
Length=76

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             ++M +  + RLCES+SH FKG C S  NC  VC +EGF+GG CRGFRHRCFCTR C
Sbjct  20   SQEMVVPSKARLCESKSHGFKGACLSDHNCGMVCSNEGFSGGRCRGFRHRCFCTRRC  76



>gb|AFK44299.1| unknown [Lotus japonicus]
Length=78

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CESQSH+FKG C S  NCASVC  E F+GGHCRGFR RCFCT+ C
Sbjct  27   MVAEARDCESQSHRFKGPCVSDTNCASVCHGEKFSGGHCRGFRRRCFCTKHC  78



>ref|XP_006292136.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
 gb|EOA25034.1| hypothetical protein CARUB_v10018340mg [Capsella rubella]
Length=77

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CES+SH+FKG C S +NC +VC +EGF GG+CRGFR RCFCTR C
Sbjct  26   VTVEARTCESKSHRFKGTCLSESNCKNVCHNEGFQGGNCRGFRRRCFCTRHC  77



>ref|XP_008349481.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008344620.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 ref|XP_008363304.1| PREDICTED: defensin Ec-AMP-D2-like [Malus domestica]
 gb|AFH74424.1| defensin [Malus domestica]
Length=75

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 42/52 (81%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ EGR CESQS++FKG C S +NCA+VC +EGF GG+CRG R RCFCT+ C
Sbjct  24   MVAEGRTCESQSNRFKGTCVSKSNCAAVCQTEGFPGGNCRGLRRRCFCTKHC  75



>ref|XP_004297787.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CES SHKFKG C S  NCASVC +EGF+GG CRG R RCFCT+ C
Sbjct  28   MVAEARTCESLSHKFKGTCLSETNCASVCKTEGFSGGDCRGLRRRCFCTKHC  79



>gb|AHA50473.1| defensin-like protein 6 [Citrullus lanatus]
Length=74

 Score = 74.3 bits (181),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            I+VE R+CES SH FKG C+S  NC ++C +EGFTGG CRGFR RCFCT+ C
Sbjct  22   IVVEARVCESLSHSFKGLCFSSTNCGNICKTEGFTGGVCRGFRRRCFCTKHC  73



>gb|AFK47422.1| unknown [Lotus japonicus]
Length=74

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
              +M +  EGR CES+SH+F G C SH NCASVC  EGFTGG CRGFR RCFC + C
Sbjct  18   SHQMVVQTEGRHCESKSHRFHGLCLSHHNCASVCHLEGFTGGKCRGFRKRCFCKKRC  74



>gb|ADK91116.1| PCP17C2 [Arabidopsis halleri]
Length=55

 Score = 73.6 bits (179),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R  ESQSH+FKG C S +NCA+VC +EGF GG+CRGFR RCFCTR C
Sbjct  4    VTVEARTRESQSHRFKGTCVSASNCANVCHNEGFIGGNCRGFRRRCFCTRNC  55



>ref|XP_009792224.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             + E R CESQ H+FKG C    NCA+VCL+EGF+GG CRG R RCFCTR C
Sbjct  27   TIAEARTCESQRHRFKGPCSRDGNCATVCLTEGFSGGDCRGLRRRCFCTRPC  78



>gb|AAL15885.1|AF417297_1 putative gamma-thionin [Castanea sativa]
Length=78

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CESQSH+FKG C   +NCASVC +EGF GG CRGFR RCFCT+ C
Sbjct  27   MVAEARTCESQSHRFKGPCVRKSNCASVCQTEGFHGGQCRGFRRRCFCTKHC  78



>ref|XP_010250779.1| PREDICTED: defensin Ec-AMP-D2-like [Nelumbo nucifera]
Length=78

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTRECP  352
            + E R CESQSH+FKG C   +NCA+VC +EGF GGHCRGFR RCFCT+ C 
Sbjct  27   VAEARTCESQSHRFKGICVRKSNCAAVCQTEGFHGGHCRGFRRRCFCTKHCA  78



>ref|XP_009354384.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ EGR CE+ S KFKG C   +NCASVC +EGF GGHCRGFR RCFCT+ C
Sbjct  27   MLAEGRTCEAHSRKFKGTCLGKSNCASVCQTEGFHGGHCRGFRRRCFCTKHC  78



>gb|KHG09995.1| Defensin-like protein 1 [Gossypium arboreum]
Length=75

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            +VEGR+CES+SH+FKG C S  NC  VC +EGF  G CRGFRHRCFCTR C
Sbjct  25   VVEGRICESKSHRFKGVCLSDHNCGLVCRNEGFLDGWCRGFRHRCFCTRNC  75



>gb|AAS13434.1| defensin [Nicotiana attenuata]
Length=52

 Score = 73.2 bits (178),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CESQS +F+G C+S +NC SVC +EGF GGHCRGFR RCFCTR C
Sbjct  1    MVAEARTCESQSRRFRGLCFSKSNCGSVCHTEGFNGGHCRGFRRRCFCTRHC  52



>gb|ADK36631.1| defensin-like protein, partial [Solanum lycopersicum var. cerasiforme]
Length=48

 Score = 73.2 bits (178),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  206  GRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             R CESQSH+FKG C S  NCASVC +EGF+GG CRGFR RCFCTR C
Sbjct  1    ARTCESQSHRFKGPCVSEKNCASVCETEGFSGGDCRGFRRRCFCTRPC  48



>ref|XP_007159918.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
 gb|ESW31912.1| hypothetical protein PHAVU_002G278600g [Phaseolus vulgaris]
Length=75

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  176  FDEKMRIM-VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            F   M +M  E RLCES SH FKG C++  NCA+VCL+EGFTGG C G RHRCFCT  C
Sbjct  17   FASDMGVMKSEARLCESPSHSFKGLCFNDRNCANVCLTEGFTGGKCEGARHRCFCTIIC  75



>gb|AGT51229.1| defensin [Brassica napus]
 emb|CDY51475.1| BnaC02g47680D [Brassica napus]
Length=77

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CESQSH+FKG C S  NCA+VC +EGF GG CRG R RCFCTR C
Sbjct  26   VSVEARTCESQSHRFKGPCVSDNNCANVCHNEGFGGGKCRGLRRRCFCTRHC  77



>ref|XP_009129168.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY09389.1| BnaA02g26210D [Brassica napus]
Length=77

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CESQSH+FKG C S  NCA+VC +EGF GG CRG R RCFCTR C
Sbjct  26   VSVEARTCESQSHRFKGPCVSENNCANVCHNEGFGGGKCRGLRRRCFCTRHC  77



>gb|AAS65426.1| Kunitz-type trypsin inhibitor [Ipomoea batatas]
Length=80

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +2

Query  191  RIMV-EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            RIMV E R+CES S KFKG C   +NCA+VC +EGFTGG C+GFR RCFCT+ C
Sbjct  27   RIMVAEARMCESASSKFKGPCSRDSNCATVCHTEGFTGGDCKGFRRRCFCTKPC  80



>ref|XP_002274353.1| PREDICTED: defensin Ec-AMP-D2 [Vitis vinifera]
 emb|CBI27507.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 73.6 bits (179),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CESQSH+FKG C   +NCA+VC +EGF GG+CRGFR RCFCT+ C
Sbjct  26   MVAEARTCESQSHRFKGTCVRQSNCAAVCQTEGFHGGNCRGFRRRCFCTKHC  77



>ref|XP_003599384.1| Defensin [Medicago truncatula]
 gb|AES69635.1| gamma-thionin/defensin [Medicago truncatula]
Length=80

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  203  EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            E R C+SQSH FKG CW   NCA+VC +EGFTGGHC GFR RCFC++ C
Sbjct  32   EARTCDSQSHSFKGVCWIKHNCANVCKTEGFTGGHCHGFRRRCFCSKPC  80



>ref|XP_004297786.1| PREDICTED: defensin-like protein 2-like [Fragaria vesca subsp. 
vesca]
Length=79

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CE+ SHKFKG C   +NCASVC +EGFTGG CRG R RCFCT+ C
Sbjct  28   MVAEARTCETLSHKFKGTCLRESNCASVCQTEGFTGGDCRGLRRRCFCTKHC  79



>ref|XP_010671291.1| PREDICTED: defensin Ec-AMP-D2-like [Beta vulgaris subsp. vulgaris]
Length=78

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R CE++SH+FKG C   ANCA+VC +EGF GGHCRGFR RCFCT+ C
Sbjct  28   VAEARTCETRSHRFKGICGRKANCAAVCQAEGFQGGHCRGFRRRCFCTKHC  78



>ref|XP_006394251.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum]
 gb|ESQ31537.1| hypothetical protein EUTSA_v10005235mg [Eutrema salsugineum]
Length=73

 Score = 73.2 bits (178),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 51/83 (61%), Gaps = 10/83 (12%)
 Frame = +2

Query  101  INNINMASINLSIVIPlllllllPSFDEKMRIMVEGRLCESQSHKFKGECWSHANCASVC  280
            + N   A+I L +V+          F  +  I +EGR+C+S+SH FK  CWS  NCA +C
Sbjct  1    MENKTFAAIFLFLVL----------FSSQKIIGIEGRMCQSKSHHFKHMCWSDHNCAIIC  50

Query  281  LSEGFTGGHCRGFRHRCFCTREC  349
             +EGF+GG CRGF  RC+CTR C
Sbjct  51   RNEGFSGGRCRGFHRRCYCTRLC  73



>ref|XP_006359486.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=78

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E R CESQS++FKG C   +NCA+VC +EGF GG+CRGFR RCFCTR C
Sbjct  29   AEARTCESQSNRFKGTCVRDSNCATVCQTEGFIGGNCRGFRRRCFCTRNC  78



>ref|XP_006395809.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
 gb|ACQ90606.1| defensin-like protein [Eutrema halophilum]
 gb|ESQ33095.1| hypothetical protein EUTSA_v10005228mg [Eutrema salsugineum]
Length=77

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CES+SH+FKG C S  NC +VC +EGF GG+CRG R RCFCTR C
Sbjct  26   VTVEARTCESKSHRFKGACLSETNCKNVCHNEGFRGGNCRGLRRRCFCTRNC  77



>ref|XP_003628979.1| Defensin [Medicago truncatula]
 ref|XP_003636616.1| Defensin [Medicago truncatula]
 gb|AET03455.1| Defensin MtDef4.4 [Medicago truncatula]
Length=78

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 40/57 (70%), Gaps = 1/57 (2%)
 Frame = +2

Query  182  EKMRIMV-EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            E   IMV E R CE+ S+ FKG C S  NCASVC +EGF GGHC GFR RCFCT+ C
Sbjct  22   EMGPIMVAEARTCETPSNNFKGLCVSDTNCASVCQTEGFPGGHCEGFRQRCFCTKPC  78



>ref|XP_009599356.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E R CESQSH+F G C   +NCAS+C +EGF GG+CRGFR RCFCTR C
Sbjct  26   AEARTCESQSHRFHGTCVRDSNCASICQTEGFIGGNCRGFRRRCFCTRNC  75



>ref|XP_004242748.1| PREDICTED: defensin-like protein [Solanum lycopersicum]
 gb|ABO36638.1| defensin protein [Solanum lycopersicum]
 gb|ABO36642.1| defensin protein [Solanum pimpinellifolium]
Length=79

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E R CESQS+ FKG C   +NCA+VC +EGF GG+CRGFR RCFCTR C
Sbjct  30   AEARTCESQSNSFKGTCVRDSNCATVCQTEGFIGGNCRGFRRRCFCTRNC  79



>ref|XP_009413079.1| PREDICTED: defensin Ec-AMP-D2 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=81

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 39/50 (78%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            VE R CES SHKFKG C+  +NCA+VC +EGF GGHCRG R RCFCT+ C
Sbjct  28   VEARKCESASHKFKGLCFRASNCANVCKTEGFHGGHCRGLRRRCFCTKHC  77



>ref|XP_011084089.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=74

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E+  ++ E R CES SH+FKG C S  NCASVC +EGF GG+CRGFR RCFCT+ C
Sbjct  18   TERGPMVGEARTCESLSHRFKGACVSSTNCASVCHTEGFPGGNCRGFRRRCFCTKHC  74



>gb|KEH35661.1| Defensin [Medicago truncatula]
Length=73

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/56 (63%), Positives = 41/56 (73%), Gaps = 0/56 (0%)
 Frame = +2

Query  182  EKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             +M +  EGR CES+SH+FKG C S  NCASVC  EGF GG+CRGFR RCFC + C
Sbjct  18   SQMMVQTEGRHCESKSHRFKGMCMSDHNCASVCHVEGFPGGNCRGFRRRCFCKKRC  73



>ref|XP_010319372.1| PREDICTED: defensin Ec-AMP-D2-like [Solanum lycopersicum]
Length=73

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R CESQSH++KG C    NCA+VC +EGF+GGHCRGFR RCFC + C
Sbjct  23   LTEARTCESQSHRYKGPCVRKNNCANVCKTEGFSGGHCRGFRRRCFCAKHC  73



>ref|XP_002459603.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
 gb|EER96124.1| hypothetical protein SORBIDRAFT_02g007390 [Sorghum bicolor]
Length=79

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             M   R CES SH+F+G C   ANCA+VC +EGFTGG C+G RHRCFCT++C
Sbjct  28   TMALARKCESPSHRFQGPCSRDANCATVCRTEGFTGGKCKGLRHRCFCTKDC  79



>ref|XP_009114206.1| PREDICTED: defensin-like protein 1 [Brassica rapa]
 emb|CDY04121.1| BnaA09g18990D [Brassica napus]
Length=77

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CES+SHKF+G C S  NCA+VC +EGF GG CRGFR RC+CTR C
Sbjct  26   VTVEARTCESKSHKFRGPCVSRHNCANVCHNEGFHGGKCRGFRRRCYCTRHC  77



>ref|XP_011070574.1| PREDICTED: defensin J1-2-like [Sesamum indicum]
Length=74

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CESQSH+FKG C   ANCA+VC +EGF  GHCRGFR RCFCT+ C
Sbjct  23   MVAEARKCESQSHRFKGICLRKANCAAVCQTEGFHSGHCRGFRGRCFCTKHC  74



>ref|XP_002875115.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51374.1| hypothetical protein ARALYDRAFT_484136 [Arabidopsis lyrata subsp. 
lyrata]
Length=77

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CES+SH+FKG C S  NCA+VC +EGF GG CRGFR RC+CTR C
Sbjct  26   VTVEARTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCYCTRHC  77



>gb|AIT42147.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +2

Query  188  MRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            MRI VE R CES SH+FKG C S  NCASVC +E F+GG+CRGFR RCFCT+ C
Sbjct  26   MRI-VEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRCFCTKPC  78



>gb|AIT42153.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +2

Query  188  MRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            MRI VE R CES SH+FKG C S  NCASVC +E F+GG+CRGFR RCFCT+ C
Sbjct  26   MRI-VEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRCFCTKPC  78



>ref|NP_178321.1| defensin-like protein 1 [Arabidopsis thaliana]
 sp|Q9ZUL7.1|DEF01_ARATH RecName: Full=Defensin-like protein 1; AltName: Full=Low-molecular-weight 
cysteine-rich protein 68; Short=Protein LCR68; 
AltName: Full=Plant defensin 2.3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97221.1| protease inhibitor II [Arabidopsis thaliana]
 gb|AAK93656.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAL85136.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AEC05549.1| defensin-like protein 1 [Arabidopsis thaliana]
Length=77

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CES+SH+FKG C S  NCA+VC +EGF GG CRGFR RC+CTR C
Sbjct  26   VTVEARTCESKSHRFKGPCVSTHNCANVCHNEGFGGGKCRGFRRRCYCTRHC  77



>ref|XP_006466198.1| PREDICTED: defensin-like protein 6-like [Citrus sinensis]
Length=73

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             ++M +  EGR+C+SQSH F G C+SH NCA VC +EGF+GG CRG R RCFC++ C
Sbjct  17   SQEMMVPAEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGKCRGVRRRCFCSKLC  73



>gb|AIT42150.1| defensin-like protein [Solanum tuberosum]
Length=63

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +2

Query  188  MRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            MRI VE R CES SH+FKG C S  NCASVC +E F+GG+CRGFR RCFCT+ C
Sbjct  11   MRI-VEARHCESLSHRFKGPCASDKNCASVCETERFSGGNCRGFRRRCFCTKPC  63



>ref|NP_178320.1| defensin-like protein 4 [Arabidopsis thaliana]
 sp|Q41914.2|DEF04_ARATH RecName: Full=Defensin-like protein 4; AltName: Full=Low-molecular-weight 
cysteine-rich protein 70; Short=Protein LCR70; 
AltName: Full=Plant defensin 2.1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC97222.1| protease inhibitor II [Arabidopsis thaliana]
 dbj|BAC42603.1| putative protease inhibitor II [Arabidopsis thaliana]
 gb|AAO42893.1| At2g02120 [Arabidopsis thaliana]
 gb|AEC05548.1| defensin-like protein 4 [Arabidopsis thaliana]
Length=77

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R C SQS +FKG+C S  NC +VC +EGF GG CRGFR RCFCTR C
Sbjct  26   VTVEARTCASQSQRFKGKCVSDTNCENVCHNEGFPGGDCRGFRRRCFCTRNC  77



>ref|XP_004151187.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
 ref|XP_004171498.1| PREDICTED: defensin J1-2-like [Cucumis sativus]
Length=74

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  176  FDEKMRIMV-EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            F   M  MV E R+CES SH FKG C+S  NC ++C +EGF+GG CRGFR RCFCT+ C
Sbjct  15   FGSGMAPMVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGVCRGFRRRCFCTKHC  73



>gb|AIT42152.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +2

Query  185  KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             MRI VE R CES SH+FKG C S  NCASVC +E F+GG+CRGFR RCFCT+ C
Sbjct  25   PMRI-VEARHCESLSHRFKGPCASDRNCASVCETERFSGGNCRGFRRRCFCTKPC  78



>gb|ABS72000.1| putative defensin protein 1 [Olea europaea]
Length=56

 Score = 71.6 bits (174),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ + R CESQSH+FKG C S +NCA+VC +EGF  G+CRGFR RCFC++ C
Sbjct  5    MVADARTCESQSHRFKGSCVSKSNCAAVCQTEGFPDGYCRGFRRRCFCSKHC  56



>gb|AGT51228.1| defensin [Brassica napus]
 emb|CDY03076.1| BnaC07g21510D [Brassica napus]
Length=76

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CES+SH+FKG C S  NC +VC +EGF GG CRGFR RC+CTR C
Sbjct  25   VTVEARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGKCRGFRRRCYCTRHC  76



>ref|XP_010513973.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CES+SH+F+G C S  NC +VC +EGF+GG CRGFR RCFCTR C
Sbjct  26   VTVEARTCESKSHRFRGPCVSRHNCGNVCHNEGFSGGKCRGFRRRCFCTRHC  77



>gb|AIA67010.1| defensin [Triticum aestivum]
Length=84

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R CE++SH+F+G C  H NCA+VC +EGF GG CRGFRHRCFCT  C
Sbjct  32   VAEARTCEAKSHRFRGPCVRHRNCANVCKTEGFPGGKCRGFRHRCFCTTHC  82



>ref|XP_010495961.1| PREDICTED: defensin-like protein 1 [Camelina sativa]
Length=77

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CES+SH+F+G C S  NC +VC +EGF+GG CRGFR RCFCTR C
Sbjct  26   VTVEARTCESKSHRFRGPCVSRHNCGNVCHNEGFSGGKCRGFRRRCFCTRHC  77



>ref|XP_004242750.1| PREDICTED: defensin-like protein P322 [Solanum lycopersicum]
 gb|ABO36643.1| defensin protein [Solanum pimpinellifolium]
Length=78

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            +VE R CES SH+FKG C S  NCASVC +E F+GG+CRGFR RCFCT+ C
Sbjct  28   IVEARHCESLSHRFKGPCVSDKNCASVCETERFSGGNCRGFRRRCFCTKPC  78



>gb|ABA81896.1| putative defensin [Aquilegia formosa]
 gb|ABA86588.1| putative defensin 1 [Aquilegia brevistyla]
Length=70

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R CESQSHKFKG C   +NCASVC SEGF GGHCRG   RC+CT +C
Sbjct  18   VAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>gb|ABA86586.1| putative defensin 1 [Aquilegia formosa]
Length=70

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R CESQSHKFKG C   +NCASVC SEGF GGHCRG   RC+CT +C
Sbjct  18   VAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>ref|XP_004509606.1| PREDICTED: defensin J1-2-like [Cicer arietinum]
Length=74

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CES+S KFKG C S  NCASVC +E F GGHCRGFR RCFCT  C
Sbjct  23   MVAEARTCESKSQKFKGACVSDRNCASVCQTERFPGGHCRGFRRRCFCTTHC  74



>ref|XP_009101273.1| PREDICTED: defensin-like protein 2 [Brassica rapa]
 emb|CDY17613.1| BnaA06g34320D [Brassica napus]
Length=77

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CES+SH+FKG C S  NC +VC +EGF GG CRGFR RC+CTR C
Sbjct  26   VTVEARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGKCRGFRRRCYCTRHC  77



>emb|CDY48618.1| BnaC09g20670D [Brassica napus]
Length=77

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CES+SHKF+G C S  NCA+VC +EGF GG CRGFR RC+CTR C
Sbjct  26   VTVEARTCESKSHKFRGLCVSRHNCANVCHNEGFHGGKCRGFRRRCYCTRHC  77



>ref|XP_009800136.1| PREDICTED: defensin J1-2-like [Nicotiana sylvestris]
Length=77

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 1/59 (2%)
 Frame = +2

Query  176  FDEKMRIMV-EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            F  +M  MV + R CESQSH+FKG C   +NCA+VC +EGF  GHCRG R RCFCT+ C
Sbjct  19   FATEMGTMVADARTCESQSHRFKGPCVRKSNCAAVCQTEGFHAGHCRGIRRRCFCTKHC  77



>gb|EMT03365.1| Defensin-like protein 1 [Aegilops tauschii]
Length=82

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R CE++SH+F+G C  H NCA+VC +EGF GG CRGFRHRCFCT  C
Sbjct  30   VAEARTCEAKSHRFRGPCVRHRNCANVCKTEGFPGGKCRGFRHRCFCTTHC  80



>gb|KGN62247.1| hypothetical protein Csa_2G340400 [Cucumis sativus]
Length=107

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 64/109 (59%), Gaps = 6/109 (6%)
 Frame = +2

Query  26   PPYKYTESSALKIQLQINFKLIYK*INNINMASINLSIVIPlllllllPSFDEKMRIM-V  202
            P Y +   +AL ++L  N+       N I M  +N S+V  LL+LLL+ S  E+M     
Sbjct  4    PFYAHHTHTALVLELNFNYY-----SNIIRMMMMNKSLVPTLLVLLLIFSASEEMMGGGA  58

Query  203  EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            E R+C+SQSH F G C    NCA VC +EGF+GG C GFR RCFCT  C
Sbjct  59   EARMCQSQSHHFHGPCVRDHNCALVCRTEGFSGGECIGFRRRCFCTHRC  107



>ref|XP_006426420.1| hypothetical protein CICLE_v10026887mg [Citrus clementina]
 gb|ESR39660.1| hypothetical protein CICLE_v10026887mg [Citrus clementina]
Length=73

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             ++M +  EGR+C+SQSH F G C+SH NCA VC +EGF+GG CRG R RCFC++ C
Sbjct  17   SQEMMVPAEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGKCRGARRRCFCSKLC  73



>ref|XP_008793609.1| PREDICTED: defensin Ec-AMP-D1-like isoform X1 [Phoenix dactylifera]
Length=78

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +2

Query  173  SFDEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            S +E    +VE R CESQSH+FKG C   +NCA+VC +EGF GG CRG R RCFCT+ C
Sbjct  20   SSEEMGTKVVEARTCESQSHRFKGTCLRASNCANVCQTEGFQGGVCRGLRGRCFCTKRC  78



>sp|Q40901.1|DEF_PETIN RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog PPT; Flags: Precursor [Petunia integrifolia]
 gb|AAA64740.1| gamma-thionin homolog [Petunia integrifolia subsp. inflata]
Length=78

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E R CESQSH+F G C   +NCASVC +EGF GG+CR FR RCFCTR C
Sbjct  29   AEARTCESQSHRFHGTCVRESNCASVCQTEGFIGGNCRAFRRRCFCTRNC  78



>ref|XP_006359485.1| PREDICTED: defensin-like protein-like [Solanum tuberosum]
Length=79

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E R CESQSH FKG C    NCASVC +EGF GG CRG R +CFCTR C
Sbjct  30   AEARTCESQSHSFKGPCVGDTNCASVCQTEGFIGGDCRGLRRQCFCTRNC  79



>gb|ADB02899.1| gamma-thionin PPT precursor defensin 1-like protein [Jatropha 
curcas]
Length=92

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTRECPHH  358
            ++ E R CES SH+FKG C  ++NCA++C +EGF GGHCRG R RCFCT  C +H
Sbjct  26   MVAEARTCESLSHRFKGICVRNSNCAAICQTEGFQGGHCRGLRRRCFCTMYCNNH  80



>gb|AAA91049.1| protease inhibitor II [Brassica rapa]
Length=77

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CES+SH+FKG C S  NC +VC +EGF GG CRGFR RC+CTR C
Sbjct  26   VTVEARTCESKSHRFKGTCVSSTNCGNVCHNEGFGGGKCRGFRVRCYCTRHC  77



>gb|ABA86589.1| putative defensin 1 [Aquilegia pyrenaica]
 gb|ABA86590.1| putative defensin 1 [Aquilegia olympica]
Length=70

 Score = 71.2 bits (173),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
              E R CESQSHKFKG C   +NCASVC SEGF GGHCRG   RC+CT +C
Sbjct  18   AAEARDCESQSHKFKGTCIRKSNCASVCQSEGFNGGHCRGVTRRCYCTAKC  68



>ref|XP_008793610.1| PREDICTED: defensin Ec-AMP-D1-like isoform X2 [Phoenix dactylifera]
Length=77

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            +VE R CESQSH+FKG C   +NCA+VC +EGF GG CRG R RCFCT+ C
Sbjct  27   VVEARTCESQSHRFKGTCLRASNCANVCQTEGFQGGVCRGLRGRCFCTKRC  77



>gb|AAG17880.1|AF293407_1 Kunitz trypsin inhibitor protein [Phaseolus coccineus]
Length=73

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  185  KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ +  E R+CESQSH FKG C    NCA VC +EGF+GG+CRGFR RCFCT+ C
Sbjct  19   QVVVQTEARVCESQSHGFKGACTGDHNCALVCRNEGFSGGNCRGFRRRCFCTKIC  73



>ref|XP_007137816.1| hypothetical protein PHAVU_009G158000g [Phaseolus vulgaris]
 emb|CAL68581.1| gamma-thionin [Phaseolus vulgaris]
 gb|ESW09810.1| hypothetical protein PHAVU_009G158000g [Phaseolus vulgaris]
Length=73

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  185  KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ +  E R+CESQSH FKG C    NCA VC +EGF+GG+CRGFR RCFCT+ C
Sbjct  19   QVVVQTEARVCESQSHGFKGACTGDHNCALVCRNEGFSGGNCRGFRRRCFCTKIC  73



>ref|XP_006426419.1| hypothetical protein CICLE_v10026887mg [Citrus clementina]
 gb|ESR39659.1| hypothetical protein CICLE_v10026887mg [Citrus clementina]
Length=72

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +2

Query  182  EKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             +M +  EGR+C+SQSH F G C+SH NCA VC +EGF+GG CRG R RCFC++ C
Sbjct  17   SQMMVPAEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGKCRGARRRCFCSKLC  72



>ref|XP_006301968.1| hypothetical protein CARUB_v10022448mg [Capsella rubella]
 gb|EOA34866.1| hypothetical protein CARUB_v10022448mg [Capsella rubella]
Length=72

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VEGR CES S+ F G C S +NCA+VC +EGF  G CRGFR RC CTR C
Sbjct  21   VTVEGRTCESSSNLFSGPCLSESNCANVCNTEGFPDGDCRGFRRRCMCTRPC  72



>ref|XP_010908980.1| PREDICTED: defensin Ec-AMP-D1-like [Elaeis guineensis]
 gb|AAN52490.1|AF322914_1 defensin EGAD1 [Elaeis guineensis]
Length=77

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 38/51 (75%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R CESQSHKF+G C   +NCA+VC +EGF GG CRG R RCFCTR C
Sbjct  27   VAEARTCESQSHKFQGTCLRESNCANVCQTEGFQGGVCRGVRRRCFCTRLC  77



>ref|XP_009802655.1| PREDICTED: defensin-like protein [Nicotiana sylvestris]
Length=75

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E R CESQSH+F G C   +NCASVC +EGF GG+CRG R RCFCTR C
Sbjct  26   AEARTCESQSHRFHGTCVRGSNCASVCQTEGFIGGNCRGLRRRCFCTRNC  75



>gb|AAG38520.1|AF283535_1 proteinase inhibitor se60-like protein [Citrus x paradisi]
Length=73

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             +++ +  EGR+C+SQSH F G C+SH NCA VC +EGF+GG CRG R RCFC++ C
Sbjct  17   SQEIMVPAEGRVCQSQSHHFHGACFSHHNCAFVCRNEGFSGGKCRGVRRRCFCSKLC  73



>ref|XP_008437687.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=77

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R+CES SH FKG C+S  NC ++C +EGF+GG CRGFR RCFCT+ C
Sbjct  25   MVAEARVCESPSHNFKGLCFSDTNCGNICKTEGFSGGLCRGFRRRCFCTKHC  76



>gb|KDP32807.1| hypothetical protein JCGZ_12099 [Jatropha curcas]
Length=77

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E   ++ E R CES SH+FKG C  ++NCA++C +EGF GGHCRG R RCFCT+ C
Sbjct  21   TETGPMVAEARTCESLSHRFKGICVRNSNCAAICQTEGFQGGHCRGLRRRCFCTKHC  77



>ref|XP_008466730.1| PREDICTED: defensin J1-2-like [Cucumis melo]
Length=74

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CES SH+FKG C+S  NC  VC +EGF GGHCRGFR RCFCT+ C
Sbjct  22   MVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>ref|NP_001048853.1| Os03g0130300 [Oryza sativa Japonica Group]
 gb|AAB17095.1| proteinase inhibitor [Oryza sativa Indica Group]
 gb|AAC00503.1| proteinase inhibitor [Oryza sativa Indica Group]
 dbj|BAA85411.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ABF93798.1| Gamma-thionin PPT precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10767.1| Os03g0130300 [Oryza sativa Japonica Group]
 dbj|BAH00191.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74445.1| hypothetical protein OsI_09847 [Oryza sativa Indica Group]
 gb|EEE58270.1| hypothetical protein OsJ_09283 [Oryza sativa Japonica Group]
Length=81

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTRECP  352
            ++ E R CESQSH+FKG C   ANCASVC +EGF  G+C G R RC CT+ CP
Sbjct  29   MVAEARTCESQSHRFKGPCARKANCASVCNTEGFPDGYCHGVRRRCMCTKPCP  81



>gb|KGN49760.1| hypothetical protein Csa_5G114570 [Cucumis sativus]
Length=74

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CES SH+FKG C+S  NC  VC +EGF GGHCRGFR RCFCT+ C
Sbjct  22   MVTEARTCESPSHRFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>ref|XP_009351645.1| PREDICTED: defensin Ec-AMP-D2-like [Pyrus x bretschneideri]
Length=78

 Score = 70.5 bits (171),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ EGR CE+ S KFKG C S +NCA+VC +EGF GGHC G R RCFCT+ C
Sbjct  27   MLAEGRTCEAHSRKFKGHCHSKSNCATVCQTEGFQGGHCHGIRRRCFCTKHC  78



>gb|EYU30124.1| hypothetical protein MIMGU_mgv1a017438mg [Erythranthe guttata]
Length=75

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  209  RLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            R CE++SH+FKG C   ANCA+VC +EGF GGHCRGFR RCFCT+ C
Sbjct  29   RTCEAKSHRFKGICARKANCAAVCQTEGFHGGHCRGFRRRCFCTKHC  75



>emb|CAA79164.1| seed-specific low molecular weight sulfur-rich protein [Glycine 
max]
Length=75

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +2

Query  176  FDEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            F  ++ +  EGR+CESQSH F G C    NCA VC +EGF+GG C+GFR RCFCTR C
Sbjct  18   FASQVVVQTEGRVCESQSHGFHGLCNRDHNCALVCRNEGFSGGRCKGFRRRCFCTRIC  75



>gb|AGT51227.1| defensin [Brassica napus]
Length=77

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R  ES+SHKF+G C S  NCA+VC +EGF GG CRGFR RC+CTR C
Sbjct  26   VTVEARTSESKSHKFRGPCVSRHNCANVCHNEGFHGGKCRGFRRRCYCTRHC  77



>ref|XP_002325735.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
 gb|ABK93028.1| unknown [Populus trichocarpa]
 gb|ABK93041.1| unknown [Populus trichocarpa]
 gb|ABK93536.1| unknown [Populus trichocarpa]
 gb|ABK93961.1| unknown [Populus trichocarpa]
 gb|ABK94429.1| unknown [Populus trichocarpa]
 gb|ABK94555.1| unknown [Populus trichocarpa]
 gb|EEF00117.1| hypothetical protein POPTR_0019s00770g [Populus trichocarpa]
Length=74

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             ++M +  E R+C SQSH FKG C    NCASVC +EGF GG C+GFR RCFC + C
Sbjct  18   SQEMMVPAEARVCLSQSHSFKGPCVRGHNCASVCKTEGFPGGECKGFRRRCFCAKPC  74



>ref|XP_002272913.2| PREDICTED: defensin-like protein 1 isoform X1 [Vitis vinifera]
 emb|CBI27688.3| unnamed protein product [Vitis vinifera]
Length=75

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             ++M +  E R+CESQSHKF+G C    NCA VC +EGF+GG C+G R RCFCT+ C
Sbjct  19   SQEMVVPSEARVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGLRRRCFCTKLC  75



>gb|KHN16909.1| Defensin J1-2 [Glycine soja]
Length=84

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/49 (69%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = +2

Query  203  EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            EGR C S+SH FKG C+S  NCA VC +EGFTGG C GFR RCFCTR C
Sbjct  36   EGRDCSSKSHGFKGLCFSDTNCAHVCRTEGFTGGDCGGFRRRCFCTRIC  84



>ref|XP_007159919.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
 gb|ESW31913.1| hypothetical protein PHAVU_002G278700g [Phaseolus vulgaris]
Length=74

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E RLC S+S  FKG C+S+ NCA+VCL+EGFTGG C G R RCFC++ C
Sbjct  25   AEARLCWSESQAFKGLCFSNDNCATVCLTEGFTGGKCEGLRRRCFCSKNC  74



>ref|XP_010270777.1| PREDICTED: defensin-like protein [Nelumbo nucifera]
 sp|A3FPF2.1|DEF_NELNU RecName: Full=Defensin-like protein; AltName: Full=Gamma-thionin 
homolog; Flags: Precursor [Nelumbo nucifera]
 gb|ABN46979.1| defensin [Nelumbo nucifera]
Length=77

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R CESQSH+FKG C S  NCASVC +EGF  G C+G R RCFC + C
Sbjct  27   VAEARTCESQSHRFKGACLSDTNCASVCQTEGFPAGDCKGARRRCFCVKPC  77



>gb|AIT42149.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 41/55 (75%), Gaps = 1/55 (2%)
 Frame = +2

Query  185  KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             MRI VE R CES SH+FKG C S  NCASVC +E F+GG+CRGFR  CFCT+ C
Sbjct  25   PMRI-VEARHCESLSHRFKGPCASDRNCASVCETERFSGGNCRGFRRLCFCTKPC  78



>gb|ABA86587.1| putative defensin 1 [Aquilegia chrysantha]
Length=70

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            +   R CESQSHKFKG C   +NCASVC SEGF GGHCRG   RC+CT +C
Sbjct  18   VAXARDCESQSHKFKGTCIRXSNCASVCXSEGFNGGHCRGVTRRCYCTAKC  68



>ref|XP_006392063.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
 gb|ESQ29349.1| hypothetical protein EUTSA_v10023787mg [Eutrema salsugineum]
Length=79

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R+CES S  F G C S  NCA++C +EGFT G C+GFR RC CTR C
Sbjct  28   VTVEARMCESSSQLFNGPCLSTTNCANICHNEGFTDGDCQGFRRRCICTRPC  79



>ref|XP_010653029.1| PREDICTED: defensin-like protein 1 isoform X2 [Vitis vinifera]
Length=74

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  185  KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            +M +  E R+CESQSHKF+G C    NCA VC +EGF+GG C+G R RCFCT+ C
Sbjct  20   QMVVPSEARVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGLRRRCFCTKLC  74



>gb|KEH35658.1| low-molecular-weight cysteine-rich protein [Medicago truncatula]
Length=52

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            +  E R+CESQSH FKG C    NCA VC +EGF+GG C+G RHRCFCTR C
Sbjct  1    MHAEARMCESQSHGFKGACVGDHNCALVCRNEGFSGGRCQGLRHRCFCTRLC  52



>ref|XP_004503014.1| PREDICTED: defensin-like protein 6-like isoform X1 [Cicer arietinum]
Length=75

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 40/56 (71%), Gaps = 0/56 (0%)
 Frame = +2

Query  182  EKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            E +    EGR+C SQSH FKG C    NCA VC +EGF+GG+C+GFR RCFCT+ C
Sbjct  20   EMVMKTAEGRVCASQSHAFKGPCVGDHNCALVCRNEGFSGGNCQGFRRRCFCTKLC  75



>ref|XP_002325734.2| defensin-like family protein [Populus trichocarpa]
 gb|EEF00116.2| defensin-like family protein [Populus trichocarpa]
Length=76

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E++ +  E R+C+SQSH FKG C    NCA VC +EGF+GG C+GFR RCFCT+ C
Sbjct  20   PEEVVVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGFRRRCFCTKLC  76



>ref|XP_011001252.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=74

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             ++M +  E R+C SQSH FKG C    NCA+VC +EGF GG C+GFR RCFC + C
Sbjct  18   SQEMMVPTEARVCLSQSHNFKGPCVRGHNCANVCKTEGFPGGECKGFRRRCFCAKPC  74



>ref|XP_004503015.1| PREDICTED: defensin-like protein 6-like isoform X2 [Cicer arietinum]
Length=74

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             EGR+C SQSH FKG C    NCA VC +EGF+GG+C+GFR RCFCT+ C
Sbjct  25   AEGRVCASQSHAFKGPCVGDHNCALVCRNEGFSGGNCQGFRRRCFCTKLC  74



>ref|XP_009769844.1| PREDICTED: defensin-like protein P322 [Nicotiana sylvestris]
Length=78

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R CES+S +F+G C    NCA+VC +EGF+GG CRG R RCFCTR C
Sbjct  28   IAEARRCESKSQRFRGPCVREKNCAAVCETEGFSGGDCRGLRRRCFCTRPC  78



>ref|XP_006586320.1| PREDICTED: defensin-like protein-like [Glycine max]
Length=74

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             EGR C S+SH FKG C+S  NCA VC +EGFTGG C GFR RCFCTR C
Sbjct  25   AEGRDCSSKSHGFKGLCFSDTNCAHVCRTEGFTGGDCGGFRRRCFCTRIC  74



>ref|XP_007045354.1| Defensin-like protein isoform 2 [Theobroma cacao]
 gb|EOY01186.1| Defensin-like protein isoform 2 [Theobroma cacao]
Length=77

 Score = 68.6 bits (166),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E R C+SQSH+FKG C   +NCA+VC +EGF  GHCRGF  RCFCT+ C
Sbjct  28   AEARTCQSQSHRFKGMCMRKSNCAAVCQTEGFHSGHCRGFHRRCFCTKHC  77



>ref|XP_007045353.1| Defensin-like protein isoform 1 [Theobroma cacao]
 gb|EOY01185.1| Defensin-like protein isoform 1 [Theobroma cacao]
Length=78

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E R C+SQSH+FKG C   +NCA+VC +EGF  GHCRGF  RCFCT+ C
Sbjct  29   AEARTCQSQSHRFKGMCMRKSNCAAVCQTEGFHSGHCRGFHRRCFCTKHC  78



>gb|KHN09675.1| Defensin-like protein, partial [Glycine soja]
Length=59

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  185  KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ +  EGR+CESQSH F G C    NCA VC +EGF+GG C+GFR RCFCTR C
Sbjct  5    EVVVQTEGRVCESQSHGFHGLCNRDHNCALVCRNEGFSGGRCKGFRRRCFCTRIC  59



>ref|XP_009768915.1| PREDICTED: defensin-like protein isoform X2 [Nicotiana sylvestris]
Length=79

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +2

Query  194  IMV-EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            IMV E R CESQS +FKG C S+ NCASVC +EGF  G C+G R RCFC R C
Sbjct  27   IMVAEARNCESQSQRFKGVCVSNRNCASVCNTEGFPDGKCKGLRRRCFCLRNC  79



>ref|NP_176302.2| defensin-like protein [Arabidopsis thaliana]
 sp|Q9C947.2|DEF05_ARATH RecName: Full=Defensin-like protein 5; AltName: Full=Low-molecular-weight 
cysteine-rich protein 66; Short=Protein LCR66; 
AltName: Full=Plant defensin 2.4; Flags: Precursor [Arabidopsis 
thaliana]
 gb|ABE65729.1| plant defensin-fusion protein [Arabidopsis thaliana]
 gb|AEE33774.1| defensin-like protein [Arabidopsis thaliana]
Length=76

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CE+ S+ F G C S +NCA+VC +EGF+ G CRGFR RC CTR C
Sbjct  25   VTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  76



>ref|XP_007226225.1| hypothetical protein PRUPE_ppa016594mg [Prunus persica]
 gb|EMJ27424.1| hypothetical protein PRUPE_ppa016594mg [Prunus persica]
Length=87

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  191  RIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++  + R CESQS KFKG C+  +NCA+ C +EGF GG CRGFR RCFC++ C
Sbjct  35   KVEPKKRTCESQSQKFKGICFLSSNCATSCTTEGFNGGQCRGFRRRCFCSKAC  87



>ref|XP_002459604.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
 gb|EER96125.1| hypothetical protein SORBIDRAFT_02g007400 [Sorghum bicolor]
Length=78

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  206  GRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             R C+S+S KFKG C    NCA+VCL+EGFT G CRG R RCFCTR+C
Sbjct  31   ARKCQSKSFKFKGPCSRDENCATVCLTEGFTSGKCRGLRRRCFCTRDC  78



>ref|XP_009768914.1| PREDICTED: defensin-like protein isoform X1 [Nicotiana sylvestris]
Length=80

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +2

Query  194  IMV-EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            IMV E R CESQS +FKG C S+ NCASVC +EGF  G C+G R RCFC R C
Sbjct  28   IMVAEARNCESQSQRFKGVCVSNRNCASVCNTEGFPDGKCKGLRRRCFCLRNC  80



>ref|XP_009593292.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R CESQS +F+G C    NCA+VC +EGF+GG CRG R RCFCTR C
Sbjct  28   IAEARHCESQSQRFRGLCVREKNCAAVCETEGFSGGDCRGLRRRCFCTRPC  78



>gb|ABK93231.1| unknown [Populus trichocarpa]
Length=75

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             +++ +  E R+C+SQSH FKG C    NCA VC +EGF+GG C+GFR RCFCT+ C
Sbjct  19   SQEVVVPTEARVCQSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGFRRRCFCTKLC  75



>dbj|BAK07823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=105

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTRECPH  355
            ++ E R CES+SH+F+G C   +NCA+VC +EGF  G CRGFR RCFCT  C H
Sbjct  52   MVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTHCHH  105



>gb|ABK28445.1| unknown [Arabidopsis thaliana]
Length=77

 Score = 68.2 bits (165),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CE+ S+ F G C S +NCA+VC +EGF+ G CRGFR RC CTR C
Sbjct  25   VTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  76



>gb|AIA67012.1| defensin [Triticum aestivum]
Length=82

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTRECPH  355
            ++ E R CES+SH+F+G C   +NCA+VC +EGF+ G CRGFR RCFCT  C H
Sbjct  29   MVAEARTCESRSHRFRGPCVRRSNCANVCRTEGFSDGKCRGFRRRCFCTTHCHH  82



>ref|XP_002886566.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62825.1| protease inhibitor II [Arabidopsis lyrata subsp. lyrata]
Length=76

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CE+ S+ F G C S +NCA+VC +EGF+ G CRGFR RC CTR C
Sbjct  25   VTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  76



>gb|AIA67013.1| defensin [Triticum aestivum]
Length=76

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            D+    +   R C+S+S KFKG C    NCASVCL EGFTGG C+GF HRC+CT++C
Sbjct  20   DQGPVQLALARDCQSKSFKFKGMCVRDDNCASVCLLEGFTGGKCKGFWHRCYCTKDC  76



>gb|AAM62652.1| protease inhibitor II [Arabidopsis thaliana]
Length=76

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CE+ S+ F G C S +NCA+VC +EGF+ G CRGFR RC CTR C
Sbjct  25   VRVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  76



>ref|XP_010088525.1| Defensin-like protein 2 [Morus notabilis]
 gb|EXB36442.1| Defensin-like protein 2 [Morus notabilis]
Length=76

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + + R C+S SH+FKG C  ++NCA++C +EGF GG+C+GFR RCFCT+ C
Sbjct  26   VADARTCQSASHRFKGTCVRNSNCANICRTEGFQGGNCQGFRRRCFCTKHC  76



>ref|XP_009614667.1| PREDICTED: defensin-like protein [Nicotiana tomentosiformis]
Length=75

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ E R CESQS +FKG C S+ NCASVC +EGF  G C+G R RCFC R C
Sbjct  24   MVAEARNCESQSERFKGVCVSNRNCASVCNTEGFPDGKCKGLRRRCFCLRNC  75



>ref|XP_004509603.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=78

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 38/58 (66%), Gaps = 1/58 (2%)
 Frame = +2

Query  179  DEKMRIMV-EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E   IMV E R CES S+ FKG C    NCA VC +EGFTGG C+GFR RCFC + C
Sbjct  21   TEMRPIMVAEARTCESLSYSFKGLCVRDHNCAVVCQTEGFTGGQCKGFRRRCFCNKPC  78



>gb|AFW90621.1| protease inhibitor-related protein [Solanum tuberosum]
 gb|AIT42151.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  185  KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             MRI  E R CES SH+FKG C   +NCASVC +E F+GG+C GFR RCFCT+ C
Sbjct  25   PMRI-AEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC  78



>gb|AIT42148.1| defensin-like protein [Solanum tuberosum]
Length=78

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  185  KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             MRI  E R CES SH+FKG C   +NCASVC +E F+GG+C GFR RCFCT+ C
Sbjct  25   PMRI-AEARNCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC  78



>gb|AAG51654.1|AC018908_20 unknown protein; 87272-87105 [Arabidopsis thaliana]
Length=55

 Score = 67.0 bits (162),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CE+ S+ F G C S +NCA+VC +EGF+ G CRGFR RC CTR C
Sbjct  4    VTVEARTCETSSNLFNGPCLSSSNCANVCHNEGFSDGDCRGFRRRCLCTRPC  55



>gb|EMS65298.1| Defensin-like protein 1 [Triticum urartu]
Length=82

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTRECPH  355
            ++ E R CES+SH+F+G C   +NCA+VC +EGF  G CRGFR RCFCT  C H
Sbjct  29   MVAEARTCESRSHRFRGPCVRRSNCANVCKTEGFPDGKCRGFRRRCFCTTHCHH  82



>gb|ACJ26760.1| protease inhibitor-related protein [Solanum tuberosum]
Length=78

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 40/55 (73%), Gaps = 1/55 (2%)
 Frame = +2

Query  185  KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             MRI  E R CES SH+FKG C   +NCASVC +E F+GG+C GFR RCFCT+ C
Sbjct  25   PMRI-AEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC  78



>dbj|BAH29762.1| defensin-like cystein-rich peptide [Torenia fournieri]
Length=71

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
              G LC S S KFKG C+S +NC SVC  EGFTGG C GFR RCFC++ C
Sbjct  22   ANGSLCRSPSQKFKGPCFSDSNCQSVCEGEGFTGGECEGFRRRCFCSKPC  71



>emb|CAN69975.1| hypothetical protein VITISV_020776 [Vitis vinifera]
Length=74

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  185  KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            +M +  E R+CESQSHKF+G C    NCA VC +EGF+GG C+G R RCFCT+ C
Sbjct  20   EMVVPSEARVCESQSHKFEGACMGDHNCALVCRNEGFSGGKCKGXRRRCFCTKLC  74



>gb|AHA50468.1| defensin-like protein 2 [Citrullus lanatus]
Length=78

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             EGR+C+SQSH F G C    NCA VC +EGF+GG C GFR RCFCTR C
Sbjct  29   AEGRVCKSQSHSFHGPCMRDHNCAVVCRTEGFSGGDCVGFRRRCFCTRLC  78



>emb|CDP10467.1| unnamed protein product [Coffea canephora]
Length=104

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  170  PSFDEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            PS  +   +    R CE+ S +FKG C   +NCA+VC +EGF GG CRG R RCFCTR C
Sbjct  42   PSRRKAAAVAAIERTCETPSKRFKGPCVKESNCAAVCQTEGFQGGKCRGLRRRCFCTRPC  101



>sp|P20346.1|DF322_SOLTU RecName: Full=Defensin-like protein P322; AltName: Full=Probable 
protease inhibitor P322; Flags: Precursor [Solanum tuberosum]
 emb|CAA31577.1| unnamed protein product [Solanum tuberosum]
Length=74

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +2

Query  188  MRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            MRI  E R CES SH+FKG C   +NCASVC +E F+GG+C GFR RCFCT+ C
Sbjct  22   MRI-AEARHCESLSHRFKGPCTRDSNCASVCETERFSGGNCHGFRRRCFCTKPC  74



>ref|XP_011001251.1| PREDICTED: defensin-like protein 1 [Populus euphratica]
Length=75

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             +++ +  E R+C SQSH FKG C    NCA VC +EGF+GG C+GFR RCFCT+ C
Sbjct  19   SQEVVVPTEARVCLSQSHYFKGPCARDHNCAWVCRNEGFSGGRCKGFRRRCFCTKLC  75



>gb|EPS66510.1| kunitz trypsin inhibitor protein, partial [Genlisea aurea]
Length=66

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/50 (66%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E R CESQSH FKG C S  NC  VC +EGFT G CRGFR RCFCT+ C
Sbjct  17   AEARTCESQSHGFKGRCLSDHNCGLVCRNEGFTNGLCRGFRQRCFCTKIC  66



>ref|XP_003562142.1| PREDICTED: defensin Ec-AMP-D1-like [Brachypodium distachyon]
Length=81

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTRECPH  355
            D    ++ E R CES+SH+F+G C   +NC +VC +EGF  G CRGFR RCFC  +C H
Sbjct  23   DGDQMMVAEARTCESRSHRFRGPCMRASNCRNVCKTEGFQDGKCRGFRRRCFCVSQCHH  81



>sp|P83399.1|DEF1_VIGUN RecName: Full=Defensin-like protein 1; AltName: Full=Cp-thionin 
I; AltName: Full=Cp-thionin-1; AltName: Full=Gamma-thionin 
I [Vigna unguiculata]
Length=47

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  209  RLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            R+CESQSH FKG C    NCA VC +EGF+GG+CRGFR RCFCT +C
Sbjct  1    RVCESQSHGFKGACTGDHNCALVCRNEGFSGGNCRGFRRRCFCTLKC  47



>ref|XP_004985852.1| PREDICTED: defensin SD2-like [Setaria italica]
Length=81

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R C SQSHKF+G C   ANCA+VC +EGF  G CRG R RCFCT  C
Sbjct  29   VAEARTCLSQSHKFRGPCVRRANCANVCRTEGFPDGKCRGLRRRCFCTTHC  79



>gb|AHA50470.1| defensin-like protein 1 [Citrullus lanatus]
Length=74

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 37/52 (71%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++ + R CES S  FKG C+S  NC  VC +EGF GGHCRGFR RCFCT+ C
Sbjct  22   MVTDARTCESPSRHFKGLCFSKNNCGHVCKTEGFHGGHCRGFRRRCFCTKHC  73



>ref|XP_010064921.1| PREDICTED: uncharacterized protein LOC104452094 [Eucalyptus grandis]
Length=135

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  182  EKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            E++   +EGR+CESQSHKF G C S   C  VC  E F  G CRGFRHRCFC + C
Sbjct  80   EEVVWRIEGRMCESQSHKFHGLCMSDRTCVVVCKEEDFDDGKCRGFRHRCFCRKPC  135



>ref|XP_007226630.1| hypothetical protein PRUPE_ppa022845mg [Prunus persica]
 gb|EMJ27829.1| hypothetical protein PRUPE_ppa022845mg [Prunus persica]
Length=87

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 50/84 (60%), Gaps = 3/84 (4%)
 Frame = +2

Query  107  NINMASINLSIVIPlllllllPSFDE---KMRIMVEGRLCESQSHKFKGECWSHANCASV  277
            +I + S    +V+ L+   + P   E     ++  + + C+SQS KFKG C+  ++C   
Sbjct  4    SIRLVSAAFVLVLLLVAAEMGPMAVEGRDAKKVEPKKKTCDSQSQKFKGMCFLTSSCVQS  63

Query  278  CLSEGFTGGHCRGFRHRCFCTREC  349
            C SEGFTGG CRGFR RCFC++ C
Sbjct  64   CKSEGFTGGQCRGFRRRCFCSKNC  87



>gb|EEC76838.1| hypothetical protein OsI_14993 [Oryza sativa Indica Group]
 gb|EEE60570.1| hypothetical protein OsJ_13935 [Oryza sativa Japonica Group]
Length=72

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             + R CE+ S++FKG C   ANCA+VCL+EGF+GG C GFR RC CT++C
Sbjct  23   AQARECETPSNEFKGICMMVANCANVCLTEGFSGGKCSGFRRRCMCTKDC  72



>gb|KCW70075.1| hypothetical protein EUGRSUZ_F03380 [Eucalyptus grandis]
Length=74

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            +EGR+CESQSHKF G C S   C  VC  E F  G CRGFRHRCFC + C
Sbjct  25   IEGRMCESQSHKFHGLCMSDRTCVVVCKEEDFDDGKCRGFRHRCFCRKPC  74



>ref|XP_002513261.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
 gb|EEF49129.1| 8.4 kDa sulfur-rich protein precursor, putative [Ricinus communis]
Length=74

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            +  E R+CESQSH FKG C    NCA VC +E F+GG C+G R RCFCT+ C
Sbjct  23   VPTEARVCESQSHYFKGPCLRDHNCAMVCRNEAFSGGRCKGVRRRCFCTKLC  74



>emb|CDP10468.1| unnamed protein product [Coffea canephora]
Length=78

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R CES SH+FKG C   +NCA+VC +EGF GG C G R RCFC++ C
Sbjct  28   VAEARTCESLSHRFKGTCVRGSNCAAVCQTEGFPGGQCSGLRRRCFCSKPC  78



>gb|KFK26328.1| hypothetical protein AALP_AA8G233400 [Arabis alpina]
Length=78

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R CE+ S  F G C S  NCA+VC +EGF  G CRGFR RC C+R C
Sbjct  27   VTVEARTCETSSQLFNGPCLSTTNCANVCHNEGFPDGDCRGFRRRCLCSRPC  78



>ref|XP_004503912.1| PREDICTED: defensin-like protein-like [Cicer arietinum]
Length=76

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             E R CES+SH+FKG C S   CA  C +EGF+GG CRG R RCFC R C
Sbjct  27   AEARTCESRSHRFKGTCLSDTTCAHACRNEGFSGGDCRGLRRRCFCNRLC  76



>ref|XP_002468581.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
 gb|EER95579.1| hypothetical protein SORBIDRAFT_01g048380 [Sorghum bicolor]
Length=80

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R C+SQSH+F+G C    NCA+VC +EGF  G CRGFR RCFC   C
Sbjct  28   VAEARTCQSQSHRFRGPCVRRENCANVCRTEGFPDGKCRGFRRRCFCLTHC  78



>sp|P86518.1|DEF1_ECHCG RecName: Full=Defensin Ec-AMP-D1 [Echinochloa crus-galli]
Length=47

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  209  RLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            R C+SQSH++KG C    NCASVC +EGF+GG C GFR RCFCT+ C
Sbjct  1    RECQSQSHRYKGACVHDTNCASVCQTEGFSGGKCVGFRGRCFCTKAC  47



>ref|NP_001052199.1| Os04g0189400 [Oryza sativa Japonica Group]
 dbj|BAF14113.1| Os04g0189400 [Oryza sativa Japonica Group]
 dbj|BAG92412.1| unnamed protein product [Oryza sativa Japonica Group]
Length=111

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             + R CE+ S++FKG C   ANCA+VCL+EGF+GG C GFR RC CT++C
Sbjct  62   AQARECETPSNEFKGICMMVANCANVCLTEGFSGGKCSGFRRRCMCTKDC  111



>ref|XP_011099999.1| PREDICTED: defensin Ec-AMP-D2-like [Sesamum indicum]
Length=82

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  203  EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTRECPH  355
            E +LC ++S+KFKG C     C SVC +EGFTGG CRGFR RC+CT+   H
Sbjct  31   EPKLCIAKSNKFKGFCLKDPKCVSVCKTEGFTGGRCRGFRLRCYCTKTAKH  81



>gb|EPS67569.1| gamma-thionin, partial [Genlisea aurea]
Length=50

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            VE R CESQS+ F+G C S+ NC  VC +EGF+ G CRGFR RCFCT+ C
Sbjct  1    VEARTCESQSNGFQGTCLSNHNCGLVCRNEGFSDGWCRGFRRRCFCTKAC  50



>sp|P86519.1|DEF2_ECHCG RecName: Full=Defensin Ec-AMP-D2 [Echinochloa crus-galli]
Length=47

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  209  RLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            R C+SQSH++KG C    NCASVC +EGF+GG C GFR RCFCT+ C
Sbjct  1    RECQSQSHRYKGACVHDTNCASVCQTEGFSGGKCVGFRGRCFCTKHC  47



>ref|XP_004509604.1| PREDICTED: defensin-like protein P322-like [Cicer arietinum]
Length=78

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R+C+SQS+ FKG C    +CA VC +EGFTGG C G R  CFCT+ C
Sbjct  28   VAEARICDSQSNTFKGPCVIDHSCAIVCQTEGFTGGQCEGLRRICFCTKPC  78



>dbj|BAB64929.1| defensin-like protein [Pyrus pyrifolia]
Length=87

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            VE R CE+ S KFKG C+S  NCA+ C  E F GG C+GFR RC CT++C
Sbjct  38   VEKRTCEAASGKFKGMCFSSNNCANTCAREKFDGGKCKGFRRRCMCTKKC  87



>ref|XP_009351647.1| PREDICTED: defensin-like protein 1 [Pyrus x bretschneideri]
Length=87

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            VE R CE+ S KFKG C+S  NCA+ C  E F GG C+GFR RC CT++C
Sbjct  38   VEKRTCEAASGKFKGMCFSSNNCANTCAREKFDGGKCKGFRRRCMCTKKC  87



>ref|XP_004147317.1| PREDICTED: defensin-like protein-like [Cucumis sativus]
 ref|XP_004170998.1| PREDICTED: defensin-like protein-like [Cucumis sativus]
Length=79

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            +E M    E R+C+SQSH F G C    NCA VC +EGF+GG C GFR RCFCT  C
Sbjct  23   EEMMGGGAEARMCQSQSHHFHGPCVRDHNCALVCRTEGFSGGECIGFRRRCFCTHRC  79



>gb|AIA67015.1| defensin [Triticum aestivum]
Length=78

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = +2

Query  203  EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            EGR+CE+ S +FKG C    NCA++CL+EGFT G C G + +C CT+ C
Sbjct  30   EGRVCETDSTRFKGICMVGTNCANICLTEGFTSGKCSGLKRKCICTKPC  78



>emb|CAH58740.1| defensin [Plantago major]
Length=72

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +2

Query  203  EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            E R C S SH+FKG C S  NCASVC +EGF GG C+G R RCFC   C
Sbjct  24   EARKCRSASHRFKGTCLSDTNCASVCKTEGFPGGDCKGLRRRCFCETHC  72



>ref|XP_006384382.1| hypothetical protein POPTR_0004s14520g [Populus trichocarpa]
 gb|ERP62179.1| hypothetical protein POPTR_0004s14520g [Populus trichocarpa]
Length=74

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             ++M +  E R+C SQSH +KG C    NCA VC +EGF GG C+GF  RCFC + C
Sbjct  18   SQEMVVPAEARVCLSQSHHYKGPCLRGHNCAMVCKTEGFAGGECKGFISRCFCAKLC  74



>dbj|BAK07043.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=104

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/51 (59%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + E R CES SH F+G C    NCA+VC +EGF GG+CRG R RCFCT  C
Sbjct  52   VAEARRCESPSHMFRGPCVRGHNCANVCRTEGFPGGNCRGLRRRCFCTTHC  102



>ref|XP_008340513.1| PREDICTED: defensin-like protein 1 [Malus domestica]
 gb|AFH74425.1| defensin [Malus domestica]
Length=87

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            VE R CE+ S KFKG C+S  NCA+ C  E F GG C+GFR RC CT++C
Sbjct  38   VEKRTCEAASGKFKGMCFSSNNCANTCAREKFDGGKCKGFRRRCMCTKKC  87



>gb|EMT11359.1| Defensin-like protein P322 [Aegilops tauschii]
Length=76

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  206  GRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             R C S SHKFKG C S  NCASVCL+E F GG C G R RC CT +C
Sbjct  29   ARECTSPSHKFKGLCVSDTNCASVCLTERFPGGKCDGIRQRCLCTEKC  76



>ref|XP_010675152.1| PREDICTED: defensin-like protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=73

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             EGR+C+S+SH FKG C    NCA VC +EGF+GG C GF  RC+CTR C
Sbjct  24   AEGRVCQSRSHYFKGPCARDHNCAYVCRNEGFSGGRCHGFFRRCYCTRLC  73



>ref|XP_010675153.1| PREDICTED: defensin-like protein 1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=72

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             EGR+C+S+SH FKG C    NCA VC +EGF+GG C GF  RC+CTR C
Sbjct  23   AEGRVCQSRSHYFKGPCARDHNCAYVCRNEGFSGGRCHGFFRRCYCTRLC  72



>ref|NP_201171.1| defensin-like protein 6 [Arabidopsis thaliana]
 sp|Q9FFP8.1|DEF06_ARATH RecName: Full=Defensin-like protein 6; AltName: Full=Low-molecular-weight 
cysteine-rich protein 74; Short=Protein LCR74; 
AltName: Full=Plant defensin 2.5; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB10459.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED97782.1| defensin-like protein 6 [Arabidopsis thaliana]
Length=73

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +2

Query  176  FDEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            F  +  I  EGR C+S+SH FK  C S+ NCA VC +EGF+GG C GF  RC+CTR C
Sbjct  16   FSSQEIIGGEGRTCQSKSHHFKYMCTSNHNCAIVCRNEGFSGGRCHGFHRRCYCTRLC  73



>ref|XP_009590912.1| PREDICTED: defensin-like protein 1 [Nicotiana tomentosiformis]
Length=74

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +2

Query  176  FDEKMRIM-VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            F  +M I   EGR+C SQSH ++G C    NCA VC +EGF+GG C G+R RCFCT+ C
Sbjct  16   FASQMAIQRAEGRVCISQSHGYRGPCVHDHNCALVCRNEGFSGGDCIGWRRRCFCTKLC  74



>ref|XP_009397593.1| PREDICTED: defensin Ec-AMP-D1 {ECO:0000303|PubMed:18625284}-like 
[Musa acuminata subsp. malaccensis]
Length=77

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VEGR CES S +FKG C   +NCASVC  EGF  G C G R RC C + C
Sbjct  26   VAVEGRTCESASTRFKGTCVRSSNCASVCQGEGFPDGKCEGVRRRCMCRKPC  77



>ref|XP_007202863.1| hypothetical protein PRUPE_ppa015550mg [Prunus persica]
 gb|EMJ04062.1| hypothetical protein PRUPE_ppa015550mg [Prunus persica]
Length=85

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 44/79 (56%), Gaps = 1/79 (1%)
 Frame = +2

Query  116  MASINLSIVIPlllllllPSFDE-KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEG  292
            M SI   +V+  + +   P   E K+      R CES S KFKG C   +NCA++C  EG
Sbjct  7    MFSIVFILVLLFVAIGTGPMVAEGKVETKETSRTCESLSTKFKGPCIRSSNCANICEEEG  66

Query  293  FTGGHCRGFRHRCFCTREC  349
            F GG C GFR RC CT+ C
Sbjct  67   FKGGKCVGFRLRCTCTKNC  85



>ref|XP_009780051.1| PREDICTED: defensin-like protein 1 [Nicotiana sylvestris]
Length=74

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 40/59 (68%), Gaps = 1/59 (2%)
 Frame = +2

Query  176  FDEKMRIM-VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            F  +M I  VEGR+C SQSH + G C    NCA VC +EGF+GG C G+R RCFCT+ C
Sbjct  16   FASQMAISRVEGRVCISQSHGYHGTCVHDHNCALVCRNEGFSGGDCIGWRRRCFCTKLC  74



>dbj|BAK07467.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=76

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  209  RLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            R+CE+ S +FKG C    NCA+VCL+EGFT G C GF+ +C CT+ C
Sbjct  30   RVCETDSTQFKGICMVGTNCANVCLTEGFTSGKCSGFKRKCMCTKPC  76



>ref|XP_010260874.1| PREDICTED: defensin D2-like [Nelumbo nucifera]
Length=72

 Score = 62.0 bits (149),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 0/56 (0%)
 Frame = +2

Query  182  EKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            E+M + V+ R+C++ S  F+G C  + NC + C  EGF  GHC+G R RCFC+R C
Sbjct  15   EEMVVHVDARMCDTPSRLFRGLCLINRNCDNTCRVEGFPDGHCKGLRRRCFCSRPC  70



>ref|XP_009357110.1| PREDICTED: defensin Ec-AMP-D1-like [Pyrus x bretschneideri]
Length=81

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  209  RLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++CES SHK++G C+  +NCA+ C  EGF GG C GFR RC CT++C
Sbjct  35   KICESPSHKYRGICFRSSNCATTCKKEGFMGGKCTGFRMRCVCTKKC  81



>ref|XP_009631841.1| PREDICTED: defensin-like protein 1 [Nicotiana tomentosiformis]
Length=62

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = +2

Query  173  SFDEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            +   +M   VE R+C S SH + G CW   NCA VC +EGF+GG C G + +C+CT+ C
Sbjct  4    ALQMEMMPQVEARVCMSPSHGYHGPCWHDHNCALVCRNEGFSGGDCVGIQRKCYCTKLC  62



>ref|XP_007203287.1| hypothetical protein PRUPE_ppa025677mg [Prunus persica]
 gb|EMJ04486.1| hypothetical protein PRUPE_ppa025677mg [Prunus persica]
Length=85

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 45/79 (57%), Gaps = 1/79 (1%)
 Frame = +2

Query  116  MASINLSIVIPlllllllPSFDE-KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEG  292
            M S    +V+ L+ +   P   E K+      R CES S KFKG C+  +NCA++C  EG
Sbjct  7    MFSTVFILVLLLVAIGTGPMVAEGKVETKETSRTCESLSTKFKGPCFRSSNCANICEKEG  66

Query  293  FTGGHCRGFRHRCFCTREC  349
            F GG C GFR RC CT+ C
Sbjct  67   FKGGKCVGFRLRCTCTKNC  85



>ref|XP_007156390.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
 gb|ESW28384.1| hypothetical protein PHAVU_003G282400g [Phaseolus vulgaris]
Length=78

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  191  RIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTR  343
            R++ E R CES+S   +G+C S  NCAS C +E F+GGHCRGFR RCFC +
Sbjct  26   RMVAEARGCESRSRHLRGKCESDENCASACRTERFSGGHCRGFRCRCFCDK  76



>gb|EYU27577.1| hypothetical protein MIMGU_mgv1a024490mg [Erythranthe guttata]
Length=71

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  200  VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             +GR CESQS  F+G C    NC +VC SEGFT G C+GFR RCFC + C
Sbjct  22   AKGRTCESQSFNFRGPCVIDHNCKAVCESEGFTDGDCQGFRRRCFCRKPC  71



>ref|XP_002865329.1| hypothetical protein ARALYDRAFT_917107 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41588.1| hypothetical protein ARALYDRAFT_917107 [Arabidopsis lyrata subsp. 
lyrata]
Length=81

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 37/56 (66%), Gaps = 1/56 (2%)
 Frame = +2

Query  188  MRIMVEGR-LCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTRECP  352
            M  MVEG+ +CE+QS  F+G C    NC  VC+SEGF  G C+GF  +C CT+ CP
Sbjct  23   MMKMVEGQQMCETQSINFRGMCTKWRNCQRVCMSEGFPDGRCKGFIRKCICTKPCP  78



>gb|EMT30046.1| Defensin-like protein P322 [Aegilops tauschii]
Length=78

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = +2

Query  203  EGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            E R+CE+ S +FKG C    NCA++CL+EGFT G C G + +C CT+ C
Sbjct  30   EPRVCETDSTRFKGICMVGTNCANICLTEGFTSGKCSGLKRKCICTKPC  78



>gb|AIA67014.1| defensin [Triticum aestivum]
Length=75

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            +  + R CE++S +F G C+  ANCA VC +EGFTGG C G +  C CT+EC
Sbjct  24   VPAQARECETESERFNGLCFVSANCAGVCNAEGFTGGKCSGLKRSCMCTKEC  75



>ref|XP_009763849.1| PREDICTED: defensin-like protein 1 [Nicotiana sylvestris]
Length=76

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 39/60 (65%), Gaps = 2/60 (3%)
 Frame = +2

Query  176  FDEKMRIM--VEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            F  +M +M  VE R+C S SH + G CW   NCA VC +EGF+GG C G + +C+CT+ C
Sbjct  17   FVSQMEMMRQVEARVCMSPSHGYHGPCWHDHNCALVCRNEGFSGGDCVGIQRKCYCTKLC  76



>ref|XP_008780828.1| PREDICTED: defensin-like protein 1 [Phoenix dactylifera]
Length=68

 Score = 60.8 bits (146),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 39/57 (68%), Gaps = 2/57 (4%)
 Frame = +2

Query  185  KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSE--GFTGGHCRGFRHRCFCTREC  349
            +M  +   RLCESQSH +KG C ++ NCA VC  E  GFTGG CRGF  +C+CT+ C
Sbjct  12   EMMTVAGARLCESQSHTYKGTCTNNHNCAIVCQREGRGFTGGRCRGFWRKCYCTKIC  68



>ref|XP_009389205.1| PREDICTED: defensin Tk-AMP-D2-like [Musa acuminata subsp. malaccensis]
Length=79

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 37/59 (63%), Gaps = 2/59 (3%)
 Frame = +2

Query  179  DEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRG--FRHRCFCTREC  349
             E    +V GR CESQSHKF G C   ANC +VC +EGF GG CRG     +C+CT+ C
Sbjct  21   SEMGTTVVNGRTCESQSHKFVGPCVRKANCGNVCQTEGFHGGVCRGSLIHRKCYCTKNC  79



>gb|ACM50880.1| defensin [Capsicum frutescens]
Length=53

 Score = 60.1 bits (144),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            +M E ++CE+ S  FKG C S  NC  VC  EGFT G C GFR +CFCT+ C
Sbjct  1    MMAEAKICEALSGNFKGLCLSSRNCGKVCRREGFTDGSCIGFRLQCFCTKPC  52



>ref|XP_008389118.1| PREDICTED: defensin-like protein 1 [Malus domestica]
Length=87

 Score = 60.8 bits (146),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            +VE R CE+ S KFKG C+S  NC   C  E FTGG CRGFR RC C ++C
Sbjct  37   VVEERTCEAASGKFKGLCFSSNNCKHTCKREQFTGGKCRGFRRRCMCNKKC  87



>sp|Q43413.1|DEF1_CAPAN RecName: Full=Defensin J1-1; Flags: Precursor [Capsicum annuum]
 gb|AAM09502.1|AF488780_1 gamma thionin [Capsicum annuum]
 emb|CAA64653.1| gamma-thionin [Capsicum annuum]
 gb|ACB30365.1| defensin [Capsicum annuum]
Length=75

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTRECP  352
            +M E ++CE+ S  FKG C S  +C +VC  EGFT G C GFR +CFCT+ C 
Sbjct  23   MMAEAKICEALSGNFKGLCLSSRDCGNVCRREGFTDGSCIGFRLQCFCTKPCA  75



>gb|AAW33979.1| proteinase inhibitor SE60-like protein [Ammopiptanthus mongolicus]
Length=68

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 41/61 (67%), Gaps = 4/61 (7%)
 Frame = +2

Query  179  DEKMRIMVEG---RLCES-QSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTRE  346
             ++M +  EG   R C S  S++FKG+C+S  NCASVC  EG+ GG CRG R RCFCT+ 
Sbjct  8    SQEMVVQTEGLFRRKCPSVLSNRFKGKCFSDHNCASVCQLEGYFGGDCRGLRQRCFCTKS  67

Query  347  C  349
            C
Sbjct  68   C  68



>sp|P82781.2|DEF03_ARATH RecName: Full=Putative defensin-like protein 3; AltName: Full=Putative 
low-molecular-weight cysteine-rich protein 71; Short=Protein 
LCR71; Flags: Precursor [Arabidopsis thaliana]
Length=62

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 34/52 (65%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            + VE R+C+S+S KFKG C S  NCA+VC +EGF  G C G   RC+C   C
Sbjct  11   VTVEARICKSRSQKFKGPCVSEDNCANVCHTEGFPDGDCDGLLRRCYCNTHC  62



>emb|CDY39856.1| BnaC02g42620D [Brassica napus]
 emb|CDY31356.1| BnaA02g33850D [Brassica napus]
Length=73

 Score = 60.1 bits (144),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = +2

Query  176  FDEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            F  +  I +EGR+C+S+SH F+  C S+ NCA++C  E F+GG C G   +C+CTR C
Sbjct  16   FSSQEVIGIEGRMCQSRSHHFRSICLSNHNCANICRGERFSGGRCHGLHRKCYCTRLC  73



>ref|XP_007202934.1| hypothetical protein PRUPE_ppa016748mg [Prunus persica]
 ref|XP_007202943.1| hypothetical protein PRUPE_ppa016379mg [Prunus persica]
 ref|XP_007203068.1| hypothetical protein PRUPE_ppa023476mg [Prunus persica]
 gb|EMJ04133.1| hypothetical protein PRUPE_ppa016748mg [Prunus persica]
 gb|EMJ04142.1| hypothetical protein PRUPE_ppa016379mg [Prunus persica]
 gb|EMJ04267.1| hypothetical protein PRUPE_ppa023476mg [Prunus persica]
Length=85

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = +2

Query  116  MASINLSIVIPlllllllPSFDE-KMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEG  292
            M S    +V+  + +   P   E K+      R CES S KFKG C   +NCA++C  EG
Sbjct  7    MFSTVFILVLLFVAIGTGPMVAEGKVETKETSRTCESLSTKFKGPCIRSSNCANICEEEG  66

Query  293  FTGGHCRGFRHRCFCTREC  349
            F GG C GFR RC CT+ C
Sbjct  67   FKGGKCVGFRLRCTCTKNC  85



>ref|XP_002864860.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41119.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=73

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            I  +GR C+S+SH FK  C S  NCA VC +EGF+GG C GF  RC+CTR C
Sbjct  22   IGSDGRTCQSKSHHFKYMCTSSHNCAIVCRNEGFSGGRCHGFHRRCYCTRLC  73



>gb|EMS68062.1| Defensin Tm-AMP-D1.2 [Triticum urartu]
Length=74

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = +2

Query  191  RIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCR--GFRHRCFCTRE  346
            R + E R C S+SHKFKG C S +NCAS+C +E F GG C+   F  +CFC RE
Sbjct  6    RKVAEARDCLSKSHKFKGACLSSSNCASICRTENFPGGECKLDSFARKCFCKRE  59



>gb|EMT03363.1| hypothetical protein F775_43918 [Aegilops tauschii]
Length=82

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTRECPH  355
            ++ E R CES+SH+F+G C   +NCA+VC +EGF+ G CRGF    FCT  C H
Sbjct  29   MVAEARTCESRSHRFRGPCVRRSNCANVCRTEGFSDGECRGFPPPPFCTTHCHH  82



>sp|Q07502.1|DEF_SOYBN RecName: Full=Defensin-like protein; AltName: Full=8.4 kDa sulfur-rich 
protein; AltName: Full=Probable proteinase inhibitor 
P322; AltName: Full=Protein SE60; Flags: Precursor [Glycine 
max]
 emb|CAA78359.1| a protein similar to potato tuber protein p322 homolgous to Bowman-Birk 
Proteinase Inhibitor [Glycine max]
Length=74

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = +2

Query  176  FDEKMRIMVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            F  ++ +  EGR+CESQSH F G C    NCA VC +EGF+GG C+  R RCFCTR C
Sbjct  18   FASQVVVQTEGRVCESQSHGFHGLCNRDHNCALVCRNEGFSGGRCKRSR-RCFCTRIC  74



>gb|KHG06821.1| Defensin-like protein [Gossypium arboreum]
Length=78

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = +2

Query  194  IMVEGRLCESQSHKFKGECWSHANCASVCLSE-GFTGGHCRGFRHRCFCTREC  349
            + VEGR CE++S ++KG C   ANC S+C  E GF GGHC GF  RC+CT+ C
Sbjct  26   MAVEGRTCETKSSEYKGICLFDANCDSICKVEPGFDGGHCHGFFRRCYCTKPC  78



>ref|XP_003581056.1| PREDICTED: defensin Ec-AMP-D1-like [Brachypodium distachyon]
Length=76

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  209  RLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            R CE+ S +FKG C    NCA+VCL+EGFTGG C  F  +C CT+ C
Sbjct  30   RECEAASVRFKGLCMVQTNCANVCLTEGFTGGRCSSFVRKCMCTKPC  76



>gb|EMS54459.1| Defensin Tk-AMP-D5 [Triticum urartu]
Length=75

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 36/51 (71%), Gaps = 1/51 (2%)
 Frame = +2

Query  197  MVEGRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
            ++  R C S+S KF G C S  NCASVCL+E F GG C G+R RCFCT++C
Sbjct  26   VILARECRSESKKFVGLCVSDTNCASVCLTERFPGGKCDGYR-RCFCTKDC  75



>gb|EMS52277.1| Defensin Tk-AMP-D1.1 [Triticum urartu]
Length=77

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  206  GRLCESQSHKFKGECWSHANCASVCLSEGFTGGHCRGFRHRCFCTREC  349
             R CES SHKF G C+S  NCA+VC +EGFT G C G +  C CT++C
Sbjct  30   ARDCESDSHKFHGACFSDTNCANVCQTEGFTAGKCVGVQRHCHCTKDC  77



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520942005441