BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16584_g2_i1 len=635 path=[397:0-634]

Length=635
                                                                      Score     E

ref|XP_008457720.1|  PREDICTED: probable protein phosphatase 2C 60      266   7e-84   
ref|XP_004147052.1|  PREDICTED: probable protein phosphatase 2C 6...    265   1e-83   
emb|CDP14549.1|  unnamed protein product                                265   1e-83   
ref|XP_007041771.1|  Phosphatase 2C family protein isoform 1            265   2e-83   
ref|XP_007041772.1|  Phosphatase 2C family protein isoform 2            265   2e-83   
ref|XP_004169425.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    263   6e-83   
gb|KDP23958.1|  hypothetical protein JCGZ_25346                         263   8e-83   
ref|XP_003624259.1|  Protein phosphatase 2C (PP2C)                      261   2e-82   
ref|XP_007046602.1|  Phosphatase 2C family protein isoform 1            262   3e-82   
ref|XP_010029636.1|  PREDICTED: probable protein phosphatase 2C 60      262   3e-82   
emb|CAB90634.1|  protein phosphatase 2C (PP2C)                          261   5e-82   Fagus sylvatica
ref|XP_002521272.1|  protein phosphatase 2c, putative                   261   5e-82   Ricinus communis
ref|XP_011046655.1|  PREDICTED: probable protein phosphatase 2C 64      261   8e-82   
ref|XP_007041776.1|  Phosphatase 2C family protein                      260   1e-81   
ref|XP_002313699.1|  phosphatase 2C family protein                      260   1e-81   Populus trichocarpa [western balsam poplar]
gb|KDP33299.1|  hypothetical protein JCGZ_13086                         259   2e-81   
ref|XP_002305529.1|  hypothetical protein POPTR_0004s18340g             259   3e-81   Populus trichocarpa [western balsam poplar]
ref|XP_010266045.1|  PREDICTED: probable protein phosphatase 2C 60      259   3e-81   
gb|KHG27171.1|  hypothetical protein F383_05187                         259   3e-81   
ref|XP_011045811.1|  PREDICTED: probable protein phosphatase 2C 64      258   1e-80   
ref|XP_003536720.1|  PREDICTED: probable protein phosphatase 2C 6...    258   1e-80   
ref|XP_003555860.1|  PREDICTED: probable protein phosphatase 2C 6...    258   1e-80   
gb|KHN11497.1|  Hypothetical protein glysoja_015392                     257   1e-80   
gb|AGF33285.1|  protein phosphatase 2C                                  251   2e-80   
ref|XP_011022262.1|  PREDICTED: probable protein phosphatase 2C 46      255   9e-80   
ref|XP_006383046.1|  phosphatase 2C family protein                      255   9e-80   
gb|KHG28703.1|  hypothetical protein F383_13791                         255   1e-79   
ref|XP_007142806.1|  hypothetical protein PHAVU_007G018300g             255   1e-79   
ref|XP_004492898.1|  PREDICTED: probable protein phosphatase 2C 6...    254   2e-79   
ref|XP_009340482.1|  PREDICTED: probable protein phosphatase 2C 60      254   3e-79   
ref|XP_009590077.1|  PREDICTED: probable protein phosphatase 2C 4...    254   3e-79   
ref|XP_006422534.1|  hypothetical protein CICLE_v10028600mg             253   5e-79   
emb|CAN64313.1|  hypothetical protein VITISV_023164                     253   5e-79   Vitis vinifera
ref|XP_006486691.1|  PREDICTED: probable protein phosphatase 2C 6...    253   5e-79   
gb|KDO68174.1|  hypothetical protein CISIN_1g015823mg                   253   6e-79   
ref|XP_002530628.1|  protein phosphatase 2c, putative                   253   7e-79   Ricinus communis
ref|XP_002279993.1|  PREDICTED: probable protein phosphatase 2C 60      253   8e-79   Vitis vinifera
ref|XP_009355640.1|  PREDICTED: probable protein phosphatase 2C 60      253   9e-79   
ref|XP_004290738.1|  PREDICTED: probable protein phosphatase 2C 2...    253   1e-78   
ref|XP_008377721.1|  PREDICTED: probable protein phosphatase 2C 60      253   1e-78   
gb|KHG25255.1|  hypothetical protein F383_08950                         253   1e-78   
ref|XP_009791771.1|  PREDICTED: probable protein phosphatase 2C 46      252   1e-78   
ref|XP_010266882.1|  PREDICTED: probable protein phosphatase 2C 60      252   1e-78   
ref|XP_006380555.1|  hypothetical protein POPTR_0007s09220g             252   2e-78   
ref|XP_007201072.1|  hypothetical protein PRUPE_ppa006747mg             252   2e-78   
ref|XP_010086827.1|  putative protein phosphatase 2C 60                 250   7e-78   
emb|CBI28366.3|  unnamed protein product                                245   1e-77   
ref|XP_010941349.1|  PREDICTED: probable protein phosphatase 2C 6...    249   3e-77   
ref|XP_010548248.1|  PREDICTED: probable protein phosphatase 2C 46      248   5e-77   
ref|XP_004497192.1|  PREDICTED: probable protein phosphatase 2C 6...    247   1e-76   
ref|XP_010935169.1|  PREDICTED: probable protein phosphatase 2C 60      247   1e-76   
ref|XP_006425370.1|  hypothetical protein CICLE_v10025781mg             247   2e-76   
ref|XP_006467020.1|  PREDICTED: probable protein phosphatase 2C 6...    247   2e-76   
ref|XP_011088628.1|  PREDICTED: probable protein phosphatase 2C 60      246   2e-76   
ref|XP_003520132.1|  PREDICTED: probable protein phosphatase 2C 6...    246   3e-76   
gb|KHN00444.1|  Hypothetical protein glysoja_000112                     246   3e-76   
ref|XP_011092959.1|  PREDICTED: probable protein phosphatase 2C 60      246   4e-76   
ref|XP_007156202.1|  hypothetical protein PHAVU_003G266900g             246   4e-76   
ref|XP_002868847.1|  phosphatase 2C family protein                      246   6e-76   
ref|XP_008242016.1|  PREDICTED: probable protein phosphatase 2C 46      245   7e-76   
ref|XP_003547908.1|  PREDICTED: probable protein phosphatase 2C 6...    245   7e-76   
gb|KHN35550.1|  Hypothetical protein glysoja_033039                     245   7e-76   
gb|AAD11430.1|  protein phosphatase 2C homolog                          245   7e-76   Mesembryanthemum crystallinum
ref|XP_003635344.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    245   9e-76   
ref|XP_006411644.1|  hypothetical protein EUTSA_v10025386mg             245   9e-76   
ref|XP_010683039.1|  PREDICTED: probable protein phosphatase 2C 60      245   1e-75   
ref|XP_009595549.1|  PREDICTED: probable protein phosphatase 2C 46      244   1e-75   
ref|XP_008791943.1|  PREDICTED: probable protein phosphatase 2C 60      244   2e-75   
ref|XP_009589840.1|  PREDICTED: probable protein phosphatase 2C 60      244   2e-75   
ref|XP_004234522.1|  PREDICTED: probable protein phosphatase 2C 60      244   2e-75   
ref|XP_009801750.1|  PREDICTED: probable protein phosphatase 2C 60      244   2e-75   
emb|CAB37508.1|  putative protein phosphatase-2c                        244   2e-75   Arabidopsis thaliana [mouse-ear cress]
gb|AAL32532.1|  putative protein phosphatase-2c                         244   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007202114.1|  hypothetical protein PRUPE_ppa006861mg             244   2e-75   
ref|XP_006343345.1|  PREDICTED: probable protein phosphatase 2C 6...    244   3e-75   
ref|NP_195564.2|  putative protein phosphatase 2C 64                    244   3e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CDP01847.1|  unnamed protein product                                243   3e-75   
ref|XP_009418617.1|  PREDICTED: probable protein phosphatase 2C 6...    243   3e-75   
ref|XP_009781837.1|  PREDICTED: probable protein phosphatase 2C 46      243   4e-75   
ref|XP_006360895.1|  PREDICTED: probable protein phosphatase 2C 6...    243   5e-75   
ref|XP_010918123.1|  PREDICTED: probable protein phosphatase 2C 60      243   6e-75   
gb|KHG27051.1|  hypothetical protein F383_06469                         243   6e-75   
ref|XP_009418584.1|  PREDICTED: probable protein phosphatase 2C 6...    243   6e-75   
gb|AAC35951.1|  protein phosphatase-2c                                  240   7e-75   Mesembryanthemum crystallinum
ref|XP_008806142.1|  PREDICTED: probable protein phosphatase 2C 60      243   8e-75   
ref|XP_004248645.1|  PREDICTED: probable protein phosphatase 2C 4...    240   1e-74   
gb|KHG06659.1|  hypothetical protein F383_03933                         240   1e-74   
ref|XP_009363444.1|  PREDICTED: probable protein phosphatase 2C 46      242   1e-74   
ref|XP_010028765.1|  PREDICTED: probable protein phosphatase 2C 60      242   1e-74   
ref|XP_008337969.1|  PREDICTED: probable protein phosphatase 2C 46      242   1e-74   
ref|XP_010690331.1|  PREDICTED: probable protein phosphatase 2C 60      241   2e-74   
ref|XP_009628267.1|  PREDICTED: probable protein phosphatase 2C 60      241   2e-74   
ref|XP_006282642.1|  hypothetical protein CARUB_v10004984mg             241   3e-74   
emb|CDY70696.1|  BnaCnng69380D                                          239   3e-74   
ref|XP_008811724.1|  PREDICTED: probable protein phosphatase 2C 60      241   5e-74   
ref|XP_004231056.1|  PREDICTED: probable protein phosphatase 2C 46      240   5e-74   
ref|XP_009418691.1|  PREDICTED: probable protein phosphatase 2C 6...    240   6e-74   
gb|EEC81321.1|  hypothetical protein OsI_24486                          240   6e-74   Oryza sativa Indica Group [Indian rice]
ref|NP_001058597.1|  Os06g0717800                                       240   6e-74   Oryza sativa Japonica Group [Japonica rice]
gb|EYU37974.1|  hypothetical protein MIMGU_mgv1a007884mg                240   7e-74   
ref|XP_006367872.1|  PREDICTED: probable protein phosphatase 2C 6...    240   8e-74   
ref|XP_009783505.1|  PREDICTED: probable protein phosphatase 2C 60      239   8e-74   
ref|XP_004248644.1|  PREDICTED: probable protein phosphatase 2C 6...    239   8e-74   
ref|XP_009418690.1|  PREDICTED: probable protein phosphatase 2C 6...    241   1e-73   
ref|XP_009101944.1|  PREDICTED: probable protein phosphatase 2C 6...    239   2e-73   
ref|XP_009344827.1|  PREDICTED: probable protein phosphatase 2C 46      239   3e-73   
ref|XP_004287772.1|  PREDICTED: probable protein phosphatase 2C 6...    238   6e-73   
ref|XP_009391019.1|  PREDICTED: probable protein phosphatase 2C 60      237   9e-73   
gb|KHG19895.1|  hypothetical protein F383_10069                         237   1e-72   
ref|XP_008393780.1|  PREDICTED: probable protein phosphatase 2C 60      237   1e-72   
ref|XP_006656500.1|  PREDICTED: probable protein phosphatase 2C 6...    236   2e-72   
ref|XP_010446360.1|  PREDICTED: probable protein phosphatase 2C 64      236   3e-72   
ref|XP_010436947.1|  PREDICTED: probable protein phosphatase 2C 64      236   3e-72   
ref|XP_009392876.1|  PREDICTED: probable protein phosphatase 2C 60      236   3e-72   
ref|XP_010431790.1|  PREDICTED: probable protein phosphatase 2C 6...    236   4e-72   
ref|XP_009101943.1|  PREDICTED: probable protein phosphatase 2C 6...    235   5e-72   
ref|XP_009101942.1|  PREDICTED: probable protein phosphatase 2C 6...    235   8e-72   
ref|XP_010526813.1|  PREDICTED: probable protein phosphatase 2C 46      234   8e-72   
ref|XP_004966475.1|  PREDICTED: probable protein phosphatase 2C 6...    233   2e-71   
gb|AET03717.2|  serine/threonine phosphatase family, 2C domain pr...    229   3e-71   
gb|ABF93864.1|  protein phosphatase 2C, putative, expressed             229   4e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010531120.1|  PREDICTED: probable protein phosphatase 2C 46      233   5e-71   
ref|XP_006828820.1|  hypothetical protein AMTR_s00001p00136050          233   5e-71   
ref|XP_009408204.1|  PREDICTED: probable protein phosphatase 2C 60      232   6e-71   
ref|XP_009395356.1|  PREDICTED: probable protein phosphatase 2C 60      232   8e-71   
ref|XP_010239682.1|  PREDICTED: probable protein phosphatase 2C 60      231   1e-70   
ref|XP_004509404.1|  PREDICTED: probable protein phosphatase 2C 4...    231   3e-70   
gb|EEE58289.1|  hypothetical protein OsJ_09327                          229   3e-70   Oryza sativa Japonica Group [Japonica rice]
gb|KCW64133.1|  hypothetical protein EUGRSUZ_G01786                     231   4e-70   
ref|XP_002439035.1|  hypothetical protein SORBIDRAFT_10g030320          230   4e-70   Sorghum bicolor [broomcorn]
ref|NP_001146390.1|  protein phosphatase 2C isoform 1                   230   5e-70   Zea mays [maize]
ref|XP_010066286.1|  PREDICTED: probable protein phosphatase 2C 60      230   5e-70   
gb|ACG45008.1|  protein phosphatase 2C                                  230   6e-70   Zea mays [maize]
gb|AFK33394.1|  unknown                                                 229   7e-70   
ref|XP_003629242.1|  Protein phosphatase 2c-like protein                229   8e-70   
ref|XP_003629241.1|  Protein phosphatase 2c-like protein                229   9e-70   
gb|ACJ85664.1|  unknown                                                 225   1e-69   Medicago truncatula
ref|NP_001048899.1|  Os03g0137200                                       229   2e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010426694.1|  PREDICTED: probable protein phosphatase 2C 46      228   2e-69   
ref|XP_010503831.1|  PREDICTED: probable protein phosphatase 2C 46      228   2e-69   
ref|XP_010229239.1|  PREDICTED: probable protein phosphatase 2C 28      228   3e-69   
gb|EMT20424.1|  Putative protein phosphatase 2C 60                      227   3e-69   
gb|EMS54114.1|  putative protein phosphatase 2C 60                      228   5e-69   
dbj|BAK01278.1|  predicted protein                                      228   5e-69   
ref|XP_002876083.1|  hypothetical protein ARALYDRAFT_485488             227   5e-69   
ref|XP_006340779.1|  PREDICTED: probable protein phosphatase 2C 6...    227   7e-69   
ref|XP_009803756.1|  PREDICTED: probable protein phosphatase 2C 6...    227   7e-69   
gb|EAY88457.1|  hypothetical protein OsI_09922                          227   7e-69   Oryza sativa Indica Group [Indian rice]
ref|NP_001065203.1|  Os10g0544900                                       227   1e-68   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK02779.1|  predicted protein                                      229   1e-68   
ref|XP_004232521.1|  PREDICTED: probable protein phosphatase 2C 60      226   1e-68   
gb|AAK20060.1|AC025783_20  putative protein phosphatase 2C              226   1e-68   Oryza sativa Japonica Group [Japonica rice]
ref|NP_974411.1|  putative protein phosphatase 2C                       223   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515547.1|  PREDICTED: probable protein phosphatase 2C 46      226   1e-68   
gb|AFK44879.1|  unknown                                                 219   2e-68   
ref|XP_004985788.1|  PREDICTED: probable protein phosphatase 2C 2...    226   2e-68   
ref|XP_010444839.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    226   2e-68   
gb|EMT06776.1|  Putative protein phosphatase 2C 28                      229   2e-68   
ref|XP_010526549.1|  PREDICTED: probable protein phosphatase 2C 64      226   2e-68   
gb|EPS71472.1|  hypothetical protein M569_03278                         225   3e-68   
ref|XP_010484688.1|  PREDICTED: probable protein phosphatase 2C 79      225   4e-68   
ref|XP_006649361.1|  PREDICTED: probable protein phosphatase 2C 2...    225   4e-68   
gb|ABR18015.1|  unknown                                                 219   4e-68   Picea sitchensis
gb|KEH44379.1|  serine/threonine phosphatase family, 2C domain pr...    225   4e-68   
ref|XP_006662022.1|  PREDICTED: probable protein phosphatase 2C 7...    225   6e-68   
ref|XP_008440869.1|  PREDICTED: probable protein phosphatase 2C 6...    225   7e-68   
ref|XP_006291300.1|  hypothetical protein CARUB_v10017436mg             224   7e-68   
ref|XP_008440874.1|  PREDICTED: probable protein phosphatase 2C 6...    224   8e-68   
ref|XP_008643604.1|  PREDICTED: LOC100281412 isoform X1                 224   8e-68   
gb|ACG29902.1|  protein phosphatase 2C                                  224   9e-68   Zea mays [maize]
ref|XP_009602153.1|  PREDICTED: probable protein phosphatase 2C 60      223   2e-67   
ref|XP_008447929.1|  PREDICTED: probable protein phosphatase 2C 6...    223   2e-67   
ref|XP_004146159.1|  PREDICTED: probable protein phosphatase 2C 6...    223   2e-67   
ref|NP_001130554.1|  protein phosphatase 2C isoform 1                   223   4e-67   Zea mays [maize]
ref|NP_566949.2|  putative protein phosphatase 2C                       222   4e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CDY16313.1|  BnaC01g23480D                                          222   5e-67   
ref|NP_001147802.1|  LOC100281412                                       222   6e-67   Zea mays [maize]
emb|CDX73725.1|  BnaC08g22780D                                          221   6e-67   
ref|XP_004135015.1|  PREDICTED: probable protein phosphatase 2C 6...    222   6e-67   
gb|EMS61157.1|  putative protein phosphatase 2C 28                      226   7e-67   
gb|KGN48956.1|  hypothetical protein Csa_6G507290                       222   7e-67   
ref|XP_004144860.1|  PREDICTED: probable protein phosphatase 2C 6...    221   9e-67   
ref|NP_201409.1|  putative protein phosphatase 2C 79                    221   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403924.1|  hypothetical protein EUTSA_v10010452mg             221   1e-66   
ref|XP_009109549.1|  PREDICTED: probable protein phosphatase 2C 64      220   2e-66   
ref|XP_002467561.1|  hypothetical protein SORBIDRAFT_01g030180          221   2e-66   Sorghum bicolor [broomcorn]
ref|XP_009149079.1|  PREDICTED: probable protein phosphatase 2C 46      220   2e-66   
ref|NP_001151373.1|  LOC100285006                                       221   2e-66   Zea mays [maize]
gb|ACN25494.1|  unknown                                                 221   3e-66   Zea mays [maize]
ref|XP_009400339.1|  PREDICTED: probable protein phosphatase 2C 60      220   4e-66   
ref|XP_010534295.1|  PREDICTED: probable protein phosphatase 2C 38      219   5e-66   
ref|NP_001288424.1|  uncharacterized protein LOC103631685               219   1e-65   
ref|XP_009115817.1|  PREDICTED: probable protein phosphatase 2C 46      218   1e-65   
gb|ACG32321.1|  protein phosphatase 2C                                  219   2e-65   Zea mays [maize]
ref|XP_004983777.1|  PREDICTED: probable protein phosphatase 2C 7...    218   2e-65   
emb|CDX90277.1|  BnaA08g17070D                                          218   2e-65   
emb|CDY12086.1|  BnaC03g60020D                                          217   4e-65   
ref|XP_004951589.1|  PREDICTED: probable protein phosphatase 2C 7...    217   6e-65   
gb|ABE77197.1|  putative protein phosphatase 2C                         217   7e-65   Sorghum bicolor [broomcorn]
ref|XP_002468552.1|  hypothetical protein SORBIDRAFT_01g047830          216   9e-65   Sorghum bicolor [broomcorn]
emb|CDX78002.1|  BnaA09g31970D                                          219   1e-64   
ref|XP_010067239.1|  PREDICTED: probable protein phosphatase 2C 38      215   2e-64   
ref|XP_008680928.1|  PREDICTED: protein phosphatase 2C isoform X1       215   4e-64   
ref|XP_011017101.1|  PREDICTED: probable protein phosphatase 2C 3...    211   5e-64   
ref|XP_010234959.1|  PREDICTED: probable protein phosphatase 2C 72      214   6e-64   
dbj|BAJ95758.1|  predicted protein                                      214   7e-64   
gb|EMT14261.1|  Putative protein phosphatase 2C 72                      214   8e-64   
emb|CBI32641.3|  unnamed protein product                                213   1e-63   
ref|XP_002276631.1|  PREDICTED: probable protein phosphatase 2C 38      213   1e-63   Vitis vinifera
gb|EMS63543.1|  putative protein phosphatase 2C 72                      213   1e-63   
gb|KDP46132.1|  hypothetical protein JCGZ_06643                         213   2e-63   
ref|NP_001152449.1|  protein phosphatase 2C                             213   3e-63   Zea mays [maize]
ref|XP_006291301.1|  hypothetical protein CARUB_v10017436mg             211   3e-63   
emb|CDY54807.1|  BnaA06g40990D                                          213   3e-63   
gb|ABK93230.1|  unknown                                                 209   3e-63   Populus trichocarpa [western balsam poplar]
ref|XP_011016941.1|  PREDICTED: probable protein phosphatase 2C 3...    213   4e-63   
gb|KDO36405.1|  hypothetical protein CISIN_1g045470mg                   204   4e-63   
ref|XP_011016344.1|  PREDICTED: probable protein phosphatase 2C 3...    212   5e-63   
ref|XP_006828247.1|  hypothetical protein AMTR_s00023p00195110          212   5e-63   
ref|NP_001045569.1|  Os01g0976700                                       211   6e-63   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011017023.1|  PREDICTED: probable protein phosphatase 2C 3...    211   6e-63   
gb|AIG52087.1|  2C-type protein phosphatase protein                     212   7e-63   
ref|XP_010499254.1|  PREDICTED: probable protein phosphatase 2C 38      211   1e-62   
gb|KDO36191.1|  hypothetical protein CISIN_1g046755mg                   203   1e-62   
ref|XP_010558777.1|  PREDICTED: probable protein phosphatase 2C 38      210   2e-62   
ref|XP_009769529.1|  PREDICTED: probable protein phosphatase 2C 38      210   2e-62   
gb|ACJ84882.1|  unknown                                                 210   2e-62   Medicago truncatula
ref|XP_010253439.1|  PREDICTED: probable protein phosphatase 2C 38      210   2e-62   
ref|XP_010465036.1|  PREDICTED: probable protein phosphatase 2C 38      209   3e-62   
ref|XP_009413031.1|  PREDICTED: probable protein phosphatase 2C 60      209   4e-62   
ref|XP_009421366.1|  PREDICTED: probable protein phosphatase 2C 60      209   5e-62   
gb|ACJ85444.1|  unknown                                                 202   5e-62   Medicago truncatula
ref|XP_002312054.1|  serine/threonine protein phosphatase 2C            209   7e-62   Populus trichocarpa [western balsam poplar]
gb|EAY77438.1|  hypothetical protein OsI_05432                          209   7e-62   Oryza sativa Indica Group [Indian rice]
ref|XP_006378750.1|  hypothetical protein POPTR_0010s22180g             209   8e-62   
ref|XP_010486985.1|  PREDICTED: probable protein phosphatase 2C 38      209   8e-62   
gb|EYU41653.1|  hypothetical protein MIMGU_mgv1a008235mg                208   1e-61   
ref|XP_007009637.1|  Phosphatase 2C family protein isoform 1            207   2e-61   
ref|XP_006297878.1|  hypothetical protein CARUB_v10013921mg             207   2e-61   
ref|XP_007009638.1|  Phosphatase 2C family protein isoform 2            207   2e-61   
emb|CDY08420.1|  BnaA05g26560D                                          207   3e-61   
ref|XP_004137794.1|  PREDICTED: probable protein phosphatase 2C 3...    207   3e-61   
ref|XP_009146605.1|  PREDICTED: probable protein phosphatase 2C 38      207   3e-61   
ref|NP_001168381.1|  uncharacterized protein LOC100382150               206   3e-61   Zea mays [maize]
gb|AIB05855.1|  orphans transcription factor                            206   3e-61   
ref|NP_187868.2|  putative protein phosphatase 2C 38                    207   4e-61   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51012.1|AC069474_11  protein phosphatase 2C, putative; 1682...    207   4e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011084375.1|  PREDICTED: probable protein phosphatase 2C 38      206   5e-61   
ref|XP_008233397.1|  PREDICTED: probable protein phosphatase 2C 3...    206   6e-61   
ref|XP_006436170.1|  hypothetical protein CICLE_v10031798mg             206   6e-61   
ref|XP_008442607.1|  PREDICTED: probable protein phosphatase 2C 38      206   7e-61   
emb|CDY42159.1|  BnaC05g40600D                                          206   7e-61   
ref|XP_008233398.1|  PREDICTED: probable protein phosphatase 2C 3...    206   7e-61   
ref|XP_011027064.1|  PREDICTED: probable protein phosphatase 2C 3...    206   8e-61   
ref|XP_004493923.1|  PREDICTED: probable protein phosphatase 2C 3...    206   8e-61   
ref|XP_011027061.1|  PREDICTED: probable protein phosphatase 2C 3...    206   9e-61   
ref|XP_003592807.1|  hypothetical protein MTR_1g116260                  206   1e-60   
ref|XP_010423830.1|  PREDICTED: probable protein phosphatase 2C 6...    205   1e-60   
ref|XP_010423831.1|  PREDICTED: probable protein phosphatase 2C 6...    205   1e-60   
ref|XP_004307440.1|  PREDICTED: probable protein phosphatase 2C 3...    205   2e-60   
gb|KDP29048.1|  hypothetical protein JCGZ_16437                         204   2e-60   
gb|EPS66771.1|  hypothetical protein M569_08005                         204   2e-60   
ref|XP_002865087.1|  phosphatase 2C family protein                      205   3e-60   
ref|XP_011095192.1|  PREDICTED: probable protein phosphatase 2C 38      205   3e-60   
ref|XP_002884915.1|  phosphatase 2C family protein                      204   3e-60   
ref|XP_006589784.1|  PREDICTED: probable protein phosphatase 2C 3...    201   3e-60   
ref|XP_006407314.1|  hypothetical protein EUTSA_v10020905mg             204   3e-60   
ref|XP_004497368.1|  PREDICTED: probable protein phosphatase 2C 3...    204   4e-60   
ref|XP_002525208.1|  protein phosphatase 2c, putative                   204   4e-60   Ricinus communis
gb|EMT24405.1|  Putative protein phosphatase 2C 38                      201   4e-60   
emb|CDY52665.1|  BnaC01g38550D                                          204   4e-60   
ref|XP_007218123.1|  hypothetical protein PRUPE_ppa007029mg             204   5e-60   
ref|XP_009120474.1|  PREDICTED: probable protein phosphatase 2C 38      204   6e-60   
gb|KHG29304.1|  hypothetical protein F383_15428                         203   6e-60   
ref|XP_002987289.1|  hypothetical protein SELMODRAFT_183083             204   7e-60   
ref|XP_004249804.1|  PREDICTED: probable protein phosphatase 2C 3...    203   8e-60   
ref|XP_002989193.1|  hypothetical protein SELMODRAFT_427794             203   8e-60   
ref|XP_006339293.1|  PREDICTED: probable protein phosphatase 2C 3...    203   9e-60   
ref|XP_008369746.1|  PREDICTED: probable protein phosphatase 2C 3...    203   9e-60   
emb|CDP04341.1|  unnamed protein product                                203   9e-60   
ref|XP_008369731.1|  PREDICTED: probable protein phosphatase 2C 3...    203   9e-60   
ref|XP_006345698.1|  PREDICTED: probable protein phosphatase 2C 3...    203   1e-59   
emb|CDM86965.1|  unnamed protein product                                203   1e-59   
ref|XP_002281610.1|  PREDICTED: probable protein phosphatase 2C 3...    202   2e-59   
ref|XP_010658151.1|  PREDICTED: probable protein phosphatase 2C 3...    202   2e-59   
ref|XP_001776511.1|  predicted protein                                  202   3e-59   
ref|XP_010669737.1|  PREDICTED: probable protein phosphatase 2C 3...    202   3e-59   
ref|XP_010669739.1|  PREDICTED: probable protein phosphatase 2C 3...    202   3e-59   
ref|XP_003565195.1|  PREDICTED: probable protein phosphatase 2C 60      202   3e-59   
ref|XP_010260120.1|  PREDICTED: probable protein phosphatase 2C 3...    201   4e-59   
ref|XP_010260119.1|  PREDICTED: probable protein phosphatase 2C 3...    201   4e-59   
dbj|BAJ97329.1|  predicted protein                                      202   4e-59   
gb|KHN37290.1|  Hypothetical protein glysoja_013505                     201   6e-59   
ref|XP_009600192.1|  PREDICTED: probable protein phosphatase 2C 38      201   6e-59   
ref|XP_010086750.1|  putative protein phosphatase 2C 38                 201   7e-59   
ref|XP_009357617.1|  PREDICTED: probable protein phosphatase 2C 3...    203   8e-59   
ref|XP_008384321.1|  PREDICTED: probable protein phosphatase 2C 3...    201   8e-59   
ref|XP_009357616.1|  PREDICTED: probable protein phosphatase 2C 3...    202   9e-59   
gb|ADE76373.1|  unknown                                                 200   1e-58   
ref|XP_008384320.1|  PREDICTED: probable protein phosphatase 2C 3...    201   1e-58   
ref|XP_003536795.1|  PREDICTED: probable protein phosphatase 2C 3...    201   1e-58   
gb|EMS47990.1|  putative protein phosphatase 2C 38                      199   1e-58   
ref|XP_011048438.1|  PREDICTED: probable protein phosphatase 2C 38      200   1e-58   
ref|XP_002878013.1|  serine/threonine protein phosphatase 2C            200   1e-58   
ref|XP_003554346.2|  PREDICTED: probable protein phosphatase 2C 7...    198   2e-58   
ref|XP_008445826.1|  PREDICTED: probable protein phosphatase 2C 3...    200   2e-58   
ref|XP_008445820.1|  PREDICTED: probable protein phosphatase 2C 3...    200   2e-58   
gb|KGN50486.1|  hypothetical protein Csa_5G177060                       200   2e-58   
ref|XP_004143597.1|  PREDICTED: probable protein phosphatase 2C 3...    200   2e-58   
ref|XP_003555636.1|  PREDICTED: probable protein phosphatase 2C 3...    199   3e-58   
gb|KHN27097.1|  Hypothetical protein glysoja_032865                     199   3e-58   
ref|XP_009629674.1|  PREDICTED: probable protein phosphatase 2C 38      199   4e-58   
ref|XP_010312271.1|  PREDICTED: probable protein phosphatase 2C 3...    199   4e-58   
ref|XP_011077015.1|  PREDICTED: probable protein phosphatase 2C 3...    199   4e-58   
ref|XP_007162702.1|  hypothetical protein PHAVU_001G173100g             198   5e-58   
ref|XP_010312270.1|  PREDICTED: probable protein phosphatase 2C 3...    199   5e-58   
ref|XP_011077014.1|  PREDICTED: probable protein phosphatase 2C 3...    199   5e-58   
ref|XP_007207906.1|  hypothetical protein PRUPE_ppa020549mg             198   5e-58   
ref|XP_004246719.1|  PREDICTED: probable protein phosphatase 2C 38      198   5e-58   
ref|XP_008241950.1|  PREDICTED: probable protein phosphatase 2C 48      198   6e-58   
gb|KHG13638.1|  hypothetical protein F383_18928                         199   6e-58   
ref|XP_010101501.1|  putative protein phosphatase 2C 38                 204   7e-58   
ref|XP_001770282.1|  predicted protein                                  198   7e-58   
ref|NP_191065.2|  putative protein phosphatase 2C 48                    198   8e-58   
ref|XP_002990452.1|  hypothetical protein SELMODRAFT_185274             198   9e-58   
ref|XP_002987879.1|  hypothetical protein SELMODRAFT_183449             198   1e-57   
ref|XP_011077398.1|  PREDICTED: probable protein phosphatase 2C 38      198   1e-57   
ref|XP_006604545.1|  PREDICTED: probable protein phosphatase 2C 7...    197   1e-57   
ref|XP_010047084.1|  PREDICTED: probable protein phosphatase 2C 3...    197   1e-57   
emb|CAB82700.1|  protein phosphatase 2C-like protein                    198   1e-57   
ref|XP_010047086.1|  PREDICTED: probable protein phosphatase 2C 3...    197   1e-57   
gb|KHG10577.1|  hypothetical protein F383_13999                         197   1e-57   
gb|KEH42314.1|  serine/threonine phosphatase family, 2C domain pr...    197   2e-57   
ref|XP_009338571.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    198   3e-57   
ref|XP_006292665.1|  hypothetical protein CARUB_v10018907mg             196   3e-57   
ref|XP_008792632.1|  PREDICTED: probable protein phosphatase 2C 3...    196   6e-57   
ref|XP_008792639.1|  PREDICTED: probable protein phosphatase 2C 3...    196   6e-57   
ref|XP_009796582.1|  PREDICTED: probable protein phosphatase 2C 38      196   9e-57   
ref|XP_010920974.1|  PREDICTED: probable protein phosphatase 2C 38      195   1e-56   
ref|XP_008369822.1|  PREDICTED: probable protein phosphatase 2C 38      194   2e-56   
ref|XP_001755777.1|  predicted protein                                  194   2e-56   
ref|XP_010516060.1|  PREDICTED: probable protein phosphatase 2C 48      194   3e-56   
ref|XP_004497440.1|  PREDICTED: probable protein phosphatase 2C 3...    194   3e-56   
emb|CDY29015.1|  BnaC07g32210D                                          193   3e-56   
ref|XP_010504342.1|  PREDICTED: probable protein phosphatase 2C 48      194   3e-56   
ref|XP_010427245.1|  PREDICTED: probable protein phosphatase 2C 48      194   3e-56   
ref|XP_009594017.1|  PREDICTED: probable protein phosphatase 2C 38      194   4e-56   
ref|XP_004302825.1|  PREDICTED: probable protein phosphatase 2C 3...    193   5e-56   
gb|EYU39574.1|  hypothetical protein MIMGU_mgv1a008078mg                193   6e-56   
ref|XP_009801002.1|  PREDICTED: probable protein phosphatase 2C 38      193   7e-56   
ref|XP_009405829.1|  PREDICTED: probable protein phosphatase 2C 38      192   1e-55   
emb|CDY02904.1|  BnaC04g25820D                                          192   1e-55   
emb|CDX76124.1|  BnaA04g03880D                                          191   3e-55   
ref|XP_003521364.1|  PREDICTED: probable protein phosphatase 2C 3...    191   3e-55   
ref|XP_009139203.1|  PREDICTED: probable protein phosphatase 2C 48      191   3e-55   
ref|XP_010534443.1|  PREDICTED: probable protein phosphatase 2C 48      192   4e-55   
ref|XP_008789012.1|  PREDICTED: probable protein phosphatase 2C 3...    191   5e-55   
gb|KHG11455.1|  hypothetical protein F383_16117                         190   8e-55   
ref|XP_001780124.1|  predicted protein                                  190   9e-55   
ref|XP_006841466.1|  hypothetical protein AMTR_s00003p00098390          189   1e-54   
ref|XP_010696499.1|  PREDICTED: probable protein phosphatase 2C 38      189   2e-54   
ref|XP_006403497.1|  hypothetical protein EUTSA_v10010445mg             189   2e-54   
ref|XP_006345807.1|  PREDICTED: probable protein phosphatase 2C 3...    189   2e-54   
gb|KHN48341.1|  Hypothetical protein glysoja_008010                     189   2e-54   
ref|XP_003542486.1|  PREDICTED: probable protein phosphatase 2C 3...    189   2e-54   
ref|XP_007144506.1|  hypothetical protein PHAVU_007G161700g             189   2e-54   
ref|XP_010558929.1|  PREDICTED: probable protein phosphatase 2C 67      189   2e-54   
ref|XP_010543349.1|  PREDICTED: probable protein phosphatase 2C 6...    189   2e-54   
ref|XP_006428945.1|  hypothetical protein CICLE_v10012157mg             187   3e-54   
ref|XP_004239681.1|  PREDICTED: probable protein phosphatase 2C 38      188   4e-54   
ref|XP_001754047.1|  predicted protein                                  188   5e-54   
ref|XP_007027175.1|  Phosphatase 2C family protein                      187   6e-54   
ref|XP_006419368.1|  hypothetical protein CICLE_v10005185mg             187   7e-54   
gb|KFK24725.1|  hypothetical protein AALP_AA8G016500                    187   8e-54   
ref|XP_006419367.1|  hypothetical protein CICLE_v10005185mg             187   8e-54   
gb|KDO47488.1|  hypothetical protein CISIN_1g017598mg                   187   1e-53   
ref|XP_006488833.1|  PREDICTED: probable protein phosphatase 2C 4...    187   1e-53   
ref|XP_006480541.1|  PREDICTED: probable protein phosphatase 2C 3...    187   1e-53   
ref|XP_009787699.1|  PREDICTED: probable protein phosphatase 2C 3...    187   1e-53   
ref|XP_009787701.1|  PREDICTED: probable protein phosphatase 2C 3...    187   1e-53   
ref|XP_003537235.1|  PREDICTED: probable protein phosphatase 2C 3...    186   2e-53   
emb|CAN72598.1|  hypothetical protein VITISV_017615                     186   3e-53   
emb|CDP06683.1|  unnamed protein product                                186   3e-53   
ref|XP_002273100.1|  PREDICTED: probable protein phosphatase 2C 42      186   3e-53   
ref|XP_009616352.1|  PREDICTED: probable protein phosphatase 2C 3...    186   5e-53   
ref|XP_008791697.1|  PREDICTED: probable protein phosphatase 2C 42      185   5e-53   
ref|XP_009404640.1|  PREDICTED: probable protein phosphatase 2C 38      186   5e-53   
ref|XP_009616353.1|  PREDICTED: probable protein phosphatase 2C 3...    186   5e-53   
ref|XP_010556097.1|  PREDICTED: probable protein phosphatase 2C 48      186   6e-53   
ref|XP_008359691.1|  PREDICTED: probable protein phosphatase 2C 38      186   6e-53   
ref|XP_004976602.1|  PREDICTED: probable protein phosphatase 2C 4...    184   1e-52   
ref|XP_004486541.1|  PREDICTED: probable protein phosphatase 2C 4...    184   2e-52   
ref|XP_003625537.1|  Protein phosphatase 2c-like protein                184   2e-52   
ref|XP_008370767.1|  PREDICTED: probable protein phosphatase 2C 42      184   2e-52   
ref|XP_010914585.1|  PREDICTED: probable protein phosphatase 2C 3...    183   2e-52   
ref|XP_007225698.1|  hypothetical protein PRUPE_ppa008679mg             182   2e-52   
ref|XP_010259227.1|  PREDICTED: probable protein phosphatase 2C 4...    183   3e-52   
ref|XP_010914584.1|  PREDICTED: probable protein phosphatase 2C 4...    183   3e-52   
dbj|BAJ33649.1|  unnamed protein product                                181   3e-52   
ref|XP_004295069.1|  PREDICTED: probable protein phosphatase 2C 4...    183   4e-52   
gb|KHN03286.1|  Hypothetical protein glysoja_004312                     181   5e-52   
gb|KDP24626.1|  hypothetical protein JCGZ_25542                         182   6e-52   
emb|CDM81310.1|  unnamed protein product                                182   6e-52   
ref|XP_010267931.1|  PREDICTED: probable protein phosphatase 2C 42      182   7e-52   
ref|XP_002519242.1|  protein phosphatase 2c, putative                   184   8e-52   
ref|XP_009383730.1|  PREDICTED: probable protein phosphatase 2C 42      182   1e-51   
gb|EEC73801.1|  hypothetical protein OsI_08504                          178   1e-51   
ref|XP_006583996.1|  PREDICTED: probable protein phosphatase 2C 4...    182   1e-51   
ref|XP_008361926.1|  PREDICTED: probable protein phosphatase 2C 42      182   1e-51   
ref|XP_009372118.1|  PREDICTED: probable protein phosphatase 2C 42      182   1e-51   
ref|XP_009350528.1|  PREDICTED: probable protein phosphatase 2C 42      182   1e-51   
ref|XP_009336282.1|  PREDICTED: probable protein phosphatase 2C 42      182   1e-51   
gb|KHG17249.1|  hypothetical protein F383_02761                         182   2e-51   
ref|XP_003594721.1|  Pyruvate dehydrogenase phosphatase                 181   2e-51   
emb|CAB86030.1|  protein phosphatase-like protein                       181   2e-51   
ref|NP_195896.2|  putative protein phosphatase 2C 67                    181   2e-51   
gb|KHN12861.1|  Hypothetical protein glysoja_029395                     179   2e-51   
ref|XP_006600378.1|  PREDICTED: probable protein phosphatase 2C 4...    181   3e-51   
ref|XP_006373848.1|  hypothetical protein POPTR_0016s08370g             180   3e-51   
ref|XP_006406770.1|  hypothetical protein EUTSA_v10020928mg             181   4e-51   
emb|CDX75902.1|  BnaC03g39850D                                          181   4e-51   
ref|XP_008223376.1|  PREDICTED: probable protein phosphatase 2C 42      181   4e-51   
ref|XP_010452122.1|  PREDICTED: probable protein phosphatase 2C 67      181   6e-51   
ref|XP_009114322.1|  PREDICTED: probable protein phosphatase 2C 42      180   7e-51   
emb|CDY39026.1|  BnaC01g34900D                                          180   7e-51   
ref|XP_010468222.1|  PREDICTED: probable protein phosphatase 2C 42      178   7e-51   
emb|CDY55405.1|  BnaCnng28720D                                          179   1e-50   
ref|NP_001168308.1|  hypothetical protein                               180   1e-50   
ref|XP_009125460.1|  PREDICTED: probable protein phosphatase 2C 67      179   1e-50   
emb|CDX73413.1|  BnaC08g25900D                                          179   1e-50   
ref|XP_004163926.1|  PREDICTED: probable protein phosphatase 2C 6...    179   1e-50   
ref|XP_006586887.1|  PREDICTED: probable protein phosphatase 2C 4...    179   1e-50   
ref|XP_010937760.1|  PREDICTED: probable protein phosphatase 2C 38      179   1e-50   
ref|XP_002870988.1|  phosphatase 2C family protein                      179   1e-50   
ref|XP_009413067.1|  PREDICTED: probable protein phosphatase 2C 25      179   2e-50   
ref|XP_008443053.1|  PREDICTED: probable protein phosphatase 2C 68      179   2e-50   
ref|XP_004981161.1|  PREDICTED: probable protein phosphatase 2C 3...    179   2e-50   
ref|XP_010487580.1|  PREDICTED: probable protein phosphatase 2C 42      179   2e-50   
emb|CDX80837.1|  BnaC03g00910D                                          178   2e-50   
gb|KHG10813.1|  hypothetical protein F383_12861                         179   2e-50   
ref|XP_002883042.1|  phosphatase 2C family protein                      179   2e-50   
ref|XP_010490738.1|  PREDICTED: probable protein phosphatase 2C 67      178   2e-50   
ref|NP_001047766.1|  Os02g0685600                                       178   3e-50   
ref|XP_006597694.1|  PREDICTED: probable protein phosphatase 2C 4...    178   3e-50   
ref|XP_010504959.1|  PREDICTED: probable protein phosphatase 2C 42      178   4e-50   
ref|XP_007154392.1|  hypothetical protein PHAVU_003G115500g             178   4e-50   
ref|XP_011019816.1|  PREDICTED: probable protein phosphatase 2C 42      178   4e-50   
ref|NP_566566.1|  putative protein phosphatase 2C 42                    178   5e-50   
ref|XP_011010586.1|  PREDICTED: probable protein phosphatase 2C 4...    177   5e-50   
ref|XP_011010579.1|  PREDICTED: probable protein phosphatase 2C 4...    177   5e-50   
ref|XP_009122756.1|  PREDICTED: probable protein phosphatase 2C 67      177   6e-50   
gb|AAM61747.1|  protein phosphatase-2c, putative                        177   6e-50   
ref|XP_009116204.1|  PREDICTED: probable protein phosphatase 2C 48      177   6e-50   
ref|XP_011010593.1|  PREDICTED: probable protein phosphatase 2C 4...    177   6e-50   
ref|XP_008789013.1|  PREDICTED: probable protein phosphatase 2C 3...    177   6e-50   
gb|KHG07073.1|  hypothetical protein F383_01352                         177   6e-50   
emb|CDX70348.1|  BnaA10g26970D                                          177   7e-50   
dbj|BAA94987.1|  protein phosphatase 2C-like protein                    177   7e-50   
emb|CDY51441.1|  BnaA09g54860D                                          177   7e-50   
ref|XP_006398730.1|  hypothetical protein EUTSA_v10013867mg             177   9e-50   
ref|XP_007147370.1|  hypothetical protein PHAVU_006G118600g             177   1e-49   
emb|CDY11224.1|  BnaA03g00600D                                          176   1e-49   
ref|XP_004953479.1|  PREDICTED: probable protein phosphatase 2C 2...    177   1e-49   
gb|KFK39044.1|  hypothetical protein AALP_AA3G193600                    176   1e-49   
ref|XP_009130744.1|  PREDICTED: probable protein phosphatase 2C 67      176   2e-49   
ref|XP_010065305.1|  PREDICTED: probable protein phosphatase 2C 42      176   2e-49   
ref|XP_003580396.1|  PREDICTED: probable protein phosphatase 2C 4...    176   2e-49   
ref|XP_006297885.1|  hypothetical protein CARUB_v10013927mg             176   2e-49   
dbj|BAK08337.1|  predicted protein                                      184   2e-49   
ref|XP_002448397.1|  hypothetical protein SORBIDRAFT_06g026510          176   2e-49   
ref|XP_010555215.1|  PREDICTED: probable protein phosphatase 2C 64      176   2e-49   
gb|KHN02618.1|  Hypothetical protein glysoja_041050                     175   3e-49   
emb|CDY10428.1|  BnaCnng03290D                                          175   3e-49   
ref|XP_010058117.1|  PREDICTED: probable protein phosphatase 2C 25      176   4e-49   
ref|NP_001051801.1|  Os03g0832400                                       175   4e-49   
gb|EPS67232.1|  hypothetical protein M569_07544                         172   5e-49   
ref|NP_001149723.1|  LOC100283350                                       175   5e-49   
ref|XP_009632067.1|  PREDICTED: probable protein phosphatase 2C 4...    174   7e-49   
ref|XP_006650849.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    175   7e-49   
ref|XP_009632066.1|  PREDICTED: probable protein phosphatase 2C 4...    174   8e-49   
ref|XP_010524586.1|  PREDICTED: probable protein phosphatase 2C 42      174   8e-49   
ref|XP_007145687.1|  hypothetical protein PHAVU_007G259900g             174   8e-49   
emb|CDY04862.1|  BnaAnng00440D                                          174   9e-49   
ref|XP_008240930.1|  PREDICTED: probable protein phosphatase 2C 68      174   1e-48   
ref|XP_002314955.2|  hypothetical protein POPTR_0010s15660g             174   1e-48   
ref|XP_002463581.1|  hypothetical protein SORBIDRAFT_01g002450          174   1e-48   
ref|XP_002312324.2|  phosphatase 2C family protein                      174   1e-48   
ref|XP_002527483.1|  protein phosphatase 2c, putative                   174   2e-48   
gb|KHG27346.1|  hypothetical protein F383_11047                         174   2e-48   
ref|XP_006652698.1|  PREDICTED: probable protein phosphatase 2C 4...    174   2e-48   
ref|XP_002279599.1|  PREDICTED: probable protein phosphatase 2C 25      174   2e-48   
ref|XP_010265917.1|  PREDICTED: probable protein phosphatase 2C 43      174   2e-48   
gb|KDP44463.1|  hypothetical protein JCGZ_16296                         173   2e-48   
ref|XP_006855631.1|  hypothetical protein AMTR_s00044p00096750          174   2e-48   
gb|AFK36280.1|  unknown                                                 167   2e-48   
ref|XP_002530709.1|  protein phosphatase 2c, putative                   173   3e-48   
ref|XP_007028992.1|  Phosphatase 2C family protein                      173   3e-48   
sp|Q7XUC5.2|P2C43_ORYSJ  RecName: Full=Probable protein phosphata...    173   3e-48   
ref|XP_007202037.1|  hypothetical protein PRUPE_ppa007128mg             173   3e-48   
emb|CDY14069.1|  BnaC02g01860D                                          173   3e-48   



>ref|XP_008457720.1| PREDICTED: probable protein phosphatase 2C 60 [Cucumis melo]
 ref|XP_008457721.1| PREDICTED: probable protein phosphatase 2C 60 [Cucumis melo]
 ref|XP_008457722.1| PREDICTED: probable protein phosphatase 2C 60 [Cucumis melo]
Length=397

 Score =   266 bits (679),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 140/156 (90%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+AEFNREPLYAKFRLREP KKPILS++PSISVLQLQ  DQF+IFASDGLWEHLS
Sbjct  235  GDVYLKRAEFNREPLYAKFRLREPIKKPILSAEPSISVLQLQPQDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRNGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL       K ASLSV+GG +NLR N+LAPC T
Sbjct  355  LDSNLVSRASSTKCASLSVRGGGVNLRPNSLAPCTT  390



>ref|XP_004147052.1| PREDICTED: probable protein phosphatase 2C 60-like [Cucumis sativus]
 gb|KGN61946.1| hypothetical protein Csa_2G271380 [Cucumis sativus]
Length=397

 Score =   265 bits (678),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 140/156 (90%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+AEFNREPLYAKFRLREP KKPILS++PSISVLQLQ  DQF+IFASDGLWEHLS
Sbjct  235  GDVYLKRAEFNREPLYAKFRLREPIKKPILSAEPSISVLQLQPQDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRNGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL       K ASLSV+GG +NLR N+LAPC T
Sbjct  355  LDSNLVSRASSTKCASLSVRGGGVNLRPNSLAPCTT  390



>emb|CDP14549.1| unnamed protein product [Coffea canephora]
Length=392

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 142/155 (92%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPF++PILSS+PSISV QLQSHDQF+IFASDGLWEHLS
Sbjct  230  GDVYLKKAEFNREPLYAKFRLREPFRRPILSSEPSISVQQLQSHDQFIIFASDGLWEHLS  289

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  290  NQEAVDIVQNHPRNGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  349

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCA  454
            L+S+L      VK+ +LSVKGG +NL  NTLAPCA
Sbjct  350  LDSHLVSRASSVKIPNLSVKGGGVNLPLNTLAPCA  384



>ref|XP_007041771.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOX97602.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
Length=397

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 140/156 (90%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREPFKKPILS+DPSISV QLQ HDQFVIFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYPKFRLREPFKKPILSADPSISVHQLQPHDQFVIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPR+GIARRLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRSGIARRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSN----LGPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SN       VK  +LSV+GG +NL  NTLAPC T
Sbjct  355  LDSNHVSGASSVKAPNLSVRGGGVNLPPNTLAPCTT  390



>ref|XP_007041772.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
 gb|EOX97603.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
Length=397

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/156 (83%), Positives = 140/156 (90%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREPFKKPILS+DPSISV QLQ HDQFVIFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYPKFRLREPFKKPILSADPSISVHQLQPHDQFVIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPR+GIARRLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRSGIARRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSN----LGPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SN       VK  +LSV+GG +NL  NTLAPC T
Sbjct  355  LDSNHVSGASSVKAPNLSVRGGGVNLPPNTLAPCTT  390



>ref|XP_004169425.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 60-like [Cucumis sativus]
Length=397

 Score =   263 bits (673),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 139/156 (89%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+AEFNREPLYAKFRLREP KKPILS++PSISVLQLQ  DQF+IFASDGLWEHLS
Sbjct  235  GDVYLKRAEFNREPLYAKFRLREPIKKPILSAEPSISVLQLQPQDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+V +
Sbjct  295  NQEAVDIVQNHPRNGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVXF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL       K ASLSV+GG +NLR N+LAPC T
Sbjct  355  LDSNLVSRASSTKCASLSVRGGGVNLRPNSLAPCTT  390



>gb|KDP23958.1| hypothetical protein JCGZ_25346 [Jatropha curcas]
Length=394

 Score =   263 bits (672),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 141/156 (90%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPFKKPILSS+PSIS+L+LQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLREPFKKPILSSEPSISMLELQPHDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ+HPRNGIARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQDAVDIVQNHPRNGIARRLVKVALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      VK  S SV+GG ++L   TLAPCAT
Sbjct  355  LDSNLVSRASSVKGPSTSVRGGGISLPAKTLAPCAT  390



>ref|XP_003624259.1| Protein phosphatase 2C (PP2C) [Medicago truncatula]
 gb|AES80477.1| protein phosphatase 2C family protein [Medicago truncatula]
Length=387

 Score =   261 bits (668),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 140/156 (90%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPLYAKFRLREPFK PILSS+PSIS  QLQ HDQF+IFASDGLWEHLS
Sbjct  230  GDVYLKKTEFNREPLYAKFRLREPFKMPILSSEPSISTYQLQPHDQFIIFASDGLWEHLS  289

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ++PR+GIARRLVK+AL+EAAKKREMRYSDLK IDRGVRRHFHDDITV+VV+
Sbjct  290  NQEAVDIVQNNPRSGIARRLVKSALQEAAKKREMRYSDLKNIDRGVRRHFHDDITVIVVF  349

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            ++SNL      VK +S+SV+GG +NLR NTLAPC T
Sbjct  350  IDSNLVSRASNVKFSSISVRGGGVNLRPNTLAPCTT  385



>ref|XP_007046602.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 ref|XP_007046603.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOX90759.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOX90760.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
Length=397

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 139/156 (89%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREPFKKPILSS+PSISV +LQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYQKFRLREPFKKPILSSEPSISVHELQPHDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ+HPRNG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY
Sbjct  295  NQDAVDIVQNHPRNGTARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      VK  SLS++GG +NL   TLAPCAT
Sbjct  355  LDSNLVSKASSVKGPSLSLRGGGVNLPAKTLAPCAT  390



>ref|XP_010029636.1| PREDICTED: probable protein phosphatase 2C 60 [Eucalyptus grandis]
 gb|KCW56582.1| hypothetical protein EUGRSUZ_I02310 [Eucalyptus grandis]
 gb|KCW56583.1| hypothetical protein EUGRSUZ_I02310 [Eucalyptus grandis]
Length=394

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 141/156 (90%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPF+KPILSSDPSISV +LQ HDQFVIFASDGLWEHL+
Sbjct  235  GDVYLKKAEFNREPLYAKFRLREPFRKPILSSDPSISVHELQPHDQFVIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVD+VQ+HPRNGIARRLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQDAVDMVQNHPRNGIARRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL       K  ++S++GG +NL   TLAPCAT
Sbjct  355  LDSNLVSRASSTKGPTVSLRGGGINLSVKTLAPCAT  390



>emb|CAB90634.1| protein phosphatase 2C (PP2C) [Fagus sylvatica]
Length=397

 Score =   261 bits (667),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 139/156 (89%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPFKKPILS+DP+ISV QLQ HDQFVIFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLREPFKKPILSADPAISVHQLQPHDQFVIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPR+G  RRL+K AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRSGSVRRLIKVALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      VK  S+SV+GG +NL HNTLAP  T
Sbjct  355  LDSNLVSRASSVKCPSISVRGGGINLPHNTLAPYTT  390



>ref|XP_002521272.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF41128.1| protein phosphatase 2c, putative [Ricinus communis]
Length=397

 Score =   261 bits (667),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 140/156 (90%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLRE FKKPILS+DPSISV QLQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLRESFKKPILSADPSISVHQLQPHDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ+HPRNG A+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQDAVDIVQNHPRNGSAKRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      VK A++SV+GG ++L  NTLAPC T
Sbjct  355  LDSNLVSRASSVKCANISVRGGGISLPSNTLAPCTT  390



>ref|XP_011046655.1| PREDICTED: probable protein phosphatase 2C 64 [Populus euphratica]
 ref|XP_011046656.1| PREDICTED: probable protein phosphatase 2C 64 [Populus euphratica]
Length=397

 Score =   261 bits (666),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 141/158 (89%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPFK PILS++PSISV QLQ+HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLREPFKNPILSAEPSISVHQLQAHDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HP NG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPHNGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+SNL      VK +++SV+GG ++L  NTLAPC T A
Sbjct  355  LDSNLVSRASSVKCSNISVRGGGISLPPNTLAPCTTPA  392



>ref|XP_007041776.1| Phosphatase 2C family protein [Theobroma cacao]
 gb|EOX97607.1| Phosphatase 2C family protein [Theobroma cacao]
Length=397

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 138/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREP KKPILS+DPSISV QLQ HDQFVIFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYPKFRLREPLKKPILSADPSISVHQLQPHDQFVIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPR+GIARRLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRSGIARRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSN----LGPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SN       VK  +LSV+GG +NL  N LAPC T
Sbjct  355  LDSNHVSRASSVKAPNLSVRGGGVNLPPNILAPCTT  390



>ref|XP_002313699.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|ABK94829.1| unknown [Populus trichocarpa]
 gb|EEE87654.1| phosphatase 2C family protein [Populus trichocarpa]
Length=397

 Score =   260 bits (664),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 140/156 (90%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPFKKPILSS+PSISV QLQ HDQFVIFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLREPFKKPILSSEPSISVHQLQPHDQFVIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRNGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSN----LGPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SN    +  VK +++SV+G  ++L  NTLAPC T
Sbjct  355  LDSNFVSRVSSVKCSNISVRGAGVSLPPNTLAPCTT  390



>gb|KDP33299.1| hypothetical protein JCGZ_13086 [Jatropha curcas]
Length=397

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 140/156 (90%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREPFKKPILS++PSIS+ QLQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYTKFRLREPFKKPILSAEPSISMHQLQPHDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQHHPR+G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+V++
Sbjct  295  NQEAVDIVQHHPRSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVLF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      VK +++SV+GG +++  NTLAPC T
Sbjct  355  LDSNLVSRASSVKCSNISVRGGGISIPSNTLAPCTT  390



>ref|XP_002305529.1| hypothetical protein POPTR_0004s18340g [Populus trichocarpa]
 gb|EEE86040.1| hypothetical protein POPTR_0004s18340g [Populus trichocarpa]
Length=397

 Score =   259 bits (662),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 139/156 (89%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPFK PILSS+PSIS  QLQ+HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLREPFKNPILSSEPSISAHQLQAHDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HP NG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPHNGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      VK +++SV+GG ++L  NTLAPC T
Sbjct  355  LDSNLVSRASSVKCSNISVRGGGISLPPNTLAPCTT  390



>ref|XP_010266045.1| PREDICTED: probable protein phosphatase 2C 60 [Nelumbo nucifera]
 ref|XP_010266046.1| PREDICTED: probable protein phosphatase 2C 60 [Nelumbo nucifera]
Length=397

 Score =   259 bits (662),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 141/156 (90%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY+KFRLREPF++PILSS+PSISV QLQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYSKFRLREPFRRPILSSEPSISVHQLQPHDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV+IVQ+HPR+G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVNIVQNHPRSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      VK  +LSV+GG +NL  NTLAPCAT
Sbjct  355  LDSNLVSRASTVKGPTLSVRGGGINLPANTLAPCAT  390



>gb|KHG27171.1| hypothetical protein F383_05187 [Gossypium arboreum]
Length=392

 Score =   259 bits (661),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY +FRLREPFKKPILS+DPSI+V QLQ HDQFVIFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYPRFRLREPFKKPILSADPSITVHQLQPHDQFVIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+H R+GIARRLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHSRSGIARRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            LNSNL      VK  +LSV+GG + L   TLAPCA  A
Sbjct  355  LNSNLVSKASSVKGPNLSVRGGGVTLPPRTLAPCAMPA  392



>ref|XP_011045811.1| PREDICTED: probable protein phosphatase 2C 64 [Populus euphratica]
Length=397

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 138/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREPFKKPILSS+PSISV QLQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYTKFRLREPFKKPILSSEPSISVHQLQPHDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRNGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SN       VK +++SV+G  ++L  NTLAPC T
Sbjct  355  LDSNFLSRASSVKCSNVSVRGAGVSLPPNTLAPCTT  390



>ref|XP_003536720.1| PREDICTED: probable protein phosphatase 2C 64-like [Glycine max]
 gb|KHN37390.1| Hypothetical protein glysoja_013605 [Glycine soja]
Length=397

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREP+K PILSS+PSISV  LQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLREPYKMPILSSEPSISVHHLQPHDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+ PR+G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDD TV+VVY
Sbjct  295  NQEAVDIVQNSPRSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDTTVIVVY  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      VK   +SV+GG +NL HNTLAPC T
Sbjct  355  LDSNLVSRASTVKFPGISVRGGGINLPHNTLAPCTT  390



>ref|XP_003555860.1| PREDICTED: probable protein phosphatase 2C 64-like isoform X1 
[Glycine max]
 ref|XP_006605858.1| PREDICTED: probable protein phosphatase 2C 64-like isoform X2 
[Glycine max]
Length=397

 Score =   258 bits (658),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREP+K PILSS+PSISV  LQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLREPYKMPILSSEPSISVHHLQPHDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+ PR+G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDD TV+VVY
Sbjct  295  NQEAVDIVQNSPRSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDTTVIVVY  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      VK   +SV+GG +NL HNTLAPC T
Sbjct  355  LDSNLVSRESTVKFPGISVRGGGINLPHNTLAPCTT  390



>gb|KHN11497.1| Hypothetical protein glysoja_015392 [Glycine soja]
Length=397

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREP+K PILSS+PSISV  LQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLREPYKMPILSSEPSISVHHLQPHDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+ PR+G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDD TV+VVY
Sbjct  295  NQEAVDIVQNSPRSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDTTVIVVY  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      VK   +SV+GG +NL HNTLAPC T
Sbjct  355  LDSNLVSRASTVKFPGISVRGGGINLPHNTLAPCTT  390



>gb|AGF33285.1| protein phosphatase 2C, partial [Quercus ilex]
Length=234

 Score =   251 bits (642),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 138/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPL+AKFRLREPFKKPILS++P+IS+ QLQ HDQF+IFASDGLWEHL+
Sbjct  74   GDVYLKKAEFNREPLFAKFRLREPFKKPILSAEPTISMHQLQPHDQFIIFASDGLWEHLT  133

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ+HP +G ARRL+K AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  134  NQEAVDMVQNHPHSGSARRLIKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  193

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      VK  S+SVKGG +NL H TLAP  T
Sbjct  194  LDSNLVSRASSVKSPSISVKGGGINLPHYTLAPYTT  229



>ref|XP_011022262.1| PREDICTED: probable protein phosphatase 2C 46 [Populus euphratica]
Length=397

 Score =   255 bits (652),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 138/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNR PLYAKFRLREPFK+PILSS+PSISV +LQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNRAPLYAKFRLREPFKRPILSSEPSISVHELQPHDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRL+K AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV VV+
Sbjct  295  NQEAVDIVQNHPRNGIARRLIKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVAVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L++NL      VK  S+SV+GG ++L   TL PCAT
Sbjct  355  LDANLVSRASTVKGPSVSVRGGGIHLPAKTLVPCAT  390



>ref|XP_006383046.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|ABK95130.1| unknown [Populus trichocarpa]
 gb|ERP60843.1| phosphatase 2C family protein [Populus trichocarpa]
Length=397

 Score =   255 bits (652),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 138/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNR PLYAKFRLREPFK+PILSS+PSISV +LQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNRAPLYAKFRLREPFKRPILSSEPSISVHELQPHDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRL+K AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV VV+
Sbjct  295  NQEAVDIVQNHPRNGIARRLIKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVAVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L++NL      VK  S+SV+GG ++L   TL PCAT
Sbjct  355  LDANLVSRASTVKGPSVSVRGGGIHLPAKTLVPCAT  390



>gb|KHG28703.1| hypothetical protein F383_13791 [Gossypium arboreum]
Length=397

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 138/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFN EPLY+KFRLREP K+PILS+DPSISV QLQ HDQFVIFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNSEPLYSKFRLREPLKRPILSADPSISVHQLQPHDQFVIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPR+G ARRLVKTAL+EAA KREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRSGSARRLVKTALKEAANKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      VK  +LSVK G ++LR N LAPCAT
Sbjct  355  LDSNLMSGASSVKGPNLSVKRGGVSLRPNILAPCAT  390



>ref|XP_007142806.1| hypothetical protein PHAVU_007G018300g [Phaseolus vulgaris]
 gb|ESW14800.1| hypothetical protein PHAVU_007G018300g [Phaseolus vulgaris]
Length=397

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 135/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLR+PFK PILSS+PSISV  LQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLRQPFKMPILSSEPSISVHHLQPHDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+ PR+G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDD TVVVVY
Sbjct  295  NQEAVDIVQNSPRSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDTTVVVVY  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL       K   +SV+GG ++L HNTLAPC T
Sbjct  355  LDSNLVSRASTAKFPGISVRGGGISLPHNTLAPCTT  390



>ref|XP_004492898.1| PREDICTED: probable protein phosphatase 2C 60-like isoform X1 
[Cicer arietinum]
 ref|XP_004492899.1| PREDICTED: probable protein phosphatase 2C 60-like isoform X2 
[Cicer arietinum]
Length=391

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/157 (78%), Positives = 139/157 (89%), Gaps = 4/157 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLR+PFK PILSS+PSISV QLQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLRQPFKMPILSSEPSISVHQLQPHDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIV+ +PR+GIARRLVK AL+EAA+KREMRYSDLK IDRGVRRHFHDDITV+VV+
Sbjct  295  NQDAVDIVKKNPRSGIARRLVKAALQEAAEKREMRYSDLKNIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATA  460
            + SNL      VK+ S+SV+GG +NLR NTLAPC+  
Sbjct  355  IESNLVSRASNVKLTSISVRGGGVNLRPNTLAPCSAT  391



>ref|XP_009340482.1| PREDICTED: probable protein phosphatase 2C 60 [Pyrus x bretschneideri]
Length=397

 Score =   254 bits (649),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 141/158 (89%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY+KFRLR+P K+PILS+DP+ISV+QLQ HDQF+IFASDGLWEHL+
Sbjct  235  GDVYLKKAEFNREPLYSKFRLRDPIKRPILSADPAISVIQLQPHDQFIIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ +PR+G A+RLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQKYPRSGSAKRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+SNL      VK  +LSV+GG +NL  NTLAP AT A
Sbjct  355  LDSNLVSKASSVKGPNLSVRGGGINLPPNTLAPYATTA  392



>ref|XP_009590077.1| PREDICTED: probable protein phosphatase 2C 46 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009590078.1| PREDICTED: probable protein phosphatase 2C 46 isoform X1 [Nicotiana 
tomentosiformis]
Length=392

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPF +PILS+DP ISV  LQS D FVIFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLREPFSRPILSADPEISVHHLQSQDLFVIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  295  NQEAVDIVQNHPRNGIAKRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SN+      VK  ++SVKGG + L  NTLAPC T
Sbjct  355  LDSNVVSRASSVKSPNVSVKGGGITLPPNTLAPCTT  390



>ref|XP_006422534.1| hypothetical protein CICLE_v10028600mg [Citrus clementina]
 gb|ESR35774.1| hypothetical protein CICLE_v10028600mg [Citrus clementina]
Length=397

 Score =   253 bits (647),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 137/155 (88%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREP K+PILS+DPSISV QLQ HDQFVIFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYIKFRLREPIKRPILSADPSISVHQLQPHDQFVIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HP++G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPQSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCA  454
            L+S+L      VK  ++SV+GG + L HNTLAPC 
Sbjct  355  LDSSLVSRASSVKSPNVSVRGGGITLPHNTLAPCT  389



>emb|CAN64313.1| hypothetical protein VITISV_023164 [Vitis vinifera]
Length=384

 Score =   253 bits (646),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPL AKFRLREPF+ PILSSDP+ISV  LQ HDQFVIFASDGLWEHLS
Sbjct  222  GDVYLKKAEFNREPLIAKFRLREPFRMPILSSDPAISVHPLQPHDQFVIFASDGLWEHLS  281

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ HPRNG A+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  282  NQEAVDIVQSHPRNGSAKRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  341

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      VK +++SV+GG +NL  NTLAP AT
Sbjct  342  LDSNLVSRASSVKCSNISVRGGGINLPANTLAPFAT  377



>ref|XP_006486691.1| PREDICTED: probable protein phosphatase 2C 60-like [Citrus sinensis]
Length=397

 Score =   253 bits (647),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 137/155 (88%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREP K+PILS+DPSISV QLQ HDQFVIFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYIKFRLREPIKRPILSADPSISVHQLQPHDQFVIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HP++G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPQSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCA  454
            L+S+L      VK  ++SV+GG + L HNTLAPC 
Sbjct  355  LDSSLVSRASSVKSPNVSVRGGGITLPHNTLAPCT  389



>gb|KDO68174.1| hypothetical protein CISIN_1g015823mg [Citrus sinensis]
 gb|KDO68175.1| hypothetical protein CISIN_1g015823mg [Citrus sinensis]
Length=399

 Score =   253 bits (647),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 137/155 (88%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREP K+PILS+DPSISV QLQ HDQFVIFASDGLWEHLS
Sbjct  237  GDVYLKKAEFNREPLYIKFRLREPIKRPILSADPSISVHQLQPHDQFVIFASDGLWEHLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HP++G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  297  NQEAVDIVQNHPQSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  356

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCA  454
            L+S+L      VK  ++SV+GG + L HNTLAPC 
Sbjct  357  LDSSLVSRASSVKSPNVSVRGGGITLPHNTLAPCT  391



>ref|XP_002530628.1| protein phosphatase 2c, putative [Ricinus communis]
 gb|EEF31736.1| protein phosphatase 2c, putative [Ricinus communis]
Length=395

 Score =   253 bits (646),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPFKKPILSS+PSISV +LQ HDQF+I+ASDGLWEHL+
Sbjct  235  GDVYLKKAEFNREPLYAKFRLREPFKKPILSSEPSISVHELQPHDQFLIYASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVK AL+EAAKKREMRYSDLKKI+RGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRNGIARRLVKAALQEAAKKREMRYSDLKKIERGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL       K  S SV+GG ++L   TLAPC  
Sbjct  355  LDSNLVSRASTAKGPSTSVRGGGVHLPAKTLAPCGA  390



>ref|XP_002279993.1| PREDICTED: probable protein phosphatase 2C 60 [Vitis vinifera]
 ref|XP_003631567.1| PREDICTED: probable protein phosphatase 2C 60 [Vitis vinifera]
 emb|CBI37846.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   253 bits (646),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPL AKFRLREPF+ PILSSDP+ISV  LQ HDQFVIFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLIAKFRLREPFRMPILSSDPAISVHPLQPHDQFVIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ HPRNG A+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQSHPRNGSAKRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      VK +++SV+GG +NL  NTLAP AT
Sbjct  355  LDSNLVSRASSVKCSNISVRGGGINLPANTLAPFAT  390



>ref|XP_009355640.1| PREDICTED: probable protein phosphatase 2C 60 [Pyrus x bretschneideri]
Length=397

 Score =   253 bits (645),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPL++KFRLR+P K+PILS+DP+IS +QLQ HDQF+IFASDGLWEHL+
Sbjct  235  GDVYLKKAEFNREPLFSKFRLRDPIKRPILSADPAISAIQLQPHDQFIIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ HPRNG A+RL+KTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQKHPRNGSAKRLIKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+SNL      VK  +LSV+GG +NL  NTLAP AT  
Sbjct  355  LDSNLVSKASSVKGPNLSVRGGGINLPPNTLAPYATTT  392



>ref|XP_004290738.1| PREDICTED: probable protein phosphatase 2C 28-like [Fragaria 
vesca subsp. vesca]
Length=395

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 136/155 (88%), Gaps = 1/155 (1%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFNREPLYAKFRLR+P K+PILS+DP+ISVLQLQ HDQF+IFASDGLWEHLS
Sbjct  235  GDFYLKKAEFNREPLYAKFRLRDPIKRPILSADPAISVLQLQPHDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNG A+RLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRNGSAKRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL-GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+SNL         SV+GG ++L  NTLAP  T A
Sbjct  355  LDSNLVSKATSVKCSVRGGGISLPPNTLAPYTTTA  389



>ref|XP_008377721.1| PREDICTED: probable protein phosphatase 2C 60 [Malus domestica]
Length=397

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 139/158 (88%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPL++KFRLR+P K+PILS+DP+IS +QLQ HDQF+IFASDGLWEHL+
Sbjct  235  GDVYLKKAEFNREPLFSKFRLRDPIKRPILSADPAISEIQLQPHDQFIIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ HPRNG A+RL+KTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQKHPRNGSAKRLIKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+SNL      VK  +LSV+GG +NL  NTLAP AT  
Sbjct  355  LDSNLVSKASSVKCPNLSVRGGGINLPPNTLAPYATTT  392



>gb|KHG25255.1| hypothetical protein F383_08950 [Gossypium arboreum]
Length=397

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 138/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREPF+KPILS+DPSIS+ +LQ HDQFVIFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYPKFRLREPFRKPILSADPSISMHELQPHDQFVIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV+IVQ+HPR+G A+RLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVNIVQNHPRSGSAKRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL       K  +LS++GG +N   N LAPCAT
Sbjct  355  LDSNLMSRASSAKGPNLSIRGGGVNFPPNILAPCAT  390



>ref|XP_009791771.1| PREDICTED: probable protein phosphatase 2C 46 [Nicotiana sylvestris]
 ref|XP_009791772.1| PREDICTED: probable protein phosphatase 2C 46 [Nicotiana sylvestris]
Length=392

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREPF +PILS+DP+ISV  LQS D FVIFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYDKFRLREPFSRPILSADPAISVHHLQSQDLFVIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  295  NQEAVDIVQNHPRNGIAKRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SN+      VK  ++SVKGG + L  NTLAPC T
Sbjct  355  LDSNVVSRASSVKSPNVSVKGGGITLPPNTLAPCTT  390



>ref|XP_010266882.1| PREDICTED: probable protein phosphatase 2C 60 [Nelumbo nucifera]
 ref|XP_010266883.1| PREDICTED: probable protein phosphatase 2C 60 [Nelumbo nucifera]
Length=397

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPL AKFRLREPFK+PILSS+PSI V  LQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLLAKFRLREPFKRPILSSEPSILVHPLQPHDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDD TV+VV+
Sbjct  295  NQEAVDIVQNHPRNGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDTTVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      VK  +LS++GG ++L  NTLAPCAT
Sbjct  355  LDSNLVSRASTVKGPTLSIRGGGISLPANTLAPCAT  390



>ref|XP_006380555.1| hypothetical protein POPTR_0007s09220g [Populus trichocarpa]
 ref|XP_006380556.1| hypothetical protein POPTR_0007s09220g [Populus trichocarpa]
 gb|ERP58352.1| hypothetical protein POPTR_0007s09220g [Populus trichocarpa]
 gb|ERP58353.1| hypothetical protein POPTR_0007s09220g [Populus trichocarpa]
Length=397

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 138/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRL EPFK+PILSSDPSISV +LQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLHEPFKRPILSSDPSISVHRLQPHDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HP +GIARRL+K AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV VV+
Sbjct  295  NQEAVDIVQNHPHSGIARRLIKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVAVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L++NL      VK  S+SV+GG ++L   TLAPCA+
Sbjct  355  LDANLLSRASTVKGPSVSVRGGGIHLPAKTLAPCAS  390



>ref|XP_007201072.1| hypothetical protein PRUPE_ppa006747mg [Prunus persica]
 ref|XP_008236049.1| PREDICTED: probable protein phosphatase 2C 60 [Prunus mume]
 gb|EMJ02271.1| hypothetical protein PRUPE_ppa006747mg [Prunus persica]
Length=397

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 140/158 (89%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY+KFRLR+P K+PILS+DP+IS +QLQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYSKFRLRDPIKRPILSADPAISAIQLQPHDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPR+G A+RLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRSGSAKRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+SNL       K  ++SV+GG +NL  N+LAP ATA 
Sbjct  355  LDSNLVSKATSGKCPNISVRGGGINLPPNSLAPYATAT  392



>ref|XP_010086827.1| putative protein phosphatase 2C 60 [Morus notabilis]
 gb|EXB24025.1| putative protein phosphatase 2C 60 [Morus notabilis]
Length=397

 Score =   250 bits (639),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPFK+PILSS+PSI+V QLQ  DQF+I+ASDGLWEHL 
Sbjct  235  GDVYLKKAEFNREPLYAKFRLREPFKRPILSSEPSITVHQLQPVDQFIIYASDGLWEHLD  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPR+G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSN----LGPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SN        K  ++SV+GG +NL  NTLAPC T
Sbjct  355  LDSNHVSRASSAKFPNISVRGGGINLPPNTLAPCGT  390



>emb|CBI28366.3| unnamed protein product [Vitis vinifera]
Length=257

 Score =   245 bits (626),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREP K+PILS++PSISVL+LQ +DQF+IFASDGLWEHL 
Sbjct  95   GDVYLKKAEFNREPLYVKFRLREPLKRPILSAEPSISVLELQPNDQFLIFASDGLWEHLK  154

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            N+EAVDIVQ+HPRNG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  155  NEEAVDIVQNHPRNGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  214

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      V+  + S++G  +NL   +LAPCAT
Sbjct  215  LDSNLVSRASSVRGPTASIRGDGVNLPAKSLAPCAT  250



>ref|XP_010941349.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Elaeis 
guineensis]
 ref|XP_010941350.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Elaeis 
guineensis]
Length=397

 Score =   249 bits (635),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPFKKPILSS+PSISV  LQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLREPFKKPILSSEPSISVQPLQPHDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV ++P +G ARRLVK AL EAA+KREMRYSDLKKIDRG+RRHFHDDITV+VV+
Sbjct  295  NQEAVDIVHNNPCSGSARRLVKAALHEAARKREMRYSDLKKIDRGIRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL       K  SLSV+GG +NL  N+LAPCAT
Sbjct  355  LDSNLVSRASSHKGPSLSVRGGGINLPANSLAPCAT  390



>ref|XP_010548248.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
 ref|XP_010548249.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
 ref|XP_010548250.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
 ref|XP_010548251.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
 ref|XP_010548252.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
Length=392

 Score =   248 bits (633),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 138/158 (87%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPFK+ ILSS+PSISV ++Q  DQFVIFASDGLWEHLS
Sbjct  232  GDVYLKKAEFNREPLYAKFRLREPFKRQILSSEPSISVHEIQPQDQFVIFASDGLWEHLS  291

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVKTAL EAAKKREMRYSDLKKI+RGVRRHFHDDITV VV+
Sbjct  292  NQEAVDIVQNHPRNGIARRLVKTALHEAAKKREMRYSDLKKIERGVRRHFHDDITVAVVF  351

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+SNL      VK  SLS++GG +++   TLAP  T++
Sbjct  352  LDSNLVSRGSSVKGPSLSLRGGGVHIPSRTLAPTETSS  389



>ref|XP_004497192.1| PREDICTED: probable protein phosphatase 2C 60-like [Cicer arietinum]
Length=398

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFR+ EP K+P+LSS+PSI V QLQ HDQF+IFASDGLWEH +
Sbjct  235  GDVYLKKAEFNREPLYAKFRVHEPLKRPVLSSEPSILVHQLQPHDQFIIFASDGLWEHFN  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ++PR+GIA+R+VK AL+ AA+KREMRYSDL KIDRGVRRHFHDDITV+VVY
Sbjct  295  NQEAVDIVQNNPRSGIAKRMVKAALQAAAEKREMRYSDLNKIDRGVRRHFHDDITVIVVY  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      VK  S+S++GG +N+ HNTLAPC T
Sbjct  355  LDSNLMSRASTVKFPSISIRGGGVNIPHNTLAPCTT  390



>ref|XP_010935169.1| PREDICTED: probable protein phosphatase 2C 60 [Elaeis guineensis]
Length=397

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 137/160 (86%), Gaps = 12/160 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPFK+PILSS+PSISV  LQ  DQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLREPFKRPILSSEPSISVQPLQPQDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV ++P +G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  295  NQEAVDIVHNNPHSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  354

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL        GP    +LSV+GG +NL  N+LAPCAT
Sbjct  355  LDSNLVSRASSHRGP----TLSVRGGGINLPANSLAPCAT  390



>ref|XP_006425370.1| hypothetical protein CICLE_v10025781mg [Citrus clementina]
 ref|XP_006425371.1| hypothetical protein CICLE_v10025781mg [Citrus clementina]
 ref|XP_006425372.1| hypothetical protein CICLE_v10025781mg [Citrus clementina]
 ref|XP_006425373.1| hypothetical protein CICLE_v10025781mg [Citrus clementina]
 gb|ESR38610.1| hypothetical protein CICLE_v10025781mg [Citrus clementina]
 gb|ESR38611.1| hypothetical protein CICLE_v10025781mg [Citrus clementina]
 gb|ESR38612.1| hypothetical protein CICLE_v10025781mg [Citrus clementina]
 gb|ESR38613.1| hypothetical protein CICLE_v10025781mg [Citrus clementina]
Length=397

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAE+NREPLYAKFRLREPF+KPILSS+PSIS  +LQ  DQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEYNREPLYAKFRLREPFRKPILSSEPSISAHELQPFDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ+HP +G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQDAVDIVQNHPHSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+S+L      V+  SLSV+GG +N+   TLAPCAT
Sbjct  355  LDSHLVSRASSVRGPSLSVRGGGVNMPSKTLAPCAT  390



>ref|XP_006467020.1| PREDICTED: probable protein phosphatase 2C 60-like [Citrus sinensis]
 gb|KDO71335.1| hypothetical protein CISIN_1g015989mg [Citrus sinensis]
 gb|KDO71336.1| hypothetical protein CISIN_1g015989mg [Citrus sinensis]
Length=397

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAE+NREPLYAKFRLREPF+KPILSS+PSIS  +LQ  DQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEYNREPLYAKFRLREPFRKPILSSEPSISAHELQPFDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ+HP +G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQDAVDIVQNHPHSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+S+L      V+  SLSV+GG +N+   TLAPCAT
Sbjct  355  LDSHLVSRASSVRGPSLSVRGGGVNMPSKTLAPCAT  390



>ref|XP_011088628.1| PREDICTED: probable protein phosphatase 2C 60 [Sesamum indicum]
 ref|XP_011088629.1| PREDICTED: probable protein phosphatase 2C 60 [Sesamum indicum]
Length=397

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAE+NREPLY KFRLREPFK+PILS++PSI+V QL  HDQF+IFASDGLWEHL+
Sbjct  235  GDVYLKKAEYNREPLYQKFRLREPFKRPILSAEPSITVHQLLPHDQFIIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ+HPRNG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  295  NQEAVDLVQNHPRNGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+S+L      V+  ++SVKGG +N+  N LAPC T
Sbjct  355  LDSHLVSRASSVRSPNVSVKGGGINVPPNFLAPCTT  390



>ref|XP_003520132.1| PREDICTED: probable protein phosphatase 2C 60-like [Glycine max]
Length=394

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFN+EPLYAKFR+RE FK+PILSSDPSISV +LQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNKEPLYAKFRVREGFKRPILSSDPSISVHELQQHDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ++P NGIARRL+K AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  295  NQDAVDIVQNNPHNGIARRLIKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      V+   LSV+GG + L   TLAPCA 
Sbjct  355  LDSNLVSRASSVRGPPLSVRGGGVPLPSRTLAPCAA  390



>gb|KHN00444.1| Hypothetical protein glysoja_000112 [Glycine soja]
Length=394

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFN+EPLYAKFR+RE FK+PILSSDPSISV +LQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNKEPLYAKFRVREGFKRPILSSDPSISVHELQQHDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ++P NGIARRL+K AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  295  NQDAVDIVQNNPHNGIARRLIKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      V+   LSV+GG + L   TLAPCA 
Sbjct  355  LDSNLVSRASSVRGPPLSVRGGGVPLPSRTLAPCAA  390



>ref|XP_011092959.1| PREDICTED: probable protein phosphatase 2C 60 [Sesamum indicum]
Length=397

 Score =   246 bits (628),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 138/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREPF++PILSS+PSI+V QL  HDQF+IFASDGLWEHL+
Sbjct  235  GDVYLKKAEFNREPLYQKFRLREPFQRPILSSEPSITVHQLLPHDQFIIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ+HPR+G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  295  NQEAVDLVQNHPRSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+S+L       + A++SVKGG ++L  N+LAPC T
Sbjct  355  LDSHLVSRASSARGANVSVKGGGISLPPNSLAPCTT  390



>ref|XP_007156202.1| hypothetical protein PHAVU_003G266900g [Phaseolus vulgaris]
 gb|ESW28196.1| hypothetical protein PHAVU_003G266900g [Phaseolus vulgaris]
Length=392

 Score =   246 bits (627),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLKKAEFN+EPLYAKFR+R+ FK+PILSSDPSISV +LQ HDQF+IFASDGLWEHLS
Sbjct  233  GDIYLKKAEFNKEPLYAKFRVRDGFKRPILSSDPSISVHELQQHDQFLIFASDGLWEHLS  292

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ++P NGIARRL+KTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  293  NQDAVDIVQNNPHNGIARRLIKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  352

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      V+   LSV+GG + L   TLAPCA 
Sbjct  353  LDSNLVSRASSVRGPPLSVRGGGVPLPSRTLAPCAA  388



>ref|XP_002868847.1| phosphatase 2C family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45106.1| phosphatase 2C family protein [Arabidopsis lyrata subsp. lyrata]
Length=399

 Score =   246 bits (627),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK++EFNREPLYAKFRLR PF KP+LS++P+I+V  L+ HDQF+I ASDGLWEH+S
Sbjct  235  GDVYLKRSEFNREPLYAKFRLRSPFSKPLLSAEPAITVHTLEPHDQFIICASDGLWEHMS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRNGIAKRLVKVALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
             ++NL      ++ A++SV+G  +NL HNTLAPC T
Sbjct  355  FDTNLVSRGSLLRGAAVSVRGAGVNLPHNTLAPCTT  390



>ref|XP_008242016.1| PREDICTED: probable protein phosphatase 2C 46 [Prunus mume]
 ref|XP_008242017.1| PREDICTED: probable protein phosphatase 2C 46 [Prunus mume]
 ref|XP_008242018.1| PREDICTED: probable protein phosphatase 2C 46 [Prunus mume]
 ref|XP_008242019.1| PREDICTED: probable protein phosphatase 2C 46 [Prunus mume]
 ref|XP_008242020.1| PREDICTED: probable protein phosphatase 2C 46 [Prunus mume]
 ref|XP_008242021.1| PREDICTED: probable protein phosphatase 2C 46 [Prunus mume]
 ref|XP_008242022.1| PREDICTED: probable protein phosphatase 2C 46 [Prunus mume]
 ref|XP_008242023.1| PREDICTED: probable protein phosphatase 2C 46 [Prunus mume]
Length=392

 Score =   245 bits (626),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/153 (78%), Positives = 135/153 (88%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLKKAEFNREPLY KFRLREPFK+PILSS+PSISV +LQ HDQFVIFASDGLWEHLS
Sbjct  235  GDIYLKKAEFNREPLYTKFRLREPFKRPILSSEPSISVHELQPHDQFVIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPR+G ARRLVKTAL+EAAKKREMRYSDLKKI+RGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRSGSARRLVKTALQEAAKKREMRYSDLKKIERGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAP  448
            L+SNL       +  SLSV+G  +N+   TLAP
Sbjct  355  LDSNLVSRASSARGPSLSVRGRGINIPAKTLAP  387



>ref|XP_003547908.1| PREDICTED: probable protein phosphatase 2C 60-like isoform 1 
[Glycine max]
Length=394

 Score =   245 bits (626),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFN+EPLYAKFR+RE FK+PILSSDPSISV ++Q HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNKEPLYAKFRVREGFKRPILSSDPSISVHEIQQHDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ++P NGIARRL+K AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  295  NQDAVDIVQNNPHNGIARRLIKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      V+   LSV+GG + L   TLAPCA 
Sbjct  355  LDSNLVSRASSVRGPPLSVRGGGIPLPSRTLAPCAA  390



>gb|KHN35550.1| Hypothetical protein glysoja_033039 [Glycine soja]
Length=394

 Score =   245 bits (626),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFN+EPLYAKFR+RE FK+PILSSDPSISV ++Q HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNKEPLYAKFRVREGFKRPILSSDPSISVHEIQQHDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ++P NGIARRL+K AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  295  NQDAVDIVQNNPHNGIARRLIKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      V+   LSV+GG + L   TLAPCA 
Sbjct  355  LDSNLVSRASSVRGPPLSVRGGGIPLPSRTLAPCAA  390



>gb|AAD11430.1| protein phosphatase 2C homolog [Mesembryanthemum crystallinum]
Length=396

 Score =   245 bits (626),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 135/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK E+NREPLY+KFRLREPFKKPILSSDP+ISV +LQ HDQ  IFASDGLWEHL+
Sbjct  234  GDVYLKKTEYNREPLYSKFRLREPFKKPILSSDPAISVHELQPHDQVCIFASDGLWEHLT  293

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ  PRNG A+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  294  NQEAVDLVQKSPRNGSAKRLVKVALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  353

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      V+  +LS++GG ++L   TLAPCAT
Sbjct  354  LDSNLISRGSSVRGPTLSLRGGGIHLPAKTLAPCAT  389



>ref|XP_003635344.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 60 [Vitis vinifera]
Length=397

 Score =   245 bits (625),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREP K+PILS++PSISVL+LQ +DQF+IFASDGLWEHL 
Sbjct  235  GDVYLKKAEFNREPLYVKFRLREPLKRPILSAEPSISVLELQPNDQFLIFASDGLWEHLK  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            N+EAVDIVQ+HPRNG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NEEAVDIVQNHPRNGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      V+  + S++G  +NL   +LAPCAT
Sbjct  355  LDSNLVSRASSVRGPTASIRGDGVNLPAKSLAPCAT  390



>ref|XP_006411644.1| hypothetical protein EUTSA_v10025386mg [Eutrema salsugineum]
 dbj|BAJ33799.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53097.1| hypothetical protein EUTSA_v10025386mg [Eutrema salsugineum]
Length=397

 Score =   245 bits (625),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ EFNREPLYAKFRLR PFKKP+LS++PSI+V  LQ HDQF+I ASDGLWEH+S
Sbjct  235  GDVYLKRPEFNREPLYAKFRLRAPFKKPLLSAEPSITVHTLQPHDQFIICASDGLWEHMS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRNGIAKRLVKVALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
             +++L      +K  ++SV+G  +N+ HNTLAPC T
Sbjct  355  FDTSLVSRASVLKGPAVSVRGAGVNIPHNTLAPCTT  390



>ref|XP_010683039.1| PREDICTED: probable protein phosphatase 2C 60 [Beta vulgaris 
subsp. vulgaris]
Length=397

 Score =   245 bits (625),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/156 (76%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK E+NR+PLYAKFRLREPFKKPILSSDP+ISV +LQ  DQFVIFASDGLWEHLS
Sbjct  235  GDVYLKKTEYNRQPLYAKFRLREPFKKPILSSDPTISVHELQPDDQFVIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ+ P NG ARRL+KTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV++V+
Sbjct  295  NQEAVDLVQNSPHNGSARRLLKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIIVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL       +  +LS++GG ++L   TLAPCAT
Sbjct  355  LDSNLISRASSARGPTLSLRGGGISLPAKTLAPCAT  390



>ref|XP_009595549.1| PREDICTED: probable protein phosphatase 2C 46 [Nicotiana tomentosiformis]
 ref|XP_009595550.1| PREDICTED: probable protein phosphatase 2C 46 [Nicotiana tomentosiformis]
Length=395

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 135/157 (86%), Gaps = 5/157 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREP ++PILS+DP+I V  LQ  DQF+IFASDGLWEHLS
Sbjct  237  GDVYLKKAEFNREPLYAKFRLREPIRRPILSADPAILVHPLQPQDQFIIFASDGLWEHLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIA+RLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDI+VVVV+
Sbjct  297  NQEAVDIVQNHPRNGIAKRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDISVVVVF  356

Query  362  LNSNL-----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+S+L        K  ++SVKGG + L  NTLAP  T
Sbjct  357  LDSDLVSRASNSAKAPNVSVKGGGITLPRNTLAPFTT  393



>ref|XP_008791943.1| PREDICTED: probable protein phosphatase 2C 60 [Phoenix dactylifera]
 ref|XP_008791944.1| PREDICTED: probable protein phosphatase 2C 60 [Phoenix dactylifera]
 ref|XP_008791945.1| PREDICTED: probable protein phosphatase 2C 60 [Phoenix dactylifera]
Length=397

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 135/160 (84%), Gaps = 12/160 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLKKAEFNREPLYAKFRLREPFK+PILSS+PSI V  LQ  DQF+IFASDGLWEH+S
Sbjct  235  GDIYLKKAEFNREPLYAKFRLREPFKRPILSSEPSILVQPLQPLDQFLIFASDGLWEHIS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HP +G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VVY
Sbjct  295  NQEAVDIVQNHPSSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVY  354

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL        GP    +LSV+GG + L  N+LAPC T
Sbjct  355  LDSNLISKATSNRGP----TLSVRGGGITLPANSLAPCMT  390



>ref|XP_009589840.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana tomentosiformis]
 ref|XP_009589841.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana tomentosiformis]
 ref|XP_009589842.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana tomentosiformis]
 ref|XP_009589843.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana tomentosiformis]
Length=397

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 138/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLKKAE+NREPLYAKFRL+EPFK+PILS+DPSI+V +L+ HDQF+I ASDGLWEHLS
Sbjct  235  GDIYLKKAEYNREPLYAKFRLKEPFKRPILSADPSITVQELEPHDQFLILASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ++PR+G ARRLVKTAL EAAKKREMRYSDLKKIDRGVRRHFHDDI+V+VV+
Sbjct  295  NQEAVDIVQNNPRSGSARRLVKTALHEAAKKREMRYSDLKKIDRGVRRHFHDDISVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      ++  +LS++GG +N    +LAPCAT
Sbjct  355  LDSNLVSRASSLRGPTLSLRGGGMNFPAKSLAPCAT  390



>ref|XP_004234522.1| PREDICTED: probable protein phosphatase 2C 60 [Solanum lycopersicum]
 ref|XP_004234523.1| PREDICTED: probable protein phosphatase 2C 60 [Solanum lycopersicum]
Length=397

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLKK E+NREPLYAKFRLREPFK+PILSSDPSI+V +L+ HDQF+I ASDGLWEHLS
Sbjct  235  GDIYLKKPEYNREPLYAKFRLREPFKRPILSSDPSITVQELEPHDQFLILASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+ PR+G ARRLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDI+V+VV+
Sbjct  295  NQEAVDIVQNSPRSGSARRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDISVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+S+L      ++  SLS++GG +N    +LAPCAT
Sbjct  355  LDSDLVSKASSLRGPSLSLRGGGMNFAAKSLAPCAT  390



>ref|XP_009801750.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana sylvestris]
 ref|XP_009801751.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana sylvestris]
Length=397

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 138/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLKKAE+NREPLYAKFRL+EPFK+PILS+DPSI+V +L+ HDQF+I ASDGLWEHLS
Sbjct  235  GDIYLKKAEYNREPLYAKFRLKEPFKRPILSADPSITVQELEPHDQFLILASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ++PR+G ARRLVKTAL EAAKKREMRYSDLKKIDRGVRRHFHDDI+V+VV+
Sbjct  295  NQEAVDIVQNNPRSGSARRLVKTALHEAAKKREMRYSDLKKIDRGVRRHFHDDISVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      ++  +LS++GG +N    +LAPCAT
Sbjct  355  LDSNLVSRANSLRGPTLSLRGGGMNFPAKSLAPCAT  390



>emb|CAB37508.1| putative protein phosphatase-2c [Arabidopsis thaliana]
 emb|CAB80516.1| putative protein phosphatase-2c [Arabidopsis thaliana]
Length=395

 Score =   244 bits (622),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK++EFNREPLYAKFRLR PF KP+LS++P+I+V  L+ HDQF+I ASDGLWEH+S
Sbjct  230  GDVYLKRSEFNREPLYAKFRLRSPFSKPLLSAEPAITVHTLEPHDQFIICASDGLWEHMS  289

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  290  NQEAVDIVQNHPRNGIAKRLVKVALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  349

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
             ++NL      ++  ++SV+G  +NL HNTLAPC T
Sbjct  350  FDTNLVSRGSMLRGPAVSVRGAGVNLPHNTLAPCTT  385



>gb|AAL32532.1| putative protein phosphatase-2c [Arabidopsis thaliana]
Length=400

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK++EFNREPLYAKFRLR PF KP+LS++P+I+V  L+ HDQF+I ASDGLWEH+S
Sbjct  235  GDVYLKRSEFNREPLYAKFRLRSPFSKPLLSAEPAITVHTLEPHDQFIICASDGLWEHMS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRNGIAKRLVKVALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
             ++NL      ++  ++SV+G  +NL HNTLAPC T
Sbjct  355  FDTNLVSRGSMLRGPAVSVRGAGVNLPHNTLAPCTT  390



>ref|XP_007202114.1| hypothetical protein PRUPE_ppa006861mg [Prunus persica]
 gb|EMJ03313.1| hypothetical protein PRUPE_ppa006861mg [Prunus persica]
Length=392

 Score =   244 bits (622),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 134/153 (88%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLKKAEFNREPLY KFRLREPF +PILSS+PSISV +LQ HDQFVIFASDGLWEHLS
Sbjct  235  GDIYLKKAEFNREPLYTKFRLREPFTRPILSSEPSISVHELQPHDQFVIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPR+G ARRLVKTAL+EAAKKREMRYSDLKKI+RGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRSGSARRLVKTALQEAAKKREMRYSDLKKIERGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAP  448
            L+SNL       +  SLSV+G  +N+   TLAP
Sbjct  355  LDSNLVSRASSARGPSLSVRGRGINIPAKTLAP  387



>ref|XP_006343345.1| PREDICTED: probable protein phosphatase 2C 60-like isoform X1 
[Solanum tuberosum]
 ref|XP_006343346.1| PREDICTED: probable protein phosphatase 2C 60-like isoform X2 
[Solanum tuberosum]
Length=397

 Score =   244 bits (622),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLKK E+NREPLYAKFRLREPFK+PILSSDPSI+V +L+ HDQF+I ASDGLWEHLS
Sbjct  235  GDIYLKKPEYNREPLYAKFRLREPFKRPILSSDPSITVQELEPHDQFLILASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+ PR+G ARRLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDI+V+VV+
Sbjct  295  NQEAVDIVQNSPRSGSARRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDISVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+S+L      ++  SLS++GG +N    +LAPCAT
Sbjct  355  LDSDLVSKASSLRGPSLSLRGGGMNFPAKSLAPCAT  390



>ref|NP_195564.2| putative protein phosphatase 2C 64 [Arabidopsis thaliana]
 ref|NP_974708.1| putative protein phosphatase 2C 64 [Arabidopsis thaliana]
 sp|Q5PNS9.1|P2C64_ARATH RecName: Full=Probable protein phosphatase 2C 64; Short=AtPP2C64 
[Arabidopsis thaliana]
 gb|AAV85723.1| At4g38520 [Arabidopsis thaliana]
 gb|AAX12864.1| At4g38520 [Arabidopsis thaliana]
 gb|AEE86941.1| putative protein phosphatase 2C 64 [Arabidopsis thaliana]
 gb|AEE86942.1| putative protein phosphatase 2C 64 [Arabidopsis thaliana]
Length=400

 Score =   244 bits (622),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK++EFNREPLYAKFRLR PF KP+LS++P+I+V  L+ HDQF+I ASDGLWEH+S
Sbjct  235  GDVYLKRSEFNREPLYAKFRLRSPFSKPLLSAEPAITVHTLEPHDQFIICASDGLWEHMS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRNGIAKRLVKVALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
             ++NL      ++  ++SV+G  +NL HNTLAPC T
Sbjct  355  FDTNLVSRGSMLRGPAVSVRGAGVNLPHNTLAPCTT  390



>emb|CDP01847.1| unnamed protein product [Coffea canephora]
Length=393

 Score =   243 bits (621),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 137/153 (90%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+AEFNREPLYAKFRLREPFK+PILSS+P+I+V +LQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKRAEFNREPLYAKFRLREPFKRPILSSEPAITVHELQPHDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPR+GIAR+LVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRSGIARKLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAP  448
            L+SNL      ++  +LS++GG +N+    LAP
Sbjct  355  LDSNLVSRASTLRGPTLSLRGGGINVPAKALAP  387



>ref|XP_009418617.1| PREDICTED: probable protein phosphatase 2C 60 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=362

 Score =   243 bits (619),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 137/162 (85%), Gaps = 4/162 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPFKKPILS++PSISV  +Q  D F+IFASDGLWEHLS
Sbjct  200  GDVYLKKAEFNREPLYAKFRLREPFKKPILSAEPSISVQPMQPQDLFLIFASDGLWEHLS  259

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV ++P +GIARRL+K ALREAAKKREMRYSDL KIDRGVRRHFHDDITV+VV+
Sbjct  260  NQEAVDIVHNNPHSGIARRLIKAALREAAKKREMRYSDLNKIDRGVRRHFHDDITVIVVF  319

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATAAM*CS  475
            LN++L      +K  +LS++GG +NL  ++LAPC T    C+
Sbjct  320  LNADLVSGASSLKGPTLSMRGGGINLPAHSLAPCTTPTGPCA  361



>ref|XP_009781837.1| PREDICTED: probable protein phosphatase 2C 46 [Nicotiana sylvestris]
Length=395

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 134/154 (87%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREP ++PILS+DP+I V  LQ  DQF+IFASDGLWEHLS
Sbjct  237  GDVYLKKAEFNREPLYAKFRLREPIRRPILSADPAILVHPLQPQDQFIIFASDGLWEHLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIA+RLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDI+VVVV+
Sbjct  297  NQEAVDIVQNHPRNGIAKRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDISVVVVF  356

Query  362  LNSNL-----GPVKVASLSVKGGTLNLRHNTLAP  448
            L+S+L        K  ++SVKGG + L  NTLAP
Sbjct  357  LDSDLVSRASNSAKALNVSVKGGGITLPRNTLAP  390



>ref|XP_006360895.1| PREDICTED: probable protein phosphatase 2C 60-like isoform X1 
[Solanum tuberosum]
 ref|XP_006360896.1| PREDICTED: probable protein phosphatase 2C 60-like isoform X2 
[Solanum tuberosum]
Length=388

 Score =   243 bits (619),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 136/153 (89%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK+EFNREPLYAKFRLREPF++PILS+DP+I V  +Q  DQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKSEFNREPLYAKFRLREPFQRPILSADPAILVHPVQPQDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIA+RLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDI+VVV++
Sbjct  295  NQEAVDIVQNHPRNGIAKRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDISVVVIF  354

Query  362  LNSNLG----PVKVASLSVKGGTLNLRHNTLAP  448
            L+S+        KV ++SVKGG ++L  NTLAP
Sbjct  355  LDSDFASRASSGKVPNVSVKGGGISLPRNTLAP  387



>ref|XP_010918123.1| PREDICTED: probable protein phosphatase 2C 60 [Elaeis guineensis]
 ref|XP_010918124.1| PREDICTED: probable protein phosphatase 2C 60 [Elaeis guineensis]
Length=397

 Score =   243 bits (620),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/160 (75%), Positives = 134/160 (84%), Gaps = 12/160 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLKK E+NREPLY KFRLREPFK+PILSS+PSI V  LQ  DQF+IFASDGLWEH+S
Sbjct  235  GDIYLKKPEYNREPLYVKFRLREPFKRPILSSEPSILVQPLQLQDQFLIFASDGLWEHIS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPR+G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY
Sbjct  295  NQEAVDIVQNHPRSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  354

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL        GP    +LSV+GG + L  N+LAPC T
Sbjct  355  LDSNLVSRATSNKGP----TLSVRGGGITLPANSLAPCMT  390



>gb|KHG27051.1| hypothetical protein F383_06469 [Gossypium arboreum]
Length=387

 Score =   243 bits (619),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 133/155 (86%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPLY +FRLRE F+KPILSS+PSIS+ +LQ +DQF+IFASDGLWEHLS
Sbjct  231  GDVYLKKPEFNREPLYQRFRLRETFRKPILSSEPSISMHELQPYDQFIIFASDGLWEHLS  290

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ HPRNG ARRLVK AL EAAKKREMRY+DLKKI+RGVRRHFHDDITVVVV+
Sbjct  291  NQDAVDIVQKHPRNGSARRLVKAALLEAAKKREMRYTDLKKIERGVRRHFHDDITVVVVF  350

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCA  454
            L+SNL          SLS++GG +NLR  TLAPCA
Sbjct  351  LDSNLVSKASSANSPSLSLRGGGVNLRAKTLAPCA  385



>ref|XP_009418584.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418592.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418600.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418609.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=397

 Score =   243 bits (620),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 137/162 (85%), Gaps = 4/162 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPFKKPILS++PSISV  +Q  D F+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLREPFKKPILSAEPSISVQPMQPQDLFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV ++P +GIARRL+K ALREAAKKREMRYSDL KIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVHNNPHSGIARRLIKAALREAAKKREMRYSDLNKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATAAM*CS  475
            LN++L      +K  +LS++GG +NL  ++LAPC T    C+
Sbjct  355  LNADLVSGASSLKGPTLSMRGGGINLPAHSLAPCTTPTGPCA  396



>gb|AAC35951.1| protein phosphatase-2c [Mesembryanthemum crystallinum]
Length=309

 Score =   240 bits (612),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/154 (77%), Positives = 134/154 (87%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPF++PILSS+PSISV +LQ HDQFVIFASDGLWEHLS
Sbjct  155  GDVYLKKAEFNREPLYAKFRLREPFRRPILSSEPSISVHELQPHDQFVIFASDGLWEHLS  214

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ++P NG A+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  215  NQKAVDIVQNNPHNGSAKRLVKIALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  274

Query  362  LNSNL-----GPVKVASLSVKGGTLNLRHNTLAP  448
            L+SNL        K   +SV+GG + LR NT AP
Sbjct  275  LDSNLVSRATTGSKGPHISVRGGGITLRSNTPAP  308



>ref|XP_008806142.1| PREDICTED: probable protein phosphatase 2C 60 [Phoenix dactylifera]
Length=397

 Score =   243 bits (619),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 134/160 (84%), Gaps = 12/160 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREPFK PILSS+PSISV  LQ  DQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYVKFRLREPFKNPILSSEPSISVQPLQPQDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ AVDIV ++PR+G ARRLVK AL+EAAKKREMRYSDL KIDRGVRRHFHDDITV+VV+
Sbjct  295  NQGAVDIVHNNPRSGSARRLVKAALQEAAKKREMRYSDLNKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL        GP    +LSV+GG +NL  N+LAPCAT
Sbjct  355  LDSNLVSRASSHRGP----TLSVRGGGINLPANSLAPCAT  390



>ref|XP_004248645.1| PREDICTED: probable protein phosphatase 2C 46 isoform X2 [Solanum 
lycopersicum]
Length=339

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 135/153 (88%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLRE F++PILS+DP+I V  +Q  DQF+IFASDGLWEHLS
Sbjct  186  GDVYLKKAEFNREPLYAKFRLRESFQRPILSADPAILVHPVQPQDQFIIFASDGLWEHLS  245

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ+HPRNGIA+RLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDI+VVV++
Sbjct  246  NQDAVDIVQNHPRNGIAKRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDISVVVIF  305

Query  362  LNSNLG----PVKVASLSVKGGTLNLRHNTLAP  448
            L+S+        KV ++SVKGG ++L  NTLAP
Sbjct  306  LDSDFASRASSGKVPNVSVKGGGISLPRNTLAP  338



>gb|KHG06659.1| hypothetical protein F383_03933 [Gossypium arboreum]
Length=339

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 132/154 (86%), Gaps = 4/154 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLR+PF+ PILSS+PS+S+ +LQ HDQF+IFASDGLWEHLS
Sbjct  186  GDVYLKKAEFNREPLYQKFRLRQPFRMPILSSEPSVSMHELQPHDQFLIFASDGLWEHLS  245

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ AVDIVQ+HPRNG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  246  NQVAVDIVQNHPRNGSARRLVKVALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  305

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPC  451
            L+SNL       K  SLS++GG + L   T APC
Sbjct  306  LDSNLVSRASSAKGPSLSLRGGGIKLPAKTKAPC  339



>ref|XP_009363444.1| PREDICTED: probable protein phosphatase 2C 46 [Pyrus x bretschneideri]
Length=394

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 137/156 (88%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNR PLY KFRLREPFK+PILSS+PSISV +LQ HDQF+I ASDGLWEHL+
Sbjct  235  GDVYLKKAEFNRAPLYTKFRLREPFKRPILSSEPSISVHELQPHDQFLILASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPR+G ARRLVKTAL+EAAKKREMRYSDLKKI+RGVRRHFHDDITV+V++
Sbjct  295  NQEAVDIVQNHPRSGSARRLVKTALQEAAKKREMRYSDLKKIERGVRRHFHDDITVIVLF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      ++  +LSV+G  +++   TLAPC+T
Sbjct  355  LDSNLVSRASSMRGPTLSVRGTGVHIPSKTLAPCST  390



>ref|XP_010028765.1| PREDICTED: probable protein phosphatase 2C 60 [Eucalyptus grandis]
 gb|KCW55582.1| hypothetical protein EUGRSUZ_I01452 [Eucalyptus grandis]
Length=397

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 134/158 (85%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPL AK RLREPF+KPILSS+PSI   QL+ HD+FVIFASDGLWE LS
Sbjct  235  GDVYLKKPEFNREPLIAKCRLREPFEKPILSSEPSILAQQLEPHDRFVIFASDGLWEQLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+H RNG ARRLVK AL+EAA+KREMRYSDLKKIDRGVRRHFHDDITV+VVY
Sbjct  295  NQEAVDIVQNHARNGSARRLVKAALQEAARKREMRYSDLKKIDRGVRRHFHDDITVIVVY  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+ N+      ++ A LS++GG +NL  NTLAPC T++
Sbjct  355  LDWNMMSTVSSIRSAKLSIRGGGINLPPNTLAPCTTSS  392



>ref|XP_008337969.1| PREDICTED: probable protein phosphatase 2C 46 [Malus domestica]
 ref|XP_008337970.1| PREDICTED: probable protein phosphatase 2C 46 [Malus domestica]
Length=394

 Score =   242 bits (617),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 136/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNR PLY KFRLREPFK+PILSS+PSISV +LQ HDQF+I ASDGLWEHL+
Sbjct  235  GDVYLKKAEFNRAPLYTKFRLREPFKRPILSSEPSISVHELQPHDQFLILASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPR+G ARRLVKTAL+EAAKKREMRYSDLKKI+RGVRRHFHDDITV+V++
Sbjct  295  NQEAVDIVQNHPRSGSARRLVKTALQEAAKKREMRYSDLKKIERGVRRHFHDDITVIVLF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL       +  +LSV+G  +++   TLAPC+T
Sbjct  355  LDSNLVRRASSTRGPTLSVRGTGVHIPSKTLAPCST  390



>ref|XP_010690331.1| PREDICTED: probable protein phosphatase 2C 60 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010690332.1| PREDICTED: probable protein phosphatase 2C 60 [Beta vulgaris 
subsp. vulgaris]
Length=390

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 133/154 (86%), Gaps = 5/154 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAE+NREPL+AKFRLREPFK+PILS+DPSI   +LQ HDQFVIFASDGLWEHLS
Sbjct  236  GDVYLKKAEYNREPLFAKFRLREPFKRPILSADPSILAHELQPHDQFVIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ++PRNG AR+LVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  296  NQEAVDIVQNNPRNGSARKLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  355

Query  362  LNSNL-----GPVKVASLSVKGGTLNLRHNTLAP  448
             +SNL        K   +SV+G  + LR NTLAP
Sbjct  356  FDSNLVSRATSGSKAPQVSVRGAGVALRSNTLAP  389



>ref|XP_009628267.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana tomentosiformis]
Length=387

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 131/150 (87%), Gaps = 4/150 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPF KPILSSDP+ISV  LQ  DQF+IFASDGLWEHL+
Sbjct  235  GDVYLKKAEFNREPLYAKFRLREPFGKPILSSDPTISVHHLQPDDQFIIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ AVDIVQ+HPRNGIARRLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDI+V VV+
Sbjct  295  NQGAVDIVQNHPRNGIARRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDISVAVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNT  439
            L+SNL      VK  ++SVKGG ++L   T
Sbjct  355  LDSNLVSQASSVKSPNISVKGGGISLPTKT  384



>ref|XP_006282642.1| hypothetical protein CARUB_v10004984mg [Capsella rubella]
 gb|EOA15540.1| hypothetical protein CARUB_v10004984mg [Capsella rubella]
Length=396

 Score =   241 bits (615),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 135/158 (85%), Gaps = 8/158 (5%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ EFNREPLYAKFRLR PF KP+LS++P+I+V  L+ HD+F+I ASDGLWEH+S
Sbjct  235  GDVYLKRPEFNREPLYAKFRLRSPFSKPLLSAEPAITVHTLEPHDEFIICASDGLWEHMS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNHPRNGIAKRLVKVALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNLGPVKVASL------SVKGGTLNLRHNTLAPCAT  457
             ++NL  V  ASL      SV+G  +NL HNTLAPC T
Sbjct  355  FDTNL--VSRASLLRGPAVSVRGAGVNLPHNTLAPCTT  390



>emb|CDY70696.1| BnaCnng69380D, partial [Brassica napus]
Length=324

 Score =   239 bits (609),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 135/160 (84%), Gaps = 10/160 (6%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK++EFNREPLYAKFRLR PF +P+LS++PSI+V  LQ HDQF+I ASDGLWEH+S
Sbjct  167  GDVYLKRSEFNREPLYAKFRLRAPFSRPLLSAEPSITVHALQPHDQFIICASDGLWEHMS  226

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV+IV  HPRNGIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  227  NQEAVEIVHTHPRNGIAKRLVKMALKEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  286

Query  362  LNSNL------GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
             +++L      GP    ++SV+G  +NL HN+LAPC TA 
Sbjct  287  FDTSLVVSRARGP----AVSVRGAGVNLPHNSLAPCTTAG  322



>ref|XP_008811724.1| PREDICTED: probable protein phosphatase 2C 60 [Phoenix dactylifera]
Length=397

 Score =   241 bits (614),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 132/156 (85%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREPFKKPILSS+PSISV  LQ HDQF+IFASDGLWE LS
Sbjct  235  GDVYLKKAEFNREPLYVKFRLREPFKKPILSSEPSISVQPLQPHDQFLIFASDGLWEQLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ AVDIV ++P +G ARRLVK AL EAA+KREMRYSDLKKIDRG+RRHFHDDITV+VV+
Sbjct  295  NQAAVDIVHNNPHSGSARRLVKAALHEAARKREMRYSDLKKIDRGIRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL       K  SLSV+GG +NL   +LAPCAT
Sbjct  355  LDSNLVSKASSHKGPSLSVRGGGINLPAKSLAPCAT  390



>ref|XP_004231056.1| PREDICTED: probable protein phosphatase 2C 46 [Solanum lycopersicum]
Length=388

 Score =   240 bits (613),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 131/150 (87%), Gaps = 4/150 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK+EFNREPLYAKFRLREPF KPILS+DP+ISV  LQ  DQF+IFASDGLWEHLS
Sbjct  236  GDVYLKKSEFNREPLYAKFRLREPFGKPILSADPAISVHHLQPDDQFIIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ AVDIVQ+HPRNGIARRLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDI+V VV+
Sbjct  296  NQGAVDIVQNHPRNGIARRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDISVAVVF  355

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNT  439
            L+SNL      VK  ++SVKGG ++L   T
Sbjct  356  LDSNLVSRASSVKSPNISVKGGGISLPTKT  385



>ref|XP_009418691.1| PREDICTED: probable protein phosphatase 2C 60 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=397

 Score =   240 bits (613),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 134/155 (86%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ EFNREPL+ KFRLREPFKKPILSS+PSI+V  LQ  DQF+IFASDGLWEHLS
Sbjct  235  GDVYLKRTEFNREPLHVKFRLREPFKKPILSSEPSITVQPLQPQDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ++P NG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNNPPNGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCA  454
            L+SNL      +K  SLS++GG +N+  N+LAPC 
Sbjct  355  LDSNLVSRASSLKGPSLSLRGGGVNVPANSLAPCT  389



>gb|EEC81321.1| hypothetical protein OsI_24486 [Oryza sativa Indica Group]
Length=392

 Score =   240 bits (613),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 134/156 (86%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK++EFNREPLYAKFRLREPF KPILSS+PSISV  LQ HDQF+IFASDGLWEHL+
Sbjct  235  GDAYLKRSEFNREPLYAKFRLREPFHKPILSSEPSISVQPLQPHDQFLIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PRNG ARRL+K AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVHSSPRNGSARRLIKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+S+L       +  S+S++GG +NLR NTLAP A+
Sbjct  355  LDSSLVSRASTYRGPSVSLRGGGVNLRSNTLAPYAS  390



>ref|NP_001058597.1| Os06g0717800 [Oryza sativa Japonica Group]
 sp|Q5Z8P0.1|P2C60_ORYSJ RecName: Full=Probable protein phosphatase 2C 60; Short=OsPP2C60 
[Oryza sativa Japonica Group]
 gb|AAL79731.1|AC091774_22 putative protein phosphatase [Oryza sativa Japonica Group]
 dbj|BAD61722.1| putative protein phosphatase 2C homolog [Oryza sativa Japonica 
Group]
 dbj|BAF20511.1| Os06g0717800 [Oryza sativa Japonica Group]
 dbj|BAG89257.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00528.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66369.1| hypothetical protein OsJ_22677 [Oryza sativa Japonica Group]
Length=392

 Score =   240 bits (613),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 134/156 (86%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK++EFNREPLYAKFRLREPF KPILSS+PSISV  LQ HDQF+IFASDGLWEHL+
Sbjct  235  GDAYLKRSEFNREPLYAKFRLREPFHKPILSSEPSISVQPLQPHDQFLIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PRNG ARRL+K AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVHSSPRNGSARRLIKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+S+L       +  S+S++GG +NLR NTLAP A+
Sbjct  355  LDSSLVSRASTYRGPSVSLRGGGVNLRSNTLAPYAS  390



>gb|EYU37974.1| hypothetical protein MIMGU_mgv1a007884mg [Erythranthe guttata]
Length=392

 Score =   240 bits (612),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 137/158 (87%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPLY KFRLREPFK+PILS++P+I+V QL  HDQFVIFASDGLWEHL+
Sbjct  235  GDVYLKKPEFNREPLYQKFRLREPFKRPILSAEPAITVHQLLPHDQFVIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ++P NG ARRLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  295  NQEAVDLVQNNPHNGSARRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+S+L      V+  ++SVKGG + +  N+LAP A AA
Sbjct  355  LDSHLVSRASSVRSPNISVKGGGITIPSNSLAPEAAAA  392



>ref|XP_006367872.1| PREDICTED: probable protein phosphatase 2C 64-like [Solanum tuberosum]
Length=388

 Score =   240 bits (612),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 131/150 (87%), Gaps = 4/150 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK+EFNREPLYAKFRLREPF KPILS+DP+ISV  LQ  DQF+IFASDGLWEHLS
Sbjct  236  GDVYLKKSEFNREPLYAKFRLREPFGKPILSADPAISVHHLQPDDQFIIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ AVDIVQ+HPRNGIARRLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDI+V VV+
Sbjct  296  NQGAVDIVQNHPRNGIARRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDISVAVVF  355

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNT  439
            L+SNL      VK  ++SVKGG ++L   T
Sbjct  356  LDSNLVSRASSVKSPNISVKGGGISLPTKT  385



>ref|XP_009783505.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana sylvestris]
Length=387

 Score =   239 bits (611),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 130/150 (87%), Gaps = 4/150 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPLYAKFRLREPF KPILSSDP+ISV  LQ  DQFVIFASDGLWEHL+
Sbjct  235  GDVYLKKTEFNREPLYAKFRLREPFVKPILSSDPTISVHHLQPDDQFVIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ AVDIVQ+HPRNGIARRLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDI+V VV+
Sbjct  295  NQGAVDIVQNHPRNGIARRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDISVAVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNT  439
            L+SNL      VK  ++SVKGG ++L   T
Sbjct  355  LDSNLVSQASSVKSPNISVKGGGISLPTKT  384



>ref|XP_004248644.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327397.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Solanum 
lycopersicum]
Length=388

 Score =   239 bits (611),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 135/153 (88%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLRE F++PILS+DP+I V  +Q  DQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLYAKFRLRESFQRPILSADPAILVHPVQPQDQFIIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ+HPRNGIA+RLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDI+VVV++
Sbjct  295  NQDAVDIVQNHPRNGIAKRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDISVVVIF  354

Query  362  LNSNLG----PVKVASLSVKGGTLNLRHNTLAP  448
            L+S+        KV ++SVKGG ++L  NTLAP
Sbjct  355  LDSDFASRASSGKVPNVSVKGGGISLPRNTLAP  387



>ref|XP_009418690.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=449

 Score =   241 bits (614),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 117/155 (75%), Positives = 134/155 (86%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ EFNREPL+ KFRLREPFKKPILSS+PSI+V  LQ  DQF+IFASDGLWEHLS
Sbjct  287  GDVYLKRTEFNREPLHVKFRLREPFKKPILSSEPSITVQPLQPQDQFLIFASDGLWEHLS  346

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ++P NG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  347  NQEAVDIVQNNPPNGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  406

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCA  454
            L+SNL      +K  SLS++GG +N+  N+LAPC 
Sbjct  407  LDSNLVSRASSLKGPSLSLRGGGVNVPANSLAPCT  441



>ref|XP_009101944.1| PREDICTED: probable protein phosphatase 2C 64 isoform X3 [Brassica 
rapa]
Length=389

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 134/160 (84%), Gaps = 10/160 (6%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK++EFNREPLYAKFRLR PF +P+LS++PSI+V  LQ HD F+I ASDGLWEH+S
Sbjct  232  GDVYLKRSEFNREPLYAKFRLRAPFSRPLLSAEPSITVHTLQPHDLFIICASDGLWEHMS  291

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV+IV  HPRNGIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  292  NQEAVEIVHTHPRNGIAKRLVKMALKEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  351

Query  362  LNSNL------GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
             +++L      GP    ++SV+G  +NL HN+LAPC TA 
Sbjct  352  FDTSLVVSRARGP----AVSVRGAGVNLPHNSLAPCTTAG  387



>ref|XP_009344827.1| PREDICTED: probable protein phosphatase 2C 46 [Pyrus x bretschneideri]
 ref|XP_009344830.1| PREDICTED: probable protein phosphatase 2C 46 [Pyrus x bretschneideri]
Length=394

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 135/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPLYAKFRLREPFK+PILSS+PSISV +LQ HDQF+I ASDGLWEHL+
Sbjct  235  GDVYLKKPEFNREPLYAKFRLREPFKRPILSSEPSISVHELQPHDQFLILASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ AVDIVQ+HP +G ARRLVKTAL+EAAKKREMRYSDLKKI+RGVRRHFHDDITV+V++
Sbjct  295  NQGAVDIVQNHPHSGSARRLVKTALQEAAKKREMRYSDLKKIERGVRRHFHDDITVIVLF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL       +  +LSV+G  +++   TLAPC+T
Sbjct  355  LDSNLVSKASSTRGPTLSVRGAGVHIPSKTLAPCST  390



>ref|XP_004287772.1| PREDICTED: probable protein phosphatase 2C 60-like [Fragaria 
vesca subsp. vesca]
Length=393

 Score =   238 bits (606),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 131/153 (86%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPLYAKFRLREPFK+PILS+DP+ISV +LQ HDQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKPEFNREPLYAKFRLREPFKRPILSADPAISVHELQPHDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ HP +G ARRLVK AL EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQSHPHSGSARRLVKAALLEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAP  448
            L+ NL       +  +LSV+GG ++L   TLAP
Sbjct  355  LDLNLVSRASSTRGPTLSVRGGGISLPAKTLAP  387



>ref|XP_009391019.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
Length=396

 Score =   237 bits (605),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 131/160 (82%), Gaps = 12/160 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPFKKPILSS+PSISV  LQ  DQF+IFASDGLWEHLS
Sbjct  234  GDVYLKKAEFNREPLYAKFRLREPFKKPILSSEPSISVQLLQPQDQFLIFASDGLWEHLS  293

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV + P +G ARRL+K AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  294  NQEAVDIVHNGPHSGSARRLIKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  353

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+ NL        GP    +LSV+GG      N+LAPC T
Sbjct  354  LDDNLVSRASSHRGP----TLSVRGGGFAPAPNSLAPCTT  389



>gb|KHG19895.1| hypothetical protein F383_10069 [Gossypium arboreum]
 gb|KHG21644.1| hypothetical protein F383_05608 [Gossypium arboreum]
Length=396

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 131/151 (87%), Gaps = 4/151 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY +FRLREPFKKPILS+DPSISV +L  HD+FVIFASDGLWEHL+
Sbjct  235  GDVYLKKAEFNREPLYPRFRLREPFKKPILSADPSISVHRLLPHDKFVIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ H R G ARRLVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+V++
Sbjct  295  NQEAVDIVQKHSRTGSARRLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVLF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTL  442
            L+SNL      VK  ++SV+GG +N   NTL
Sbjct  355  LDSNLISKASSVKGPNISVRGGGINFPSNTL  385



>ref|XP_008393780.1| PREDICTED: probable protein phosphatase 2C 60 [Malus domestica]
Length=394

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 133/156 (85%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPLYAKFRLREPFK+PILSS+PSISV +LQ HDQF+I ASDGLWEHL+
Sbjct  235  GDVYLKKPEFNREPLYAKFRLREPFKRPILSSEPSISVHELQPHDQFLILASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDI Q+HP +G ARRL KTAL+EAAKKREMRYSDLKKI+RGVRRHFHDDITV+V++
Sbjct  295  NQEAVDIXQNHPHSGSARRLXKTALQEAAKKREMRYSDLKKIERGVRRHFHDDITVIVLF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL       +   LSV+G  +++   TLAPC+T
Sbjct  355  LDSNLVSKASSTRGPXLSVRGAGVHIPSKTLAPCST  390



>ref|XP_006656500.1| PREDICTED: probable protein phosphatase 2C 60-like [Oryza brachyantha]
Length=392

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 135/160 (84%), Gaps = 12/160 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKK+EFNREPLYAKFRLREPF KPILSS+PSISV  LQ HDQF+IFASDGLWEHL+
Sbjct  235  GDAYLKKSEFNREPLYAKFRLREPFHKPILSSEPSISVQSLQPHDQFLIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV+IV  +P +G ARRL+K AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVEIVHSNPCSGSARRLIKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+S+L        GP    S+S++GG +NLR NTLAP A+
Sbjct  355  LDSSLVSRASTYRGP----SVSLRGGGVNLRSNTLAPYAS  390



>ref|XP_010446360.1| PREDICTED: probable protein phosphatase 2C 64 [Camelina sativa]
Length=393

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 134/156 (86%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK++EFNREPLYAKFRLR PF +P+LS++P+I+V  L+  DQF+I ASDGLWEH+S
Sbjct  232  GDVYLKRSEFNREPLYAKFRLRSPFSRPLLSAEPAITVHTLEPQDQFIICASDGLWEHMS  291

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV +HPRNGIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  292  NQEAVDIVHNHPRNGIAKRLVKVALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  351

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
             ++NL      +K  ++SV+G  +N+ HN+LAPC T
Sbjct  352  FDTNLVSRASLLKGPTVSVRGAGVNVPHNSLAPCTT  387



>ref|XP_010436947.1| PREDICTED: probable protein phosphatase 2C 64 [Camelina sativa]
Length=393

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 134/156 (86%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK++EFNREPLYAKFRLR PF +P+LS++P+I+V  L+  DQF+I ASDGLWEH+S
Sbjct  232  GDVYLKRSEFNREPLYAKFRLRSPFSRPLLSAEPAITVHTLEPQDQFIICASDGLWEHMS  291

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV +HPRNGIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  292  NQEAVDIVHNHPRNGIAKRLVKVALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  351

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
             ++NL      +K  ++SV+G  +N+ HN+LAPC T
Sbjct  352  FDTNLVSRASLLKGPTVSVRGAGVNVPHNSLAPCTT  387



>ref|XP_009392876.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
Length=394

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 133/156 (85%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPL+ KFRLREPFKKPILSS PSI+V  LQ  DQF+IFASDGLWEHL+
Sbjct  235  GDVYLKKAEFNREPLHVKFRLREPFKKPILSSVPSITVQPLQPQDQFLIFASDGLWEHLN  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV+IVQ +  +G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVNIVQKNSHSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      ++  SLSV+GG +N+ H +LAPC T
Sbjct  355  LDSNLVSRANSLRGPSLSVRGGGINVPHKSLAPCTT  390



>ref|XP_010431790.1| PREDICTED: probable protein phosphatase 2C 64 isoform X1 [Camelina 
sativa]
 ref|XP_010431791.1| PREDICTED: probable protein phosphatase 2C 64 isoform X2 [Camelina 
sativa]
Length=397

 Score =   236 bits (601),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 134/157 (85%), Gaps = 4/157 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK++EFNREPLYAKFRLR PF +P+LS++P+I+V  L+  DQF+I ASDGLWEH+S
Sbjct  232  GDVYLKRSEFNREPLYAKFRLRSPFSRPLLSAEPAITVHTLEPQDQFIICASDGLWEHMS  291

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV +HPRNGIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  292  NQEAVDIVHNHPRNGIAKRLVKVALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  351

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATA  460
             ++NL      +K  ++SV+G  +N+ HN+LAPC T 
Sbjct  352  FDTNLVSRASLLKGPTVSVRGAGVNVPHNSLAPCTTT  388



>ref|XP_009101943.1| PREDICTED: probable protein phosphatase 2C 64 isoform X2 [Brassica 
rapa]
Length=397

 Score =   235 bits (600),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 134/160 (84%), Gaps = 10/160 (6%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK++EFNREPLYAKFRLR PF +P+LS++PSI+V  LQ HD F+I ASDGLWEH+S
Sbjct  240  GDVYLKRSEFNREPLYAKFRLRAPFSRPLLSAEPSITVHTLQPHDLFIICASDGLWEHMS  299

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV+IV  HPRNGIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  300  NQEAVEIVHTHPRNGIAKRLVKMALKEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  359

Query  362  LNSNL------GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
             +++L      GP    ++SV+G  +NL HN+LAPC TA 
Sbjct  360  FDTSLVVSRARGP----AVSVRGAGVNLPHNSLAPCTTAG  395



>ref|XP_009101942.1| PREDICTED: probable protein phosphatase 2C 64 isoform X1 [Brassica 
rapa]
Length=405

 Score =   235 bits (599),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 134/160 (84%), Gaps = 10/160 (6%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK++EFNREPLYAKFRLR PF +P+LS++PSI+V  LQ HD F+I ASDGLWEH+S
Sbjct  248  GDVYLKRSEFNREPLYAKFRLRAPFSRPLLSAEPSITVHTLQPHDLFIICASDGLWEHMS  307

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV+IV  HPRNGIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  308  NQEAVEIVHTHPRNGIAKRLVKMALKEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  367

Query  362  LNSNL------GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
             +++L      GP    ++SV+G  +NL HN+LAPC TA 
Sbjct  368  FDTSLVVSRARGP----AVSVRGAGVNLPHNSLAPCTTAG  403



>ref|XP_010526813.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
 ref|XP_010526814.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
 ref|XP_010526815.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
 ref|XP_010526817.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
Length=390

 Score =   234 bits (598),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 122/125 (98%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPFK+PILSS+PSISV +LQ HDQFVIFASDGLWEHLS
Sbjct  232  GDVYLKKAEFNREPLYAKFRLREPFKRPILSSEPSISVHELQPHDQFVIFASDGLWEHLS  291

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPR+G+A+RLVKTAL +AAKKREMRYSDLKKI+RGVRRHFHDDITVVVV+
Sbjct  292  NQEAVDIVQNHPRSGVAQRLVKTALHDAAKKREMRYSDLKKIERGVRRHFHDDITVVVVF  351

Query  362  LNSNL  376
            L+SNL
Sbjct  352  LDSNL  356



>ref|XP_004966475.1| PREDICTED: probable protein phosphatase 2C 60-like [Setaria italica]
Length=388

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 131/157 (83%), Gaps = 12/157 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKK EFN+EPLYAKFRLREPF KPILSS+PSISV  LQ HDQF+IFASDGLWEHL+
Sbjct  235  GDAYLKKQEFNKEPLYAKFRLREPFSKPILSSEPSISVQPLQPHDQFLIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ  PRNG AR+L++ AL+EAAKKREMRYSDLKKI+RGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQSSPRNGCARKLIRAALQEAAKKREMRYSDLKKIERGVRRHFHDDITVIVVF  354

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAP  448
            L+S+L        GP    +LS++GG  ++R NTL P
Sbjct  355  LDSSLVSRASTHRGP----ALSLRGGGASMRSNTLTP  387



>gb|AET03717.2| serine/threonine phosphatase family, 2C domain protein [Medicago 
truncatula]
Length=280

 Score =   229 bits (585),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 129/153 (84%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLRE FK PILSSDPSISV +LQ HDQF+IFASDGLWEHLS
Sbjct  121  GDVYLKKAEFNREPLYAKFRLRETFKTPILSSDPSISVHELQEHDQFLIFASDGLWEHLS  180

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ+HP +G AR+L+K AL EAAKKREMRYSDLKKIDRGVRRHFHDDITVVV++
Sbjct  181  NQDAVDIVQNHPHSGSARKLIKVALLEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVIF  240

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAP  448
            L+SNL      V    +S++G  + L   +LAP
Sbjct  241  LDSNLVSRASTVTGPPVSLRGAGVPLPSRSLAP  273



>gb|ABF93864.1| protein phosphatase 2C, putative, expressed [Oryza sativa Japonica 
Group]
Length=284

 Score =   229 bits (585),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 136/160 (85%), Gaps = 12/160 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ E+NREPL++KFRLRE FK+PILSS+P+I+V Q+Q +D FVIFASDGLWEHLS
Sbjct  121  GDVYLKRPEYNREPLHSKFRLRETFKRPILSSEPAIAVHQIQPNDHFVIFASDGLWEHLS  180

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ++PRNGIARRLVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  181  NQEAVDLVQNNPRNGIARRLVKVAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  240

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SN         GP    S+S++GG + L  N+LAP +T
Sbjct  241  LDSNAISKANWSRGP----SVSLRGGGVTLPANSLAPFST  276



>ref|XP_010531120.1| PREDICTED: probable protein phosphatase 2C 46 [Tarenaya hassleriana]
Length=384

 Score =   233 bits (593),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 128/145 (88%), Gaps = 11/145 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLREPFK+PILS +PSISV +LQ  DQFVIFASDGLWEHL+
Sbjct  232  GDVYLKKAEFNREPLYAKFRLREPFKRPILSPEPSISVHELQPQDQFVIFASDGLWEHLT  291

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPR+GIA+RLVKTAL+EAAKKREMRYSDLKKI+RGVRRHFHDDITVVVV+
Sbjct  292  NQEAVDIVQNHPRSGIAQRLVKTALQEAAKKREMRYSDLKKIERGVRRHFHDDITVVVVF  351

Query  362  LNSNL-------GPVKVASLSVKGG  415
             +SNL       GP    S S+KGG
Sbjct  352  FDSNLLSSVKGGGP----SFSLKGG  372



>ref|XP_006828820.1| hypothetical protein AMTR_s00001p00136050 [Amborella trichopoda]
 gb|ERM96236.1| hypothetical protein AMTR_s00001p00136050 [Amborella trichopoda]
Length=393

 Score =   233 bits (593),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 135/156 (87%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRL +P ++PILS+DP+IS+  LQ HDQF+IFASDGLWEHLS
Sbjct  236  GDVYLKKAEFNREPLYAKFRLPDPIRRPILSADPAISLHPLQPHDQFLIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV +HPRNG ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  296  NQEAVDIVHNHPRNGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  355

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+S+L       +  +LS++GG +++  N+LAP +T
Sbjct  356  LDSHLISRASTNRAPNLSLRGGGVSVPANSLAPYST  391



>ref|XP_009408204.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408205.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408207.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408208.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009408209.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
Length=388

 Score =   232 bits (592),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 133/159 (84%), Gaps = 12/159 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRLREPFKKP+LSS+PSISV  LQ  DQF+IFASDGLWEHL+
Sbjct  234  GDVYLKKAEFNREPLYPKFRLREPFKKPLLSSEPSISVQPLQPQDQFLIFASDGLWEHLN  293

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV ++PR+G ARRL+K  L+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  294  NQEAVDIVHNNPRSGSARRLIKAVLQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  353

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAPCA  454
            L+ NL        GP    +LS++GG +NL  N+LAP +
Sbjct  354  LDPNLASRASSHRGP----ALSLRGGGINLPANSLAPSS  388



>ref|XP_009395356.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   232 bits (591),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 132/156 (85%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPL+ KFRLREPFKKPILSS+PSI+V  LQ  DQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKAEFNREPLHVKFRLREPFKKPILSSEPSITVHSLQPQDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ++PR+G ARRLVK AL+EAAKKREMRYSDL KI RGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNNPRSGSARRLVKIALQEAAKKREMRYSDLTKIGRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L++NL      ++  +LSV+GG +N   N+L P  T
Sbjct  355  LDNNLISRASSLRGPTLSVRGGGINAPSNSLTPYTT  390



>ref|XP_010239682.1| PREDICTED: probable protein phosphatase 2C 60 [Brachypodium distachyon]
 ref|XP_010239689.1| PREDICTED: probable protein phosphatase 2C 60 [Brachypodium distachyon]
Length=392

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 129/153 (84%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKK EFNREPLYAKFRLREPF KPILSS+PSI V  +Q HDQF+IFASDGLWEHL+
Sbjct  235  GDAYLKKQEFNREPLYAKFRLREPFSKPILSSEPSIYVQPIQPHDQFLIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PR+G ARRL+K AL EAAKKREMRYSDLKKIDRGVRRHFHDDITV++V+
Sbjct  295  NQEAVDIVHSSPRSGSARRLIKAALLEAAKKREMRYSDLKKIDRGVRRHFHDDITVIIVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAP  448
            L+S+L    G  +  ++S++G  ++LR NTLAP
Sbjct  355  LDSSLVSRAGTCRGPTVSLRGAGVSLRSNTLAP  387



>ref|XP_004509404.1| PREDICTED: probable protein phosphatase 2C 46-like [Cicer arietinum]
Length=392

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 132/158 (84%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFN+EPLYAKFRLRE FK+PILSSDP++SV +LQ HDQF+IFASDGLWEHLS
Sbjct  233  GDVYLKKAEFNKEPLYAKFRLRETFKRPILSSDPAMSVHELQEHDQFLIFASDGLWEHLS  292

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ+HP +G AR+L+K AL EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  293  NQDAVDIVQNHPHSGSARKLIKVALLEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  352

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+SNL      ++   LSV+G  + +   +LAP   A 
Sbjct  353  LDSNLVSKASTIRGPPLSVRGAGIPVPSRSLAPMELAG  390



>gb|EEE58289.1| hypothetical protein OsJ_09327 [Oryza sativa Japonica Group]
Length=349

 Score =   229 bits (584),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 136/160 (85%), Gaps = 12/160 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ E+NREPL++KFRLRE FK+PILSS+P+I+V Q+Q +D FVIFASDGLWEHLS
Sbjct  186  GDVYLKRPEYNREPLHSKFRLRETFKRPILSSEPAIAVHQIQPNDHFVIFASDGLWEHLS  245

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ++PRNGIARRLVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  246  NQEAVDLVQNNPRNGIARRLVKVAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  305

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SN         GP    S+S++GG + L  N+LAP +T
Sbjct  306  LDSNAISKANWSRGP----SVSLRGGGVTLPANSLAPFST  341



>gb|KCW64133.1| hypothetical protein EUGRSUZ_G01786 [Eucalyptus grandis]
Length=413

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 132/160 (83%), Gaps = 14/160 (9%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPLYAKFRLREPFK+PILS++PSISV QLQSH         GLWEH+ 
Sbjct  235  GDVYLKKPEFNREPLYAKFRLREPFKRPILSAEPSISVHQLQSH---------GLWEHIG  285

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  286  NQEAVDIVQNHPRNGIARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  345

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAP-CATAAM  466
            L+SNL      +K  ++SV+ G +NLR NTLAP CA   +
Sbjct  346  LDSNLVSRASLIKSPNVSVRAGGVNLRPNTLAPYCANVVL  385



>ref|XP_002439035.1| hypothetical protein SORBIDRAFT_10g030320 [Sorghum bicolor]
 gb|EER90402.1| hypothetical protein SORBIDRAFT_10g030320 [Sorghum bicolor]
Length=389

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 130/159 (82%), Gaps = 14/159 (9%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKK EFNREPLYAKFRLREPF KPILSS+PSI V  LQ HDQF+IFASDGLWEHL+
Sbjct  234  GDAYLKKQEFNREPLYAKFRLREPFNKPILSSEPSICVQPLQPHDQFLIFASDGLWEHLT  293

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PR+G ARRL++ AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  294  NQEAVDIVHSSPRSGCARRLIRAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  353

Query  362  LNSNL--------GPVKVASLSVKGG--TLNLRHNTLAP  448
            L+S+L        GP    +LS++GG  +  LR NTLAP
Sbjct  354  LDSSLVSRASTHRGP----TLSLRGGGASAGLRSNTLAP  388



>ref|NP_001146390.1| protein phosphatase 2C isoform 1 [Zea mays]
 ref|XP_008647733.1| PREDICTED: protein phosphatase 2C isoform 1 isoform X1 [Zea mays]
 ref|XP_008647735.1| PREDICTED: protein phosphatase 2C isoform 1 isoform X1 [Zea mays]
 ref|XP_008647736.1| PREDICTED: protein phosphatase 2C isoform 1 isoform X1 [Zea mays]
 gb|ACL53864.1| unknown [Zea mays]
 gb|ACN34369.1| unknown [Zea mays]
 gb|AFW75749.1| protein phosphatase 2C isoform 1 [Zea mays]
 gb|AFW75750.1| protein phosphatase 2C isoform 2 [Zea mays]
 gb|AFW75751.1| protein phosphatase 2C isoform 3 [Zea mays]
 gb|AFW75752.1| protein phosphatase 2C isoform 4 [Zea mays]
 gb|AIB05420.1| orphans transcription factor, partial [Zea mays]
Length=390

 Score =   230 bits (586),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 127/157 (81%), Gaps = 10/157 (6%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKK EFNREPLYAKFRLREPF KPILSS+PSISV  LQ HDQF+IFASDGLWE L+
Sbjct  235  GDAYLKKQEFNREPLYAKFRLREPFHKPILSSEPSISVQPLQPHDQFLIFASDGLWEQLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV+  PR+G ARRL++ AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVRSSPRSGCARRLIRAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAP  448
            L+S L        GP    SL   GG+  LR NTLAP
Sbjct  355  LDSGLVSQASTHRGP--TLSLRGGGGSAGLRSNTLAP  389



>ref|XP_010066286.1| PREDICTED: probable protein phosphatase 2C 60 [Eucalyptus grandis]
 ref|XP_010066287.1| PREDICTED: probable protein phosphatase 2C 60 [Eucalyptus grandis]
 ref|XP_010066288.1| PREDICTED: probable protein phosphatase 2C 60 [Eucalyptus grandis]
 ref|XP_010066289.1| PREDICTED: probable protein phosphatase 2C 60 [Eucalyptus grandis]
 ref|XP_010066290.1| PREDICTED: probable protein phosphatase 2C 60 [Eucalyptus grandis]
 gb|KCW64134.1| hypothetical protein EUGRSUZ_G01786 [Eucalyptus grandis]
 gb|KCW64135.1| hypothetical protein EUGRSUZ_G01786 [Eucalyptus grandis]
 gb|KCW64136.1| hypothetical protein EUGRSUZ_G01786 [Eucalyptus grandis]
 gb|KCW64137.1| hypothetical protein EUGRSUZ_G01786 [Eucalyptus grandis]
Length=385

 Score =   230 bits (586),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 131/159 (82%), Gaps = 14/159 (9%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPLYAKFRLREPFK+PILS++PSISV QLQSH         GLWEH+ 
Sbjct  235  GDVYLKKPEFNREPLYAKFRLREPFKRPILSAEPSISVHQLQSH---------GLWEHIG  285

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  286  NQEAVDIVQNHPRNGIARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  345

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAP-CATAA  463
            L+SNL      +K  ++SV+ G +NLR NTLAP CA   
Sbjct  346  LDSNLVSRASLIKSPNVSVRAGGVNLRPNTLAPYCANGT  384



>gb|ACG45008.1| protein phosphatase 2C [Zea mays]
Length=390

 Score =   230 bits (586),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 127/157 (81%), Gaps = 10/157 (6%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKK EFNREPLYAKFRLREPF KPILSS+PSISV  LQ HDQF+IFASDGLWE L+
Sbjct  235  GDAYLKKQEFNREPLYAKFRLREPFHKPILSSEPSISVQPLQPHDQFLIFASDGLWEQLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV+  PR+G ARRL++ AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVRSSPRSGCARRLIRAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAP  448
            L+S L        GP    SL   GG+  LR NTLAP
Sbjct  355  LDSGLVSQASTHRGP--TLSLRGGGGSAGLRSNTLAP  389



>gb|AFK33394.1| unknown [Medicago truncatula]
 gb|AET03718.2| serine/threonine phosphatase family, 2C domain protein [Medicago 
truncatula]
Length=392

 Score =   229 bits (585),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 129/153 (84%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLRE FK PILSSDPSISV +LQ HDQF+IFASDGLWEHLS
Sbjct  233  GDVYLKKAEFNREPLYAKFRLRETFKTPILSSDPSISVHELQEHDQFLIFASDGLWEHLS  292

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ+HP +G AR+L+K AL EAAKKREMRYSDLKKIDRGVRRHFHDDITVVV++
Sbjct  293  NQDAVDIVQNHPHSGSARKLIKVALLEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVIF  352

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAP  448
            L+SNL      V    +S++G  + L   +LAP
Sbjct  353  LDSNLVSRASTVTGPPVSLRGAGVPLPSRSLAP  385



>ref|XP_003629242.1| Protein phosphatase 2c-like protein [Medicago truncatula]
Length=393

 Score =   229 bits (585),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 129/153 (84%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLRE FK PILSSDPSISV +LQ HDQF+IFASDGLWEHLS
Sbjct  234  GDVYLKKAEFNREPLYAKFRLRETFKTPILSSDPSISVHELQEHDQFLIFASDGLWEHLS  293

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ+HP +G AR+L+K AL EAAKKREMRYSDLKKIDRGVRRHFHDDITVVV++
Sbjct  294  NQDAVDIVQNHPHSGSARKLIKVALLEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVIF  353

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAP  448
            L+SNL      V    +S++G  + L   +LAP
Sbjct  354  LDSNLVSRASTVTGPPVSLRGAGVPLPSRSLAP  386



>ref|XP_003629241.1| Protein phosphatase 2c-like protein [Medicago truncatula]
Length=387

 Score =   229 bits (584),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 129/153 (84%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFRLRE FK PILSSDPSISV +LQ HDQF+IFASDGLWEHLS
Sbjct  228  GDVYLKKAEFNREPLYAKFRLRETFKTPILSSDPSISVHELQEHDQFLIFASDGLWEHLS  287

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIVQ+HP +G AR+L+K AL EAAKKREMRYSDLKKIDRGVRRHFHDDITVVV++
Sbjct  288  NQDAVDIVQNHPHSGSARKLIKVALLEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVIF  347

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAP  448
            L+SNL      V    +S++G  + L   +LAP
Sbjct  348  LDSNLVSRASTVTGPPVSLRGAGVPLPSRSLAP  380



>gb|ACJ85664.1| unknown [Medicago truncatula]
Length=266

 Score =   225 bits (574),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 134/158 (85%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFR+ +PFK+PILSS+PSI V QLQ  DQF+IFASDGLWEH S
Sbjct  104  GDVYLKKAEFNREPLYAKFRVPQPFKRPILSSEPSILVHQLQPQDQFIIFASDGLWEHFS  163

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ++PR GIARR+VKTAL+ AAKKREMRYSDL KIDRGVRRHFHDDITV+VV+
Sbjct  164  NQEAVDIVQNNPRAGIARRMVKTALKAAAKKREMRYSDLNKIDRGVRRHFHDDITVIVVF  223

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+SNL      VK   +SV+GG +++ HNTLAP  T  
Sbjct  224  LDSNLMSRASTVKFPGISVRGGGVSIPHNTLAPFTTTT  261



>ref|NP_001048899.1| Os03g0137200 [Oryza sativa Japonica Group]
 sp|Q10S32.1|P2C28_ORYSJ RecName: Full=Probable protein phosphatase 2C 28; Short=OsPP2C28 
[Oryza sativa Japonica Group]
 gb|ABF93863.1| protein phosphatase 2C, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF10813.1| Os03g0137200 [Oryza sativa Japonica Group]
Length=399

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 136/160 (85%), Gaps = 12/160 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ E+NREPL++KFRLRE FK+PILSS+P+I+V Q+Q +D FVIFASDGLWEHLS
Sbjct  236  GDVYLKRPEYNREPLHSKFRLRETFKRPILSSEPAIAVHQIQPNDHFVIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ++PRNGIARRLVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  296  NQEAVDLVQNNPRNGIARRLVKVAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  355

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SN         GP    S+S++GG + L  N+LAP +T
Sbjct  356  LDSNAISKANWSRGP----SVSLRGGGVTLPANSLAPFST  391



>ref|XP_010426694.1| PREDICTED: probable protein phosphatase 2C 46 [Camelina sativa]
Length=380

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFN+EPLY K+RLREPFK+PILS +P+I+  ++Q  DQF+IFASDGLWE LS
Sbjct  234  GDVYLKKAEFNKEPLYTKYRLREPFKRPILSGEPTITEHEIQPQDQFLIFASDGLWEQLS  293

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVK AL+EAAKKREMRYSDLKKI+RGVRRHFHDDITVVV++
Sbjct  294  NQEAVDIVQNHPRNGIARRLVKMALQEAAKKREMRYSDLKKIERGVRRHFHDDITVVVIF  353

Query  362  LNSN-LGPVKVASLSVKGGTLNL  427
            L++N +  VK  SLS++GG +  
Sbjct  354  LDTNQVSSVKGPSLSIRGGGMTF  376



>ref|XP_010503831.1| PREDICTED: probable protein phosphatase 2C 46 [Camelina sativa]
Length=381

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFN+EPLY K+RLREPFK+PILS +P+I+  ++Q  DQF+IFASDGLWE LS
Sbjct  235  GDVYLKKAEFNKEPLYTKYRLREPFKRPILSGEPTITEHEIQPQDQFLIFASDGLWEQLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVK AL+EAAKKREMRYSDLKKI+RGVRRHFHDDITVVV++
Sbjct  295  NQEAVDIVQNHPRNGIARRLVKMALQEAAKKREMRYSDLKKIERGVRRHFHDDITVVVIF  354

Query  362  LNSN-LGPVKVASLSVKGGTLNL  427
            L++N +  VK  SLS++GG +  
Sbjct  355  LDTNQVSSVKGPSLSIRGGGMTF  377



>ref|XP_010229239.1| PREDICTED: probable protein phosphatase 2C 28 [Brachypodium distachyon]
Length=399

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 133/159 (84%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ E+NR PL++KFRLRE FKKPIL S+P+I+  Q+Q  DQFVIFASDGLWEHLS
Sbjct  236  GDVYLKRPEYNRTPLHSKFRLRETFKKPILRSEPAIAEHQIQPSDQFVIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ +PRNGIARRLVK A++EAAKKREMRYSDLKKI+RGVRRHFHDDITVVVV+
Sbjct  296  NQEAVDLVQSNPRNGIARRLVKAAMQEAAKKREMRYSDLKKIERGVRRHFHDDITVVVVF  355

Query  362  LNSN----LGPVKVASLSVKGGTLNLRHNTLAPCATAAM  466
            L++N     G  K  S+SV+GG +++R N+LAP     M
Sbjct  356  LDANAASKAGWSKSPSVSVRGGGVSVRANSLAPFLAPTM  394



>gb|EMT20424.1| Putative protein phosphatase 2C 60 [Aegilops tauschii]
Length=365

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 131/157 (83%), Gaps = 12/157 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKK EFNREPLYAKFRLREPF +PILSS+PSI V  +Q HD+F+IFASDGLWEHL+
Sbjct  208  GDAYLKKQEFNREPLYAKFRLREPFNRPILSSEPSICVQPIQPHDEFIIFASDGLWEHLT  267

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ  PR+G ARRL+K+AL EAAKKREMRYSDLKKIDRGVRRHFHDDITV+++Y
Sbjct  268  NQEAVDIVQSSPRSGSARRLIKSALLEAAKKREMRYSDLKKIDRGVRRHFHDDITVIILY  327

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAP  448
            L+S+L        GP    ++S++G  ++LR +TLAP
Sbjct  328  LDSSLVSRASTHRGP----AVSLRGAGVSLRSSTLAP  360



>gb|EMS54114.1| putative protein phosphatase 2C 60 [Triticum urartu]
Length=392

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 131/157 (83%), Gaps = 12/157 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKK EFNREPLYAKFRLREPF +PILSS+PSI V  +Q HD+F+IFASDGLWEHL+
Sbjct  235  GDAYLKKQEFNREPLYAKFRLREPFNRPILSSEPSICVQPIQPHDEFLIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ  PR+G ARRL+K+AL EAAKKREMRYSDLKKIDRGVRRHFHDDITV+++Y
Sbjct  295  NQEAVDIVQSSPRSGSARRLIKSALLEAAKKREMRYSDLKKIDRGVRRHFHDDITVIILY  354

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAP  448
            L+S+L        GP    ++S++G  ++LR +TLAP
Sbjct  355  LDSSLVSRASTHRGP----AVSLRGAGVSLRSSTLAP  387



>dbj|BAK01278.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=392

 Score =   228 bits (580),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 131/157 (83%), Gaps = 12/157 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKK EFNREPLYAKFRLREPF +PILSS+PSI V  +Q HD+F+IFASDGLWEHL+
Sbjct  235  GDAYLKKQEFNREPLYAKFRLREPFNRPILSSEPSICVQPIQPHDEFLIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ  PR+G ARRL+K+AL EAAKKREMRYSDLKKIDRGVRRHFHDDITV+++Y
Sbjct  295  NQEAVDIVQSSPRSGSARRLIKSALLEAAKKREMRYSDLKKIDRGVRRHFHDDITVIILY  354

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAP  448
            L+S+L        GP    ++S++G  ++LR +TLAP
Sbjct  355  LDSSLVSRASTYRGP----AVSLRGAGVSLRSSTLAP  387



>ref|XP_002876083.1| hypothetical protein ARALYDRAFT_485488 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52342.1| hypothetical protein ARALYDRAFT_485488 [Arabidopsis lyrata subsp. 
lyrata]
Length=374

 Score =   227 bits (578),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFN+EPLY K+R+REPFK+PILS +P+I+  ++Q  DQF+IFASDGLWE LS
Sbjct  228  GDVYLKKAEFNKEPLYTKYRIREPFKRPILSGEPTITEHEIQPQDQFLIFASDGLWEQLS  287

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVK AL+EAAKKREMRYSDLKKI+RGVRRHFHDDITVVV++
Sbjct  288  NQEAVDIVQNHPRNGIARRLVKMALQEAAKKREMRYSDLKKIERGVRRHFHDDITVVVIF  347

Query  362  LNSN-LGPVKVASLSVKGGTLNL  427
            L++N +  VK  SLS++GG +  
Sbjct  348  LDTNQVSSVKGPSLSIRGGGMTF  370



>ref|XP_006340779.1| PREDICTED: probable protein phosphatase 2C 60-like isoform X1 
[Solanum tuberosum]
 ref|XP_006340780.1| PREDICTED: probable protein phosphatase 2C 60-like isoform X2 
[Solanum tuberosum]
Length=390

 Score =   227 bits (579),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 130/156 (83%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLK  E+N+EPLYAKFRLREPF +PILS+DP+ISV +LQ HDQF+I ASDGLWEHLS
Sbjct  235  GDLYLKNTEYNKEPLYAKFRLREPFTRPILSADPAISVHELQPHDQFLILASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+  R G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDI+V+VV+
Sbjct  295  NQEAVDIVQNSSRKGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDISVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      ++  S+S++GG +N    +LAP  T
Sbjct  355  LDSNLVSRASSLRGPSVSLRGGGMNFPAKSLAPTPT  390



>ref|XP_009803756.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009803763.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Nicotiana 
sylvestris]
Length=390

 Score =   227 bits (578),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 133/156 (85%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLK AE+N+EPLYAKFRLREPFK+P+LS+DPSISV +L+ HDQF+I ASDGLWEHLS
Sbjct  235  GDLYLKNAEYNKEPLYAKFRLREPFKRPLLSADPSISVHELEPHDQFLILASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+   +G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDI+V+VV+
Sbjct  295  NQEAVDIVQNSSHSGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDISVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      ++  S+S++GG +NL   +LAP  T
Sbjct  355  LDSNLVSRATSLRGPSVSLRGGGVNLLARSLAPTPT  390



>gb|EAY88457.1| hypothetical protein OsI_09922 [Oryza sativa Indica Group]
Length=394

 Score =   227 bits (579),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 134/157 (85%), Gaps = 12/157 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ E+NREPL++KFRLRE FK+PILSS+P+I+V Q+Q +D FVIFASDGLWEHLS
Sbjct  231  GDVYLKRPEYNREPLHSKFRLRETFKRPILSSEPAIAVHQIQPNDHFVIFASDGLWEHLS  290

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ++PRNGIARRLVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  291  NQEAVDLVQNNPRNGIARRLVKVAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  350

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAP  448
            L+SN         GP    S+S++GG + L  N+LAP
Sbjct  351  LDSNAISKANWSRGP----SVSLRGGGVTLPANSLAP  383



>ref|NP_001065203.1| Os10g0544900 [Oryza sativa Japonica Group]
 sp|Q7XCJ7.1|P2C72_ORYSJ RecName: Full=Probable protein phosphatase 2C 72; Short=OsPP2C72 
[Oryza sativa Japonica Group]
 gb|AAP54876.1| protein phosphatase 2C, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27117.1| Os10g0544900 [Oryza sativa Japonica Group]
 dbj|BAG99722.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67386.1| hypothetical protein OsI_34528 [Oryza sativa Indica Group]
 gb|EEE69065.1| hypothetical protein OsJ_28079 [Oryza sativa Japonica Group]
Length=393

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 133/154 (86%), Gaps = 7/154 (5%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPL++KFRL+E F++P+LSS+P+I V QLQ+ DQF+IFASDGLWEH+S
Sbjct  237  GDVYLKKPEFNREPLHSKFRLQETFRRPLLSSEPAIVVHQLQTTDQFIIFASDGLWEHIS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQH+PRNGIARRLVK A+++AAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  297  NQEAVDLVQHNPRNGIARRLVKAAMQQAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  356

Query  362  LNSNLGPVKVA-----SLSVKGGTLNLRHNTLAP  448
             +SN   +  A     S+S++GG + L  N+LAP
Sbjct  357  FDSN--AITTANWSRPSVSLRGGGVTLPANSLAP  388



>dbj|BAK02779.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=474

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 134/159 (84%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ E+NR PL++KFRLRE FKKPILSS+P+I+V Q+Q  DQFVIFASDGLWEHLS
Sbjct  311  GDVYLKRPEYNRTPLHSKFRLRETFKKPILSSEPAIAVHQIQPSDQFVIFASDGLWEHLS  370

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ +PRNGIAR+LVK A++EAAKKREMRYSDLKKI+RGVRRHFHDDITVVVV+
Sbjct  371  NQEAVDLVQTNPRNGIARKLVKAAMQEAAKKREMRYSDLKKIERGVRRHFHDDITVVVVF  430

Query  362  LN----SNLGPVKVASLSVKGGTLNLRHNTLAPCATAAM  466
            L+    S  G  K  S+SV+GG +++  N+LAP +   M
Sbjct  431  LDASAVSRAGWSKSPSVSVRGGGVSVPANSLAPFSAPTM  469



>ref|XP_004232521.1| PREDICTED: probable protein phosphatase 2C 60 [Solanum lycopersicum]
Length=390

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/153 (71%), Positives = 129/153 (84%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLK AE+N+EPLYAKFRLREPF +PILS+DP+ISV +LQ HDQF+I ASDGLWEHLS
Sbjct  235  GDLYLKNAEYNKEPLYAKFRLREPFTRPILSADPAISVHELQPHDQFLILASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+    G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDI+V+VV+
Sbjct  295  NQEAVDIVQNSSHKGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDISVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAP  448
            L+SNL      ++  S+S+KGG +N    +LAP
Sbjct  355  LDSNLVSRASSLRGPSVSLKGGGMNFPAKSLAP  387



>gb|AAK20060.1|AC025783_20 putative protein phosphatase 2C [Oryza sativa Japonica Group]
Length=388

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 133/154 (86%), Gaps = 7/154 (5%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPL++KFRL+E F++P+LSS+P+I V QLQ+ DQF+IFASDGLWEH+S
Sbjct  232  GDVYLKKPEFNREPLHSKFRLQETFRRPLLSSEPAIVVHQLQTTDQFIIFASDGLWEHIS  291

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQH+PRNGIARRLVK A+++AAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  292  NQEAVDLVQHNPRNGIARRLVKAAMQQAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  351

Query  362  LNSNLGPVKVA-----SLSVKGGTLNLRHNTLAP  448
             +SN   +  A     S+S++GG + L  N+LAP
Sbjct  352  FDSN--AITTANWSRPSVSLRGGGVTLPANSLAP  383



>ref|NP_974411.1| putative protein phosphatase 2C [Arabidopsis thaliana]
 gb|AEE78785.1| putative protein phosphatase 2C [Arabidopsis thaliana]
Length=294

 Score =   223 bits (569),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFN+EPLY K+R+REPFK+PILS +P+I+  ++Q  D+F+IFASDGLWE +S
Sbjct  148  GDVYLKKAEFNKEPLYTKYRIREPFKRPILSGEPTITEHEIQPQDKFLIFASDGLWEQMS  207

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVK AL+EAAKKREMRYSDLKKI+RGVRRHFHDDITVV+++
Sbjct  208  NQEAVDIVQNHPRNGIARRLVKMALQEAAKKREMRYSDLKKIERGVRRHFHDDITVVIIF  267

Query  362  LNSN-LGPVKVASLSVKGGTLNL  427
            L++N +  VK   LS++GG +  
Sbjct  268  LDTNQVSSVKGPPLSIRGGGMTF  290



>ref|XP_010515547.1| PREDICTED: probable protein phosphatase 2C 46 [Camelina sativa]
Length=380

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFN+EPLY K+RLREPFK+PILS +P+I+  ++Q  DQF+IFASDGLWE LS
Sbjct  234  GDVYLKKAEFNKEPLYTKYRLREPFKRPILSGEPTITEHEIQPQDQFLIFASDGLWEQLS  293

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVK AL+EAAKKREMRYSDLKKI+RGVRRHFHDDITVVV++
Sbjct  294  NQEAVDIVQNHPRNGIARRLVKMALQEAAKKREMRYSDLKKIERGVRRHFHDDITVVVIF  353

Query  362  LNSN-LGPVKVASLSVKGGTLNL  427
            L++N +  VK   LS++GG +  
Sbjct  354  LDTNQVSSVKGPPLSIRGGGMTF  376



>gb|AFK44879.1| unknown [Medicago truncatula]
Length=191

 Score =   219 bits (559),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 132/158 (84%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFR+ +PFK+PILSS+P I V QLQ  DQF+IFASDGLWEH S
Sbjct  29   GDVYLKKAEFNREPLYAKFRVPQPFKRPILSSEPPILVHQLQPQDQFIIFASDGLWEHFS  88

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ++P  GIARR+VKTAL+ AAKKREMRYSDL KIDRGVRRHFHDDITV+VV+
Sbjct  89   NQEAVDIVQNNPHAGIARRMVKTALKAAAKKREMRYSDLNKIDRGVRRHFHDDITVIVVF  148

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+SNL      VK   +SV+GG +++ HNTLAP  T  
Sbjct  149  LDSNLMSRASTVKFPGISVRGGGVSIPHNTLAPFTTTT  186



>ref|XP_004985788.1| PREDICTED: probable protein phosphatase 2C 28-like [Setaria italica]
Length=399

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 132/158 (84%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ EFNREPL++KFRLRE F+KPILSSDP I+  ++Q +DQFVIFASDGLWEHLS
Sbjct  236  GDVYLKRPEFNREPLHSKFRLRETFQKPILSSDPQITEHRIQPNDQFVIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ+ PRNGIAR+LVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITVVV++
Sbjct  296  NQEAVDLVQNSPRNGIARKLVKVAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVIF  355

Query  362  LNSN----LGPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+SN        K  S+S++GG + L   +LAP +  A
Sbjct  356  LDSNAMSKASWSKSPSVSIRGGGVTLPAKSLAPFSAPA  393



>ref|XP_010444839.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 79 [Camelina sativa]
Length=387

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 126/147 (86%), Gaps = 5/147 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLKKAEFNREPLY KFRLREP K+PILS +PSI+V  LQS DQF+IFASDGLWE LS
Sbjct  237  GDLYLKKAEFNREPLYTKFRLREPMKRPILSGEPSITVHDLQSDDQFLIFASDGLWEQLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV+IVQ+HPRNGIARRLVK AL EAAKKREMRYSDL KI+RGVRRHFHDDITVVV++
Sbjct  297  NQEAVEIVQNHPRNGIARRLVKAALLEAAKKREMRYSDLNKIERGVRRHFHDDITVVVLF  356

Query  362  LNSNL-----GPVKVASLSVKGGTLNL  427
            L++NL       +K  S+S++GG + L
Sbjct  357  LDTNLLSRATSSLKTPSVSIRGGGITL  383



>gb|EMT06776.1| Putative protein phosphatase 2C 28 [Aegilops tauschii]
Length=513

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 135/159 (85%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ E+NR PL++KFRLRE FKKPILSS+P+I+V Q+Q  DQFVIFASDGLWEHLS
Sbjct  186  GDVYLKRPEYNRSPLHSKFRLRETFKKPILSSEPAIAVHQIQPSDQFVIFASDGLWEHLS  245

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ +PRNGIAR+LVK A++EAAKKREMRYSDLKKI+RGVRRHFHDDITVVVV+
Sbjct  246  NQEAVDLVQSNPRNGIARKLVKAAMQEAAKKREMRYSDLKKIERGVRRHFHDDITVVVVF  305

Query  362  LN----SNLGPVKVASLSVKGGTLNLRHNTLAPCATAAM  466
            L+    S  G  K  S+SV+GG +++  N+LAP +  AM
Sbjct  306  LDASAVSRAGWSKSPSVSVRGGGVSVPANSLAPFSAPAM  344



>ref|XP_010526549.1| PREDICTED: probable protein phosphatase 2C 64 [Tarenaya hassleriana]
Length=392

 Score =   226 bits (575),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 131/161 (81%), Gaps = 12/161 (7%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK++EFNREPL  KFRLRE F KPILS++P+I+V QLQ HDQF+I ASDGLWEHLS
Sbjct  232  GDVYLKRSEFNREPLLPKFRLRERFSKPILSAEPAITVHQLQPHDQFIICASDGLWEHLS  291

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPR+GIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  292  NQEAVDIVQNHPRSGIAKRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  351

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAPCATA  460
            L+  L        GP    ++SV+G  L+   NTLAP   A
Sbjct  352  LDYELVSRARARAGP----AVSVRGAGLSYPPNTLAPTQAA  388



>gb|EPS71472.1| hypothetical protein M569_03278, partial [Genlisea aurea]
Length=380

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 130/151 (86%), Gaps = 2/151 (1%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAE+N+EPL+ KFRLREPF+KPILSS+PSI+  QL  HDQF+IFASDGLWEHLS
Sbjct  230  GDVYLKKAEYNKEPLHHKFRLREPFRKPILSSEPSITAHQLLPHDQFIIFASDGLWEHLS  289

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+V++ PR+G ARRLVK AL+EAA+KREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  290  NQEAVDLVKNQPRSGSARRLVKAALQEAARKREMRYSDLKKIDRGVRRHFHDDITVVVVF  349

Query  362  LNSNLGPVKVA--SLSVKGGTLNLRHNTLAP  448
            L+S+LG        +S+KGG ++L    LAP
Sbjct  350  LDSHLGGSDRVGPGVSIKGGGISLPGRALAP  380



>ref|XP_010484688.1| PREDICTED: probable protein phosphatase 2C 79 [Camelina sativa]
Length=387

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 126/147 (86%), Gaps = 5/147 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLKKAEFNREPLY KFRLREP K+PILS +PSI+V  LQS DQF+IFASDGLWE LS
Sbjct  237  GDLYLKKAEFNREPLYTKFRLREPMKRPILSGEPSITVHDLQSDDQFLIFASDGLWEQLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV+IVQ+HPRNGIARRLVK AL EAAKKREMRYSDL KI+RGVRRHFHDDITV+V++
Sbjct  297  NQEAVEIVQNHPRNGIARRLVKAALLEAAKKREMRYSDLNKIERGVRRHFHDDITVIVLF  356

Query  362  LNSNL-----GPVKVASLSVKGGTLNL  427
            L++NL       +K  S+S++GG + L
Sbjct  357  LDTNLLSKASSSLKTPSVSIRGGGITL  383



>ref|XP_006649361.1| PREDICTED: probable protein phosphatase 2C 28-like [Oryza brachyantha]
Length=399

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 133/157 (85%), Gaps = 12/157 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ E+NREPL++KFRLRE FK+PILSS+P+I V Q+Q +D FVIFASDGLWEHLS
Sbjct  236  GDVYLKRPEYNREPLHSKFRLRETFKRPILSSEPAIVVHQIQPNDHFVIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ +PRNGIARRLVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITVVV++
Sbjct  296  NQEAVDLVQSNPRNGIARRLVKVAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVIF  355

Query  362  LNSNL--------GPVKVASLSVKGGTLNLRHNTLAP  448
            L+SN         GP    S+S++GG ++L  N+LAP
Sbjct  356  LDSNAISKANWSRGP----SVSLRGGGVSLPANSLAP  388



>gb|ABR18015.1| unknown [Picea sitchensis]
Length=209

 Score =   219 bits (558),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/159 (69%), Positives = 127/159 (80%), Gaps = 11/159 (7%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPLY KFRL EP + PIL+++PSI+V  LQ HDQF+IFASDGLWEHLS
Sbjct  49   GDVYLKKPEFNREPLYQKFRLSEPLRGPILTAEPSINVHTLQPHDQFIIFASDGLWEHLS  108

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV +HP  G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  109  NQEAVDIVHNHPHAGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  168

Query  362  LNSNL-------GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+ +L       GP    ++S+ GG   +  N+LAP +T
Sbjct  169  LDHSLISKFSSRGP----TISIIGGGTTVPSNSLAPDST  203



>gb|KEH44379.1| serine/threonine phosphatase family, 2C domain protein [Medicago 
truncatula]
Length=397

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 134/158 (85%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFR+ +PFK+PILSS+PSI V QLQ  DQF+IFASDGLWEH S
Sbjct  235  GDVYLKKAEFNREPLYAKFRVPQPFKRPILSSEPSILVHQLQPQDQFIIFASDGLWEHFS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ++PR GIARR+VKTAL+ AAKKREMRYSDL KIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNNPRAGIARRMVKTALKAAAKKREMRYSDLNKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+SNL      VK   +SV+GG +++ HNTLAP  T  
Sbjct  355  LDSNLMSRASTVKFPGISVRGGGVSIPHNTLAPFTTTT  392



>ref|XP_006662022.1| PREDICTED: probable protein phosphatase 2C 72-like [Oryza brachyantha]
Length=393

 Score =   225 bits (573),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 130/152 (86%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPL++KFRL E F++P+LSS+P+I V QLQ+ DQF+IFASDGLWEH+S
Sbjct  237  GDVYLKKPEFNREPLHSKFRLHETFRRPLLSSEPAIVVHQLQATDQFIIFASDGLWEHIS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQH+PRNGIARRLVK A+++AAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  297  NQEAVDLVQHNPRNGIARRLVKAAMQQAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  356

Query  362  LNSN---LGPVKVASLSVKGGTLNLRHNTLAP  448
             +SN          S+S++GG + L  N+LAP
Sbjct  357  FDSNAITTASWSRPSVSLRGGGIILPANSLAP  388



>ref|XP_008440869.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Cucumis 
melo]
 ref|XP_008440870.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Cucumis 
melo]
 ref|XP_008440871.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Cucumis 
melo]
 ref|XP_008440872.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Cucumis 
melo]
Length=398

 Score =   225 bits (573),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 128/156 (82%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPLYAKFRLREPF +PILS +PSISV +LQ HDQF+IFASDGLWEH+S
Sbjct  235  GDVYLKKPEFNREPLYAKFRLREPFTRPILSCEPSISVYELQPHDQFIIFASDGLWEHIS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVD+++ HP NG A+RLVK A+ EAAKKREMRYSDLK IDRG+RRHFHDDITV+VV+
Sbjct  295  NQQAVDLIRSHPHNGSAKRLVKFAMLEAAKKREMRYSDLKDIDRGIRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      V+  + S++G  + L   +LA C T
Sbjct  355  LDSNLVSRASSVRGPTTSLRGCGVILPTKSLARCTT  390



>ref|XP_006291300.1| hypothetical protein CARUB_v10017436mg [Capsella rubella]
 gb|EOA24198.1| hypothetical protein CARUB_v10017436mg [Capsella rubella]
Length=379

 Score =   224 bits (571),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFN+EPLY K+RLREPFK+PILS +P+I+  ++Q  D+F+IFASDGLWE LS
Sbjct  233  GDVYLKKAEFNKEPLYTKYRLREPFKRPILSGEPTITEHEIQPQDKFLIFASDGLWEQLS  292

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVK AL+EAAKKREMRYSDLKKI+RGVRRHFHDDITVVV++
Sbjct  293  NQEAVDIVQNHPRNGIARRLVKMALQEAAKKREMRYSDLKKIERGVRRHFHDDITVVVIF  352

Query  362  LNSN-LGPVKVASLSVKGGTLNL  427
            L++N +  VK   LS++GG +  
Sbjct  353  LDTNQVSSVKGPPLSIRGGGMTF  375



>ref|XP_008440874.1| PREDICTED: probable protein phosphatase 2C 60 isoform X2 [Cucumis 
melo]
 ref|XP_008440875.1| PREDICTED: probable protein phosphatase 2C 60 isoform X2 [Cucumis 
melo]
 ref|XP_008440876.1| PREDICTED: probable protein phosphatase 2C 60 isoform X2 [Cucumis 
melo]
Length=393

 Score =   224 bits (572),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 128/156 (82%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPLYAKFRLREPF +PILS +PSISV +LQ HDQF+IFASDGLWEH+S
Sbjct  230  GDVYLKKPEFNREPLYAKFRLREPFTRPILSCEPSISVYELQPHDQFIIFASDGLWEHIS  289

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVD+++ HP NG A+RLVK A+ EAAKKREMRYSDLK IDRG+RRHFHDDITV+VV+
Sbjct  290  NQQAVDLIRSHPHNGSAKRLVKFAMLEAAKKREMRYSDLKDIDRGIRRHFHDDITVIVVF  349

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      V+  + S++G  + L   +LA C T
Sbjct  350  LDSNLVSRASSVRGPTTSLRGCGVILPTKSLARCTT  385



>ref|XP_008643604.1| PREDICTED: LOC100281412 isoform X1 [Zea mays]
 ref|XP_008643605.1| PREDICTED: LOC100281412 isoform X1 [Zea mays]
 ref|XP_008643606.1| PREDICTED: LOC100281412 isoform X1 [Zea mays]
 gb|ACN34437.1| unknown [Zea mays]
 gb|AFW69527.1| protein phosphatase 2C isoform 1 [Zea mays]
 gb|AFW69528.1| protein phosphatase 2C isoform 2 [Zea mays]
 gb|AIB05422.1| orphans transcription factor, partial [Zea mays]
Length=394

 Score =   224 bits (572),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 129/159 (81%), Gaps = 14/159 (9%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKK EFNREPLY KFRLREPF KPILSS+PSI+V  LQ HDQF+IFASDGLWEHL+
Sbjct  235  GDAYLKKQEFNREPLYVKFRLREPFHKPILSSEPSINVQPLQPHDQFLIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PR+G ARRL++ AL+ AAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVHSSPRSGCARRLIRAALQVAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL--------GPVKVASLSVKGG--TLNLRHNTLAP  448
            L+S+L        GP    +LS++GG  +  LR NTLAP
Sbjct  355  LDSSLVSKASTHRGP----TLSLRGGGASAGLRSNTLAP  389



>gb|ACG29902.1| protein phosphatase 2C [Zea mays]
Length=392

 Score =   224 bits (571),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 129/159 (81%), Gaps = 14/159 (9%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKK EFNREPLY KFRLREPF KPILSS+PSI+V  LQ HDQF+IFASDGLWEHL+
Sbjct  235  GDAYLKKQEFNREPLYVKFRLREPFHKPILSSEPSINVRPLQPHDQFLIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PR+G ARRL++ AL+ AAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVHSSPRSGCARRLIRAALQVAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL--------GPVKVASLSVKGG--TLNLRHNTLAP  448
            L+S+L        GP    +LS++GG  +  LR NTLAP
Sbjct  355  LDSSLVSKASAHRGP----TLSLRGGGASAGLRSNTLAP  389



>ref|XP_009602153.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana tomentosiformis]
 ref|XP_009602154.1| PREDICTED: probable protein phosphatase 2C 60 [Nicotiana tomentosiformis]
Length=385

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 133/156 (85%), Gaps = 9/156 (6%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLK AE+N+EPLYAKFRLREPFK+P+LS+DPSISV +L++HDQF+IFASDGLWEHLS
Sbjct  235  GDLYLKNAEYNKEPLYAKFRLREPFKRPLLSADPSISVHELETHDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+    G ARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDI+V+VV+
Sbjct  295  NQEAVDIVQNSSHRGSARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDISVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      ++  S+S++GG+      +LAP +T
Sbjct  355  LDSNLVSRATSLRGPSVSLRGGS-----RSLAPTST  385



>ref|XP_008447929.1| PREDICTED: probable protein phosphatase 2C 60 isoform X1 [Cucumis 
melo]
Length=390

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 129/156 (83%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFR++EPF+ P LSS+P+IS +QL+  DQFVIFASDGLWEHLS
Sbjct  233  GDVYLKKAEFNREPLYAKFRVQEPFRTPFLSSEPAISEIQLKPDDQFVIFASDGLWEHLS  292

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV  H ++G ARRLV+ AL+ AAKKREMRYSDLKKI RGVRRHFHDDITVVVV+
Sbjct  293  NQEAVDIVHSHNQSGSARRLVRAALQVAAKKREMRYSDLKKIGRGVRRHFHDDITVVVVF  352

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L++NL       K  S+S++GG LN   N+L+P  T
Sbjct  353  LDTNLLFKASSTKSMSVSLRGGGLNRLPNSLSPLTT  388



>ref|XP_004146159.1| PREDICTED: probable protein phosphatase 2C 60-like [Cucumis sativus]
 ref|XP_004159731.1| PREDICTED: probable protein phosphatase 2C 60-like [Cucumis sativus]
 gb|KGN55637.1| hypothetical protein Csa_3G002570 [Cucumis sativus]
Length=390

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 125/153 (82%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPLY KFRLREPF +PILSS+P++SV +L  +DQF+IFASDGLWEHLS
Sbjct  238  GDVYLKKPEFNREPLYTKFRLREPFSRPILSSEPAVSVHELDPNDQFLIFASDGLWEHLS  297

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIV  HP +G ARRLVK A++EAAKKREMRYSDLKKIDRGVRRHFHDD TV+VV+
Sbjct  298  NQDAVDIVHKHPHSGSARRLVKAAMQEAAKKREMRYSDLKKIDRGVRRHFHDDTTVIVVF  357

Query  362  LNSNLGPVKVAS----LSVKGGTLNLRHNTLAP  448
            L S+ G          LSV+GG +NL   +LAP
Sbjct  358  LGSSRGSNATGGGSPVLSVRGGGVNLSAKSLAP  390



>ref|NP_001130554.1| protein phosphatase 2C isoform 1 [Zea mays]
 ref|XP_008658019.1| PREDICTED: protein phosphatase 2C isoform 1 isoform X1 [Zea mays]
 gb|ACF78817.1| unknown [Zea mays]
 gb|ACG33728.1| protein phosphatase 2C [Zea mays]
 gb|ACN28452.1| unknown [Zea mays]
 gb|ACN28986.1| unknown [Zea mays]
 gb|ACN36242.1| unknown [Zea mays]
 gb|AFW89613.1| protein phosphatase 2C isoform 1 [Zea mays]
 gb|AFW89614.1| protein phosphatase 2C isoform 2 [Zea mays]
 gb|AFW89615.1| protein phosphatase 2C isoform 3 [Zea mays]
 gb|AIB05669.1| orphans transcription factor, partial [Zea mays]
Length=399

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 131/158 (83%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK E+NREPL++KFRLRE F+KPILSS+P I+  ++Q +DQFVIFASDGLWEHLS
Sbjct  236  GDVYLKKPEYNREPLHSKFRLRETFQKPILSSEPQITEHRIQPNDQFVIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ  PRNGIARRLVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  296  NQEAVDLVQSSPRNGIARRLVKAAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  355

Query  362  LNSN----LGPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+S+        K  S+S++GG + L   +LAP +  A
Sbjct  356  LDSDAMSKASWSKSPSVSLRGGGVTLPAKSLAPFSAPA  393



>ref|NP_566949.2| putative protein phosphatase 2C [Arabidopsis thaliana]
 sp|Q9SD12.1|P2C46_ARATH RecName: Full=Probable protein phosphatase 2C 46; Short=AtPP2C46; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB63001.1| protein phosphatase 2C-like protein [Arabidopsis thaliana]
 gb|AEE78784.1| putative protein phosphatase 2C [Arabidopsis thaliana]
Length=379

 Score =   222 bits (566),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFN+EPLY K+R+REPFK+PILS +P+I+  ++Q  D+F+IFASDGLWE +S
Sbjct  233  GDVYLKKAEFNKEPLYTKYRIREPFKRPILSGEPTITEHEIQPQDKFLIFASDGLWEQMS  292

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVK AL+EAAKKREMRYSDLKKI+RGVRRHFHDDITVV+++
Sbjct  293  NQEAVDIVQNHPRNGIARRLVKMALQEAAKKREMRYSDLKKIERGVRRHFHDDITVVIIF  352

Query  362  LNSN-LGPVKVASLSVKGGTLNL  427
            L++N +  VK   LS++GG +  
Sbjct  353  LDTNQVSSVKGPPLSIRGGGMTF  375



>emb|CDY16313.1| BnaC01g23480D [Brassica napus]
Length=377

 Score =   222 bits (565),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 126/148 (85%), Gaps = 10/148 (7%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY K+RLREP K+PILS +PSI+  ++Q HDQF+IFASDGLWE +S
Sbjct  230  GDVYLKKAEFNREPLYTKYRLREPMKRPILSGEPSITEHEIQPHDQFLIFASDGLWEQMS  289

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVK AL+ AAKKREMRY+DLKKI+RGVRRHFHDDITVVV++
Sbjct  290  NQEAVDIVQNHPRNGIARRLVKMALQAAAKKREMRYTDLKKIERGVRRHFHDDITVVVIF  349

Query  362  LNSNL------GPVKVASLSVKGGTLNL  427
            L++N+      GP    S+S++GG +  
Sbjct  350  LDTNVMSSAKGGP----SVSIRGGGMTF  373



>ref|NP_001147802.1| LOC100281412 [Zea mays]
 gb|ACG28741.1| protein phosphatase 2C [Zea mays]
Length=392

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 128/159 (81%), Gaps = 14/159 (9%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
             D YLKK EFNREPLY KFRLREPF KPILSS+PSI+V  LQ HDQF+IFASDGLWEHL+
Sbjct  235  ADAYLKKQEFNREPLYVKFRLREPFHKPILSSEPSINVQPLQPHDQFLIFASDGLWEHLT  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PR+G ARRL++ AL+ AAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVHSSPRSGCARRLIRAALQVAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL--------GPVKVASLSVKGG--TLNLRHNTLAP  448
            L+S+L        GP    +LS++GG  +  LR NTLAP
Sbjct  355  LDSSLVSKASAHRGP----TLSLRGGGASAGLRSNTLAP  389



>emb|CDX73725.1| BnaC08g22780D [Brassica napus]
Length=377

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLKKAEFNREPLY K+RLREP K+PILS +PSI+  +LQ  DQF+IFASDGLWE LS
Sbjct  231  GDMYLKKAEFNREPLYTKYRLREPIKRPILSGEPSITEHELQPQDQFLIFASDGLWEQLS  290

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVKTA++ AAKKREMRYSDL KI+RGVRRHFHDDITVVV+Y
Sbjct  291  NQEAVDIVQNHPRNGIARRLVKTAMQAAAKKREMRYSDLMKIERGVRRHFHDDITVVVIY  350

Query  362  LNSN-LGPVKVASLSVKG  412
            L++N +   K  SLS++G
Sbjct  351  LDTNVVSSAKGPSLSIRG  368



>ref|XP_004135015.1| PREDICTED: probable protein phosphatase 2C 60-like [Cucumis sativus]
 ref|XP_004166973.1| PREDICTED: probable protein phosphatase 2C 60-like [Cucumis sativus]
Length=393

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 128/156 (82%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPLY+KFRLREPF +P+LS +PSI+V +LQ HDQF+IFASDGLWEH+S
Sbjct  230  GDVYLKKPEFNREPLYSKFRLREPFTRPLLSCEPSIAVYELQPHDQFIIFASDGLWEHIS  289

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVD+++ HP NG A+RLVK A+ EAAKKREMRYSDLK IDRG+RRHFHDDITV+VV+
Sbjct  290  NQQAVDLIRSHPHNGSAKRLVKVAMLEAAKKREMRYSDLKDIDRGIRRHFHDDITVIVVF  349

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      V+  + S++G  + L   +LA C T
Sbjct  350  LDSNLVSRASSVRGPTTSLRGCGVILPTKSLARCTT  385



>gb|EMS61157.1| putative protein phosphatase 2C 28 [Triticum urartu]
Length=550

 Score =   226 bits (576),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 133/159 (84%), Gaps = 4/159 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ E+NR PL++KFRLRE FKKPILSS+P+I+V Q+Q  DQFVIFASDGLWEHLS
Sbjct  177  GDVYLKRPEYNRSPLHSKFRLRETFKKPILSSEPAIAVHQIQPSDQFVIFASDGLWEHLS  236

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ +PRNGIAR+LVK A++EAAKKREMRYSDLKKI+RGVRRHFHDDITVVVV+
Sbjct  237  NQEAVDLVQSNPRNGIARKLVKAAMQEAAKKREMRYSDLKKIERGVRRHFHDDITVVVVF  296

Query  362  LN----SNLGPVKVASLSVKGGTLNLRHNTLAPCATAAM  466
            L+    S  G  K   +SV+GG +++  N+LAP +   M
Sbjct  297  LDASAVSRAGWSKSPPVSVRGGGVSVPANSLAPFSAPTM  335



>gb|KGN48956.1| hypothetical protein Csa_6G507290 [Cucumis sativus]
Length=398

 Score =   222 bits (565),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 128/156 (82%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPLY+KFRLREPF +P+LS +PSI+V +LQ HDQF+IFASDGLWEH+S
Sbjct  235  GDVYLKKPEFNREPLYSKFRLREPFTRPLLSCEPSIAVYELQPHDQFIIFASDGLWEHIS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVD+++ HP NG A+RLVK A+ EAAKKREMRYSDLK IDRG+RRHFHDDITV+VV+
Sbjct  295  NQQAVDLIRSHPHNGSAKRLVKVAMLEAAKKREMRYSDLKDIDRGIRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L+SNL      V+  + S++G  + L   +LA C T
Sbjct  355  LDSNLVSRASSVRGPTTSLRGCGVILPTKSLARCTT  390



>ref|XP_004144860.1| PREDICTED: probable protein phosphatase 2C 60-like [Cucumis sativus]
 ref|XP_004164213.1| PREDICTED: probable protein phosphatase 2C 60-like [Cucumis sativus]
 gb|KGN43269.1| hypothetical protein Csa_7G014550 [Cucumis sativus]
Length=390

 Score =   221 bits (564),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 130/156 (83%), Gaps = 4/156 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFR++EPF+ P LS++P+IS +QL+  DQFVIFASDGLWEHLS
Sbjct  233  GDVYLKKAEFNREPLYAKFRVQEPFRTPFLSAEPAISEIQLKPDDQFVIFASDGLWEHLS  292

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV  H ++G A+RLV+ AL+ AAKKREMRYSDLKKI RGVRRHFHDDITVVVV+
Sbjct  293  NQEAVDIVHSHKQSGSAKRLVRAALQIAAKKREMRYSDLKKIGRGVRRHFHDDITVVVVF  352

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCAT  457
            L++NL      +K  S+S++GG LN   N+L+P  T
Sbjct  353  LDTNLLFKASSMKSMSVSLRGGGLNRLPNSLSPVTT  388



>ref|NP_201409.1| putative protein phosphatase 2C 79 [Arabidopsis thaliana]
 sp|Q9FKX4.1|P2C79_ARATH RecName: Full=Probable protein phosphatase 2C 79; Short=AtPP2C79; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10413.1| protein phosphatase 2C-like protein [Arabidopsis thaliana]
 gb|AAL32665.1| protein phosphatase 2C-like protein [Arabidopsis thaliana]
 gb|AAN65116.1| protein phosphatase 2C-like protein [Arabidopsis thaliana]
 gb|AED98157.1| putative protein phosphatase 2C 79 [Arabidopsis thaliana]
Length=385

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 126/146 (86%), Gaps = 4/146 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK+EFN+EPLY K+RLREP K+PILS +PSI+V  LQ  DQF+IFASDGLWE LS
Sbjct  236  GDVYLKKSEFNKEPLYTKYRLREPMKRPILSWEPSITVHDLQPDDQFLIFASDGLWEQLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV+IVQ+HPRNGIARRLVK AL+EAAKKREMRYSDL KI+RGVRRHFHDDITVVV++
Sbjct  296  NQEAVEIVQNHPRNGIARRLVKAALQEAAKKREMRYSDLNKIERGVRRHFHDDITVVVLF  355

Query  362  LNSNL----GPVKVASLSVKGGTLNL  427
            L++NL      +K  S+S++GG + L
Sbjct  356  LDTNLLSRASSLKTPSVSIRGGGITL  381



>ref|XP_006403924.1| hypothetical protein EUTSA_v10010452mg [Eutrema salsugineum]
 ref|XP_006403925.1| hypothetical protein EUTSA_v10010452mg [Eutrema salsugineum]
 gb|AAM19705.1|AF499718_1 protein phosphatase 2c-like protein [Eutrema halophilum]
 gb|ESQ45377.1| hypothetical protein EUTSA_v10010452mg [Eutrema salsugineum]
 gb|ESQ45378.1| hypothetical protein EUTSA_v10010452mg [Eutrema salsugineum]
Length=378

 Score =   221 bits (563),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLKKAEFN+EPLY K+RLREP K+PILS +PSI+  ++Q  DQF+IFASDGLWE +S
Sbjct  232  GDIYLKKAEFNKEPLYTKYRLREPIKRPILSGEPSITEHEIQPQDQFLIFASDGLWEQMS  291

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVK AL+ AAKKREMRYSDLKKI+RGVRRHFHDDITVVV++
Sbjct  292  NQEAVDIVQNHPRNGIARRLVKMALQAAAKKREMRYSDLKKIERGVRRHFHDDITVVVIF  351

Query  362  LNSN-LGPVKVASLSVKGGTLNL  427
            L++N +   K  SLS++GG +  
Sbjct  352  LDTNVVSSAKGPSLSIRGGGMTF  374



>ref|XP_009109549.1| PREDICTED: probable protein phosphatase 2C 64 [Brassica rapa]
 ref|XP_009109550.1| PREDICTED: probable protein phosphatase 2C 64 [Brassica rapa]
Length=380

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK++EFNREPLYAKFRLR PF +P+LS++P+++V +L+  D+F+I ASDGLWEH+S
Sbjct  235  GDVYLKRSEFNREPLYAKFRLRAPFSRPLLSAEPAVTVHRLKEQDKFIICASDGLWEHMS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV++VQ+HPRNGIA+RLVK AL+EAAKKREMRYSDLKKI+RGVRRHFHDDITV+VV+
Sbjct  295  NQEAVEMVQNHPRNGIAKRLVKVALQEAAKKREMRYSDLKKIERGVRRHFHDDITVIVVF  354

Query  362  LNSNLGPVKVASLSVKGGTLNLRHNT  439
            L++  G VK  ++SVKG  +++   T
Sbjct  355  LDAKPGEVKGPAVSVKGAGVSIPKKT  380



>ref|XP_002467561.1| hypothetical protein SORBIDRAFT_01g030180 [Sorghum bicolor]
 gb|EER94559.1| hypothetical protein SORBIDRAFT_01g030180 [Sorghum bicolor]
Length=393

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 129/152 (85%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKK EFNREPL++KFRL+E F++P+LS+DP+I+V Q+Q  D+F+IFASDGLWEHLS
Sbjct  231  GDAYLKKPEFNREPLHSKFRLQETFRRPLLSADPAITVHQIQPTDKFIIFASDGLWEHLS  290

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ  PRNGIAR+LVK+A++EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  291  NQEAVDMVQSSPRNGIARKLVKSAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  350

Query  362  LNSNLGPVKV---ASLSVKGGTLNLRHNTLAP  448
             +SN          S+S++GG + +  NTLAP
Sbjct  351  FDSNAMTAAAWSRPSVSLRGGGVPIPSNTLAP  382



>ref|XP_009149079.1| PREDICTED: probable protein phosphatase 2C 46 [Brassica rapa]
 ref|XP_009149083.1| PREDICTED: probable protein phosphatase 2C 46 [Brassica rapa]
 ref|XP_009149091.1| PREDICTED: probable protein phosphatase 2C 46 [Brassica rapa]
 ref|XP_009149101.1| PREDICTED: probable protein phosphatase 2C 46 [Brassica rapa]
 ref|XP_009149107.1| PREDICTED: probable protein phosphatase 2C 46 [Brassica rapa]
 emb|CDY33283.1| BnaA01g19500D [Brassica napus]
Length=382

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY K+RLREP K+PILS +PSI+  ++Q HDQF+IFASDGLWE +S
Sbjct  235  GDVYLKKAEFNREPLYTKYRLREPMKRPILSGEPSITEHEIQPHDQFLIFASDGLWEQMS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVK AL+ AAKKREMRY+DLKKI+RGVRRHFHDDITVVV++
Sbjct  295  NQEAVDIVQNHPRNGIARRLVKMALQAAAKKREMRYTDLKKIERGVRRHFHDDITVVVIF  354

Query  362  LNSNL--GPVKVASLSVKGGTLNL  427
            L++N+       +S+S++GG +  
Sbjct  355  LDNNVMSSAKGGSSVSIRGGGMTF  378



>ref|NP_001151373.1| LOC100285006 [Zea mays]
 gb|ACG42595.1| protein phosphatase 2C [Zea mays]
Length=397

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 128/152 (84%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPL++KFRL+E F++P+LSSDP+I+V Q+Q  D+F+IFASDGLWEHLS
Sbjct  236  GDVYLKKPEFNREPLHSKFRLQETFRRPLLSSDPAITVHQIQPTDKFIIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQE VD+VQ  PRNGIAR+LVK+A++EAAKKREMRYSDLKK+DRGVRRHFHDDITV+VV+
Sbjct  296  NQEVVDMVQSSPRNGIARKLVKSAVQEAAKKREMRYSDLKKVDRGVRRHFHDDITVIVVF  355

Query  362  LNSNLGPVKV---ASLSVKGGTLNLRHNTLAP  448
             +SN          S+S++GG   +  NTLAP
Sbjct  356  FDSNAMTTAAWSRPSVSLRGGGFPIHSNTLAP  387



>gb|ACN25494.1| unknown [Zea mays]
 gb|AFW88241.1| protein phosphatase 2C [Zea mays]
 gb|AIB05709.1| orphans transcription factor, partial [Zea mays]
Length=398

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 128/152 (84%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPL++KFRL+E F++P+LSSDP+I+V Q+Q  D+F+IFASDGLWEHLS
Sbjct  236  GDVYLKKPEFNREPLHSKFRLQETFRRPLLSSDPAITVHQIQPTDKFIIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQE VD+VQ  PRNGIAR+LVK+A++EAAKKREMRYSDLKK+DRGVRRHFHDDITV+VV+
Sbjct  296  NQEVVDMVQSSPRNGIARKLVKSAVQEAAKKREMRYSDLKKVDRGVRRHFHDDITVIVVF  355

Query  362  LNSNLGPVKV---ASLSVKGGTLNLRHNTLAP  448
             +SN          S+S++GG   +  NTLAP
Sbjct  356  FDSNAMTTAAWSRPSVSLRGGGFPIHSNTLAP  387



>ref|XP_009400339.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
Length=396

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 4/142 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPL AKF LREPF++PILSS+PSISVL LQ  DQF+IFASDGLWEHLS
Sbjct  235  GDVYLKKTEFNREPLQAKFLLREPFQRPILSSEPSISVLPLQPQDQFLIFASDGLWEHLS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV+IVQ++P +GIARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  295  NQEAVNIVQNNPCSGIARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  354

Query  362  LNSNL-GPV---KVASLSVKGG  415
            L+S+L G V   K  ++S++GG
Sbjct  355  LDSSLTGWVSSHKGPTVSIRGG  376



>ref|XP_010534295.1| PREDICTED: probable protein phosphatase 2C 38 [Tarenaya hassleriana]
Length=389

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 121/141 (86%), Gaps = 3/141 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFNREPL AKFRL EPF  PILS++P+I+V ++Q  DQF+IFASDGLWEHLS
Sbjct  238  GDAYLKKAEFNREPLLAKFRLPEPFSTPILSAEPAITVHKIQPEDQFLIFASDGLWEHLS  297

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PRNGIAR+LVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  298  NQEAVDIVNTCPRNGIARKLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  357

Query  362  LNSNL---GPVKVASLSVKGG  415
            L+SNL   G  +   LS+ GG
Sbjct  358  LDSNLVSRGFSRRPLLSITGG  378



>ref|NP_001288424.1| uncharacterized protein LOC103631685 [Zea mays]
 ref|XP_008650800.1| PREDICTED: probable protein phosphatase 2C 28 [Zea mays]
 gb|ACL52901.1| unknown [Zea mays]
 gb|ACL54138.1| unknown [Zea mays]
 tpg|DAA43257.1| TPA: protein phosphatase 2C isoform 1 [Zea mays]
 tpg|DAA43258.1| TPA: protein phosphatase 2C isoform 2 [Zea mays]
 gb|AIB05419.1| orphans transcription factor, partial [Zea mays]
Length=399

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 131/158 (83%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK E+NREPL++KFRLRE F++PILSS+P I+  ++Q +DQFVIFASDGLWEHLS
Sbjct  236  GDVYLKKPEYNREPLHSKFRLRETFQRPILSSEPQITEHRIQPNDQFVIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            N+EAVD+VQ  PRNGIARRLVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  296  NKEAVDLVQSSPRNGIARRLVKAAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  355

Query  362  LNSN----LGPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+S+        K  S+S++GG + L   +LAP +  A
Sbjct  356  LDSDAMSKASWSKSPSVSLRGGGVALPAKSLAPFSAPA  393



>ref|XP_009115817.1| PREDICTED: probable protein phosphatase 2C 46 [Brassica rapa]
Length=377

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLKKAEFNREPLY K+RLREP K+PILS +PSI+  +LQ  DQF+IFASDGLWE LS
Sbjct  231  GDMYLKKAEFNREPLYTKYRLREPIKRPILSGEPSITEHELQPQDQFLIFASDGLWEQLS  290

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVK A++ AAKKREMRYSDL KI+RGVRRHFHDDITVVV+Y
Sbjct  291  NQEAVDIVQNHPRNGIARRLVKMAMQAAAKKREMRYSDLMKIERGVRRHFHDDITVVVIY  350

Query  362  LNSN-LGPVKVASLSVKG  412
            L++N +   +  SLS++G
Sbjct  351  LDTNVVSSARGPSLSIRG  368



>gb|ACG32321.1| protein phosphatase 2C [Zea mays]
Length=399

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 131/158 (83%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK E+NREPL++KFRLRE F++PILSS+P I+  ++Q +DQFVIFASDGLWEHLS
Sbjct  236  GDVYLKKPEYNREPLHSKFRLRETFQRPILSSEPQITEHRIQPNDQFVIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            N+EAVD+VQ  PRNGIARRLVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  296  NKEAVDLVQSSPRNGIARRLVKAAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  355

Query  362  LNSN----LGPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+S+        K  S+S++GG + L   +LAP +  A
Sbjct  356  LDSDAMSKASWSKSPSVSLRGGGVALPAKSLAPFSAPA  393



>ref|XP_004983777.1| PREDICTED: probable protein phosphatase 2C 72-like [Setaria italica]
Length=398

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 127/152 (84%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNR PL++KFRL+E F++P+LSSDP+I+V Q++  D+F+IFASDGLWE LS
Sbjct  236  GDVYLKKPEFNRAPLHSKFRLQETFRRPLLSSDPAITVHQMEPTDKFIIFASDGLWEQLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ  PRNGIARRLVK A+REAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  296  NQEAVDMVQSSPRNGIARRLVKAAMREAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  355

Query  362  LNSNLGPVKVAS---LSVKGGTLNLRHNTLAP  448
             +SN       S   +S++GG + +  NTLAP
Sbjct  356  FDSNDMATAAWSRPTVSLRGGGVPIPPNTLAP  387



>emb|CDX90277.1| BnaA08g17070D [Brassica napus]
Length=380

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK++EFNREPLYAKFRLR PF +P+LS++P+++V +L+  D+F+I ASDGLWEH+S
Sbjct  235  GDVYLKRSEFNREPLYAKFRLRAPFSRPLLSAEPAVTVHRLKEQDKFIICASDGLWEHMS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV++VQ+HPRNGIA+RLVK AL+EAAKKREMRYSDLKKI+RGVRRHFHDDITV+VV+
Sbjct  295  NQEAVEMVQNHPRNGIAKRLVKVALQEAAKKREMRYSDLKKIERGVRRHFHDDITVIVVF  354

Query  362  LNSNLGPVKVASLSVKGGTLNLRHNT  439
            L++  G V+  ++SV+G  +++   T
Sbjct  355  LDAKPGEVRGPAVSVRGAGVSIPKKT  380



>emb|CDY12086.1| BnaC03g60020D [Brassica napus]
Length=380

 Score =   217 bits (553),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK++EFNREPLYAKFRLR PF +P+LS++P+++V +LQ  D+F+I ASDGLWEH+S
Sbjct  235  GDVYLKRSEFNREPLYAKFRLRAPFSRPLLSAEPAVTVHRLQEQDKFIICASDGLWEHMS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV++VQ+HPRNGIA+RLVK AL+EAAKKREMRYSDLKKI+RGVRRHFHDDITV+VV+
Sbjct  295  NQEAVEMVQNHPRNGIAKRLVKMALQEAAKKREMRYSDLKKIERGVRRHFHDDITVIVVF  354

Query  362  LNSNLGPVKVASLSVKGGTLNLRHNT  439
            L++  G ++   +SV+G  +++   T
Sbjct  355  LDAKPGELRGPVVSVRGAGVSIPKKT  380



>ref|XP_004951589.1| PREDICTED: probable protein phosphatase 2C 72-like [Setaria italica]
Length=398

 Score =   217 bits (553),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 126/151 (83%), Gaps = 3/151 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK EFNREPL+ KFR++  F++P+LSSDP+I+V Q+Q  D+F+IFASDGLWEHLS
Sbjct  236  GDVYLKKPEFNREPLHNKFRIQGTFRRPLLSSDPAITVHQIQPTDRFIIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD+VQ  PRNGIARRLVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  296  NQEAVDMVQSSPRNGIARRLVKAAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  355

Query  362  LNSNLGPVKV---ASLSVKGGTLNLRHNTLA  445
             +SN          S+S++GG + +  NTLA
Sbjct  356  FDSNAMTTAAWSRPSVSLRGGGVPIPSNTLA  386



>gb|ABE77197.1| putative protein phosphatase 2C [Sorghum bicolor]
Length=394

 Score =   217 bits (552),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 128/158 (81%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK E+NREPL++KFRLRE F++PILS+DP I+  ++Q +DQFVIFASDGLWEHLS
Sbjct  231  GDVYLKKPEYNREPLHSKFRLRETFQRPILSADPQITEHRIQPNDQFVIFASDGLWEHLS  290

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
             QEAVD+V   PRNGIARRLVK A++EAAKKREMRYSDLKKIDRGVRRHFHDD TVVV++
Sbjct  291  TQEAVDLVHSSPRNGIARRLVKAAMQEAAKKREMRYSDLKKIDRGVRRHFHDDTTVVVLF  350

Query  362  LNSN----LGPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+SN        K  S+S++GG + L   +LAP +  A
Sbjct  351  LDSNAMSKASWSKSPSVSIRGGGVTLPAKSLAPFSALA  388



>ref|XP_002468552.1| hypothetical protein SORBIDRAFT_01g047830 [Sorghum bicolor]
 gb|EER95550.1| hypothetical protein SORBIDRAFT_01g047830 [Sorghum bicolor]
Length=399

 Score =   216 bits (551),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 128/158 (81%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK E+NREPL++KFRLRE F++PILS+DP I+  ++Q +DQFVIFASDGLWEHLS
Sbjct  236  GDVYLKKPEYNREPLHSKFRLRETFQRPILSADPQITEHRIQPNDQFVIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
             QEAVD+V   PRNGIARRLVK A++EAAKKREMRYSDLKKIDRGVRRHFHDD TVVV++
Sbjct  296  TQEAVDLVHSSPRNGIARRLVKAAMQEAAKKREMRYSDLKKIDRGVRRHFHDDTTVVVLF  355

Query  362  LNSN----LGPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+SN        K  S+S++GG + L   +LAP +  A
Sbjct  356  LDSNAMSKASWSKSPSVSIRGGGVTLPAKSLAPFSALA  393



>emb|CDX78002.1| BnaA09g31970D [Brassica napus]
Length=499

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD+YLKKAEFNREPLY K+RLREP K+PILS +PSI+  +LQ  DQF+IFASDGLWE LS
Sbjct  231  GDMYLKKAEFNREPLYTKYRLREPIKRPILSGEPSITEHELQPQDQFLIFASDGLWEQLS  290

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+HPRNGIARRLVK A++ AAKKREMRYSDL KI+RGVRRHFHDDITVVV+Y
Sbjct  291  NQEAVDIVQNHPRNGIARRLVKMAMQAAAKKREMRYSDLMKIERGVRRHFHDDITVVVIY  350

Query  362  LNSN-LGPVKVASLSVKG  412
            L++N +   +  SLS++G
Sbjct  351  LDTNVVSSARGPSLSIRG  368



>ref|XP_010067239.1| PREDICTED: probable protein phosphatase 2C 38 [Eucalyptus grandis]
 gb|KCW65337.1| hypothetical protein EUGRSUZ_G02783 [Eucalyptus grandis]
 gb|KCW65338.1| hypothetical protein EUGRSUZ_G02783 [Eucalyptus grandis]
 gb|KCW65339.1| hypothetical protein EUGRSUZ_G02783 [Eucalyptus grandis]
Length=386

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/149 (71%), Positives = 124/149 (83%), Gaps = 4/149 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFN+EPL AKFRL EPF +PIL ++PS+ V Q+   DQF+IFASDGLWEHLS
Sbjct  237  GDAYLKKAEFNKEPLLAKFRLPEPFHRPILKAEPSVLVQQIYPEDQFLIFASDGLWEHLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ+ PRNG+AR+LVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVV++
Sbjct  297  NQEAVDIVQNCPRNGVARKLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVLF  356

Query  362  LNSNLGPVKVASLSVKGGTLNLRHNTLAP  448
            L+S+L    +   S +G  L+LR  +  P
Sbjct  357  LDSHL----IRRSSWRGPLLSLRGGSSPP  381



>ref|XP_008680928.1| PREDICTED: protein phosphatase 2C isoform X1 [Zea mays]
 gb|ACF87377.1| unknown [Zea mays]
 tpg|DAA43256.1| TPA: protein phosphatase 2C [Zea mays]
 gb|AIB05384.1| orphans transcription factor, partial [Zea mays]
Length=399

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 129/158 (82%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK E+NREPL++KFRLRE F++PILSS+P I+  ++Q +DQFVIFASDGLWEHLS
Sbjct  236  GDVYLKKPEYNREPLHSKFRLRETFQRPILSSEPQITEHRIQPNDQFVIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            N+EAVD+VQ  P NGIARRLVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  296  NKEAVDLVQSSPHNGIARRLVKAAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  355

Query  362  LN----SNLGPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+    S     K  S+S++GG + +   +LAP +  A
Sbjct  356  LDLNAMSKASWSKSPSVSLRGGGVTVPAKSLAPFSAPA  393



>ref|XP_011017101.1| PREDICTED: probable protein phosphatase 2C 38 isoform X4 [Populus 
euphratica]
Length=294

 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 119/146 (82%), Gaps = 11/146 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK+AEFNREPL AKFRL EPF KPIL S+P+I V +L   DQF+IFASDGLWEHLS
Sbjct  135  GDAYLKRAEFNREPLLAKFRLPEPFDKPILKSEPTILVQKLCPEDQFLIFASDGLWEHLS  194

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PRNGIAR+L+K AL EAAKKREMRYSDLKKIDRGVRRHFHDDITV+V++
Sbjct  195  NQEAVDIVHSCPRNGIARKLLKAALCEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVLF  254

Query  362  LNSNL-------GPVKVASLSVKGGT  418
            L+SNL       GP+    +S+KGG 
Sbjct  255  LDSNLVSRSSFRGPL----ISIKGGC  276



>ref|XP_010234959.1| PREDICTED: probable protein phosphatase 2C 72 [Brachypodium distachyon]
Length=395

 Score =   214 bits (546),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 127/152 (84%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ EFNREPL++KFRL E F++P+LSS+P+I+V Q+Q  DQF+IFASDGLWEHLS
Sbjct  237  GDVYLKRPEFNREPLHSKFRLPETFRRPLLSSEPAITVHQIQLTDQFIIFASDGLWEHLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AV++V   PRNGIARRLVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  297  NQKAVELVHSSPRNGIARRLVKAAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  356

Query  362  LNSNLGPVKVAS---LSVKGGTLNLRHNTLAP  448
             +SN       S   +S++GG + L  N+LAP
Sbjct  357  FDSNAVAADNWSRPTVSLRGGGVTLPANSLAP  388



>dbj|BAJ95758.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93286.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=392

 Score =   214 bits (545),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 128/152 (84%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ EFNREPL++KFRL E F++P+LSS+P+I+V Q+Q  DQF+IFASDGLWEHLS
Sbjct  237  GDVYLKRPEFNREPLHSKFRLPETFRRPLLSSEPAITVHQIQLTDQFIIFASDGLWEHLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AV++V   PRNGIAR+LVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  297  NQKAVELVHSSPRNGIARKLVKAAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  356

Query  362  LNSNLGPVKVAS---LSVKGGTLNLRHNTLAP  448
             +SN   +   S   +S++GG + L  N+LAP
Sbjct  357  FDSNAIAMDAWSRPTVSLRGGGVALPANSLAP  388



>gb|EMT14261.1| Putative protein phosphatase 2C 72 [Aegilops tauschii]
Length=387

 Score =   214 bits (544),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 128/152 (84%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ EFNREPL++KFRL E F++P+LSS+P+I+V Q+Q  DQF+IFASDGLWEHLS
Sbjct  232  GDVYLKRPEFNREPLHSKFRLPETFRRPLLSSEPAITVHQIQLTDQFIIFASDGLWEHLS  291

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AV++V   PRNGIAR+LVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  292  NQKAVELVHSSPRNGIARKLVKAAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  351

Query  362  LNSNLGPVKVAS---LSVKGGTLNLRHNTLAP  448
             +SN   +   S   +S++GG + L  N+LAP
Sbjct  352  FDSNAIAMDAWSRPTVSLRGGGVALPANSLAP  383



>emb|CBI32641.3| unnamed protein product [Vitis vinifera]
Length=380

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 125/153 (82%), Gaps = 4/153 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFNREPL ++FRL +PF +PILSS+PSISV +++  DQF+IFASDGLWEHLS
Sbjct  230  GDAYLKKAEFNREPLLSRFRLPQPFIEPILSSEPSISVHKIRPEDQFIIFASDGLWEHLS  289

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV+IV ++PRNGIAR+LVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  290  NQEAVNIVNNYPRNGIARKLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  349

Query  362  LNSNLGPVKVASLSVKGGTLNLRHNTLAPCATA  460
            L+    P+ +   S  G   +++    AP   A
Sbjct  350  LD----PLLIKRSSSSGCPFSIKGGVKAPAPAA  378



>ref|XP_002276631.1| PREDICTED: probable protein phosphatase 2C 38 [Vitis vinifera]
Length=387

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 126/155 (81%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFNREPL ++FRL +PF +PILSS+PSISV +++  DQF+IFASDGLWEHLS
Sbjct  237  GDAYLKKAEFNREPLLSRFRLPQPFIEPILSSEPSISVHKIRPEDQFIIFASDGLWEHLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV+IV ++PRNGIAR+LVKTAL+EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  297  NQEAVNIVNNYPRNGIARKLVKTALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  356

Query  362  LNSNLGPVKVASLSVKGGTLNLRHNTLAPCATAAM  466
            L+    P+ +   S  G   +++    AP   A +
Sbjct  357  LD----PLLIKRSSSSGCPFSIKGGVKAPAPAAEV  387



>gb|EMS63543.1| putative protein phosphatase 2C 72 [Triticum urartu]
Length=387

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 128/152 (84%), Gaps = 3/152 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK+ EFNREPL++KFRL E F++P+LSS+P+I+V Q+Q  DQF+IFASDGLWEHLS
Sbjct  232  GDVYLKRPEFNREPLHSKFRLPETFRRPLLSSEPAITVHQIQLTDQFIIFASDGLWEHLS  291

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AV++V   PRNGIAR+LVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  292  NQKAVELVHSSPRNGIARKLVKAAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  351

Query  362  LNSNLGPVKVAS---LSVKGGTLNLRHNTLAP  448
             +SN   +   S   +S++GG + L  N+LAP
Sbjct  352  FDSNAIAMDAWSRPTVSLRGGGVALPVNSLAP  383



>gb|KDP46132.1| hypothetical protein JCGZ_06643 [Jatropha curcas]
Length=385

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 4/143 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK+AEFNREPL AKFRL EPF KPIL ++P+ISV +L   DQF+IFASDGLWEHLS
Sbjct  237  GDAYLKRAEFNREPLLAKFRLPEPFDKPILKAEPTISVQKLCPEDQFLIFASDGLWEHLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV + PRNGIAR+L+K ALREAAKKREMRYSDLKKIDRGVRRHFHDDITV+V++
Sbjct  297  NQEAVDIVNNCPRNGIARKLLKAALREAAKKREMRYSDLKKIDRGVRRHFHDDITVIVLF  356

Query  362  LNSNLGPVKVASLSVKGGTLNLR  430
            L+S+L    ++  S +G  L++R
Sbjct  357  LDSHL----ISRSSFRGPLLSIR  375



>ref|NP_001152449.1| protein phosphatase 2C [Zea mays]
 gb|ACG47671.1| protein phosphatase 2C [Zea mays]
Length=399

 Score =   213 bits (542),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 129/158 (82%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK E+NREPL++KFRLRE F++PILSS+P I+  ++Q +DQFVIFASDGLWEHL+
Sbjct  236  GDVYLKKPEYNREPLHSKFRLRETFQRPILSSEPQITEHRIQPNDQFVIFASDGLWEHLT  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            N+EAVD+VQ  PRNGIARRLVK A++EAAKKREMRYSDLKKIDRGVRRHF DDITVVVV+
Sbjct  296  NKEAVDLVQSSPRNGIARRLVKAAMQEAAKKREMRYSDLKKIDRGVRRHFLDDITVVVVF  355

Query  362  LN----SNLGPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+    S     K  S+S++GG + +   +LAP +  A
Sbjct  356  LDLNAMSKASWSKSPSVSLRGGGVTVPAKSLAPFSAPA  393



>ref|XP_006291301.1| hypothetical protein CARUB_v10017436mg [Capsella rubella]
 gb|EOA24199.1| hypothetical protein CARUB_v10017436mg [Capsella rubella]
Length=328

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 119/136 (88%), Gaps = 1/136 (1%)
 Frame = +2

Query  23   AEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLSNQEAVDI  202
            AEFN+EPLY K+RLREPFK+PILS +P+I+  ++Q  D+F+IFASDGLWE LSNQEAVDI
Sbjct  189  AEFNKEPLYTKYRLREPFKRPILSGEPTITEHEIQPQDKFLIFASDGLWEQLSNQEAVDI  248

Query  203  VQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVYLNSN-LG  379
            VQ+HPRNGIARRLVK AL+EAAKKREMRYSDLKKI+RGVRRHFHDDITVVV++L++N + 
Sbjct  249  VQNHPRNGIARRLVKMALQEAAKKREMRYSDLKKIERGVRRHFHDDITVVVIFLDTNQVS  308

Query  380  PVKVASLSVKGGTLNL  427
             VK   LS++GG +  
Sbjct  309  SVKGPPLSIRGGGMTF  324



>emb|CDY54807.1| BnaA06g40990D [Brassica napus]
Length=390

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLK++EFNREPLYAKFRLR PF +P+LS++PSI+V  LQ HD F+I ASDGLWEH+S
Sbjct  240  GDVYLKRSEFNREPLYAKFRLRAPFSRPLLSAEPSITVHTLQPHDLFIICASDGLWEHMS  299

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV+IV  HPRNGIA+RLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  300  NQEAVEIVHTHPRNGIAKRLVKMALKEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  359

Query  362  LNSNLGPV  385
             ++   P+
Sbjct  360  FDTTAWPL  367



>gb|ABK93230.1| unknown [Populus trichocarpa]
Length=270

 Score =   209 bits (531),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 119/145 (82%), Gaps = 11/145 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK+AE+NREPL AKFRL EPF KPIL ++P+I V +L   DQF+IFASDGLWEHLS
Sbjct  121  GDAYLKRAEYNREPLLAKFRLPEPFNKPILKAEPTILVQKLYPEDQFLIFASDGLWEHLS  180

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD V   PRNG+AR+L+K ALREAAKKREMRYSDLKKIDRGVRRHFHDDITV+V++
Sbjct  181  NQEAVDFVHSCPRNGVARKLLKAALREAAKKREMRYSDLKKIDRGVRRHFHDDITVIVLF  240

Query  362  LNSNL-------GPVKVASLSVKGG  415
            L+SNL       GP+    +S+KGG
Sbjct  241  LDSNLVSRSSFRGPL----ISIKGG  261



>ref|XP_011016941.1| PREDICTED: probable protein phosphatase 2C 38 isoform X2 [Populus 
euphratica]
Length=396

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 123/161 (76%), Gaps = 12/161 (7%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK+AEFNREPL AKFRL EPF KPIL S+P+I V +L   DQF+IFASDGLWEHLS
Sbjct  237  GDAYLKRAEFNREPLLAKFRLPEPFDKPILKSEPTILVQKLCPEDQFLIFASDGLWEHLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PRNGIAR+L+K AL EAAKKREMRYSDLKKIDRGVRRHFHDDITV+V++
Sbjct  297  NQEAVDIVHSCPRNGIARKLLKAALCEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVLF  356

Query  362  LNSNL-------GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+SNL       GP+    +S+KGG   +  N    C  + 
Sbjct  357  LDSNLVSRSSFRGPL----ISIKGGC-GVSGNGKGGCGVSG  392



>gb|KDO36405.1| hypothetical protein CISIN_1g045470mg, partial [Citrus sinensis]
Length=155

 Score =   204 bits (520),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 119/145 (82%), Gaps = 11/145 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFNREPL  KFRL EPF KPIL ++P++SV +L   DQF+IFASDGLWEHLS
Sbjct  6    GDAYLKKAEFNREPLLPKFRLPEPFHKPILLAEPTVSVQRLYPEDQFLIFASDGLWEHLS  65

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV + PRNG+AR+LVK AL EAAKKREMRYSDLKKIDRGVRRHFHDDITV++++
Sbjct  66   NQEAVDIVHNCPRNGVARKLVKAALHEAAKKREMRYSDLKKIDRGVRRHFHDDITVIILF  125

Query  362  LNSNL-------GPVKVASLSVKGG  415
            L+S L       GP+    +SV+GG
Sbjct  126  LDSYLISRSSWDGPL----ISVRGG  146



>ref|XP_011016344.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Populus 
euphratica]
 ref|XP_011016863.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Populus 
euphratica]
Length=401

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 123/161 (76%), Gaps = 12/161 (7%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK+AEFNREPL AKFRL EPF KPIL S+P+I V +L   DQF+IFASDGLWEHLS
Sbjct  242  GDAYLKRAEFNREPLLAKFRLPEPFDKPILKSEPTILVQKLCPEDQFLIFASDGLWEHLS  301

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PRNGIAR+L+K AL EAAKKREMRYSDLKKIDRGVRRHFHDDITV+V++
Sbjct  302  NQEAVDIVHSCPRNGIARKLLKAALCEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVLF  361

Query  362  LNSNL-------GPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+SNL       GP+    +S+KGG   +  N    C  + 
Sbjct  362  LDSNLVSRSSFRGPL----ISIKGGC-GVSGNGKGGCGVSG  397



>ref|XP_006828247.1| hypothetical protein AMTR_s00023p00195110 [Amborella trichopoda]
 gb|ERM95663.1| hypothetical protein AMTR_s00023p00195110 [Amborella trichopoda]
Length=388

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 120/143 (84%), Gaps = 4/143 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLY KFRL EP ++PILS++PSI+   + + DQFVIFASDGLWEHLS
Sbjct  233  GDVYLKKAEFNREPLYPKFRLSEPIRRPILSAEPSITTHTISALDQFVIFASDGLWEHLS  292

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV +H R+G ARRLVK ALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVV++
Sbjct  293  NQEAVDIVHNHSRSGSARRLVKAALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVLF  352

Query  362  LNSNLGPVKVASLSVKGGTLNLR  430
            L+    P  V+  S++G   +LR
Sbjct  353  LD----PYLVSQSSIRGPKSSLR  371



>ref|NP_001045569.1| Os01g0976700 [Oryza sativa Japonica Group]
 dbj|BAD87037.1| putative protein phosphatase 2C [Oryza sativa Japonica Group]
 dbj|BAF07483.1| Os01g0976700 [Oryza sativa Japonica Group]
 gb|EAZ15024.1| hypothetical protein OsJ_04966 [Oryza sativa Japonica Group]
 dbj|BAG94660.1| unnamed protein product [Oryza sativa Japonica Group]
Length=376

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 118/145 (81%), Gaps = 11/145 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK  EFNREPL A+FRL EPF KPILS +PSI V +L + DQFVIFASDGLWEHL+
Sbjct  227  GDAYLKSTEFNREPLLARFRLSEPFHKPILSPEPSIEVHKLCTEDQFVIFASDGLWEHLT  286

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PRNGIARRL+K ALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVV++
Sbjct  287  NQEAVDIVNCAPRNGIARRLIKAALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVLF  346

Query  362  LNSNL-------GPVKVASLSVKGG  415
            L+S L       GP+    LS++GG
Sbjct  347  LDSALVGKRFYGGPL----LSLRGG  367



>ref|XP_011017023.1| PREDICTED: probable protein phosphatase 2C 38 isoform X3 [Populus 
euphratica]
Length=391

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 119/146 (82%), Gaps = 11/146 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK+AEFNREPL AKFRL EPF KPIL S+P+I V +L   DQF+IFASDGLWEHLS
Sbjct  242  GDAYLKRAEFNREPLLAKFRLPEPFDKPILKSEPTILVQKLCPEDQFLIFASDGLWEHLS  301

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PRNGIAR+L+K AL EAAKKREMRYSDLKKIDRGVRRHFHDDITV+V++
Sbjct  302  NQEAVDIVHSCPRNGIARKLLKAALCEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVLF  361

Query  362  LNSNL-------GPVKVASLSVKGGT  418
            L+SNL       GP+    +S+KGG 
Sbjct  362  LDSNLVSRSSFRGPL----ISIKGGC  383



>gb|AIG52087.1| 2C-type protein phosphatase protein [Zea mays]
Length=399

 Score =   212 bits (539),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 127/158 (80%), Gaps = 4/158 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK E+NREPL++KFRLRE F++PILSS+P I+  ++Q +DQFVIFASDGLWEHLS
Sbjct  236  GDVYLKKPEYNREPLHSKFRLRETFQRPILSSEPQITEHRIQPNDQFVIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            N+EAVD+VQ  P NGIARRLVK A++EA KKREMRY DLKKIDRGVRRHFHDDITVVVV+
Sbjct  296  NKEAVDLVQSSPHNGIARRLVKAAMQEATKKREMRYPDLKKIDRGVRRHFHDDITVVVVF  355

Query  362  LN----SNLGPVKVASLSVKGGTLNLRHNTLAPCATAA  463
            L+    S     K  S+S++GG + +   +LAP +  A
Sbjct  356  LDLNAMSKASWSKSPSVSLRGGGVTVPAKSLAPFSAPA  393



>ref|XP_010499254.1| PREDICTED: probable protein phosphatase 2C 38 [Camelina sativa]
Length=386

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 119/141 (84%), Gaps = 3/141 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFNREPL AKFR+ E F KPIL ++P+I+V ++   DQF+IFASDGLWEHL+
Sbjct  238  GDAYLKKAEFNREPLLAKFRVPEAFHKPILKAEPAITVHKIHPEDQFLIFASDGLWEHLT  297

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PRNGIAR+L+KTALREAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  298  NQEAVDIVNTSPRNGIARKLIKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  357

Query  362  LNSNLGPVKVAS---LSVKGG  415
            L+SNL    V+    LS+ GG
Sbjct  358  LDSNLVSRSVSRRPLLSISGG  378



>gb|KDO36191.1| hypothetical protein CISIN_1g046755mg, partial [Citrus sinensis]
Length=155

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 118/146 (81%), Gaps = 11/146 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKK EFNREPL  KFRL EPF KPIL ++P++SV +L   DQF+IFASDGLWEHLS
Sbjct  6    GDAYLKKVEFNREPLLPKFRLPEPFHKPILLAEPTVSVQRLYPEDQFLIFASDGLWEHLS  65

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV + PRNG+AR+LVK AL EAAKKREMRYSDLKKIDRGVRRHFHDDITV++++
Sbjct  66   NQEAVDIVHNCPRNGVARKLVKAALHEAAKKREMRYSDLKKIDRGVRRHFHDDITVIILF  125

Query  362  LNSNL-------GPVKVASLSVKGGT  418
            L+S L       GP+    +SV+GG 
Sbjct  126  LDSYLISRSSWDGPL----ISVRGGA  147



>ref|XP_010558777.1| PREDICTED: probable protein phosphatase 2C 38 [Tarenaya hassleriana]
Length=388

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFNREPL AKFR++EPF KPIL ++P+I+V ++Q  DQF+IFASDGLWEHLS
Sbjct  237  GDAYLKKAEFNREPLLAKFRVQEPFSKPILKAEPAITVHKIQPEDQFLIFASDGLWEHLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV+IV   PRNGIAR+L+K+ALREAAKKREMRYSDLKKI+RGVRRHFHDDITV+VV+
Sbjct  297  NQEAVEIVSTSPRNGIARKLIKSALREAAKKREMRYSDLKKIERGVRRHFHDDITVIVVF  356

Query  362  LNSNL  376
            L+S+L
Sbjct  357  LHSHL  361



>ref|XP_009769529.1| PREDICTED: probable protein phosphatase 2C 38 [Nicotiana sylvestris]
Length=376

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 120/142 (85%), Gaps = 3/142 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKK+EFN+ PL A+FRL EPF KPILS++PSISV +L S DQFVIFASDGLW+HLS
Sbjct  229  GDAYLKKSEFNQAPLLARFRLPEPFPKPILSAEPSISVHRLSSKDQFVIFASDGLWDHLS  288

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV +HPRNGIARRL++ AL  AAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  289  NQEAVDIVHNHPRNGIARRLIEAALHVAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  348

Query  362  LNS---NLGPVKVASLSVKGGT  418
            ++    N    + + LS++GGT
Sbjct  349  VDPYSMNRSSSRGSILSIRGGT  370



>gb|ACJ84882.1| unknown [Medicago truncatula]
Length=378

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 124/142 (87%), Gaps = 4/142 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKKAEFNREPLYAKFR+ +PFK+PILSS+PSI V QLQ  DQF+IFASDGLWEH S
Sbjct  235  GDVYLKKAEFNREPLYAKFRVPQPFKRPILSSEPSILVHQLQPQDQFIIFASDGLWEHFS  294

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ++PR GIARR+VKTAL+ AAKKREMRYSDL KIDRGVRRHFHDDITV+VV+
Sbjct  295  NQEAVDIVQNNPRAGIARRMVKTALKAAAKKREMRYSDLNKIDRGVRRHFHDDITVIVVF  354

Query  362  LNSNL----GPVKVASLSVKGG  415
            L+SNL      VK   +SV+GG
Sbjct  355  LDSNLMSRASTVKFPGISVRGG  376



>ref|XP_010253439.1| PREDICTED: probable protein phosphatase 2C 38 [Nelumbo nucifera]
 ref|XP_010253440.1| PREDICTED: probable protein phosphatase 2C 38 [Nelumbo nucifera]
Length=388

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFN+EPL AKFRL +PF KPILS++PSI V +L   DQF+IFASDGLWEHLS
Sbjct  234  GDAYLKKAEFNKEPLLAKFRLPKPFHKPILSAEPSILVQKLSPEDQFLIFASDGLWEHLS  293

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV ++PRNGIA+RL+KTALREAAKKREMRYSDLKKIDRGVRRHFHDDITV+V++
Sbjct  294  NQEAVDIVHNYPRNGIAKRLIKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVIVLF  353

Query  362  LNSNL  376
            L+ +L
Sbjct  354  LDYHL  358



>ref|XP_010465036.1| PREDICTED: probable protein phosphatase 2C 38 [Camelina sativa]
Length=386

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 119/141 (84%), Gaps = 3/141 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFNREPL AKFR+ E F KPIL ++P+I+V ++   DQF+IFASDGLWEHL+
Sbjct  238  GDAYLKKAEFNREPLLAKFRVPEVFHKPILLAEPAITVHKIHPEDQFLIFASDGLWEHLT  297

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PRNGIAR+L+KTALREAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  298  NQEAVDIVNTSPRNGIARKLIKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  357

Query  362  LNSNLGPVKVAS---LSVKGG  415
            L+SNL    V+    LS+ GG
Sbjct  358  LDSNLVSRSVSRRPLLSISGG  378



>ref|XP_009413031.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   209 bits (533),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 128/155 (83%), Gaps = 4/155 (3%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK+AEFNREPL AKF L+EPFKKPILSS+PSIS   LQ  DQF+IFASDGLWEHLS
Sbjct  230  GDAYLKRAEFNREPLQAKFCLQEPFKKPILSSEPSISAQPLQREDQFLIFASDGLWEHLS  289

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQHHPR+G ARRLVK AL+ AAKKRE+R SDL+KIDRGVRRHFHDD+TV+VV+
Sbjct  290  NQEAVDIVQHHPRSGSARRLVKAALQAAAKKREIRCSDLEKIDRGVRRHFHDDMTVIVVF  349

Query  362  LNSNL----GPVKVASLSVKGGTLNLRHNTLAPCA  454
            LNSNL      ++    S++GG ++L  N+L P A
Sbjct  350  LNSNLTSRVSSIRGPKTSIRGGAISLPPNSLTPYA  384



>ref|XP_009421366.1| PREDICTED: probable protein phosphatase 2C 60 [Musa acuminata 
subsp. malaccensis]
Length=380

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 121/147 (82%), Gaps = 11/147 (7%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK AEFNREPL +KFRL EPF+KPILS++PSI   +L   DQF+IFASDGLWEHLS
Sbjct  236  GDAYLKDAEFNREPLLSKFRLPEPFQKPILSAEPSIVTHKLCPEDQFIIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD++Q++PRNGIARRLVK AL+EAAKKREMRYSDLKKIDRGVRRHFHDDITV+V++
Sbjct  296  NQEAVDMIQNYPRNGIARRLVKAALQEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVLF  355

Query  362  LNSNL-------GPVKVASLSVKGGTL  421
            L+  L       GPV    LS+KG  +
Sbjct  356  LDPALISRNFYHGPV----LSLKGAGV  378



>gb|ACJ85444.1| unknown [Medicago truncatula]
 gb|AFK35587.1| unknown [Medicago truncatula]
Length=164

 Score =   202 bits (514),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 116/138 (84%), Gaps = 2/138 (1%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKK EFN+ PL  KFRL EPF+ PIL ++P+I V +LQ  DQF+IFASDGLWEHLS
Sbjct  19   GDAYLKKKEFNQAPLLTKFRLPEPFETPILKAEPTIQVQKLQPCDQFLIFASDGLWEHLS  78

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIVQ  PRNG+A++L+K AL EAAKKR MRYSDLKKIDRGVRRHFHDDITV+VVY
Sbjct  79   NQEAVDIVQSCPRNGVAKKLIKAALCEAAKKRGMRYSDLKKIDRGVRRHFHDDITVIVVY  138

Query  362  LNSNLGPVKVASLSVKGG  415
            L+S+  P +  ++S+KGG
Sbjct  139  LDSH-NP-RAPAVSIKGG  154



>ref|XP_002312054.1| serine/threonine protein phosphatase 2C [Populus trichocarpa]
 gb|EEE89421.1| serine/threonine protein phosphatase 2C [Populus trichocarpa]
Length=386

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 119/146 (82%), Gaps = 11/146 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK+AEFNREPL AKFRL EPF KPIL ++P+I V +L   DQF+IFASDGLWEHLS
Sbjct  237  GDAYLKRAEFNREPLLAKFRLPEPFDKPILKAEPTILVQKLCPEDQFLIFASDGLWEHLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PRNG+AR+L+K AL EAAKKREMRYSDLK+IDRGVRRHFHDDITV+V++
Sbjct  297  NQEAVDIVHSCPRNGVARKLLKAALCEAAKKREMRYSDLKRIDRGVRRHFHDDITVIVLF  356

Query  362  LNSNL-------GPVKVASLSVKGGT  418
            L+SNL       GP+    +S+KGG 
Sbjct  357  LDSNLVSRSSFRGPL----ISIKGGC  378



>gb|EAY77438.1| hypothetical protein OsI_05432 [Oryza sativa Indica Group]
Length=378

 Score =   209 bits (531),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 117/145 (81%), Gaps = 11/145 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK  EFNREPL A+FRL EPF KPILS +PSI V +L + DQFVIFASDGLWEH++
Sbjct  228  GDAYLKSTEFNREPLLARFRLSEPFHKPILSPEPSIEVHKLCTEDQFVIFASDGLWEHMT  287

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PRNGIARRL+K ALR+AAKKREMRYSDLKKIDRGVRRHFHDDITVVV++
Sbjct  288  NQEAVDIVNCSPRNGIARRLIKAALRDAAKKREMRYSDLKKIDRGVRRHFHDDITVVVLF  347

Query  362  LNSNL-------GPVKVASLSVKGG  415
            L+S L       GP+    LS+ GG
Sbjct  348  LDSALVGKRFYGGPL----LSLMGG  368



>ref|XP_006378750.1| hypothetical protein POPTR_0010s22180g [Populus trichocarpa]
 ref|XP_002315265.2| hypothetical protein POPTR_0010s22180g [Populus trichocarpa]
 gb|ERP56547.1| hypothetical protein POPTR_0010s22180g [Populus trichocarpa]
 gb|EEF01436.2| hypothetical protein POPTR_0010s22180g [Populus trichocarpa]
Length=386

 Score =   209 bits (531),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 119/145 (82%), Gaps = 11/145 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK+AE+NREPL AKFRL EPF KPIL ++P+I V +L   DQF+IFASDGLWEHLS
Sbjct  237  GDAYLKRAEYNREPLLAKFRLPEPFNKPILKAEPTILVQKLYPEDQFLIFASDGLWEHLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVD V   PRNG+AR+L+K ALREAAKKREMRYSDLKKIDRGVRRHFHDDITV+V++
Sbjct  297  NQEAVDFVHSCPRNGVARKLLKAALREAAKKREMRYSDLKKIDRGVRRHFHDDITVIVLF  356

Query  362  LNSNL-------GPVKVASLSVKGG  415
            L+SNL       GP+    +S+KGG
Sbjct  357  LDSNLVSRSSFRGPL----ISIKGG  377



>ref|XP_010486985.1| PREDICTED: probable protein phosphatase 2C 38 [Camelina sativa]
Length=386

 Score =   209 bits (531),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 118/141 (84%), Gaps = 3/141 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFNREPL AKFR+ E F KPIL ++P+I+V ++   DQF+IFASDGLWEHL+
Sbjct  238  GDAYLKKAEFNREPLLAKFRVPEAFHKPILKAEPAITVHKIHPEDQFLIFASDGLWEHLT  297

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   P NGIAR+L+KTALREAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  298  NQEAVDIVNTSPHNGIARKLIKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  357

Query  362  LNSNLGPVKVAS---LSVKGG  415
            L+SNL    V+    LS+ GG
Sbjct  358  LDSNLVSRSVSRRPLLSISGG  378



>gb|EYU41653.1| hypothetical protein MIMGU_mgv1a008235mg [Erythranthe guttata]
 gb|EYU41654.1| hypothetical protein MIMGU_mgv1a008235mg [Erythranthe guttata]
Length=380

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 120/143 (84%), Gaps = 7/143 (5%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK++EFNREPL AKFR+ EPF KPILS++PSI V +LQ+ DQF++FASDGLWEHLS
Sbjct  236  GDAYLKRSEFNREPLLAKFRVAEPFHKPILSAEPSILVHKLQAEDQFLVFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV  +PR GIARRLVK  LR AAKKREMRY+DLKKIDRGVRRHFHDDITVVVV+
Sbjct  296  NQEAVDIVNSYPRQGIARRLVKAGLRVAAKKREMRYTDLKKIDRGVRRHFHDDITVVVVF  355

Query  362  LNSNLGPVKVAS-----LSVKGG  415
            ++  L  +K AS     +S++GG
Sbjct  356  IDQCL--IKTASSRSSTVSIRGG  376



>ref|XP_007009637.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 ref|XP_007009640.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY18447.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
 gb|EOY18450.1| Phosphatase 2C family protein isoform 1 [Theobroma cacao]
Length=379

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 11/145 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFN+EPL  KFRL EPF+KPIL ++P+I V +L   DQF+IFASDGLWEHLS
Sbjct  237  GDAYLKKAEFNKEPLLPKFRLPEPFQKPILQAEPAILVQKLHPEDQFLIFASDGLWEHLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV++V   PRNGIARRLVK ALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVV++
Sbjct  297  NQEAVNVVNTCPRNGIARRLVKAALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVLF  356

Query  362  LNSNL-------GPVKVASLSVKGG  415
            L+S+L       GP+    +S++GG
Sbjct  357  LDSHLISRSYWRGPM----VSIRGG  377



>ref|XP_006297878.1| hypothetical protein CARUB_v10013921mg [Capsella rubella]
 gb|EOA30776.1| hypothetical protein CARUB_v10013921mg [Capsella rubella]
Length=386

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 119/141 (84%), Gaps = 3/141 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFNREPL AKFR+ E F KPIL ++P+++V ++   DQF+IFASDGLWEHL+
Sbjct  238  GDAYLKKAEFNREPLLAKFRVPEVFHKPILRAEPTVTVHKIHPEDQFLIFASDGLWEHLT  297

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV  +PRNGIA++L+KTALREAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  298  NQEAVDIVNTYPRNGIAKKLIKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  357

Query  362  LNSNL---GPVKVASLSVKGG  415
            L+SNL      +   LS+ GG
Sbjct  358  LDSNLVSRSASRRPLLSISGG  378



>ref|XP_007009638.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
 ref|XP_007009639.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
 gb|EOY18448.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
 gb|EOY18449.1| Phosphatase 2C family protein isoform 2 [Theobroma cacao]
Length=384

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 11/145 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFN+EPL  KFRL EPF+KPIL ++P+I V +L   DQF+IFASDGLWEHLS
Sbjct  242  GDAYLKKAEFNKEPLLPKFRLPEPFQKPILQAEPAILVQKLHPEDQFLIFASDGLWEHLS  301

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV++V   PRNGIARRLVK ALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVV++
Sbjct  302  NQEAVNVVNTCPRNGIARRLVKAALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVLF  361

Query  362  LNSNL-------GPVKVASLSVKGG  415
            L+S+L       GP+    +S++GG
Sbjct  362  LDSHLISRSYWRGPM----VSIRGG  382



>emb|CDY08420.1| BnaA05g26560D [Brassica napus]
Length=379

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 120/141 (85%), Gaps = 3/141 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK++EFNREPL AKFR+ E F+ PIL ++P+ISV ++   DQF+IFASDGLWEHLS
Sbjct  229  GDAYLKRSEFNREPLLAKFRVPEAFQTPILRAEPAISVHKIHPEDQFLIFASDGLWEHLS  288

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV  +PRNGIAR+L+KTALREAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  289  NQEAVDIVNTNPRNGIARKLIKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  348

Query  362  LNSNLGPVKVAS---LSVKGG  415
            L+S+L    V+    +S+ GG
Sbjct  349  LDSHLVSKSVSRRPLISISGG  369



>ref|XP_004137794.1| PREDICTED: probable protein phosphatase 2C 38-like [Cucumis sativus]
 ref|XP_004156568.1| PREDICTED: probable protein phosphatase 2C 38-like [Cucumis sativus]
 gb|KGN58915.1| hypothetical protein Csa_3G736630 [Cucumis sativus]
Length=370

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 119/140 (85%), Gaps = 2/140 (1%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKA+FNR PL  KF+L EPF KPILS++PSI V +L+  DQ++IFASDGLWEHLS
Sbjct  222  GDAYLKKAKFNRPPLPPKFQLPEPFYKPILSAEPSILVHKLRPDDQYLIFASDGLWEHLS  281

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQ+AVDIV  +PRNGIARRLVK ALREAAKKREMRYSDLKKIDRGVRRHFHDDI+VVVV+
Sbjct  282  NQKAVDIVNSYPRNGIARRLVKAALREAAKKREMRYSDLKKIDRGVRRHFHDDISVVVVF  341

Query  362  LNSNL--GPVKVASLSVKGG  415
            L+ +L  G     SLS+KGG
Sbjct  342  LDPHLINGRPSPCSLSIKGG  361



>ref|XP_009146605.1| PREDICTED: probable protein phosphatase 2C 38 [Brassica rapa]
 ref|XP_009146606.1| PREDICTED: probable protein phosphatase 2C 38 [Brassica rapa]
Length=388

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 120/141 (85%), Gaps = 3/141 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK++EFNREPL AKFR+ E F+ PIL ++P+ISV ++   DQF+IFASDGLWEHLS
Sbjct  237  GDAYLKRSEFNREPLLAKFRVPEAFQTPILRAEPAISVHKIHPEDQFLIFASDGLWEHLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV  +PRNGIAR+L+KTALREAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  297  NQEAVDIVNTNPRNGIARKLIKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  356

Query  362  LNSNLGPVKVAS---LSVKGG  415
            L+S+L    V+    +S+ GG
Sbjct  357  LDSHLVSKSVSRRPLISISGG  377



>ref|NP_001168381.1| uncharacterized protein LOC100382150 [Zea mays]
 ref|XP_008643791.1| PREDICTED: uncharacterized protein LOC100382150 isoform X1 [Zea 
mays]
 gb|ACN28032.1| unknown [Zea mays]
 tpg|DAA43254.1| TPA: hypothetical protein ZEAMMB73_941915 [Zea mays]
Length=357

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK E+NREPL++KFRLRE F++PILSS+P I+  ++Q +DQFVIFASDGLWEHLS
Sbjct  236  GDVYLKKPEYNREPLHSKFRLRETFQRPILSSEPQITEHRIQPNDQFVIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            N+EAVD+VQ  PRNGIARRLVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  296  NKEAVDLVQSSPRNGIARRLVKAAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  355

Query  362  L  364
            +
Sbjct  356  M  356



>gb|AIB05855.1| orphans transcription factor, partial [Zea mays]
Length=357

 Score =   206 bits (525),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 112/121 (93%), Gaps = 0/121 (0%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GDVYLKK E+NREPL++KFRLRE F++PILSS+P I+  ++Q +DQFVIFASDGLWEHLS
Sbjct  236  GDVYLKKPEYNREPLHSKFRLRETFQRPILSSEPQITEHRIQPNDQFVIFASDGLWEHLS  295

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            N+EAVD+VQ  PRNGIARRLVK A++EAAKKREMRYSDLKKIDRGVRRHFHDDITVVVV+
Sbjct  296  NKEAVDLVQSSPRNGIARRLVKAAMQEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVF  355

Query  362  L  364
            +
Sbjct  356  M  356



>ref|NP_187868.2| putative protein phosphatase 2C 38 [Arabidopsis thaliana]
 ref|NP_001030682.1| putative protein phosphatase 2C 38 [Arabidopsis thaliana]
 sp|Q9LHJ9.1|P2C38_ARATH RecName: Full=Probable protein phosphatase 2C 38; Short=AtPP2C38 
[Arabidopsis thaliana]
 dbj|BAB02253.1| protein phosphatase 2C [Arabidopsis thaliana]
 gb|AAO44090.1| At3g12620 [Arabidopsis thaliana]
 dbj|BAE99854.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAH20008.1| AT3G12620 [Arabidopsis thaliana]
 dbj|BAH20072.1| AT3G12620 [Arabidopsis thaliana]
 gb|AEE75224.1| putative protein phosphatase 2C 38 [Arabidopsis thaliana]
 gb|AEE75225.1| putative protein phosphatase 2C 38 [Arabidopsis thaliana]
Length=385

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 118/141 (84%), Gaps = 3/141 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFNREPL AKFR+ E F KPIL ++P+I+V ++   DQF+IFASDGLWEHLS
Sbjct  237  GDAYLKKAEFNREPLLAKFRVPEVFHKPILRAEPAITVHKIHPEDQFLIFASDGLWEHLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PRNGIAR+L+KTALREAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  297  NQEAVDIVNTCPRNGIARKLIKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  356

Query  362  LNSNLGPVKVAS---LSVKGG  415
            L+S+L     +    LS+ GG
Sbjct  357  LDSHLVSRSTSRRPLLSISGG  377



>gb|AAG51012.1|AC069474_11 protein phosphatase 2C, putative; 16828-18284 [Arabidopsis thaliana]
Length=376

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 118/141 (84%), Gaps = 3/141 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFNREPL AKFR+ E F KPIL ++P+I+V ++   DQF+IFASDGLWEHLS
Sbjct  228  GDAYLKKAEFNREPLLAKFRVPEVFHKPILRAEPAITVHKIHPEDQFLIFASDGLWEHLS  287

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV   PRNGIAR+L+KTALREAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  288  NQEAVDIVNTCPRNGIARKLIKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  347

Query  362  LNSNLGPVKVAS---LSVKGG  415
            L+S+L     +    LS+ GG
Sbjct  348  LDSHLVSRSTSRRPLLSISGG  368



>ref|XP_011084375.1| PREDICTED: probable protein phosphatase 2C 38 [Sesamum indicum]
 ref|XP_011084376.1| PREDICTED: probable protein phosphatase 2C 38 [Sesamum indicum]
Length=384

 Score =   206 bits (525),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 117/144 (81%), Gaps = 3/144 (2%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKK+EFNR PL  KFRL EPF+KPIL ++PSI V +L   DQF+IFASDGLWEHLS
Sbjct  240  GDAYLKKSEFNRPPLLPKFRLPEPFEKPILLAEPSILVKELYPEDQFLIFASDGLWEHLS  299

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAV++V   PRNGIAR+LVK AL EAAKKREMRYSDLKKIDRGVRRHFHDDITV+VV+
Sbjct  300  NQEAVELVSCSPRNGIARKLVKAALHEAAKKREMRYSDLKKIDRGVRRHFHDDITVIVVF  359

Query  362  LNSNL---GPVKVASLSVKGGTLN  424
            L+S+L    P     LS+KGG+  
Sbjct  360  LDSHLVTSSPFDGPILSIKGGSFT  383



>ref|XP_008233397.1| PREDICTED: probable protein phosphatase 2C 38 isoform X1 [Prunus 
mume]
Length=390

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 120/145 (83%), Gaps = 11/145 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLK+ EFN+EPL AKFRL EPF KPIL ++P+I V +L   DQF+IFASDGLWE LS
Sbjct  243  GDAYLKRQEFNKEPLLAKFRLSEPFHKPILKAEPTILVQKLYPEDQFLIFASDGLWEQLS  302

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            +QEAVDIVQ++PRNGIAR+LVK AL EAAKKREMRYSDLKKIDRGVRRHFHDDITVVV++
Sbjct  303  SQEAVDIVQNYPRNGIARKLVKAALHEAAKKREMRYSDLKKIDRGVRRHFHDDITVVVLF  362

Query  362  LNSNL-------GPVKVASLSVKGG  415
            L+S+L       GP+    LSVKGG
Sbjct  363  LDSHLVSRSYWHGPL----LSVKGG  383



>ref|XP_006436170.1| hypothetical protein CICLE_v10031798mg [Citrus clementina]
 ref|XP_006436171.1| hypothetical protein CICLE_v10031798mg [Citrus clementina]
 ref|XP_006485969.1| PREDICTED: probable protein phosphatase 2C 38-like isoform X1 
[Citrus sinensis]
 ref|XP_006485970.1| PREDICTED: probable protein phosphatase 2C 38-like isoform X2 
[Citrus sinensis]
 gb|ESR49410.1| hypothetical protein CICLE_v10031798mg [Citrus clementina]
 gb|ESR49411.1| hypothetical protein CICLE_v10031798mg [Citrus clementina]
Length=386

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 119/145 (82%), Gaps = 11/145 (8%)
 Frame = +2

Query  2    GDVYLKKAEFNREPLYAKFRLREPFKKPILSSDPSISVLQLQSHDQFVIFASDGLWEHLS  181
            GD YLKKAEFNREPL  KFRL EPF KPIL ++P++SV +L   DQF+IFASDGLWEHLS
Sbjct  237  GDAYLKKAEFNREPLLPKFRLPEPFHKPILLAEPTVSVQRLYPEDQFLIFASDGLWEHLS  296

Query  182  NQEAVDIVQHHPRNGIARRLVKTALREAAKKREMRYSDLKKIDRGVRRHFHDDITVVVVY  361
            NQEAVDIV + PRNG+AR+LVK AL EAAKKREMRYSDLKKIDRGVRRHFHDDITV++++
Sbjct  297  NQEAVDIVHNCPRNGVARKLVKAALHEAAKKREMRYSDLKKIDRGVRRHFHDDITVIILF  356

Query  362  LNSNL-------GPVKVASLSVKGG  415
            L+S L       GP+    +SV+GG
Sbjct  357  LDSYLISRSSWDGPL----ISVRGG  377



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 884735313480