BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16538_g3_i1 len=638 path=[1801:0-198 579:199-224 605:225-637]

Length=638
                                                                      Score     E

ref|XP_011075467.1|  PREDICTED: kirola-like                           92.0    1e-19   
ref|XP_006367964.1|  PREDICTED: MLP-like protein 34-like              88.2    2e-17   
ref|XP_006355094.1|  PREDICTED: kirola-like                           83.6    1e-16   
gb|EYU23173.1|  hypothetical protein MIMGU_mgv1a020758mg              82.8    3e-16   
gb|EYU31821.1|  hypothetical protein MIMGU_mgv1a015566mg              81.6    8e-16   
ref|XP_010319391.1|  PREDICTED: kirola-like                           83.6    8e-16   
ref|XP_009591453.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  83.6    8e-16   
ref|XP_009803723.1|  PREDICTED: kirola-like                           83.6    8e-16   
gb|EYU31819.1|  hypothetical protein MIMGU_mgv1a021736mg              80.1    1e-15   
ref|XP_006367998.1|  PREDICTED: MLP-like protein 34-like              80.1    2e-15   
ref|XP_004237031.1|  PREDICTED: kirola-like                           80.1    2e-15   
gb|ADG43176.1|  putative major latex-like protein                     80.1    3e-15   
gb|EYU33127.1|  hypothetical protein MIMGU_mgv1a019445mg              78.6    5e-15   
ref|XP_006367897.1|  PREDICTED: kirola-like                           79.0    7e-15   
ref|XP_006367636.1|  PREDICTED: MLP-like protein 34-like              80.1    1e-14   
ref|XP_006367513.1|  PREDICTED: MLP-like protein 34-like isoform X1   78.6    1e-14   
ref|XP_006367968.1|  PREDICTED: MLP-like protein 34-like              78.2    1e-14   
ref|XP_011092069.1|  PREDICTED: kirola-like                           78.2    1e-14   
gb|EYU31820.1|  hypothetical protein MIMGU_mgv1a015676mg              77.8    2e-14   
gb|EYU29497.1|  hypothetical protein MIMGU_mgv1a021619mg              77.8    2e-14   
ref|XP_011078290.1|  PREDICTED: kirola-like isoform X1                77.8    2e-14   
ref|XP_011078439.1|  PREDICTED: MLP-like protein 28                   79.7    2e-14   
gb|EYU40241.1|  hypothetical protein MIMGU_mgv1a016485mg              76.6    3e-14   
gb|EYU17814.1|  hypothetical protein MIMGU_mgv1a015637mg              77.0    3e-14   
ref|XP_006367717.1|  PREDICTED: MLP-like protein 28-like              77.0    4e-14   
ref|XP_004240135.1|  PREDICTED: kirola-like                           76.6    4e-14   
gb|EYU34509.1|  hypothetical protein MIMGU_mgv1a026388mg              76.6    5e-14   
ref|XP_011078291.1|  PREDICTED: kirola-like isoform X2                76.6    5e-14   
gb|EYU31817.1|  hypothetical protein MIMGU_mgv1a015578mg              76.6    5e-14   
ref|XP_004246757.1|  PREDICTED: MLP-like protein 28                   76.3    6e-14   
ref|XP_009781869.1|  PREDICTED: kirola-like                           75.9    8e-14   
gb|EYU32958.1|  hypothetical protein MIMGU_mgv1a015581mg              75.9    9e-14   
gb|KDO64572.1|  hypothetical protein CISIN_1g039477mg                 73.2    2e-13   
gb|EYU17813.1|  hypothetical protein MIMGU_mgv1a014581mg              75.1    3e-13   
ref|XP_009761954.1|  PREDICTED: kirola-like                           73.2    3e-13   
ref|XP_004237023.1|  PREDICTED: MLP-like protein 43                   74.3    3e-13   
emb|CDP21915.1|  unnamed protein product                              74.3    3e-13   
ref|XP_004240136.1|  PREDICTED: kirola-like                           73.9    4e-13   
ref|XP_010670107.1|  PREDICTED: MLP-like protein 34                   73.9    5e-13   
ref|XP_009798271.1|  PREDICTED: kirola-like                           73.6    5e-13   
ref|XP_011084196.1|  PREDICTED: kirola-like                           73.2    8e-13   
ref|XP_009589470.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  71.6    8e-13   
gb|ACH72969.1|  major latex-like protein                              73.2    8e-13   Panax ginseng [Chinese ginseng]
emb|CDP21429.1|  unnamed protein product                              72.8    9e-13   
ref|XP_006367208.1|  PREDICTED: MLP-like protein 43-like              72.8    1e-12   
gb|EYU32956.1|  hypothetical protein MIMGU_mgv1a015606mg              72.8    1e-12   
ref|XP_010688570.1|  PREDICTED: MLP-like protein 34                   73.9    2e-12   
ref|XP_003631205.1|  PREDICTED: MLP-like protein 43                   72.0    2e-12   
ref|XP_009791305.1|  PREDICTED: kirola-like isoform X2                71.2    2e-12   
ref|XP_006448199.1|  hypothetical protein CICLE_v10017039mg           72.0    2e-12   
ref|XP_009781868.1|  PREDICTED: kirola-like                           72.0    2e-12   
ref|XP_006367518.1|  PREDICTED: kirola-like                           71.2    2e-12   
ref|XP_011070720.1|  PREDICTED: kirola-like                           71.6    2e-12   
ref|XP_006344280.1|  PREDICTED: MLP-like protein 34-like              71.6    3e-12   
ref|XP_006344332.1|  PREDICTED: kirola-like                           70.1    3e-12   
ref|WP_039311017.1|  hypothetical protein                             72.0    3e-12   
ref|XP_009791304.1|  PREDICTED: kirola-like isoform X1                71.2    3e-12   
emb|CAN75774.1|  hypothetical protein VITISV_033953                   71.2    3e-12   Vitis vinifera
ref|XP_006365784.1|  PREDICTED: MLP-like protein 34-like              71.2    3e-12   
ref|XP_006469318.1|  PREDICTED: MLP-like protein 34-like              70.9    5e-12   
ref|XP_006448231.1|  hypothetical protein CICLE_v10017056mg           70.9    5e-12   
gb|KDO64617.1|  hypothetical protein CISIN_1g031759mg                 70.9    5e-12   
emb|CDP14657.1|  unnamed protein product                              70.9    5e-12   
gb|KDO64616.1|  hypothetical protein CISIN_1g031759mg                 70.9    5e-12   
sp|P85524.1|KIRO_ACTDE  RecName: Full=Kirola; AltName: Allergen=A...  70.9    5e-12   
pdb|4IHR|A  Chain A, Crystal Structure Of Recombinant Kirola (act...  70.9    5e-12   
gb|KHG08746.1|  MLP-like protein 28                                   70.1    7e-12   
gb|KFK41514.1|  hypothetical protein AALP_AA2G139500                  70.5    8e-12   
gb|KHG22340.1|  MLP-like protein 28                                   70.1    9e-12   
gb|KHG27208.1|  MLP-like protein 28                                   70.1    9e-12   
ref|XP_002284516.1|  PREDICTED: MLP-like protein 43                   70.1    9e-12   Vitis vinifera
gb|KCW64564.1|  hypothetical protein EUGRSUZ_G02169                   70.1    1e-11   
ref|XP_010066609.1|  PREDICTED: MLP-like protein 28                   70.1    1e-11   
ref|XP_009620151.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  69.7    1e-11   
ref|XP_002284578.2|  PREDICTED: MLP-like protein 28                   69.7    1e-11   Vitis vinifera
gb|KDO39372.1|  hypothetical protein CISIN_1g041437mg                 69.7    1e-11   
gb|ABA01325.1|  VDRG6                                                 69.7    1e-11   Gossypium hirsutum [American cotton]
ref|XP_006448202.1|  hypothetical protein CICLE_v10018174mg           68.9    1e-11   
emb|CDY03715.1|  BnaA02g15220D                                        69.7    1e-11   
emb|CDY65619.1|  BnaAnng20750D                                        69.7    1e-11   
ref|XP_009127830.1|  PREDICTED: MLP-like protein 34                   69.7    2e-11   
emb|CBI26880.3|  unnamed protein product                              68.9    2e-11   
ref|XP_006303097.1|  hypothetical protein CARUB_v100206591mg          67.4    2e-11   
emb|CAA55812.1|  Sn-1                                                 68.9    2e-11   Capsicum annuum
ref|XP_009773826.1|  PREDICTED: kirola-like                           68.6    2e-11   
ref|XP_009592503.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  68.6    3e-11   
ref|XP_002872296.1|  bet v I allergen family protein                  68.9    3e-11   
ref|XP_004237027.1|  PREDICTED: kirola-like                           68.6    3e-11   
ref|XP_002534267.1|  Major latex protein, putative                    68.6    3e-11   Ricinus communis
gb|EYU32312.1|  hypothetical protein MIMGU_mgv1a015629mg              68.6    3e-11   
gb|EPS58827.1|  hypothetical protein M569_15986                       68.6    3e-11   
ref|XP_004237021.1|  PREDICTED: kirola-like                           68.6    3e-11   
emb|CDP14655.1|  unnamed protein product                              68.6    3e-11   
ref|XP_006390832.1|  hypothetical protein EUTSA_v10019117mg           69.3    3e-11   
ref|NP_177245.1|  MLP-like protein 43                                 68.6    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427882.1|  PREDICTED: MLP-like protein 28                   68.6    3e-11   
emb|CDX68328.1|  BnaA07g23680D                                        68.6    4e-11   
emb|CDY09495.1|  BnaC02g20370D                                        68.2    4e-11   
ref|XP_009780262.1|  PREDICTED: kirola-like                           67.8    4e-11   
ref|XP_006360413.1|  PREDICTED: MLP-like protein 34-like              67.8    4e-11   
ref|XP_009127833.1|  PREDICTED: MLP-like protein 31                   68.2    5e-11   
gb|AER29899.1|  MLP                                                   67.8    5e-11   
ref|XP_006367041.1|  PREDICTED: MLP-like protein 28-like              67.8    5e-11   
ref|XP_002888805.1|  hypothetical protein ARALYDRAFT_476224           67.8    5e-11   
ref|XP_010415784.1|  PREDICTED: MLP-like protein 43                   67.8    5e-11   
gb|EPS59252.1|  hypothetical protein M569_15558                       67.8    5e-11   
ref|XP_002284570.1|  PREDICTED: MLP-like protein 34                   67.8    5e-11   Vitis vinifera
ref|XP_010471089.1|  PREDICTED: MLP-like protein 28                   67.8    6e-11   
ref|XP_011070613.1|  PREDICTED: kirola-like                           67.8    6e-11   
emb|CBI26883.3|  unnamed protein product                              67.4    6e-11   
pdb|2I9Y|A  Chain A, Solution Structure Of Arabidopsis Thaliana P...  67.8    6e-11   
dbj|BAJ25788.1|  putative PR-10 type pathogenesis-related protein     67.4    7e-11   
ref|NP_001117579.1|  MLP-like protein 28                              67.8    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006365602.1|  PREDICTED: MLP-like protein 28-like              67.4    7e-11   
ref|XP_011070612.1|  PREDICTED: kirola-like                           67.4    8e-11   
ref|NP_198153.1|  polyketide cyclase/dehydrase and lipid transpor...  67.4    8e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010678160.1|  PREDICTED: kirola-like                           67.4    8e-11   
ref|XP_009779849.1|  PREDICTED: kirola-like isoform X1                67.4    8e-11   
ref|XP_009127832.1|  PREDICTED: MLP-like protein 31                   67.4    8e-11   
ref|XP_010415777.1|  PREDICTED: MLP-like protein 28                   67.4    8e-11   
gb|KDP44595.1|  hypothetical protein JCGZ_22177                       67.0    9e-11   
ref|XP_008340260.1|  PREDICTED: MLP-like protein 31                   67.4    1e-10   
ref|XP_010494066.1|  PREDICTED: MLP-like protein 31                   67.4    1e-10   
ref|XP_004240133.1|  PREDICTED: kirola-like                           67.0    1e-10   
ref|XP_007226522.1|  hypothetical protein PRUPE_ppa025363mg           67.0    1e-10   
ref|XP_010415785.1|  PREDICTED: MLP-like protein 43                   67.0    1e-10   
ref|XP_009616725.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  66.2    1e-10   
ref|NP_001077806.1|  MLP-like protein 28                              67.4    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010684109.1|  PREDICTED: MLP-like protein 43                   67.0    1e-10   
gb|KFK41510.1|  hypothetical protein AALP_AA2G139000                  67.8    1e-10   
ref|XP_002535412.1|  Major latex protein, putative                    67.0    1e-10   Ricinus communis
ref|XP_010672189.1|  PREDICTED: kirola-like                           67.0    1e-10   
ref|XP_004237017.1|  PREDICTED: kirola-like                           66.6    1e-10   
ref|XP_009777224.1|  PREDICTED: kirola-like                           66.6    1e-10   
gb|EPS57581.1|  hypothetical protein M569_17236                       66.2    1e-10   
ref|XP_009774601.1|  PREDICTED: kirola-like                           66.6    1e-10   
ref|XP_009104932.1|  PREDICTED: MLP-like protein 34                   67.0    1e-10   
ref|XP_004237029.1|  PREDICTED: kirola-like                           66.6    1e-10   
ref|XP_002862771.1|  hypothetical protein ARALYDRAFT_497302           68.2    1e-10   
dbj|BAJ25783.1|  putative PR-10 type pathogenesis-related protein     66.6    1e-10   
ref|XP_006303111.1|  hypothetical protein CARUB_v100206590mg          68.2    1e-10   
emb|CDY03718.1|  BnaA02g15190D                                        67.8    1e-10   
ref|XP_011078288.1|  PREDICTED: kirola-like isoform X1                66.6    1e-10   
ref|XP_009127828.1|  PREDICTED: MLP-like protein 31                   67.4    1e-10   
ref|NP_177240.3|  MLP-like protein 28                                 67.8    1e-10   Arabidopsis thaliana [mouse-ear cress]
gb|EYU31818.1|  hypothetical protein MIMGU_mgv1a024291mg              66.6    1e-10   
ref|XP_011078287.1|  PREDICTED: kirola-like                           66.6    1e-10   
ref|XP_009761732.1|  PREDICTED: kirola-like                           66.6    1e-10   
emb|CDY09492.1|  BnaC02g20340D                                        67.8    1e-10   
ref|XP_010421666.1|  PREDICTED: MLP-like protein 31                   66.6    1e-10   
ref|XP_006301425.1|  hypothetical protein CARUB_v10021843mg           66.6    1e-10   
emb|CAA55813.1|  Sn-2                                                 66.2    1e-10   Capsicum annuum
ref|XP_002535538.1|  conserved hypothetical protein                   64.7    2e-10   Ricinus communis
ref|XP_009626144.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  66.2    2e-10   
gb|EPS64959.1|  hypothetical protein M569_09820                       65.9    2e-10   
ref|XP_004297383.1|  PREDICTED: MLP-like protein 28-like              66.2    2e-10   
ref|XP_009616724.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  66.2    2e-10   
ref|XP_002323753.1|  major latex protein homologue                    65.9    2e-10   Populus trichocarpa [western balsam poplar]
ref|XP_009793464.1|  PREDICTED: kirola-like                           66.2    2e-10   
ref|NP_001077807.1|  MLP-like protein 28                              67.8    2e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888799.1|  predicted protein                                68.2    2e-10   
ref|XP_006367814.1|  PREDICTED: kirola-like                           65.9    2e-10   
emb|CDP00800.1|  unnamed protein product                              65.9    2e-10   
ref|XP_009609604.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  65.9    2e-10   
ref|XP_006344279.1|  PREDICTED: MLP-like protein 34-like              65.9    3e-10   
ref|XP_010415774.1|  PREDICTED: MLP-like protein 43 isoform X2        67.8    3e-10   
ref|XP_006289231.1|  hypothetical protein CARUB_v10002687mg           65.9    3e-10   
ref|NP_850976.1|  MLP-like protein 34                                 67.8    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009587470.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  64.3    3e-10   
ref|XP_002862769.1|  predicted protein                                67.0    3e-10   
ref|XP_009592037.1|  PREDICTED: MLP-like protein 28                   67.4    3e-10   
ref|XP_006303098.1|  hypothetical protein CARUB_v100206591mg          67.0    4e-10   
ref|XP_006345291.1|  PREDICTED: kirola-like                           65.1    4e-10   
ref|XP_010427896.1|  PREDICTED: MLP-like protein 43                   65.5    4e-10   
ref|XP_009607912.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  65.5    4e-10   
ref|XP_002284527.1|  PREDICTED: MLP-like protein 43                   65.1    4e-10   Vitis vinifera
ref|XP_010415773.1|  PREDICTED: MLP-like protein 28 isoform X1        67.4    4e-10   
ref|XP_010427894.1|  PREDICTED: MLP-like protein 43                   65.1    4e-10   
ref|XP_004242814.1|  PREDICTED: kirola-like                           65.1    4e-10   
ref|NP_849875.1|  MLP-like protein 28                                 67.8    4e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010471086.1|  PREDICTED: MLP-like protein 34                   67.8    4e-10   
gb|KDP32318.1|  hypothetical protein JCGZ_13243                       65.1    5e-10   
ref|XP_006367896.1|  PREDICTED: kirola-like                           65.1    5e-10   
dbj|BAJ25787.1|  putative PR-10 type pathogenesis-related protein     64.7    5e-10   
ref|XP_006390831.1|  hypothetical protein EUTSA_v10019454mg           67.4    5e-10   
ref|XP_009759247.1|  PREDICTED: kirola-like                           64.7    6e-10   
emb|CDY23474.1|  BnaC06g24430D                                        65.1    6e-10   
ref|XP_002315876.1|  Csf-2 family protein                             64.7    6e-10   Populus trichocarpa [western balsam poplar]
ref|XP_004246324.1|  PREDICTED: MLP-like protein 31                   64.7    6e-10   
gb|AFV29675.1|  major latex-like protein                              63.2    7e-10   
ref|XP_010676168.1|  PREDICTED: MLP-like protein 31                   64.7    7e-10   
ref|XP_010427877.1|  PREDICTED: MLP-like protein 34                   67.0    7e-10   
ref|XP_006361655.1|  PREDICTED: MLP-like protein 34-like              64.7    7e-10   
ref|XP_006367980.1|  PREDICTED: MLP-like protein 28-like              64.3    7e-10   
ref|XP_009616726.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  64.3    8e-10   
ref|NP_565003.3|  MLP-like protein 34                                 65.5    8e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007223651.1|  hypothetical protein PRUPE_ppa012742mg           64.3    8e-10   
ref|XP_002888797.1|  bet v I allergen family protein                  66.6    8e-10   
ref|XP_010415772.1|  PREDICTED: MLP-like protein 34                   67.4    9e-10   
ref|XP_006367813.1|  PREDICTED: kirola-like                           64.3    9e-10   
emb|CBI26888.3|  unnamed protein product                              63.2    9e-10   
ref|XP_010688214.1|  PREDICTED: MLP-like protein 34                   64.3    1e-09   
ref|XP_006355753.1|  PREDICTED: kirola-like                           63.5    1e-09   
ref|XP_007226386.1|  hypothetical protein PRUPE_ppa023240mg           63.5    1e-09   
ref|XP_010684158.1|  PREDICTED: MLP-like protein 43                   64.7    1e-09   
ref|XP_009758199.1|  PREDICTED: MLP-like protein 43                   63.9    1e-09   
ref|XP_002874413.1|  bet v I allergen family protein                  64.3    1e-09   
ref|XP_010314987.1|  PREDICTED: kirola-like isoform X2                62.8    1e-09   
ref|XP_009105750.1|  PREDICTED: MLP-like protein 43                   64.7    1e-09   
gb|KFK41512.1|  hypothetical protein AALP_AA2G139300                  64.3    1e-09   
ref|XP_006300911.1|  hypothetical protein CARUB_v10021281mg           63.9    1e-09   
ref|XP_006354582.1|  PREDICTED: kirola-like                           63.9    1e-09   
ref|XP_006469191.1|  PREDICTED: MLP-like protein 28-like isoform X2   63.2    1e-09   
emb|CDX91696.1|  BnaC08g06150D                                        63.9    1e-09   
gb|EPS71115.1|  hypothetical protein M569_03645                       63.5    1e-09   
gb|KDP32317.1|  hypothetical protein JCGZ_13242                       63.9    1e-09   
ref|XP_002323752.1|  major latex protein homologue                    63.9    1e-09   Populus trichocarpa [western balsam poplar]
emb|CDP00799.1|  unnamed protein product                              63.9    1e-09   
ref|XP_006302942.1|  hypothetical protein CARUB_v10021082mg           63.9    1e-09   
gb|KDO64615.1|  hypothetical protein CISIN_1g031759mg                 63.2    1e-09   
ref|NP_001268151.1|  ripening-related protein-like                    63.5    1e-09   
ref|XP_010427880.1|  PREDICTED: MLP-like protein 43 isoform X2        65.9    1e-09   
emb|CDY00801.1|  BnaCnng00010D                                        63.9    1e-09   
ref|XP_004237018.1|  PREDICTED: kirola                                63.5    1e-09   
ref|XP_010471088.1|  PREDICTED: MLP-like protein 28 isoform X2        65.5    1e-09   
emb|CAN83049.1|  hypothetical protein VITISV_030287                   63.5    1e-09   Vitis vinifera
ref|XP_009767588.1|  PREDICTED: kirola-like                           63.5    2e-09   
ref|XP_004246759.2|  PREDICTED: MLP-like protein 34                   65.9    2e-09   
ref|XP_004140475.1|  PREDICTED: MLP-like protein 28-like              63.5    2e-09   
ref|XP_004246323.1|  PREDICTED: kirola-like                           63.5    2e-09   
ref|XP_009759779.1|  PREDICTED: kirola-like                           63.2    2e-09   
gb|KFK44401.1|  hypothetical protein AALP_AA1G252600                  63.5    2e-09   
ref|XP_006355259.1|  PREDICTED: kirola-like                           63.2    2e-09   
ref|XP_009783369.1|  PREDICTED: kirola-like                           63.2    2e-09   
ref|XP_010427878.1|  PREDICTED: MLP-like protein 34 isoform X1        65.5    2e-09   
ref|XP_011043108.1|  PREDICTED: MLP-like protein 31                   63.2    2e-09   
gb|AAP34364.1|  putative major latex-like protein                     62.8    2e-09   Gossypium barbadense [Egyptian cotton]
ref|XP_006355289.1|  PREDICTED: kirola-like                           63.2    2e-09   
ref|XP_010471087.1|  PREDICTED: MLP-like protein 34 isoform X1        65.5    2e-09   
ref|XP_010317813.1|  PREDICTED: kirola-like isoform X2                62.8    2e-09   
ref|XP_004234684.1|  PREDICTED: kirola-like isoform X1                63.2    2e-09   
ref|XP_004253390.1|  PREDICTED: kirola-like isoform X1                62.8    2e-09   
ref|XP_002280830.1|  PREDICTED: MLP-like protein 28                   62.8    2e-09   Vitis vinifera
ref|XP_010092945.1|  MLP-like protein 28                              65.1    2e-09   
ref|XP_011038620.1|  PREDICTED: MLP-like protein 43                   63.2    2e-09   
ref|XP_004244869.1|  PREDICTED: kirola-like                           62.8    3e-09   
ref|XP_006365611.1|  PREDICTED: kirola-like                           62.0    3e-09   
ref|XP_010666837.1|  PREDICTED: MLP-like protein 43                   62.8    3e-09   
ref|XP_006301818.1|  hypothetical protein CARUB_v10022286mg           62.8    4e-09   
ref|XP_008221417.1|  PREDICTED: MLP-like protein 31                   62.4    4e-09   
ref|XP_010666838.1|  PREDICTED: MLP-like protein 43                   62.8    4e-09   
ref|XP_010415778.1|  PREDICTED: MLP-like protein 31                   62.4    4e-09   
ref|XP_009770200.1|  PREDICTED: kirola-like                           61.6    4e-09   
emb|CAC43292.1|  major latex like protein homolog                     62.4    4e-09   Beta vulgaris [beet]
ref|XP_011078289.1|  PREDICTED: MLP-like protein 28 isoform X2        62.4    4e-09   
gb|AER29900.1|  MLP-like protein                                      62.4    4e-09   
gb|EPS68988.1|  hypothetical protein M569_05780                       62.0    4e-09   
gb|KDP38075.1|  hypothetical protein JCGZ_04718                       62.4    4e-09   
ref|XP_006367209.1|  PREDICTED: MLP-like protein 43-like              62.0    5e-09   
emb|CBI26887.3|  unnamed protein product                              62.0    5e-09   
ref|XP_006366345.1|  PREDICTED: MLP-like protein 34-like              62.0    5e-09   
ref|XP_009339700.1|  PREDICTED: MLP-like protein 28                   62.4    5e-09   
emb|CDY41465.1|  BnaA08g20670D                                        62.0    5e-09   
ref|XP_006301568.1|  hypothetical protein CARUB_v10022006mg           62.0    5e-09   
gb|EPS59251.1|  hypothetical protein M569_15557                       61.6    5e-09   
gb|AFV29663.1|  major latex-like protein                              60.5    5e-09   
ref|XP_002888800.1|  hypothetical protein ARALYDRAFT_894905           62.0    5e-09   
ref|XP_010415776.1|  PREDICTED: MLP-like protein 31                   62.4    5e-09   
ref|NP_177241.3|  MLP-like protein 31                                 62.4    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006303112.1|  hypothetical protein CARUB_v100206590mg          63.2    6e-09   
gb|AFV29669.1|  major latex-like protein                              60.5    6e-09   
ref|XP_004248782.1|  PREDICTED: kirola-like                           61.6    6e-09   
gb|AAD55499.1|AC008148_9  Unknown protein                             62.0    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010099804.1|  MLP-like protein 31                              62.0    6e-09   
gb|AFV29686.1|  major latex-like protein                              60.5    6e-09   
ref|XP_006344378.1|  PREDICTED: kirola-like                           61.6    6e-09   
ref|XP_006366347.1|  PREDICTED: kirola-like                           62.0    6e-09   
gb|AFV29664.1|  major latex-like protein                              60.5    6e-09   
ref|XP_009612232.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  61.6    6e-09   
emb|CAC83580.1|  major latex-like protein                             62.0    6e-09   
ref|NP_198152.1|  SRPBCC ligand-binding domain-containing protein     62.0    7e-09   
ref|XP_003631204.1|  PREDICTED: MLP-like protein 34                   61.6    7e-09   
dbj|BAJ25786.1|  putative PR-10 type pathogenesis-related protein     61.6    7e-09   
ref|XP_010325795.1|  PREDICTED: kirola-like                           61.6    7e-09   
ref|XP_010427883.1|  PREDICTED: MLP-like protein 31                   61.6    7e-09   
ref|XP_002862770.1|  hypothetical protein ARALYDRAFT_497301           61.6    8e-09   
ref|XP_002888798.1|  bet v I allergen family protein                  61.6    8e-09   
ref|XP_006367051.1|  PREDICTED: kirola-like                           61.6    8e-09   
ref|XP_004498312.1|  PREDICTED: MLP-like protein 34-like              61.6    8e-09   
emb|CDY09499.1|  BnaC02g20410D                                        61.2    8e-09   
ref|XP_009110123.1|  PREDICTED: MLP-like protein 31                   61.2    9e-09   
ref|XP_010427881.1|  PREDICTED: MLP-like protein 31                   61.6    1e-08   
emb|CDX72752.1|  BnaC06g32000D                                        60.8    1e-08   
ref|XP_009105753.1|  PREDICTED: MLP-like protein 43                   61.2    1e-08   
ref|XP_006367207.1|  PREDICTED: kirola-like                           60.8    1e-08   
gb|KHN05143.1|  MLP-like protein 43                                   61.2    1e-08   
ref|NP_001236164.1|  uncharacterized protein LOC100527699             60.8    1e-08   
ref|XP_007153302.1|  hypothetical protein PHAVU_003G023600g           60.8    1e-08   
ref|XP_011078438.1|  PREDICTED: MLP-like protein 34                   63.5    1e-08   
ref|XP_007045183.1|  MLP-like protein 28                              60.8    1e-08   
ref|XP_004290369.1|  PREDICTED: MLP-like protein 43-like              60.8    1e-08   
gb|AFV29734.1|  major latex-like protein                              59.3    1e-08   
ref|XP_009110122.1|  PREDICTED: MLP-like protein 34                   60.8    1e-08   
emb|CDY41464.1|  BnaA08g20660D                                        60.5    1e-08   
gb|AFV29662.1|  major latex-like protein                              59.3    2e-08   
ref|XP_011070614.1|  PREDICTED: MLP-like protein 28                   60.5    2e-08   
ref|XP_009115561.1|  PREDICTED: MLP-like protein 43                   61.2    2e-08   
emb|CDY21418.1|  BnaA09g30090D                                        60.8    2e-08   
ref|XP_002888804.1|  hypothetical protein ARALYDRAFT_894909           60.5    2e-08   
emb|CDY03714.1|  BnaA02g15230D                                        60.8    2e-08   
ref|XP_002534266.1|  Major latex protein, putative                    60.5    2e-08   
ref|XP_011038618.1|  PREDICTED: MLP-like protein 43                   60.5    2e-08   
ref|XP_009127831.1|  PREDICTED: MLP-like protein 31                   60.5    2e-08   
gb|KDO64618.1|  hypothetical protein CISIN_1g034001mg                 59.7    2e-08   
ref|XP_004237016.1|  PREDICTED: kirola-like                           60.1    2e-08   
emb|CDY68859.1|  BnaC06g43750D                                        60.1    2e-08   
ref|XP_006303687.1|  hypothetical protein CARUB_v10011772mg           60.1    2e-08   
ref|XP_003519004.2|  PREDICTED: MLP-like protein 28-like              60.5    3e-08   
ref|XP_004237497.1|  PREDICTED: MLP-like protein 34                   60.1    3e-08   
gb|KDP38072.1|  hypothetical protein JCGZ_04715                       60.1    3e-08   
ref|XP_009339704.1|  PREDICTED: MLP-like protein 34                   58.9    3e-08   
emb|CBI26882.3|  unnamed protein product                              62.0    3e-08   
ref|XP_006367815.1|  PREDICTED: kirola-like                           59.7    3e-08   
ref|XP_002888801.1|  hypothetical protein ARALYDRAFT_894906           60.1    3e-08   
ref|XP_010533364.1|  PREDICTED: major latex protein 146               59.7    3e-08   
ref|XP_004156146.1|  PREDICTED: MLP-like protein 328-like             59.7    4e-08   
emb|CDY70076.1|  BnaAnng32530D                                        59.3    4e-08   
ref|XP_009110119.1|  PREDICTED: MLP-like protein 34                   59.3    4e-08   
ref|XP_004142319.1|  PREDICTED: MLP-like protein 328-like             59.3    4e-08   
gb|AAC14179.1|  major latex protein homolog                           59.3    4e-08   
gb|AFK47321.1|  unknown                                               59.3    5e-08   
ref|XP_002284534.2|  PREDICTED: MLP-like protein 34                   61.6    5e-08   
emb|CDP00795.1|  unnamed protein product                              59.3    5e-08   
emb|CDY41462.1|  BnaA08g20640D                                        59.3    5e-08   
ref|XP_009105754.1|  PREDICTED: MLP-like protein 31                   59.3    5e-08   
ref|XP_006301346.1|  hypothetical protein CARUB_v10021755mg           59.3    5e-08   
ref|XP_006448232.1|  hypothetical protein CICLE_v10017055mg           59.3    5e-08   
ref|XP_006367206.1|  PREDICTED: kirola-like                           59.3    5e-08   
ref|XP_007045185.1|  MLP-like protein 28                              59.3    5e-08   
gb|KFK41516.1|  hypothetical protein AALP_AA2G139700                  59.3    5e-08   
ref|XP_009105755.1|  PREDICTED: MLP-like protein 31                   59.3    5e-08   
ref|XP_006367211.1|  PREDICTED: kirola-like                           58.9    6e-08   
ref|XP_008439039.1|  PREDICTED: MLP-like protein 43                   59.3    6e-08   
ref|XP_007045173.1|  MLP-like protein 34                              59.3    6e-08   
ref|XP_006469189.1|  PREDICTED: MLP-like protein 43-like              58.9    6e-08   
gb|AFK46963.1|  unknown                                               58.9    7e-08   
ref|XP_010913536.1|  PREDICTED: MLP-like protein 423                  58.9    7e-08   
ref|XP_009110120.1|  PREDICTED: MLP-like protein 31                   58.9    8e-08   
gb|KFK44402.1|  hypothetical protein AALP_AA1G252700                  58.5    8e-08   
gb|KHG17607.1|  MLP-like protein 31                                   58.9    8e-08   
ref|XP_011038619.1|  PREDICTED: MLP-like protein 28                   58.5    9e-08   
ref|XP_010462854.1|  PREDICTED: MLP-like protein 28                   60.8    9e-08   
ref|NP_177244.1|  SRPBCC domain-containing protein                    58.5    9e-08   
emb|CDX91697.1|  BnaC08g06160D                                        58.5    9e-08   
ref|XP_007045171.1|  MLP-like protein 34 isoform 2                    57.8    1e-07   
ref|XP_010415783.1|  PREDICTED: MLP-like protein 31                   58.5    1e-07   
gb|KDP38071.1|  hypothetical protein JCGZ_04714                       57.0    1e-07   
ref|XP_006416123.1|  hypothetical protein EUTSA_v10009858mg           57.0    1e-07   
ref|XP_006599132.1|  PREDICTED: MLP-like protein 43-like              58.2    1e-07   
ref|XP_003626964.1|  MLP-like protein                                 58.2    1e-07   
ref|XP_006416122.1|  hypothetical protein EUTSA_v10009023mg           57.8    1e-07   
gb|EPS64958.1|  hypothetical protein M569_09819                       58.2    1e-07   
ref|XP_007045170.1|  MLP-like protein 34 isoform 1                    57.8    2e-07   
ref|XP_010066616.1|  PREDICTED: MLP-like protein 423                  57.8    2e-07   
ref|XP_006344281.1|  PREDICTED: kirola-like                           57.8    2e-07   
ref|XP_010046548.1|  PREDICTED: MLP-like protein 34                   57.0    2e-07   
ref|XP_010552705.1|  PREDICTED: MLP-like protein 34                   59.7    2e-07   
ref|XP_007045177.1|  MLP-like protein 34, putative                    57.4    2e-07   
emb|CDY12480.1|  BnaC07g13200D                                        57.8    2e-07   
ref|XP_010694239.1|  PREDICTED: MLP-like protein 31                   57.4    2e-07   
emb|CDX72753.1|  BnaC06g32010D                                        57.4    2e-07   
ref|XP_002890555.1|  hypothetical protein ARALYDRAFT_472567           57.4    2e-07   
gb|EYU30076.1|  hypothetical protein MIMGU_mgv1a015662mg              57.4    2e-07   
gb|ACU19047.1|  unknown                                               57.4    2e-07   
ref|XP_004498311.1|  PREDICTED: MLP-like protein 34-like              57.4    2e-07   
emb|CDX96283.1|  BnaA07g28940D                                        57.0    2e-07   
emb|CDP20847.1|  unnamed protein product                              57.4    2e-07   
ref|XP_008439042.1|  PREDICTED: MLP-like protein 43 isoform X2        57.4    2e-07   
gb|KCW64575.1|  hypothetical protein EUGRSUZ_G02178                   57.0    3e-07   
ref|XP_010325794.1|  PREDICTED: kirola-like                           57.0    3e-07   
gb|AFK45005.1|  unknown                                               57.0    3e-07   
ref|XP_010460089.1|  PREDICTED: MLP-like protein 34                   57.0    3e-07   
gb|KCW86238.1|  hypothetical protein EUGRSUZ_B02924                   56.6    3e-07   
ref|XP_008450247.1|  PREDICTED: MLP-like protein 328                  57.0    3e-07   
ref|XP_008439041.1|  PREDICTED: MLP-like protein 28 isoform X1        56.6    4e-07   
gb|KFK41515.1|  hypothetical protein AALP_AA2G139600                  57.0    4e-07   
ref|XP_006367632.1|  PREDICTED: MLP-like protein 34-like              56.6    4e-07   
gb|AFK38000.1|  unknown                                               57.0    4e-07   
ref|XP_010471091.1|  PREDICTED: MLP-like protein 31                   57.0    4e-07   
gb|KFK44400.1|  hypothetical protein AALP_AA1G252500                  57.0    4e-07   
ref|XP_006367997.1|  PREDICTED: kirola-like                           56.6    5e-07   
ref|XP_006598268.1|  PREDICTED: MLP-like protein 34-like              56.6    5e-07   
ref|NP_001236428.1|  uncharacterized protein LOC100527208             56.2    6e-07   
gb|KHN40931.1|  MLP-like protein 43                                   56.2    7e-07   
gb|KGN57232.1|  Csf-2 protein                                         56.2    8e-07   
ref|XP_011086520.1|  PREDICTED: MLP-like protein 423                  55.8    8e-07   
ref|XP_009105751.1|  PREDICTED: MLP-like protein 43                   55.8    8e-07   
ref|XP_010688218.1|  PREDICTED: MLP-like protein 43 isoform X1        55.8    9e-07   
ref|XP_006366068.1|  PREDICTED: kirola-like                           55.8    9e-07   
ref|XP_002888803.1|  bet v I allergen family protein                  55.8    9e-07   
sp|Q06394.1|ML146_PAPSO  RecName: Full=Major latex protein 146; S...  55.8    9e-07   
dbj|BAA83470.1|  Csf-2                                                55.8    9e-07   
ref|XP_009351501.1|  PREDICTED: MLP-like protein 28                   55.8    1e-06   
ref|XP_008339534.1|  PREDICTED: MLP-like protein 28                   55.5    1e-06   
ref|NP_173725.1|  polyketide cyclase/dehydrase and lipid transpor...  55.5    1e-06   
gb|AFK35144.1|  unknown                                               55.5    1e-06   
ref|XP_006367040.1|  PREDICTED: MLP-like protein 28-like              55.5    1e-06   
ref|XP_004297384.1|  PREDICTED: kirola-like                           55.5    1e-06   
ref|XP_003628192.1|  MLP-like protein                                 55.5    1e-06   
ref|XP_009349512.1|  PREDICTED: MLP-like protein 28                   55.5    1e-06   
ref|XP_004293036.1|  PREDICTED: major latex protein 146-like          55.1    2e-06   
emb|CDP00797.1|  unnamed protein product                              55.1    2e-06   
ref|XP_007149299.1|  hypothetical protein PHAVU_005G058600g           55.1    2e-06   
gb|KDO36351.1|  hypothetical protein CISIN_1g038195mg                 55.5    2e-06   
gb|KHG05186.1|  MLP-like protein 28                                   55.1    2e-06   
ref|XP_010272916.1|  PREDICTED: MLP-like protein 34                   54.7    2e-06   
ref|XP_010427893.1|  PREDICTED: MLP-like protein 31                   55.1    2e-06   
gb|EYU33126.1|  hypothetical protein MIMGU_mgv1a0195071mg             53.1    2e-06   
ref|XP_004237022.1|  PREDICTED: kirola-like                           54.7    2e-06   
gb|EMT05612.1|  MLP-like protein 423                                  54.7    3e-06   
gb|KEH40555.1|  polyketide cyclase/dehydrase and lipid transporter    54.7    3e-06   
emb|CAB96767.1|  major latex protein homologue                        53.1    3e-06   
gb|AAY26389.1|  salt tolerant protein                                 54.7    3e-06   
emb|CDP00798.1|  unnamed protein product                              54.3    3e-06   
ref|XP_010533357.1|  PREDICTED: MLP-like protein 31                   54.7    3e-06   
ref|XP_006366344.1|  PREDICTED: MLP-like protein 34-like              54.3    3e-06   
ref|XP_009351493.1|  PREDICTED: MLP-like protein 43                   54.3    3e-06   
ref|XP_009610076.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  54.3    3e-06   
ref|NP_001237398.1|  uncharacterized protein LOC100500396             54.3    3e-06   
gb|AAM64541.1|  major latex protein (MLP149), putative                54.7    3e-06   
ref|XP_002534268.1|  Major latex protein, putative                    53.5    3e-06   
ref|XP_004142279.1|  PREDICTED: MLP-like protein 328-like             54.3    3e-06   
ref|XP_010498816.1|  PREDICTED: MLP-like protein 328                  54.3    3e-06   
ref|XP_009360478.1|  PREDICTED: MLP-like protein 423                  53.9    4e-06   
ref|XP_008389602.1|  PREDICTED: MLP-like protein 423                  53.9    4e-06   
ref|XP_004147670.1|  PREDICTED: MLP-like protein 28-like              55.8    4e-06   
ref|XP_010086735.1|  MLP-like protein 329                             53.9    4e-06   
ref|XP_007148876.1|  hypothetical protein PHAVU_005G021700g           53.5    5e-06   
ref|XP_006469314.1|  PREDICTED: MLP-like protein 28-like              55.8    5e-06   
ref|NP_001238076.1|  ripening related protein                         53.5    5e-06   
gb|AFK49330.1|  unknown                                               53.5    5e-06   
ref|XP_008389201.1|  PREDICTED: MLP-like protein 28                   53.5    5e-06   
gb|KHN38144.1|  MLP-like protein 43                                   53.5    5e-06   
gb|EPS58825.1|  hypothetical protein M569_15989                       53.5    6e-06   
gb|AFK42542.1|  unknown                                               53.5    6e-06   
ref|XP_010326138.1|  PREDICTED: MLP-like protein 43                   53.5    7e-06   
ref|NP_001240867.1|  MLP-like protein 28-like                         53.5    7e-06   
ref|XP_007045180.1|  MLP-like protein 28, putative                    53.5    7e-06   
gb|AFK45085.1|  unknown                                               53.1    8e-06   
ref|XP_004291554.1|  PREDICTED: MLP-like protein 28-like              53.1    8e-06   
ref|NP_001236859.1|  uncharacterized protein LOC100499848             53.1    8e-06   
ref|XP_010272919.1|  PREDICTED: kirola-like                           52.0    9e-06   
ref|XP_008450254.1|  PREDICTED: MLP-like protein 328                  52.8    1e-05   
ref|XP_007045179.1|  MLP-like protein 28, putative                    53.1    1e-05   
ref|XP_010415780.1|  PREDICTED: MLP-like protein 31                   53.1    1e-05   
ref|XP_004489875.1|  PREDICTED: MLP-like protein 423-like             52.8    1e-05   
ref|XP_004135228.1|  PREDICTED: MLP-like protein 423-like             52.8    1e-05   
ref|XP_006390830.1|  hypothetical protein EUTSA_v10019433mg           52.8    1e-05   
ref|XP_007149098.1|  hypothetical protein PHAVU_005G041000g           52.8    1e-05   
ref|XP_010427885.1|  PREDICTED: MLP-like protein 43 isoform X2        53.5    1e-05   
ref|XP_006366346.1|  PREDICTED: MLP-like protein 34-like              52.8    1e-05   
emb|CDP20848.1|  unnamed protein product                              52.8    1e-05   
ref|XP_006652389.1|  PREDICTED: MLP-like protein 423-like             52.4    1e-05   
gb|KEH40553.1|  pathogenesis-related protein bet V I family protein   52.4    1e-05   
ref|XP_010044190.1|  PREDICTED: MLP-like protein 328                  52.4    1e-05   
ref|XP_004142280.1|  PREDICTED: MLP-like protein 328-like             52.4    2e-05   
ref|XP_006367212.1|  PREDICTED: kirola-like                           51.6    2e-05   
ref|XP_010044193.1|  PREDICTED: MLP-like protein 34                   52.4    2e-05   
ref|XP_008358813.1|  PREDICTED: MLP-like protein 329                  52.4    2e-05   
gb|AFK40667.1|  unknown                                               52.0    2e-05   
gb|KGN57831.1|  hypothetical protein Csa_3G340350                     52.4    2e-05   
gb|AFK48227.1|  unknown                                               52.0    2e-05   
ref|XP_010272006.1|  PREDICTED: MLP-like protein 423                  52.0    2e-05   
ref|XP_008446239.1|  PREDICTED: MLP-like protein 423                  52.0    2e-05   
ref|XP_004140443.1|  PREDICTED: MLP-like protein 28-like              52.0    3e-05   
emb|CAA11844.1|  major latex-like protein                             51.6    3e-05   
ref|XP_008340261.1|  PREDICTED: MLP-like protein 329                  52.0    3e-05   
gb|KCW86226.1|  hypothetical protein EUGRSUZ_B02913                   52.4    3e-05   
ref|XP_010272876.1|  PREDICTED: MLP-like protein 423                  51.6    3e-05   
ref|XP_011021651.1|  PREDICTED: MLP-like protein 423                  51.6    3e-05   
ref|XP_007224404.1|  hypothetical protein PRUPE_ppa021708m1g          53.1    3e-05   
gb|EYU18071.1|  hypothetical protein MIMGU_mgv1a023909mg              51.6    3e-05   
ref|XP_008457062.1|  PREDICTED: MLP-like protein 423                  51.6    3e-05   
ref|XP_004164830.1|  PREDICTED: MLP-like protein 34-like              51.6    3e-05   
gb|KCW85795.1|  hypothetical protein EUGRSUZ_B02546                   50.8    3e-05   
ref|XP_010928576.1|  PREDICTED: MLP-like protein 423                  51.2    4e-05   
emb|CAG34224.1|  putative Bet v I family protein                      51.2    4e-05   
ref|XP_011023662.1|  PREDICTED: MLP-like protein 328                  51.2    4e-05   
emb|CDP00197.1|  unnamed protein product                              51.2    4e-05   
ref|XP_007045166.1|  Polyketide cyclase/dehydrase and lipid trans...  51.6    4e-05   
ref|XP_010427884.1|  PREDICTED: MLP-like protein 31 isoform X1        53.1    4e-05   
ref|XP_009351485.1|  PREDICTED: MLP-like protein 328 isoform X1       51.6    4e-05   
ref|XP_002890563.1|  bet v I allergen family protein                  51.2    4e-05   
ref|XP_009351488.1|  PREDICTED: MLP-like protein 329 isoform X4       51.6    4e-05   
ref|XP_008245210.1|  PREDICTED: MLP-like protein 423                  51.2    4e-05   
ref|XP_010100504.1|  MLP-like protein 423                             51.2    4e-05   
ref|XP_009351487.1|  PREDICTED: MLP-like protein 329 isoform X3       51.6    4e-05   
ref|XP_008386234.1|  PREDICTED: MLP-like protein 423                  51.2    5e-05   
ref|XP_010552706.1|  PREDICTED: major latex protein 146               50.8    5e-05   
ref|XP_010683260.1|  PREDICTED: MLP-like protein 28                   51.2    5e-05   



>ref|XP_011075467.1| PREDICTED: kirola-like [Sesamum indicum]
Length=155

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/75 (55%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EKK V F+V++GD++E YK+F LT  V +N DD+ VTWTLEYEKLSE++P+P + +
Sbjct  75   AIDEEKKSVTFKVIEGDLMELYKTFKLTVHVDTNGDDNLVTWTLEYEKLSEDVPDPHTLM  134

Query  182  QTILDITKEMEDHHA  226
            +  L++TK++E HH 
Sbjct  135  EFCLNVTKDIEKHHV  149



>ref|XP_006367964.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=296

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+EKKLVKF+V+ GDIL+ YKSF +T  V +  +D+ VTW LEYEKL+++IP+P + ++
Sbjct  76   IDEEKKLVKFKVIGGDILDYYKSFYITVHVETKGEDNLVTWILEYEKLNQDIPDPHTLMK  135

Query  185  TILDITKEMEDHH  223
              LD+TK++E HH
Sbjct  136  FCLDVTKDIETHH  148


 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+EKKLVKF+V  GDILE Y SF LT  V +  +D+ VTW LEYEK +  +P+P + ++
Sbjct  222  IDEEKKLVKFKVTGGDILEDYNSFYLTVHVETKGEDNIVTWILEYEKRNCNVPDPHTLME  281

Query  185  TILDITKEMEDHH  223
              L+ITK++E HH
Sbjct  282  LCLNITKDIETHH  294



>ref|XP_006355094.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=149

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EKKLVKF+V  GDILE YK+ S T  V S  +++ VTW  EYEK +  +P+P +Y+
Sbjct  74   AIDEEKKLVKFKVTGGDILEEYKACSFTVHVESKGENNLVTWIAEYEKKNVNVPDPHTYM  133

Query  182  QTILDITKEMEDHH  223
            + +L+I+K++E HH
Sbjct  134  ELLLNISKDIETHH  147



>gb|EYU23173.1| hypothetical protein MIMGU_mgv1a020758mg [Erythranthe guttata]
Length=153

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 57/74 (77%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+E K V F+V++GD++E YK+F L   V ++ +D+ VTWTLEYEKL+E++P+P + +
Sbjct  75   AIDEENKSVTFKVIEGDLMELYKTFKLIVHVDTSGEDNLVTWTLEYEKLNEDVPDPHTLM  134

Query  182  QTILDITKEMEDHH  223
            +  L +TK++E HH
Sbjct  135  EFCLKVTKDIESHH  148



>gb|EYU31821.1| hypothetical protein MIMGU_mgv1a015566mg [Erythranthe guttata]
Length=153

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EKK V F+V +GD++E YK+F LT  V +  +D+ VTWTLEYEKL+E++ EP + +
Sbjct  75   AIDEEKKSVTFKVTEGDMMELYKAFKLTVHVDTTGEDNVVTWTLEYEKLNEDVSEPHTLM  134

Query  182  QTILDITKEMEDHH  223
               +++TK++E HH
Sbjct  135  DLCVNMTKDIESHH  148



>ref|XP_010319391.1| PREDICTED: kirola-like [Solanum lycopersicum]
 ref|XP_004253534.2| PREDICTED: kirola-like [Solanum lycopersicum]
Length=296

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+EKKLVKF+V+ GDILE+Y SF LT  V +  +D+ VTW LEYEK +  +P+P + ++
Sbjct  222  IDEEKKLVKFKVIGGDILEAYNSFYLTVHVETKGEDNLVTWILEYEKKNCNVPDPHTLME  281

Query  185  TILDITKEMEDHH  223
              L++TK++E HH
Sbjct  282  FCLNVTKDIETHH  294


 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +2

Query  23   LVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQTILDIT  202
            LVKF+V+ GDIL+ YKSF LT  V +  +D+ VTW LEYEKL+E+I +P + ++  LD+T
Sbjct  82   LVKFKVIGGDILDYYKSFYLTVHVETKGEDNLVTWILEYEKLNEDIEDPHTLMKFCLDVT  141

Query  203  KEMEDHH  223
            K++E HH
Sbjct  142  KDIETHH  148



>ref|XP_009591453.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like [Nicotiana 
tomentosiformis]
Length=299

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
             ID+EKKLVKF+V+ GD+LE+YKSF LT  V +  + + VTW LEYEK + ++P+P + +
Sbjct  221  VIDEEKKLVKFKVIGGDLLETYKSFYLTVHVETKGESNLVTWILEYEKQNSKVPDPHTLM  280

Query  182  QTILDITKEMEDHH  223
            +  L++TK++E HH
Sbjct  281  EFCLNVTKDIETHH  294


 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  23   LVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQTILDIT  202
            LVKF+V+ GD+L+ YKS  LT  V +  +D+ VTW L+YEKL+ +IP+P + ++  L++T
Sbjct  82   LVKFKVIGGDLLDFYKSVYLTVHVETKGEDNLVTWILDYEKLNPDIPDPHTLMEFCLNVT  141

Query  203  KEMEDHH  223
            K++E HH
Sbjct  142  KDIETHH  148



>ref|XP_009803723.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=299

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EKKLVKF+V+ GD+LE+Y SF LT  V +  +++ VTW LEYEK + ++P+P + +
Sbjct  221  AIDEEKKLVKFKVIGGDLLETYNSFYLTVHVETTGENNLVTWILEYEKKNSKVPDPHTLM  280

Query  182  QTILDITKEMEDHH  223
            +  L +TK++E HH
Sbjct  281  EFCLSVTKDIETHH  294


 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 50/67 (75%), Gaps = 0/67 (0%)
 Frame = +2

Query  23   LVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQTILDIT  202
            LVKF+V+ GD+L+ YKS  LT  V +  +D+ VTW L+YEKL+ +IP+P + ++  L++T
Sbjct  82   LVKFKVIGGDLLDFYKSLYLTVHVETKGEDNLVTWILDYEKLNPDIPDPHTLMEFCLNVT  141

Query  203  KEMEDHH  223
            K++E HH
Sbjct  142  KDIETHH  148



>gb|EYU31819.1| hypothetical protein MIMGU_mgv1a021736mg, partial [Erythranthe 
guttata]
Length=118

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+  K V F+V++GD++E YK+F L   V ++ +D+ VTWTLEYEKL+E++P+P + +
Sbjct  40   AIDEVNKSVTFKVIEGDLMELYKTFKLIVHVDTSGEDNLVTWTLEYEKLNEDVPDPHTLM  99

Query  182  QTILDITKEMEDHH  223
            +  L +TK++E HH
Sbjct  100  EFCLKVTKDIESHH  113



>ref|XP_006367998.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=129

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            I+ EK+LV F+  +G ++E YK+F  T  + +  D++ V WT+EYEK +E IPEP SYLQ
Sbjct  54   INKEKRLVTFKAFEGHVIEEYKAFKATLHIENKGDNNLVIWTIEYEKQNEHIPEPFSYLQ  113

Query  185  TILDITKEMEDHHA  226
               +ITK+++ HH 
Sbjct  114  LATNITKDVDTHHV  127



>ref|XP_004237031.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=134

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+EKK++K R+++GDILE YKSF +T  V +  +++ VTW LEYEK +  +P+P + ++
Sbjct  60   IDEEKKMMKKRIIEGDILEYYKSFYVTIHVETKGENNLVTWILEYEKKNVNVPDPHTLVE  119

Query  185  TILDITKEMEDHH  223
             +L++TK++E+HH
Sbjct  120  LLLNVTKDIENHH  132



>gb|ADG43176.1| putative major latex-like protein [Salvia miltiorrhiza]
Length=152

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            +ID+EKKL+ F++++GD +E YK+F +T  V +  D   VTWTLEYE L+E++  P+S+L
Sbjct  75   SIDEEKKLIVFKMIEGDWMELYKTFVITAHVETTGDIDLVTWTLEYEMLNEDVGHPISFL  134

Query  182  QTILDITKEMEDHH  223
               +D+TK++E HH
Sbjct  135  SYFIDLTKDIETHH  148



>gb|EYU33127.1| hypothetical protein MIMGU_mgv1a019445mg [Erythranthe guttata]
Length=120

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D+E K V ++V++GD++E YK+F LT +V +  +D+ VTWT EYEKLSE+IP+P + +
Sbjct  42   ALDEENKSVTYKVIEGDLMELYKTFKLTVRVDTTGEDNVVTWTFEYEKLSEDIPDPHTLM  101

Query  182  QTILDITKEMEDHH  223
            +    +TK ++ HH
Sbjct  102  EFFGTMTKSIDSHH  115



>ref|XP_006367897.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=150

 Score = 79.0 bits (193),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            IDDEKKLVK ++++GD+LE YKSF LT  V +  +++ VTW LEYEK +  +P+P ++++
Sbjct  76   IDDEKKLVKKKMIEGDMLEYYKSFYLTIHVETKGENNLVTWILEYEKKNANVPDPHTFME  135

Query  185  TILDITKEMEDHH  223
              ++ITK++E +H
Sbjct  136  LCINITKDIESYH  148



>ref|XP_006367636.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=280

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+EKKLVKF+V  GDILE Y SF +T  V +  +D+ VTW LEYEK +  +P+P + ++
Sbjct  206  IDEEKKLVKFKVTGGDILEDYNSFYVTVHVDTKGEDNIVTWILEYEKKNCNVPDPHTLME  265

Query  185  TILDITKEMEDHH  223
              L+ITK++E HH
Sbjct  266  LCLNITKDIETHH  278


 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  53   ILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQTILDITKEMEDHH  223
            IL+ YKSF +T  V +  +D+ VTW LEYEKL+++IP+P + ++  LD+TK++E HH
Sbjct  76   ILDYYKSFYITVHVETKGEDNLVTWILEYEKLNQDIPDPHTLMKFCLDVTKDIETHH  132



>ref|XP_006367513.1| PREDICTED: MLP-like protein 34-like isoform X1 [Solanum tuberosum]
Length=151

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            I+ EK+LV F+  +G ++E YK+F  T  + +  D++ V WT+EYEK +E+IPEP SYLQ
Sbjct  76   INKEKRLVTFKAFEGHLIEEYKAFKATLHIENEGDNNLVIWTIEYEKQNEDIPEPFSYLQ  135

Query  185  TILDITKEMEDHHA  226
               ++TK+++ HH 
Sbjct  136  LATNLTKDVDTHHV  149



>ref|XP_006367968.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=151

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            I+ EK+LV F+  +G ++E YK+F  T  + +  D++ V WT+EYEK +E+IPEP SYLQ
Sbjct  76   INKEKRLVTFKAFEGHLIEEYKAFKATIHIENEGDNNLVIWTIEYEKQNEDIPEPFSYLQ  135

Query  185  TILDITKEMEDHHA  226
               ++TK+++ HH 
Sbjct  136  LATNLTKDVDTHHV  149



>ref|XP_011092069.1| PREDICTED: kirola-like [Sesamum indicum]
Length=152

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EK+ +  +V++GDILE +KSF+L   V +N   H VTW LEYEKL E++ +P+S +
Sbjct  75   AIDEEKRSITLKVIEGDILEFFKSFTLGIHVDTNGQTHLVTWVLEYEKLHEDVEDPVSLI  134

Query  182  QTILDITKEMEDHH  223
               + +TK++E HH
Sbjct  135  PLYIKLTKDIEAHH  148



>gb|EYU31820.1| hypothetical protein MIMGU_mgv1a015676mg [Erythranthe guttata]
Length=149

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EKK V F+V +GD++E YK F L   V ++ +D+ VTWTLEYEKLSE++ +P + +
Sbjct  75   AIDEEKKSVTFKVTEGDLMELYKEFKLVVHVDTSGEDNVVTWTLEYEKLSEDVSDPHTLM  134

Query  182  QTILDITKEMEDHH  223
               + +TK++E HH
Sbjct  135  DLCVSMTKDIESHH  148



>gb|EYU29497.1| hypothetical protein MIMGU_mgv1a021619mg [Erythranthe guttata]
Length=149

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EKK V F+V +GD++E YK F L   V ++ +D+ VTWTLEYEKLSE++ +P + +
Sbjct  75   AIDEEKKSVTFKVTEGDLMELYKEFKLVVHVDTSGEDNVVTWTLEYEKLSEDVSDPHTLM  134

Query  182  QTILDITKEMEDHH  223
               + +TK++E HH
Sbjct  135  DLCVSMTKDIESHH  148



>ref|XP_011078290.1| PREDICTED: kirola-like isoform X1 [Sesamum indicum]
Length=152

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
             I++EKKL++F++++GD++E YK+F +T  + + D    VTWTLEYE L++++  P+S L
Sbjct  75   TINEEKKLIEFKMLEGDLMEEYKTFLITLHIETKDGIDLVTWTLEYEMLNDDVGHPISLL  134

Query  182  QTILDITKEMEDHH  223
              I+D+TK++E HH
Sbjct  135  SFIIDLTKDIETHH  148



>ref|XP_011078439.1| PREDICTED: MLP-like protein 28 [Sesamum indicum]
Length=309

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+EKKL++F++++GD++E YK+F +T  + + +D   VTWTLEYE L++++  P+S L 
Sbjct  233  IDEEKKLIEFKMLEGDLMEEYKTFLITLHIETKNDIDLVTWTLEYEMLNDDVGHPISLLS  292

Query  185  TILDITKEMEDHH  223
             I+D+TK++E HH
Sbjct  293  FIIDLTKDIETHH  305


 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
             ID+EKKL++F++++GD++E YK+F +T  + + D    VTWTLEYE LSE++  P+S L
Sbjct  75   TIDEEKKLIEFKMLEGDLMEEYKTFLITLHIETKDGIDLVTWTLEYEMLSEDVDHPISLL  134

Query  182  QTILDITKEMEDHH  223
               +D+TK++E HH
Sbjct  135  SFFIDLTKDIETHH  148



>gb|EYU40241.1| hypothetical protein MIMGU_mgv1a016485mg [Erythranthe guttata]
Length=119

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EKK V F +V+GD++E YK+F  T  V +  +D+ VTWT  YEKL+E++P+P + +
Sbjct  42   AIDEEKKSVTFNIVEGDLMELYKTFKATVHVDTVGEDNLVTWTFVYEKLNEDVPDPHTLM  101

Query  182  QTILDITKEMEDHH  223
            +  + +TK++E HH
Sbjct  102  EFCVKLTKDIESHH  115



>gb|EYU17814.1| hypothetical protein MIMGU_mgv1a015637mg [Erythranthe guttata]
Length=151

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AI++E+KL++F++++GD++E YK+F +T  V + +    VTWTLEYE L+E++  PLS L
Sbjct  75   AINEEQKLMEFKMLEGDLMELYKAFLITIHVETKNGIDLVTWTLEYEMLNEDVEHPLSLL  134

Query  182  QTILDITKEMEDHHA  226
               +D+TK++E HH 
Sbjct  135  SFFIDMTKDIETHHV  149



>ref|XP_006367717.1| PREDICTED: MLP-like protein 28-like [Solanum tuberosum]
Length=151

 Score = 77.0 bits (188),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            I+ EK+LV F+  +G ++E YK+F  T  + +  D++   WT+EYEK +E+IPEP SYLQ
Sbjct  76   INKEKRLVTFKAFEGHLIEEYKAFKATIHIENEGDNNLAIWTIEYEKQNEDIPEPFSYLQ  135

Query  185  TILDITKEMEDHHA  226
               ++TK+++ HH 
Sbjct  136  LATNLTKDVDTHHV  149



>ref|XP_004240135.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=150

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 57/73 (78%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+EKKLVK ++++GD+LE Y+SF LT  V + D+++ VTW LEYEK +  +P+P ++++
Sbjct  76   IDEEKKLVKKKMIEGDMLEYYESFYLTIHVETKDENNLVTWILEYEKKNVHVPDPHTFME  135

Query  185  TILDITKEMEDHH  223
              ++ITK++E +H
Sbjct  136  LCINITKDIESYH  148



>gb|EYU34509.1| hypothetical protein MIMGU_mgv1a026388mg [Erythranthe guttata]
Length=152

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EK+LV F +V+GD++E YK+F  T  V +  +D+ VTWT +YEKL+E++ EP + +
Sbjct  75   AIDEEKRLVTFNMVEGDLMELYKTFKATVHVDTVGEDNLVTWTFDYEKLNEDVTEPHTLM  134

Query  182  QTILDITKEMEDHH  223
               + +TK++E HH
Sbjct  135  DLCIKMTKDIESHH  148



>ref|XP_011078291.1| PREDICTED: kirola-like isoform X2 [Sesamum indicum]
Length=152

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 55/73 (75%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+ KKL++F++++GD++E YK+F +T  V + D+   VTWTLEYE L++++  P+S L 
Sbjct  76   IDEGKKLIEFKMLEGDLMEEYKTFLITLHVETKDNIDLVTWTLEYEMLNDDVGHPISLLS  135

Query  185  TILDITKEMEDHH  223
              +D+TK++E HH
Sbjct  136  FFIDLTKDIETHH  148



>gb|EYU31817.1| hypothetical protein MIMGU_mgv1a015578mg [Erythranthe guttata]
Length=152

 Score = 76.6 bits (187),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EKK V F +V+GD++E YK+F  T  V +  +D+ VTWT  YEKL+E++P+P + +
Sbjct  75   AIDEEKKSVTFNIVEGDLMELYKTFKATVHVDTVGEDNLVTWTFVYEKLNEDVPDPHTLM  134

Query  182  QTILDITKEMEDHH  223
            +  + +TK++E HH
Sbjct  135  EFCVKLTKDIESHH  148



>ref|XP_004246757.1| PREDICTED: MLP-like protein 28 [Solanum lycopersicum]
Length=151

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            I+ EK+LV F+  +G ++E YK+F  T  + +  D++ V WT+EYEK +EEI EP SYLQ
Sbjct  76   INKEKRLVTFKAFEGHLIEEYKAFKATLHIENEGDNNLVIWTIEYEKQNEEIQEPFSYLQ  135

Query  185  TILDITKEMEDHHA  226
               ++TK+++ HH 
Sbjct  136  LATNLTKDVDTHHV  149



>ref|XP_009781869.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=148

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 54/75 (72%), Gaps = 4/75 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
             IDDEKK + ++V+ GD+LE+Y +F+    V+ + D H++TWTL YEK +E+ PEPL++ 
Sbjct  76   VIDDEKKSITWKVIGGDLLEAYNTFT----VNISCDQHWITWTLVYEKKTEDTPEPLTFF  131

Query  182  QTILDITKEMEDHHA  226
              + D+TK++E HH 
Sbjct  132  GYVTDLTKDIEAHHV  146



>gb|EYU32958.1| hypothetical protein MIMGU_mgv1a015581mg [Erythranthe guttata]
Length=152

 Score = 75.9 bits (185),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPE-PLSYL  181
            ID+E+KLV+F+  +GD++E YK+F +TC V + ++   VTWT EYE L++++ E P++ L
Sbjct  76   IDEEQKLVQFKTFEGDLMELYKTFLVTCHVETKNEIDMVTWTFEYEMLNDDVVEHPITPL  135

Query  182  QTILDITKEMEDHHA  226
               +DITK +E HHA
Sbjct  136  SVAIDITKAIETHHA  150



>gb|KDO64572.1| hypothetical protein CISIN_1g039477mg, partial [Citrus sinensis]
Length=92

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            AID+E  +  ++V++G++LE YKSFS T +V    NDD   V W  EYEKL+E++P+P  
Sbjct  12   AIDNENYITNYKVIEGNLLELYKSFSSTVKVTPKENDDGSLVHWIFEYEKLNEDVPDPTG  71

Query  176  YLQTILDITKEMEDH  220
             LQ ++D+ K+++ H
Sbjct  72   KLQILIDVAKDIDAH  86



>gb|EYU17813.1| hypothetical protein MIMGU_mgv1a014581mg [Erythranthe guttata]
Length=185

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGD-ILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSY  178
            AID+E+KL++F+ ++GD +LE YK F +T  V + +D   VTWTLEYE L+E++  PLS 
Sbjct  108  AIDEEQKLIQFKSIEGDCLLEEYKDFLITIHVETKNDIDLVTWTLEYELLNEDVEHPLSL  167

Query  179  LQTILDITKEMEDHH  223
            L   +D+TK +E HH
Sbjct  168  LSFFIDMTKVIETHH  182



>ref|XP_009761954.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=92

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 57/75 (76%), Gaps = 4/75 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+DDEKK + +++++GD+LE+Y +F     V+ + D H++TWT+EYEK +E+  EP+++L
Sbjct  20   AVDDEKKSITWKLIEGDLLEAYNTFI----VNISCDQHWITWTIEYEKKTEDTSEPITFL  75

Query  182  QTILDITKEMEDHHA  226
            + + D+TK++E HH 
Sbjct  76   EFLTDLTKDIEVHHV  90



>ref|XP_004237023.1| PREDICTED: MLP-like protein 43 [Solanum lycopersicum]
Length=148

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+DDEKKL+ ++V++GD LE Y SF++T     N    + TWTL YEK +E+ PEP++ L
Sbjct  76   AVDDEKKLITWKVLEGDTLELYNSFAITASFEEN----WATWTLVYEKKTEDTPEPITLL  131

Query  182  QTILDITKEMEDH  220
              ++DIT+++E H
Sbjct  132  SLMIDITRDLESH  144



>emb|CDP21915.1| unnamed protein product [Coffea canephora]
Length=150

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            +ID EKK V F+V++GD+L+ YKSF +T QV ++  ++ V WTL+YEKL+  +P+P +  
Sbjct  75   SIDKEKKSVTFKVIEGDLLKLYKSFIITVQVENHGQNNLVIWTLQYEKLNHSVPDPTTIA  134

Query  182  QTILDITKEMEDHH  223
                 +TK++E HH
Sbjct  135  DLATKLTKDIETHH  148



>ref|XP_004240136.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=150

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 56/73 (77%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+E KL+K ++++GDILE YKSF +T  V +  +++ VT  +EYEK +  +P+P ++++
Sbjct  76   IDEENKLIKKKIIEGDILEYYKSFYITVHVETKGENNLVTLIIEYEKKNANVPDPHTFME  135

Query  185  TILDITKEMEDHH  223
             IL++TK++E++H
Sbjct  136  LILNVTKDIENYH  148



>ref|XP_010670107.1| PREDICTED: MLP-like protein 34 [Beta vulgaris subsp. vulgaris]
Length=156

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDH-FVTWTLEYEKLSEEIPEPLSYL  181
            ID++KKL+K+R ++G ILE YK+ + TCQV   D ++  V WT EYEK    IPEP + L
Sbjct  78   IDEQKKLIKYRAIEGHILEEYKTITGTCQVIPKDAENCIVRWTFEYEKQHPGIPEPTALL  137

Query  182  QTILDITKEMEDHH  223
             + L   K+++DHH
Sbjct  138  DSWLSAAKDLDDHH  151



>ref|XP_009798271.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=151

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EK+LV F   +G ++E YK+F  T  + +  +++ V WT+EYEK ++E+ EP  YL
Sbjct  75   AIDEEKRLVTFSAFEGHLIEQYKTFKATVHIENEGENNLVLWTIEYEKQNDEVSEPFCYL  134

Query  182  QTILDITKEMEDHHA  226
            +   ++TKE++ HH 
Sbjct  135  EFATNLTKEVDAHHV  149



>ref|XP_011084196.1| PREDICTED: kirola-like [Sesamum indicum]
Length=150

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 53/74 (72%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AIDDE++ +  +V++G +++ +KSF +   V +  + H VTW LEYEKL E++ +P+S+L
Sbjct  74   AIDDEQRSITLKVIEGHLMDYFKSFKIGIHVDTKGEIHLVTWVLEYEKLHEDVEDPVSFL  133

Query  182  QTILDITKEMEDHH  223
              ++ +TK++E HH
Sbjct  134  SLLIKVTKDVETHH  147



>ref|XP_009589470.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like [Nicotiana 
tomentosiformis]
Length=89

 Score = 71.6 bits (174),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 53/75 (71%), Gaps = 4/75 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
             +DDEKK + ++ ++GD+LE Y +F+    V+ + D H++TWT  YEK +E+ PEPL++L
Sbjct  17   VMDDEKKSITWKGIEGDLLERYNAFT----VNISCDQHWITWTFVYEKKTEDTPEPLTFL  72

Query  182  QTILDITKEMEDHHA  226
              + D+TK++E HH 
Sbjct  73   GYVTDLTKDIEAHHV  87



>gb|ACH72969.1| major latex-like protein [Panax ginseng]
Length=151

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+E K V F+VV+G + E +KS   +  V +  +D+ VTW+++YEKL+E + +P SYL
Sbjct  75   AIDEEDKSVTFKVVEGHLFEEFKSIVFSVHVDTKGEDNLVTWSIDYEKLNESVKDPTSYL  134

Query  182  QTILDITKEMEDHH  223
              +L +T+++E HH
Sbjct  135  DFLLSVTRDIEAHH  148



>emb|CDP21429.1| unnamed protein product [Coffea canephora]
Length=150

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+ K+ + F+V++GD+LE YK+F +T  V ++   + VTWT EYEK +  IP+P + +
Sbjct  75   AIDEAKRSITFKVIEGDVLELYKTFIITVHVDAHGKSNLVTWTFEYEKKNPNIPDPNTLM  134

Query  182  QTILDITKEMEDHH  223
               L +TK++E HH
Sbjct  135  DFCLHVTKDIETHH  148



>ref|XP_006367208.1| PREDICTED: MLP-like protein 43-like [Solanum tuberosum]
Length=148

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+DDEKK + ++V++GD LE Y SF++T       +D++  WTL YEK SE+ PEP++ L
Sbjct  76   AVDDEKKTITWKVLEGDTLELYNSFAITASF----EDNWAMWTLVYEKKSEDTPEPITLL  131

Query  182  QTILDITKEMEDH  220
              ++DIT+++E H
Sbjct  132  SLMIDITRDLESH  144



>gb|EYU32956.1| hypothetical protein MIMGU_mgv1a015606mg [Erythranthe guttata]
Length=152

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 55/75 (73%), Gaps = 1/75 (1%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPE-PLSYL  181
            I++E+KLV+F+  +GD++E YK+F +T  V + +D   VTWT EYE LS+++ E P++ L
Sbjct  76   INEEQKLVQFKTFEGDLMEVYKTFLVTFHVETKNDIDLVTWTFEYEMLSDDVVEHPIAML  135

Query  182  QTILDITKEMEDHHA  226
              ++D+TK++E HH 
Sbjct  136  SFVIDVTKDIETHHV  150



>ref|XP_010688570.1| PREDICTED: MLP-like protein 34 [Beta vulgaris subsp. vulgaris]
Length=304

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 51/74 (69%), Gaps = 1/74 (1%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDH-FVTWTLEYEKLSEEIPEPLSYL  181
            ID+EKKLVK+R ++GD+L+ YK+F  TCQV   D+ +  V +  EYEKL   +PEP ++L
Sbjct  79   IDEEKKLVKYRAIEGDMLDEYKTFCGTCQVIPKDEKNCIVKYIFEYEKLHSGVPEPTAWL  138

Query  182  QTILDITKEMEDHH  223
               L  T +M+DHH
Sbjct  139  DAWLAATIDMDDHH  152


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFV-TWTLEYEKLSEEIPEPLSYL  181
            +D+EKK V++RV++GD+L+ YK+ +    V   D+   + TWTL+YEK    IPEP   L
Sbjct  226  VDEEKKYVRYRVIEGDLLDEYKTLTGEFHVIPKDEKTSIGTWTLKYEKQHPGIPEPTELL  285

Query  182  QTILDITKEMEDHH  223
             + L  TK+++DHH
Sbjct  286  DSWLASTKDLDDHH  299



>ref|XP_003631205.1| PREDICTED: MLP-like protein 43 [Vitis vinifera]
 emb|CBI26884.3| unnamed protein product [Vitis vinifera]
Length=151

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            ++DDE K + F+VV G+I+  +K F    QV + D+   V W+LEYEK+++++P P +YL
Sbjct  75   SVDDENKSITFKVVDGEIMNHFKCFKSNLQVKAKDEGSLVKWSLEYEKVNKDVPNPDAYL  134

Query  182  QTILDITKEMEDHH  223
            +  +++TK++E H+
Sbjct  135  EFAVNVTKDIESHY  148



>ref|XP_009791305.1| PREDICTED: kirola-like isoform X2 [Nicotiana sylvestris]
Length=118

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A D +KK V ++V++GD+LE Y SF++   +    +D ++TWT  YEK +E+ PEPL+++
Sbjct  46   ATDPQKKSVTWKVIEGDLLELYNSFTIVTSI----EDQWITWTFVYEKKTEDTPEPLAFM  101

Query  182  QTILDITKEMEDH  220
              +LD+TK++E H
Sbjct  102  GVVLDMTKDVEGH  114



>ref|XP_006448199.1| hypothetical protein CICLE_v10017039mg [Citrus clementina]
 ref|XP_006469319.1| PREDICTED: MLP-like protein 43-like [Citrus sinensis]
 gb|ESR61439.1| hypothetical protein CICLE_v10017039mg [Citrus clementina]
Length=156

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            AID+E  +  ++V+ G++LE YKSFS T +V    NDD   V W  EYEKL E++P+P  
Sbjct  76   AIDNENYITNYKVIGGNLLELYKSFSSTVKVTPKENDDGSLVHWIFEYEKLKEDVPDPTG  135

Query  176  YLQTILDITKEMEDH  220
             LQ ++D+ K+++ H
Sbjct  136  KLQILIDVAKDIDAH  150



>ref|XP_009781868.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=148

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 51/75 (68%), Gaps = 4/75 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
             IDDEKK   ++++ GD+LE+Y +F +    +     H++TWTLEYEK +E+ PEP+++L
Sbjct  76   VIDDEKKSSTWKLIGGDLLEAYNAFIVNISCYQ----HYITWTLEYEKKTEDTPEPITFL  131

Query  182  QTILDITKEMEDHHA  226
              +  + K++EDHH 
Sbjct  132  GYVTGLIKDVEDHHV  146



>ref|XP_006367518.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=122

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+EK+LV + + +G+++E YK+F +T  + + ++++ V WT++YEK +E++PEP SYLQ
Sbjct  43   IDEEKRLVTYNIFEGNLMEQYKAFKVTLHIENEEENNLVIWTIQYEKQNEDVPEPFSYLQ  102

Query  185  TILD  196
              ++
Sbjct  103  MAVN  106



>ref|XP_011070720.1| PREDICTED: kirola-like [Sesamum indicum]
Length=151

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+E K +  +V++GD+LE YKSF +   V +  + + VTW LEYEKL E+I +P+ ++
Sbjct  75   AIDEENKSIILKVIEGDLLEHYKSFVIRIHVDTKGEINLVTWVLEYEKLHEDIEDPIVFI  134

Query  182  QTILDITKEMEDHH  223
              ++ +TK +E HH
Sbjct  135  AYLIKVTKNIETHH  148



>ref|XP_006344280.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=147

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 49/73 (67%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID  KKL+K++V++GD+LE Y  F  T       D  + TWT+EYEK +E+ PEPL + 
Sbjct  75   AIDPHKKLIKWKVIEGDLLELYNYFDYTTSC----DHQWTTWTIEYEKKTEDTPEPLIHF  130

Query  182  QTILDITKEMEDH  220
              ILD+TK++E H
Sbjct  131  GNILDMTKDIEGH  143



>ref|XP_006344332.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=89

 Score = 70.1 bits (170),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 51/73 (70%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D  KKL+K++V++GD+LE Y  F  T    ++ D  + TWT+EYEK +E+ PEPL +L
Sbjct  17   AVDPHKKLIKWKVIEGDLLELYNYFVYT----TSCDHQWTTWTIEYEKKTEDTPEPLIHL  72

Query  182  QTILDITKEMEDH  220
              I D+TK++E H
Sbjct  73   SNIFDMTKDIEGH  85



>ref|WP_039311017.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91165.1| hypothetical protein QW71_36240, partial [Paenibacillus sp. IHB 
B 3415]
Length=178

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+E K V F+V+ GD+ E Y++F +T  V +  +++ VTWT EYEK SE++ +P + +
Sbjct  102  AIDEENKSVTFKVIGGDVTELYRTFKITVHVDTKGENNLVTWTFEYEKKSEDVEDPNTLM  161

Query  182  QTILDITKEMEDHH  223
               ++++K++E HH
Sbjct  162  DFAINVSKDIESHH  175



>ref|XP_009791304.1| PREDICTED: kirola-like isoform X1 [Nicotiana sylvestris]
Length=147

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A D +KK V ++V++GD+LE Y SF++   +    +D ++TWT  YEK +E+ PEPL+++
Sbjct  75   ATDPQKKSVTWKVIEGDLLELYNSFTIVTSI----EDQWITWTFVYEKKTEDTPEPLAFM  130

Query  182  QTILDITKEMEDH  220
              +LD+TK++E H
Sbjct  131  GVVLDMTKDVEGH  143



>emb|CAN75774.1| hypothetical protein VITISV_033953 [Vitis vinifera]
Length=151

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            ++DDE K + F+VV G+I+  +K F    QV + D+   V W LEYEK+++++P P +YL
Sbjct  75   SVDDENKSITFKVVDGEIMNHFKCFKSNLQVKAKDEGSLVKWXLEYEKVNKDVPNPDAYL  134

Query  182  QTILDITKEMEDHH  223
            +  +++TK++E H+
Sbjct  135  EFAVNVTKDIESHY  148



>ref|XP_006365784.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=146

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID  KK + ++V++GD+LE Y SF++     ++ +  +  WTL+YEK +E+IPEPLS++
Sbjct  74   AIDPYKKSICWKVIEGDVLEMYSSFTII----TSHEPQWTIWTLDYEKKTEDIPEPLSFM  129

Query  182  QTILDITKEMEDH  220
              ILDI K+ME H
Sbjct  130  GHILDIIKDMEGH  142



>ref|XP_006469318.1| PREDICTED: MLP-like protein 34-like [Citrus sinensis]
Length=156

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 51/73 (70%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            AID+E  +  ++V++G++LE YKSFS T +V    NDD   V W  EYEKL+E++P+P  
Sbjct  76   AIDNENYITNYKVIEGNLLELYKSFSSTVKVTPKENDDGSLVHWIFEYEKLNEDVPDPTG  135

Query  176  YLQTILDITKEME  214
             LQ ++D+ K+++
Sbjct  136  KLQMVIDVAKDID  148



>ref|XP_006448231.1| hypothetical protein CICLE_v10017056mg [Citrus clementina]
 ref|XP_006469190.1| PREDICTED: MLP-like protein 28-like isoform X1 [Citrus sinensis]
 gb|ESR61471.1| hypothetical protein CICLE_v10017056mg [Citrus clementina]
Length=153

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID E   + F+V++G++L+ YKSF    QV    +  FVTWTL+YEK +E +PEP + LQ
Sbjct  77   IDYENNKITFKVIEGNLLDQYKSFCCFFQVTPKGEGSFVTWTLKYEKPNENVPEPAAMLQ  136

Query  185  TILDITKEM  211
              +D+TK++
Sbjct  137  LCVDVTKDV  145



>gb|KDO64617.1| hypothetical protein CISIN_1g031759mg [Citrus sinensis]
Length=153

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID E   + F+V++G++L+ YKSF    QV    +  FVTWTL+YEK +E +PEP + LQ
Sbjct  77   IDYENNKITFKVIEGNLLDQYKSFCCFFQVTPKGEGSFVTWTLKYEKPNENVPEPAAMLQ  136

Query  185  TILDITKEM  211
              +D+TK++
Sbjct  137  LCVDVTKDV  145



>emb|CDP14657.1| unnamed protein product [Coffea canephora]
Length=150

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+ KK + F++++GD++E YK+F  T  V +      + WT+EYEK SE +P+P + +
Sbjct  75   AIDEGKKSITFKMIEGDLMEFYKTFIATVHVEALGQSSLIAWTIEYEKRSENVPDPNTLM  134

Query  182  QTILDITKEMEDHH  223
            +  L+ITK++E H 
Sbjct  135  ELALNITKDIEAHQ  148



>gb|KDO64616.1| hypothetical protein CISIN_1g031759mg [Citrus sinensis]
Length=152

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID E   + F+V++G++L+ YKSF    QV    +  FVTWTL+YEK +E +PEP + LQ
Sbjct  76   IDYENNKITFKVIEGNLLDQYKSFCCFFQVTPKGEGSFVTWTLKYEKPNENVPEPAAMLQ  135

Query  185  TILDITKEM  211
              +D+TK++
Sbjct  136  LCVDVTKDV  144



>sp|P85524.1|KIRO_ACTDE RecName: Full=Kirola; AltName: Allergen=Act d 11 [Actinidia deliciosa]
 pdb|4IGV|A Chain A, Crystal Structure Of Kirola (act D 11)
 pdb|4IGW|A Chain A, Crystal Structure Of Kirola (act D 11) In P6122 Space 
Group
 pdb|4IGW|B Chain B, Crystal Structure Of Kirola (act D 11) In P6122 Space 
Group
 pdb|4IGX|A Chain A, Crystal Structure Of Kirola (act D 11) - Triclinic Form
 pdb|4IGX|B Chain B, Crystal Structure Of Kirola (act D 11) - Triclinic Form
 pdb|4IGX|C Chain C, Crystal Structure Of Kirola (act D 11) - Triclinic Form
 pdb|4IGX|D Chain D, Crystal Structure Of Kirola (act D 11) - Triclinic Form
 pdb|4IGY|A Chain A, Crystal Structure Of Kirola (act D 11) - Triclinic Form
 pdb|4IGY|B Chain B, Crystal Structure Of Kirola (act D 11) - Triclinic Form
 pdb|4IGY|C Chain C, Crystal Structure Of Kirola (act D 11) - Triclinic Form
 pdb|4IGY|D Chain D, Crystal Structure Of Kirola (act D 11) - Triclinic Form
 pdb|4IH0|A Chain A, Crystal Structure Of Kirola (act D 11) From Crystal 
Soaked With Serotonin
 pdb|4IH2|A Chain A, Crystal Structure Of Kirola (act D 11) From Crystal 
Soaked With 2- Aminopurine
Length=150

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+E K V F++V+GD++E YK+F +  QV +  + + VTWT  YEKL E++ EP + +
Sbjct  75   AIDEETKSVTFKIVEGDLMELYKTFIIIVQVDTKGEHNSVTWTFHYEKLKEDVEEPNTLM  134

Query  182  QTILDITKEMEDHH  223
               ++ITK++E +H
Sbjct  135  NFCIEITKDIETYH  148



>pdb|4IHR|A Chain A, Crystal Structure Of Recombinant Kirola (act D 11)
Length=153

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 52/74 (70%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+E K V F++V+GD++E YK+F +  QV +  + + VTWT  YEKL E++ EP + +
Sbjct  78   AIDEETKSVTFKIVEGDLMELYKTFIIIVQVDTKGEHNSVTWTFHYEKLKEDVEEPNTLM  137

Query  182  QTILDITKEMEDHH  223
               ++ITK++E +H
Sbjct  138  NFCIEITKDIETYH  151



>gb|KHG08746.1| MLP-like protein 28 [Gossypium arboreum]
 gb|KHG21406.1| MLP-like protein 28 [Gossypium arboreum]
Length=132

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A+D +K LV FRV++GD++E YKSF +T QV   S      V WTLEYEKL + I  P +
Sbjct  53   AVDPDKNLVTFRVIEGDLMEEYKSFVITIQVSPKSEGSGSLVHWTLEYEKLHDGIAHPET  112

Query  176  YLQTILDITKEMEDH  220
             LQ + D++K+++ H
Sbjct  113  LLQFVQDVSKDIDAH  127



>gb|KFK41514.1| hypothetical protein AALP_AA2G139500 [Arabis alpina]
Length=161

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+KFRV++GD+++ YKSF LT QV          V W LEYEK+S+E+  P +
Sbjct  82   AVEPEKNLIKFRVIEGDLMKEYKSFVLTIQVTPKHGGPGSIVHWHLEYEKISDEVAHPET  141

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  142  LLQFCVEVSKEIDEH  156



>gb|KHG22340.1| MLP-like protein 28 [Gossypium arboreum]
 gb|KHG24649.1| MLP-like protein 28 [Gossypium arboreum]
Length=157

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A+D +K LV FRV++GD++E YKSF +T QV   S      V WTLEYEKL + I  P +
Sbjct  78   AVDPDKNLVTFRVIEGDLMEEYKSFVITIQVSPKSEGSGSLVHWTLEYEKLHDGIAHPET  137

Query  176  YLQTILDITKEMEDH  220
             LQ + D++K+++ H
Sbjct  138  LLQFVQDVSKDIDAH  152



>gb|KHG27208.1| MLP-like protein 28 [Gossypium arboreum]
Length=157

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A+D +K LV FRV++GD++E YKSF +T QV   S      V WTLEYEKL + I  P +
Sbjct  78   AVDPDKNLVTFRVIEGDLMEEYKSFVITIQVSPKSEGSGSLVHWTLEYEKLHDGIAHPET  137

Query  176  YLQTILDITKEMEDH  220
             LQ + D++K+++ H
Sbjct  138  LLQFVQDVSKDIDAH  152



>ref|XP_002284516.1| PREDICTED: MLP-like protein 43 [Vitis vinifera]
Length=151

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            +ID+E + + F+V+ G++L+ YKS+  T Q     +   V WT+EYEK SE  P+P +YL
Sbjct  75   SIDEENRSITFKVLDGEVLKEYKSYKFTAQAIPKGEGSLVIWTIEYEKASEGGPDPHNYL  134

Query  182  QTILDITKEMEDH  220
            +  ++ITK++E H
Sbjct  135  EFAVNITKDIESH  147



>gb|KCW64564.1| hypothetical protein EUGRSUZ_G02169, partial [Eucalyptus grandis]
Length=152

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVT-WTLEYEKLSEEIPEPLSY  178
            AIDDEK    FRV++GD+++ YK+F L  Q    +    V  WTLEYEKLSEE+ EP S 
Sbjct  75   AIDDEKNSTTFRVIEGDLMKLYKNFVLVVQATPKEGGGSVVHWTLEYEKLSEEVTEPYSL  134

Query  179  LQTILDITKEMEDH  220
            LQ  + ++K+M+ H
Sbjct  135  LQFCVHVSKDMDLH  148



>ref|XP_010066609.1| PREDICTED: MLP-like protein 28 [Eucalyptus grandis]
Length=159

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVT-WTLEYEKLSEEIPEPLSY  178
            AIDDEK    FRV++GD+++ YK+F L  Q    +    V  WTLEYEKLSEE+ EP S 
Sbjct  75   AIDDEKNSTTFRVIEGDLMKLYKNFVLVVQATPKEGGGSVVHWTLEYEKLSEEVTEPYSL  134

Query  179  LQTILDITKEMEDH  220
            LQ  + ++K+M+ H
Sbjct  135  LQFCVHVSKDMDLH  148



>ref|XP_009620151.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like [Nicotiana 
tomentosiformis]
Length=147

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 53/77 (69%), Gaps = 8/77 (10%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSF--SLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            AIDDEKK   ++V+ GD+LE+Y  F  +++C      D H++TWTLEYEK +E+I EP++
Sbjct  75   AIDDEKKSNTWKVIGGDLLEAYNDFIVNISC------DQHWITWTLEYEKKTEDISEPIT  128

Query  176  YLQTILDITKEMEDHHA  226
            +L     ++K++E HH 
Sbjct  129  FLGFFTYLSKDIEAHHV  145



>ref|XP_002284578.2| PREDICTED: MLP-like protein 28 [Vitis vinifera]
Length=151

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID E K V F+V++GD+L+ YKSF    Q  S  +  +V WT EYEKL++EI  P+  L
Sbjct  75   AIDKENKAVTFKVIEGDLLKEYKSFKAIVQTISKGETTWVRWTFEYEKLNKEISTPVKLL  134

Query  182  QTILDITKEMEDH  220
              ++ + +E++DH
Sbjct  135  GFVIHMNEELDDH  147



>gb|KDO39372.1| hypothetical protein CISIN_1g041437mg [Citrus sinensis]
Length=156

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLSY  178
            ID+E  +  ++V++G++LE YKSF  T +V    NDD   V W  EYEKL+E++P+P   
Sbjct  77   IDNENYITNYKVIEGNLLELYKSFCSTVKVTPKENDDGSLVHWIFEYEKLNEDVPDPTGK  136

Query  179  LQTILDITKEMEDH  220
            LQ ++D+ K+++ H
Sbjct  137  LQMVIDVAKDIDAH  150



>gb|ABA01325.1| VDRG6 [Gossypium hirsutum]
 gb|ABC16635.1| bet vI [Gossypium hirsutum]
Length=157

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A+D +K LV FRV++GD++E YKSF +T QV   S      V WTLEYEKL   I  P +
Sbjct  78   AVDPDKNLVTFRVIEGDLMEEYKSFVITIQVSPKSEGSGSVVHWTLEYEKLHGGIAHPET  137

Query  176  YLQTILDITKEMEDH  220
             LQ + DI+K+++ H
Sbjct  138  LLQFVQDISKDIDAH  152



>ref|XP_006448202.1| hypothetical protein CICLE_v10018174mg [Citrus clementina]
 gb|ESR61442.1| hypothetical protein CICLE_v10018174mg [Citrus clementina]
Length=122

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 50/73 (68%), Gaps = 2/73 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
             ID+E  +  ++V++G++LE YKSFS T +V    NDD   V W  EYEKL+E++P+P  
Sbjct  42   VIDNENYITNYKVIEGNLLELYKSFSSTVKVTPKENDDGSLVHWIFEYEKLNEDVPDPTG  101

Query  176  YLQTILDITKEME  214
             LQ ++D+ K+++
Sbjct  102  KLQMVIDVAKDID  114



>emb|CDY03715.1| BnaA02g15220D [Brassica napus]
Length=164

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF LT QV          V W LEYEK+SEE+  P +
Sbjct  85   AVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKHGGPGSIVHWHLEYEKISEEVAHPET  144

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  145  LLQFCVEVSKEIDEH  159



>emb|CDY65619.1| BnaAnng20750D [Brassica napus]
Length=164

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF LT QV          V W LEYEK+SEE+  P +
Sbjct  85   AVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKHGGPGSIVHWHLEYEKISEEVAHPET  144

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  145  LLQFCVEVSKEIDEH  159



>ref|XP_009127830.1| PREDICTED: MLP-like protein 34 [Brassica rapa]
Length=163

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF LT QV          V W LEYEK+SEE+  P +
Sbjct  84   AVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKHGGPGSIVHWHLEYEKISEEVAHPET  143

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  144  LLQFCVEVSKEIDEH  158



>emb|CBI26880.3| unnamed protein product [Vitis vinifera]
Length=147

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID E K V F+V++GD+L+ YKSF    Q  S  +  +V WT EYEKL++EI  P+  L
Sbjct  71   AIDKENKAVTFKVIEGDLLKEYKSFKAIVQTISKGETTWVRWTFEYEKLNKEISTPVKLL  130

Query  182  QTILDITKEMEDH  220
              ++ + +E++DH
Sbjct  131  GFVIHMNEELDDH  143



>ref|XP_006303097.1| hypothetical protein CARUB_v100206591mg, partial [Capsella rubella]
 gb|EOA35995.1| hypothetical protein CARUB_v100206591mg, partial [Capsella rubella]
Length=80

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF LT QV          V W LEYEK+S E+  P +
Sbjct  1    AVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKQGGPGSIVHWHLEYEKISNEVAHPET  60

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  61   LLQFCVEVSKEIDEH  75



>emb|CAA55812.1| Sn-1 [Capsicum annuum]
Length=147

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 51/72 (71%), Gaps = 4/72 (6%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID + KL++++ ++GD+LESY SF++     ++ +  + TWT+EYEK +E  PEPL  L 
Sbjct  76   IDPDMKLIRWKAIEGDVLESYNSFTIV----TSSEHEWTTWTIEYEKKTEGTPEPLVLLG  131

Query  185  TILDITKEMEDH  220
             +LD+TK++E H
Sbjct  132  LVLDMTKDIEAH  143



>ref|XP_009773826.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=131

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A D +KK V ++V++GD+LE Y  F++      + +D + TWT  YEK +E+IPEPL+++
Sbjct  16   AFDPQKKSVTWKVIEGDLLELYNYFTIII----SSEDQWTTWTFVYEKKTEDIPEPLAFM  71

Query  182  QTILDITKEMEDH  220
              +LD+TK++++H
Sbjct  72   GVVLDLTKDIDNH  84



>ref|XP_009592503.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like [Nicotiana 
tomentosiformis]
Length=146

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D +KK + ++V+ GD+LE Y SF++T    ++ D  + TWT  YEK +EEIPEPL  L
Sbjct  75   AVDHQKKSITWKVIGGDLLELYNSFTIT----TSHDHQWTTWTFVYEKKTEEIPEPLVLL  130

Query  182  QTILDITKEMEDH  220
              +L +TK++E H
Sbjct  131  GFVLHVTKDIECH  143



>ref|XP_002872296.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48555.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata]
Length=164

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 51/74 (69%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDD--HFVTWTLEYEKLSEEIPEPLSY  178
            ++ EKKL+KFRV++GD+L  YKSF +T +V   + +    V W LEYEK  E +P P ++
Sbjct  86   VEPEKKLIKFRVIEGDVLAVYKSFLITIRVTPKEGEVGSVVKWHLEYEKNDENVPHPYNF  145

Query  179  LQTILDITKEMEDH  220
            L  + ++TKE+++H
Sbjct  146  LPFLAEMTKEIDEH  159



>ref|XP_004237027.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=152

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 49/69 (71%), Gaps = 0/69 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            IDDEKKL+K +V++GD+LE YKSF  T QV +  +++ VTW +EYEK +  +P+P   ++
Sbjct  76   IDDEKKLIKKKVIEGDLLEYYKSFYGTIQVETKGENNLVTWIMEYEKKNVNVPDPHYLME  135

Query  185  TILDITKEM  211
              L  TK++
Sbjct  136  FCLGATKDI  144



>ref|XP_002534267.1| Major latex protein, putative [Ricinus communis]
 gb|EEF28116.1| Major latex protein, putative [Ricinus communis]
Length=151

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            IDD      F+V++GDIL+ YKSF    Q     +   V W LEYEKL+  IPEP S L+
Sbjct  76   IDDVNMSTTFKVIEGDILKEYKSFKFVVQATPQGEGSTVHWILEYEKLNANIPEPTSLLE  135

Query  185  TILDITKEMEDH  220
             ++D+TK+++ H
Sbjct  136  FVVDLTKDIDAH  147



>gb|EYU32312.1| hypothetical protein MIMGU_mgv1a015629mg [Erythranthe guttata]
Length=151

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            +D+EKK   ++ ++GD+LE YK F +TC V + D   ++TWT++YE L  + P P++ L+
Sbjct  77   VDEEKKQFSYKFIEGDLLELYKDFVVTCHVETRDGVDYITWTIDYELLKADNPHPINILK  136

Query  185  TILDITKEMEDH  220
             ++  TK++E H
Sbjct  137  FVIGFTKDIETH  148



>gb|EPS58827.1| hypothetical protein M569_15986 [Genlisea aurea]
Length=149

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            ++DDEKKL+ FR+++GD+LE YK F LT  V S D    VTWT +YE L++++  P S  
Sbjct  75   SVDDEKKLISFRIIEGDVLEEYKDFLLTFHVESRDGKDLVTWTFDYETLNDDVGPPFSLA  134

Query  182  QTIL  193
            + + 
Sbjct  135  ELVF  138



>ref|XP_004237021.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=147

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 53/73 (73%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D+EKK + ++V++GD LE Y SF+++       +D++ TWT  YEK +E+ PEP++ L
Sbjct  75   AVDEEKKSITWKVLEGDTLELYNSFTISASF----EDNWATWTFVYEKKTEDTPEPVTLL  130

Query  182  QTILDITKEMEDH  220
            + ++DIT+++E H
Sbjct  131  KLMIDITRDLEGH  143



>emb|CDP14655.1| unnamed protein product [Coffea canephora]
Length=150

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EKK V F+  +GD+ + YK   +T  V +    + VTWTL+YEK++E +P+P S +
Sbjct  75   AIDEEKKSVTFKTTEGDLKQLYKKLLVTLHVDTKGQSNLVTWTLDYEKVNESVPDPNSVM  134

Query  182  QTILDITKEMEDHH  223
            +    +TK++E HH
Sbjct  135  ELAQKVTKDIEAHH  148



>ref|XP_006390832.1| hypothetical protein EUTSA_v10019117mg [Eutrema salsugineum]
 gb|ESQ28118.1| hypothetical protein EUTSA_v10019117mg [Eutrema salsugineum]
Length=219

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF LT QV          V W LEYEK+SEE+  P +
Sbjct  140  AVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKHGGPGSIVHWHLEYEKISEEVAHPET  199

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  200  LLQFCVEVSKEIDEH  214



>ref|NP_177245.1| MLP-like protein 43 [Arabidopsis thaliana]
 sp|Q9SSK5.1|MLP43_ARATH RecName: Full=MLP-like protein 43 [Arabidopsis thaliana]
 gb|AAD55504.1|AC008148_14 Unknown protein [Arabidopsis thaliana]
 emb|CAC83578.1| major latex-like protein [Arabidopsis thaliana]
 gb|AAL38311.1| unknown protein [Arabidopsis thaliana]
 gb|AAP37800.1| At1g70890 [Arabidopsis thaliana]
 gb|AEE35134.1| MLP-like protein 43 [Arabidopsis thaliana]
Length=158

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A+D EK L+ F+V++GD++  YKSF+ T QV     +      W LEYEK+SEE+  P +
Sbjct  79   AVDPEKNLITFKVLEGDLMNEYKSFAFTLQVTPKQGESGSIAHWHLEYEKISEEVAHPET  138

Query  176  YLQTILDITKEMEDH  220
             LQ  ++I+KE+++H
Sbjct  139  LLQFCVEISKEIDEH  153



>ref|XP_010427882.1| PREDICTED: MLP-like protein 28 [Camelina sativa]
Length=163

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF LT QV          V W LE+EK+SEE+  P +
Sbjct  84   AVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKQGGPGSIVHWHLEFEKISEEVAHPET  143

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  144  LLQFCVEVSKEIDEH  158



>emb|CDX68328.1| BnaA07g23680D [Brassica napus]
Length=164

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF +T QV          V W LEYEK+S+E+  P +
Sbjct  85   AVEPEKNLITFRVIEGDLMKEYKSFLITIQVTPKHGGPGSIVHWHLEYEKISDEVAHPET  144

Query  176  YLQTILDITKEMEDH  220
             LQ  +D++KE+++H
Sbjct  145  LLQFCVDVSKEIDEH  159



>emb|CDY09495.1| BnaC02g20370D [Brassica napus]
Length=158

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRVV+GD+++ YKSF +T QV          V W LEYEK+S+E+  P +
Sbjct  79   AVEPEKNLITFRVVEGDLMKEYKSFVITIQVTPKHGGPGSVVHWHLEYEKISDEVAHPET  138

Query  176  YLQTILDITKEMEDH  220
             LQ  ++I+KE+++H
Sbjct  139  LLQFCVEISKEIDEH  153



>ref|XP_009780262.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=146

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AIDDE K   ++V+ GD LE Y SF++T       ++ + TWT  YEK +E+ PEPL+ L
Sbjct  75   AIDDENKSFTWKVIGGDTLELYNSFTITASF----ENDWATWTFVYEKKTEDTPEPLTLL  130

Query  182  QTILDITKEMEDH  220
              +LD+TK++E H
Sbjct  131  GFVLDVTKDIEAH  143



>ref|XP_006360413.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=147

 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
             ID  KKL+K++V++GDILE Y  F++        +  + TW+ EYEK +E+ PEPL+++
Sbjct  75   VIDPHKKLIKWKVIEGDILEMYSFFTIVTSC----EHEWTTWSFEYEKKTEDTPEPLNFV  130

Query  182  QTILDITKEMEDH  220
              IL++TK ++DH
Sbjct  131  GLILEVTKHIDDH  143



>ref|XP_009127833.1| PREDICTED: MLP-like protein 31 [Brassica rapa]
Length=158

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRVV+GD+++ YKSF +T QV          V W LEYEK+S+E+  P +
Sbjct  79   AVEPEKNLITFRVVEGDLMKEYKSFVITIQVTPKHGGPGSVVHWHLEYEKISDEVAHPET  138

Query  176  YLQTILDITKEMEDH  220
             LQ  ++I+KE+++H
Sbjct  139  LLQFCVEISKEIDEH  153



>gb|AER29899.1| MLP [Gossypium barbadense]
Length=157

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A+D +K LV FRV++GD++E YKSF +T QV   S      V WTLEYEK    I  P +
Sbjct  78   AVDPDKNLVTFRVIEGDLMEEYKSFVITIQVSPKSEGSGSLVHWTLEYEKRHGGIAHPET  137

Query  176  YLQTILDITKEMEDH  220
             LQ + DI+K+++ H
Sbjct  138  LLQFVQDISKDIDAH  152



>ref|XP_006367041.1| PREDICTED: MLP-like protein 28-like [Solanum tuberosum]
Length=146

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 48/72 (67%), Gaps = 4/72 (6%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID  KK ++++++ GD+LE Y SF++        +  +VTWT+EYEK +E+ PEPL  L 
Sbjct  75   IDPHKKSIRWKIIGGDVLEMYNSFTIAVSC----EPQWVTWTIEYEKKTEDTPEPLIELG  130

Query  185  TILDITKEMEDH  220
             ILD+ K++E H
Sbjct  131  IILDLNKDIEGH  142



>ref|XP_002888805.1| hypothetical protein ARALYDRAFT_476224 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65064.1| hypothetical protein ARALYDRAFT_476224 [Arabidopsis lyrata subsp. 
lyrata]
Length=159

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A+D EK L+ F+V++GD+++ YKSF+ T QV          V W L+YEK+SEE+  P +
Sbjct  80   AVDPEKNLITFKVLEGDLMKEYKSFAFTIQVTPKQGAPGSIVHWHLDYEKISEEVAHPET  139

Query  176  YLQTILDITKEMEDH  220
             LQ  ++I+KE+++H
Sbjct  140  LLQFCVEISKEIDEH  154



>ref|XP_010415784.1| PREDICTED: MLP-like protein 43 [Camelina sativa]
Length=158

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+KFRV++GD++E YKSF +T QV     +    V W  EYEK++EE+  P +
Sbjct  79   AVEPEKNLIKFRVIEGDLMEEYKSFFVTIQVTPKHGESGSVVHWHFEYEKINEEVVHPEN  138

Query  176  YLQTILDITKEMEDH  220
             LQ  + ++KE+++H
Sbjct  139  LLQFAVGMSKEIDEH  153



>gb|EPS59252.1| hypothetical protein M569_15558 [Genlisea aurea]
Length=151

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV-HSNDDDHFVTWTLEYEKLSEEIPEPLSY  178
            A+DDEKKL+  RV+ GDIL+ YK F LT  V  SND     TWT EYE L++++  P S 
Sbjct  76   AVDDEKKLISLRVIGGDILDEYKEFLLTFHVEESNDGKELATWTFEYETLNDDVGPPFSL  135

Query  179  LQTILDITKEME  214
            +Q    +  ++E
Sbjct  136  IQLAFAMIVDVE  147



>ref|XP_002284570.1| PREDICTED: MLP-like protein 34 [Vitis vinifera]
Length=151

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+E K V F+V++GD+++ YKSF +  Q     D  +V WTLEYEKL++++  P+  L
Sbjct  75   AIDEENKSVTFKVIEGDLMKEYKSFRIIVQAIPKGDATYVHWTLEYEKLNKDVLAPIKIL  134

Query  182  QTILDITKEMEDH  220
              ++ ++++++DH
Sbjct  135  GFVVHVSEDIDDH  147



>ref|XP_010471089.1| PREDICTED: MLP-like protein 28 [Camelina sativa]
Length=163

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+  RV++GD+++ YKSF LT QV          V W LE+EK+SEE+  P +
Sbjct  84   AVEPEKNLITLRVIEGDLMKEYKSFLLTIQVTPKQGGPGSIVHWHLEFEKISEEVAHPET  143

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+E+H
Sbjct  144  LLQFCVEVSKEIEEH  158



>ref|XP_011070613.1| PREDICTED: kirola-like [Sesamum indicum]
Length=154

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDD-DHFVTWTLEYEKLSEEIPEPLSY  178
            A+D+EK+ + +++++GD++ +Y +F L+  + S  + D+ VTWT+EYEK +E +PEP ++
Sbjct  75   AVDEEKRSITYKLIEGDLMAAYNTFKLSFSIDSKGELDNVVTWTIEYEKKNESVPEPSTF  134

Query  179  LQTILDITKEMEDHH  223
            L      T+E+E H+
Sbjct  135  LDICRSATQEIERHY  149



>emb|CBI26883.3| unnamed protein product [Vitis vinifera]
Length=138

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+E K V F+V++GD+++ YKSF +  Q     D  +V WTLEYEKL++++  P+  L
Sbjct  62   AIDEENKSVTFKVIEGDLMKEYKSFRIIVQAIPKGDATYVHWTLEYEKLNKDVLAPIKIL  121

Query  182  QTILDITKEMEDH  220
              ++ ++++++DH
Sbjct  122  GFVVHVSEDIDDH  134



>pdb|2I9Y|A Chain A, Solution Structure Of Arabidopsis Thaliana Protein At1g70830, 
A Member Of The Major Latex Protein Family
Length=166

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ +K L+ FRV++GD+++ YKSF LT QV          V W LEYEK+SEE+  P +
Sbjct  87   AVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYEKISEEVAHPET  146

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  147  LLQFCVEVSKEIDEH  161



>dbj|BAJ25788.1| putative PR-10 type pathogenesis-related protein [Nicotiana tabacum]
Length=146

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D EKK + ++V+ GD+LESY SF++     ++ D  + TWT  YEK +EE PEPL  L
Sbjct  75   AVDHEKKSITWKVIGGDLLESYNSFTII----TSHDHQWTTWTFVYEKKTEETPEPLVLL  130

Query  182  QTILDITKEMEDH  220
               L +TK++E H
Sbjct  131  AYALHVTKDVESH  143



>ref|NP_001117579.1| MLP-like protein 28 [Arabidopsis thaliana]
 gb|AEE35125.1| MLP-like protein 28 [Arabidopsis thaliana]
Length=173

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ +K L+ FRV++GD+++ YKSF LT QV          V W LEYEK+SEE+  P +
Sbjct  94   AVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYEKISEEVAHPET  153

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  154  LLQFCVEVSKEIDEH  168



>ref|XP_006365602.1| PREDICTED: MLP-like protein 28-like [Solanum tuberosum]
Length=150

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
             ID EKK++  +  +GD+++ Y SF  T  + + D+   V+WTLEYE+ +E +PE ++ L
Sbjct  75   TIDHEKKVLTLKEFEGDVIDKYDSFKATLHIETKDEIDLVSWTLEYERPNENVPELINVL  134

Query  182  QTILDITKEMEDHHA  226
              ++ +TK ++DHHA
Sbjct  135  NFVVGMTKAIDDHHA  149



>ref|XP_011070612.1| PREDICTED: kirola-like [Sesamum indicum]
Length=154

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 53/75 (71%), Gaps = 1/75 (1%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDD-DHFVTWTLEYEKLSEEIPEPLSY  178
            A+D+EK+ + ++V++GD++ +Y +F +T  V S  + D+ VTWT+EYEK +E +PEP  +
Sbjct  75   AVDEEKRSITYKVIEGDLMVAYNTFKVTFCVDSKGELDNVVTWTIEYEKKNESVPEPSKF  134

Query  179  LQTILDITKEMEDHH  223
            L    + T+E+E H+
Sbjct  135  LDFCSNATQEIERHY  149



>ref|NP_198153.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
 gb|AED93758.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
Length=166

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDD--DHFVTWTLEYEKLSEEIPEPLSY  178
            ++ EKKL+KFRV++GD++  YKSF +T QV   +      V W +EYEK+ E +P P + 
Sbjct  88   VEPEKKLIKFRVIEGDVMAEYKSFLITIQVTPKEGGTGSVVKWHIEYEKIDENVPHPENL  147

Query  179  LQTILDITKEMEDH  220
            L    ++TKE+++H
Sbjct  148  LPFFAEMTKEIDEH  161



>ref|XP_010678160.1| PREDICTED: kirola-like [Beta vulgaris subsp. vulgaris]
Length=154

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDD-HFVTWTLEYEKLSEEIPEPLSYL  181
            ID+E K++KF++++GD++E Y +F LT QV     +   V W  EYEK    +PEP S +
Sbjct  76   IDEENKIIKFKMLEGDLMEDYNTFVLTYQVLPESKEISLVKWIFEYEKKHPGVPEPSSLM  135

Query  182  QTILDITKEMEDHH  223
             T+L + K+++DHH
Sbjct  136  DTLLGLAKKIDDHH  149



>ref|XP_009779849.1| PREDICTED: kirola-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009779850.1| PREDICTED: kirola-like isoform X2 [Nicotiana sylvestris]
Length=147

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A D +KK   ++V++GD+LE Y SF ++  +    +D + TWT  YEK +E+ PEPL+++
Sbjct  75   ATDPQKKTGTWKVIEGDLLELYNSFIISISI----EDQWTTWTFVYEKKTEDTPEPLAFM  130

Query  182  QTILDITKEMEDH  220
              ++DITK++E H
Sbjct  131  GVVIDITKDVEGH  143



>ref|XP_009127832.1| PREDICTED: MLP-like protein 31 [Brassica rapa]
Length=158

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRVV+GD+++ YKSF +T QV          V W LEYEK+S+E+  P +
Sbjct  79   AVEPEKNLITFRVVEGDLMKEYKSFVITIQVTPKHGGPGSVVHWYLEYEKISDEVAHPET  138

Query  176  YLQTILDITKEMEDH  220
             LQ  ++I++E+++H
Sbjct  139  LLQFCVEISREIDEH  153



>ref|XP_010415777.1| PREDICTED: MLP-like protein 28 [Camelina sativa]
Length=163

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF LT QV          V W LE+EK++EE+  P +
Sbjct  84   AVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKQGGPGSIVHWHLEFEKINEEVAHPET  143

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  144  LLQFCIEVSKEIDEH  158



>gb|KDP44595.1| hypothetical protein JCGZ_22177 [Jatropha curcas]
Length=151

 Score = 67.0 bits (162),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+      ++V++GDIL+ YKSF  T +    D    V WTL+YEKL++ IP+P S LQ
Sbjct  76   IDNVNLFTTYKVIEGDILKEYKSFKFTVKATPKDTGSVVRWTLDYEKLNKNIPDPHSILQ  135

Query  185  TILDITKEMEDH  220
             +++I+K+++ H
Sbjct  136  LLIEISKDIDAH  147



>ref|XP_008340260.1| PREDICTED: MLP-like protein 31 [Malus domestica]
Length=181

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            AID+E K VKF V+ G+IL+ YKSF +T +V   +      V W ++YEK+ EEIP+P S
Sbjct  103  AIDEENKTVKFNVLDGEILKHYKSFRVTLKVTEKTTGGGSLVKWIIDYEKVKEEIPDPES  162

Query  176  YLQTILDITKEMEDH  220
            Y    + +TK++E H
Sbjct  163  YQDFAVKVTKDLEAH  177



>ref|XP_010494066.1| PREDICTED: MLP-like protein 31 [Camelina sativa]
Length=168

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDD--DHFVTWTLEYEKLSEEIPEPLSY  178
            ++ EKKL+KFRV++GD+L  YKSF +T Q    +      V W LEYE+  E +P P ++
Sbjct  90   VEPEKKLIKFRVIEGDVLAVYKSFLITIQATPKEGGVGSVVKWHLEYERNDENVPHPENF  149

Query  179  LQTILDITKEMEDH  220
            L  + ++TKE+++H
Sbjct  150  LPFLAEMTKEIDEH  163



>ref|XP_004240133.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=149

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 51/73 (70%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+E KL+K ++++GD+LE YKSF +T  V +  +++   W +EYEK +  + +P ++++
Sbjct  75   IDEENKLIKKKMIEGDLLEDYKSFYITTHVETKGENNLFIWIIEYEKKNANVSDPHTFME  134

Query  185  TILDITKEMEDHH  223
              L +TK++E HH
Sbjct  135  FALKMTKDIETHH  147



>ref|XP_007226522.1| hypothetical protein PRUPE_ppa025363mg [Prunus persica]
 gb|EMJ27721.1| hypothetical protein PRUPE_ppa025363mg [Prunus persica]
Length=150

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AIDDEK  +  RVV+G++LE YKSF +T Q     +   V WT EYEK+  ++ +P + L
Sbjct  75   AIDDEKNSITLRVVEGNLLEHYKSFKITVQATPKGEGSVVHWTFEYEKVHGDVTDPHTLL  134

Query  182  QTILDITKEMEDH  220
            Q  +D+T ++  H
Sbjct  135  QLAVDLTTDIGAH  147



>ref|XP_010415785.1| PREDICTED: MLP-like protein 43 [Camelina sativa]
Length=159

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A+D EK L+ F+V+ G +++ YKSF+ T QV          V W LEYEK+S E+  P +
Sbjct  80   AVDTEKNLITFKVIGGVLMKEYKSFAFTIQVTPKQGGPGSIVHWHLEYEKISNEVAHPET  139

Query  176  YLQTILDITKEMEDH  220
             LQ  +DI+KE+++H
Sbjct  140  LLQFCVDISKEIDEH  154



>ref|XP_009616725.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like isoform 
X2 [Nicotiana tomentosiformis]
Length=120

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A D +KK + ++V+ GD+LE Y SF++     ++ D  + TWTLEYEK +E+ PEPL +L
Sbjct  49   AADYQKKSITWKVIGGDLLELYNSFTII----TSHDHQWTTWTLEYEKKTEDTPEPLVFL  104

Query  182  QTILDITKEMEDH  220
               L +TK++E H
Sbjct  105  GYALHVTKDIEGH  117



>ref|NP_001077806.1| MLP-like protein 28 [Arabidopsis thaliana]
 gb|AEE35123.1| MLP-like protein 28 [Arabidopsis thaliana]
Length=201

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ +K L+ FRV++GD+++ YKSF LT QV          V W LEYEK+SEE+  P +
Sbjct  94   AVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYEKISEEVAHPET  153

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  154  LLQFCVEVSKEIDEH  168



>ref|XP_010684109.1| PREDICTED: MLP-like protein 43 [Beta vulgaris subsp. vulgaris]
Length=156

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDD-HFVTWTLEYEKLSEEIPEPLSYL  181
            ID+E K++KF++++GD++E Y +F LT QV     +   V W  EYEK    +PEP S +
Sbjct  78   IDEENKIIKFKMLEGDLMEDYNTFVLTYQVLPESKEISLVKWIFEYEKKHPGVPEPSSLM  137

Query  182  QTILDITKEMEDHH  223
             T+L + K+++DHH
Sbjct  138  DTLLGLAKKIDDHH  151



>gb|KFK41510.1| hypothetical protein AALP_AA2G139000 [Arabis alpina]
Length=213

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 52/75 (69%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDD--DHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF LT QV   +      V W LEYEK+S+E+  P +
Sbjct  134  AVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKEGGTGSIVHWHLEYEKISDEVAHPET  193

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  194  LLQFCVEVSKEIDEH  208



>ref|XP_002535412.1| Major latex protein, putative [Ricinus communis]
 gb|EEF26971.1| Major latex protein, putative [Ricinus communis]
Length=151

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            IDD      F+V++GD+L+ YKSF    Q         V WTL YEKL+  IPEP S L+
Sbjct  76   IDDVNMSTTFKVIEGDLLKEYKSFKFVVQATPKGKGSIVHWTLVYEKLNANIPEPTSMLE  135

Query  185  TILDITKEMEDHHA  226
              +D+TK+++ H A
Sbjct  136  FAVDVTKDIDAHLA  149



>ref|XP_010672189.1| PREDICTED: kirola-like [Beta vulgaris subsp. vulgaris]
Length=154

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 51/74 (69%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D+EKK+V+F++++GD+L+ +KSF+L  QV   D+   V WT E+EK+ +E   P   +
Sbjct  75   AVDEEKKMVRFKIIEGDLLKEFKSFTLVVQVIPKDNITGVRWTAEFEKVHDEGHYPTKLI  134

Query  182  QTILDITKEMEDHH  223
               + +TK++E HH
Sbjct  135  DFCIAVTKDIEAHH  148



>ref|XP_004237017.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=147

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 51/73 (70%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A D ++KL+K++V++GD+L+ YK     C   ++ D  + TWT++YEK +E+ PEPL +L
Sbjct  75   AADPQQKLIKWKVIEGDLLKLYKY----CNFTTSCDGQWTTWTIDYEKKTEDTPEPLLHL  130

Query  182  QTILDITKEMEDH  220
              IL +TK++E H
Sbjct  131  GVILAMTKDIESH  143



>ref|XP_009777224.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=147

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A D +KK   ++V++GD+LE Y SF ++  +    +D + TWT  YEK +E+ PEPL+++
Sbjct  75   ATDPQKKSGTWKVIEGDLLELYNSFIISISI----EDQWTTWTFVYEKKTEDTPEPLAFM  130

Query  182  QTILDITKEMEDH  220
              ++DITK++E H
Sbjct  131  GVVIDITKDVEGH  143



>gb|EPS57581.1| hypothetical protein M569_17236, partial [Genlisea aurea]
Length=131

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+EK+ V F++++GD+ E YK   +T  V + D   F+TWT+EYE L  + P PLS + 
Sbjct  60   IDEEKRHVGFQMIEGDLFELYKDVFITTDVETKDGVDFITWTIEYELLKPDNPHPLSLIN  119

Query  185  TILDITKEMEDH  220
              +D TK++E H
Sbjct  120  YFIDFTKDVEAH  131



>ref|XP_009774601.1| PREDICTED: kirola-like [Nicotiana sylvestris]
 dbj|BAJ25784.1| putative PR-10 type pathogenesis-related protein [Nicotiana tabacum]
Length=146

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D EKK + ++V+ GD+LE Y SF +T    S+ D  + TWT  YEK +E+ PEPL  L
Sbjct  75   AVDHEKKSITWKVIGGDLLELYNSFIIT----SSHDHQWTTWTFVYEKKTEDTPEPLVLL  130

Query  182  QTILDITKEMEDH  220
              +L +TK++E H
Sbjct  131  GFVLHVTKDIEGH  143



>ref|XP_009104932.1| PREDICTED: MLP-like protein 34 [Brassica rapa]
Length=161

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF +T QV          V W LEYEK+S+E+  P +
Sbjct  82   AVEPEKNLITFRVIEGDLMKEYKSFLITIQVTPKHGGPGSIVHWHLEYEKISDEVAHPET  141

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  142  LLQFCVEVSKEIDEH  156



>ref|XP_004237029.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=147

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D E K + ++++ GD+LE Y SF++        D H+ TWT  YEK +E+ PEPL  L
Sbjct  75   AVDHETKTITWKIIGGDLLELYDSFTIITSC----DHHWTTWTFLYEKKTEDTPEPLVLL  130

Query  182  QTILDITKEMEDH  220
              +L +TKE+E+H
Sbjct  131  AYVLHVTKEIENH  143



>ref|XP_002862771.1| hypothetical protein ARALYDRAFT_497302 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39029.1| hypothetical protein ARALYDRAFT_497302 [Arabidopsis lyrata subsp. 
lyrata]
Length=245

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A+D EK L+ FRV++GD+++ YKSF +T QV          V W  EYEK++EE+  P +
Sbjct  166  AVDPEKNLITFRVIEGDLMKEYKSFVITIQVTPKHGGSGSVVHWHFEYEKINEEVAHPET  225

Query  176  YLQTILDITKEMEDH  220
             LQ  ++I+KE+++H
Sbjct  226  LLQFAVEISKEIDEH  240


 Score = 60.8 bits (146),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = +2

Query  23   LVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLSYLQTILD  196
            L+ FRV++GD+++ YKSF +T QV          V W LEYEK+S+E+  P + LQ  ++
Sbjct  9    LITFRVIEGDLMKEYKSFVITIQVTPKHGGSGSIVHWHLEYEKISDEVAHPETLLQFCVE  68

Query  197  ITKEMEDH  220
            ++KE+++H
Sbjct  69   VSKEIDEH  76



>dbj|BAJ25783.1| putative PR-10 type pathogenesis-related protein [Nicotiana tabacum]
Length=146

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D EKK + ++V+ GD+LE Y SF +T    S+ D  + TWT  YEK +E+ PEPL  L
Sbjct  75   AVDHEKKSITWKVIGGDLLELYNSFIIT----SSHDHQWTTWTFVYEKKTEDTPEPLVLL  130

Query  182  QTILDITKEMEDH  220
              +L +TK++E H
Sbjct  131  GFVLHVTKDIEGH  143



>ref|XP_006303111.1| hypothetical protein CARUB_v100206590mg [Capsella rubella]
 gb|EOA36009.1| hypothetical protein CARUB_v100206590mg [Capsella rubella]
Length=261

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 51/77 (66%), Gaps = 4/77 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSN----DDDHFVTWTLEYEKLSEEIPEP  169
            A++ +K L+ FRV++GD+++ YKSF  T QV  N         V W LEYEK+SEE+  P
Sbjct  180  AVEPDKNLITFRVIEGDLMKEYKSFVATIQVTPNPKHGGSGSIVHWHLEYEKISEEVAHP  239

Query  170  LSYLQTILDITKEMEDH  220
             + LQ  ++I+KE+++H
Sbjct  240  ETLLQLCVEISKEIDEH  256


 Score = 63.2 bits (152),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV+ GD+++ YKSF +T QV +   +    V W LEYEK+S+ +  P +
Sbjct  17   AVELEKNLITFRVLDGDLMKEYKSFVITIQVTNKHGEPGSIVHWHLEYEKISDAVAHPET  76

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  77   LLQFCVEVSKEIDEH  91



>emb|CDY03718.1| BnaA02g15190D [Brassica napus]
Length=229

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF LT QV          V W LEYEK+S+E+  P +
Sbjct  150  AVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKHGGAGSIVHWHLEYEKISDEVAHPET  209

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  210  LLQFCVEVSKEIDEH  224



>ref|XP_011078288.1| PREDICTED: kirola-like isoform X1 [Sesamum indicum]
Length=151

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            IDD KK +KF++++GD +E YK+  +T  V +     F+TWT++YE+++ + P PLS L 
Sbjct  77   IDDTKKQIKFKMLEGDPVELYKNMVITAHVETKGGVDFITWTMDYEQINPDNPHPLSLLN  136

Query  185  TILDITKEMEDH  220
             ++++ K++E H
Sbjct  137  FLIELIKDIEAH  148



>ref|XP_009127828.1| PREDICTED: MLP-like protein 31 [Brassica rapa]
Length=218

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF LT QV          V W LEYEK+S+E+  P +
Sbjct  139  AVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKHGGAGSIVHWHLEYEKISDEVAHPET  198

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  199  LLQFCVEVSKEIDEH  213



>ref|NP_177240.3| MLP-like protein 28 [Arabidopsis thaliana]
 gb|AEE35121.1| MLP-like protein 28 [Arabidopsis thaliana]
Length=249

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ +K L+ FRV++GD+++ YKSF LT QV          V W LEYEK+SEE+  P +
Sbjct  94   AVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYEKISEEVAHPET  153

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  154  LLQFCVEVSKEIDEH  168



>gb|EYU31818.1| hypothetical protein MIMGU_mgv1a024291mg [Erythranthe guttata]
Length=147

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 50/71 (70%), Gaps = 0/71 (0%)
 Frame = +2

Query  11   DEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQTI  190
            +EKK V + +V+GD++E YK+F  T  V +  +D+ VTWT  YEKL++++P+P + +   
Sbjct  73   EEKKSVTYNLVEGDLMELYKTFKATVHVDTVGEDNLVTWTFVYEKLNKDVPDPHTLMDLC  132

Query  191  LDITKEMEDHH  223
            + +TK++E HH
Sbjct  133  VKLTKDIESHH  143



>ref|XP_011078287.1| PREDICTED: kirola-like [Sesamum indicum]
Length=151

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+ KK +KF++++GD+LE YK+  LT  V +     F+TWT++YE ++ + P PLS L 
Sbjct  77   IDETKKQIKFKMLEGDLLELYKNMVLTVHVETKGGVDFITWTIDYELINPDNPHPLSILN  136

Query  185  TILDITKEMEDH  220
              ++ TK++E H
Sbjct  137  WTIEFTKDVEAH  148



>ref|XP_009761732.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=147

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A D +KK   ++V++GD+LE Y SF ++  +    +D + TWT  YEK +E+ PEPL+++
Sbjct  75   ATDPQKKSGTWKVIEGDLLELYNSFIISISI----EDQWTTWTFVYEKKTEDTPEPLAFM  130

Query  182  QTILDITKEMEDH  220
              ++DITK++E H
Sbjct  131  GVVIDITKDVEGH  143



>emb|CDY09492.1| BnaC02g20340D [Brassica napus]
Length=229

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF LT QV          V W LEYEK+S+E+  P +
Sbjct  150  AVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKHGGAGSIVHWHLEYEKISDEVAHPET  209

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  210  LLQFCVEVSKEIDEH  224



>ref|XP_010421666.1| PREDICTED: MLP-like protein 31 [Camelina sativa]
Length=168

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 49/74 (66%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDD--DHFVTWTLEYEKLSEEIPEPLSY  178
            ++ EKKL+KFRV++GD+L  YKSF +T Q    +      V W LEYE+  E +P P ++
Sbjct  90   VEPEKKLIKFRVIEGDVLAVYKSFLITIQATPKEGGVGSVVKWHLEYERSDENVPHPDNF  149

Query  179  LQTILDITKEMEDH  220
            L  + ++TKE+++H
Sbjct  150  LPFLAEMTKEIDEH  163



>ref|XP_006301425.1| hypothetical protein CARUB_v10021843mg, partial [Capsella rubella]
 gb|EOA34323.1| hypothetical protein CARUB_v10021843mg, partial [Capsella rubella]
Length=157

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF LT QV          V W LEYEK+S+E+  P +
Sbjct  78   AVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKQGGSGSIVHWHLEYEKISDEVAHPET  137

Query  176  YLQTILDITKEMEDH  220
             LQ  +D++ +++ H
Sbjct  138  LLQFCIDVSNQIDAH  152



>emb|CAA55813.1| Sn-2 [Capsicum annuum]
Length=147

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 50/72 (69%), Gaps = 4/72 (6%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID +KKL++++ ++GD+LESY SF++     +  +  + TW +EYEK +E  PEPL  L 
Sbjct  76   IDPDKKLIRWKAIEGDVLESYNSFTIV----TFSEHEWTTWVIEYEKKTEGTPEPLVQLG  131

Query  185  TILDITKEMEDH  220
             +LD+TK+++ H
Sbjct  132  IVLDMTKDIDAH  143



>ref|XP_002535538.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF26845.1| conserved hypothetical protein [Ricinus communis]
Length=71

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 41/65 (63%), Gaps = 0/65 (0%)
 Frame = +2

Query  32   FRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQTILDITKEM  211
            F+V++GD+L+ YKSF    Q         V WTL YEKL+  IPEP S L+  +D+TK++
Sbjct  5    FKVIEGDLLKEYKSFKFVVQATPKGKGSIVHWTLVYEKLNANIPEPTSMLEFAVDVTKDI  64

Query  212  EDHHA  226
            + H A
Sbjct  65   DAHLA  69



>ref|XP_009626144.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like [Nicotiana 
tomentosiformis]
Length=147

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 49/74 (66%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EK+ + F+ ++GD+LE YK+FS T          ++ WT EYEK +E+I EPL+ L
Sbjct  75   AIDEEKQKITFKFIEGDLLEMYKAFSATLAAEGK----WIEWTFEYEKQNEDIREPLTLL  130

Query  182  QTILDITKEMEDHH  223
               +D+ K+++ HH
Sbjct  131  GLAIDLIKDIDSHH  144



>gb|EPS64959.1| hypothetical protein M569_09820 [Genlisea aurea]
Length=124

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+ KK + ++VV G +LE Y++  ++  V + D   F+TWTLEYE L  E P P+S + 
Sbjct  47   IDEGKKHIGYKVVGGSLLELYRNVFISTDVETKDGVDFITWTLEYELLVPENPHPVSIIN  106

Query  185  TILDITKEMEDHH  223
              ++ TKE E HH
Sbjct  107  FWIEFTKEFEAHH  119



>ref|XP_004297383.1| PREDICTED: MLP-like protein 28-like [Fragaria vesca subsp. vesca]
Length=153

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AIDDE   +  ++++GD+LE YKSF  T Q     +   V WT EYEKL +E+ +P + L
Sbjct  76   AIDDETNSITLKIIEGDLLEHYKSFKATIQASPKGEGSSVHWTFEYEKLHDEVSDPHTLL  135

Query  182  QTILDITKEMEDH  220
            Q + +++K++++H
Sbjct  136  QLVAELSKDIDNH  148



>ref|XP_009616724.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like isoform 
X1 [Nicotiana tomentosiformis]
Length=146

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A D +KK + ++V+ GD+LE Y SF++     ++ D  + TWTLEYEK +E+ PEPL +L
Sbjct  75   AADYQKKSITWKVIGGDLLELYNSFTII----TSHDHQWTTWTLEYEKKTEDTPEPLVFL  130

Query  182  QTILDITKEMEDH  220
               L +TK++E H
Sbjct  131  GYALHVTKDIEGH  143



>ref|XP_002323753.1| major latex protein homologue [Populus trichocarpa]
 gb|EEF03886.1| major latex protein homologue [Populus trichocarpa]
Length=120

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+ K    F+V++GD++E+YKSF +  Q         V WTL +EKL+E IP P ++L 
Sbjct  43   IDNTKLSTTFKVIEGDLMEAYKSFKVIVQATPKGHGSVVHWTLIFEKLNENIPAPTAFLD  102

Query  185  TILDITKEMEDH  220
              +D TK++  H
Sbjct  103  NAVDFTKDINAH  114



>ref|XP_009793464.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=147

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 52/73 (71%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A D EKK + ++V++GD+LE Y  F++     ++ +D + TWTL YEK +E+ PEPL+++
Sbjct  75   AFDHEKKSITWKVIEGDLLELYNYFTVI----TSSEDQWTTWTLVYEKKTEDTPEPLAFM  130

Query  182  QTILDITKEMEDH  220
              +LD+TK+++ H
Sbjct  131  GVVLDLTKDIDVH  143



>ref|NP_001077807.1| MLP-like protein 28 [Arabidopsis thaliana]
 gb|AEE35124.1| MLP-like protein 28 [Arabidopsis thaliana]
Length=288

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ +K L+ FRV++GD+++ YKSF LT QV          V W LEYEK+SEE+  P +
Sbjct  47   AVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYEKISEEVAHPET  106

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  107  LLQFCVEVSKEIDEH  121


 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++  K L+ FRV+ GD+++ YKSF LT QV          V W LEYEK+SEE+  P +
Sbjct  209  AVEPNKNLITFRVIDGDLMKEYKSFLLTIQVTPKLGGPGSIVHWHLEYEKISEEVAHPET  268

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  269  LLQFCVEVSKEIDEH  283



>ref|XP_002888799.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65058.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=316

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A+D EK L+ FRV++GD+++ YKSF +T QV          V W  EYEK++EE+  P +
Sbjct  237  AVDPEKNLITFRVIEGDLMKEYKSFVITIQVTPKHGGSGSVVHWHFEYEKINEEVAHPET  296

Query  176  YLQTILDITKEMEDH  220
             LQ  ++I+KE+++H
Sbjct  297  LLQFAVEISKEIDEH  311


 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF +T QV          V W LEYEK+S+E+  P +
Sbjct  81   AVEPEKNLITFRVIEGDLMKEYKSFVITIQVTPKHGGSGSIVHWHLEYEKISDEVAHPET  140

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  141  LLQFCVEVSKEIDEH  155



>ref|XP_006367814.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=146

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A++ E K + ++V+ GD+LE Y SF++        D H+ TWT  YEK +E+ PEPL  L
Sbjct  75   AVNHETKTITWKVIGGDLLELYDSFTIITSC----DHHWATWTFLYEKKTEDTPEPLVLL  130

Query  182  QTILDITKEMEDH  220
              +L +TKE+E+H
Sbjct  131  AYVLHVTKEIENH  143



>emb|CDP00800.1| unnamed protein product [Coffea canephora]
Length=157

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHS-NDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            I++EKK + F++++GD++E YK+F++   V    D++  +TWTL+YEKL E+ P P ++L
Sbjct  80   INEEKKSIVFKMIEGDLMELYKTFTIMYHVDVLGDEESLITWTLDYEKLKEDTPHPGTFL  139

Query  182  QTILDITKEMEDHH  223
              +L   +++E HH
Sbjct  140  NLLLHAVEDIESHH  153



>ref|XP_009609604.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like [Nicotiana 
tomentosiformis]
Length=147

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A D +KK + ++V+ GD+LE Y  F++     ++ +D + TWTL YEK +E+ PEPL +L
Sbjct  75   AFDHQKKSITWKVIGGDLLELYNYFTII----TSSEDQWTTWTLVYEKKTEDTPEPLDFL  130

Query  182  QTILDITKEMEDH  220
              +LD+TK+++ H
Sbjct  131  GVVLDLTKDIDAH  143



>ref|XP_006344279.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=147

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D  KKL+K++V++GD+LE Y      C   ++ +  + TWT+EYEK +E+ PEPL +L
Sbjct  75   AVDPHKKLIKWKVIEGDLLELYNY----CNFTTSCEREWTTWTIEYEKKTEDTPEPLLHL  130

Query  182  QTILDITKEMEDH  220
              IL +T ++E+H
Sbjct  131  GVILAMTMDIENH  143



>ref|XP_010415774.1| PREDICTED: MLP-like protein 43 isoform X2 [Camelina sativa]
Length=288

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHF--VTWTLEYEKLSEEIPEPLS  175
            A++ +K L+ FRV+ GD+++ YKSF  T QV   D      V W LEYEK+SEE+  P +
Sbjct  209  AVEPDKNLITFRVIDGDLMKEYKSFVFTIQVTPKDGGSGSNVHWHLEYEKISEEVAHPET  268

Query  176  YLQTILDITKEMEDH  220
             LQ  ++I+KE+++H
Sbjct  269  LLQLCVEISKEIDEH  283


 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ E  L+ FRV+ GD+++ Y SF  T QV          V W LEYEK+S+E+  P +
Sbjct  47   AVEPENNLITFRVLDGDLMKEYTSFVTTIQVTPKHGGPGSIVHWHLEYEKISDEVAHPET  106

Query  176  YLQTILDITKEMEDH  220
             LQ  ++I+KE+++H
Sbjct  107  LLQFCIEISKEIDEH  121



>ref|XP_006289231.1| hypothetical protein CARUB_v10002687mg [Capsella rubella]
 gb|EOA22129.1| hypothetical protein CARUB_v10002687mg [Capsella rubella]
Length=169

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDH---FVTWTLEYEKLSEEIPEPLS  175
            ++ EK L+KFRV++GD+L  YKSF +T Q  +  +      V W LEYE+  E +P P +
Sbjct  90   VEPEKNLIKFRVIEGDVLALYKSFLITIQATTAKEGGVGSVVKWHLEYERNDENVPHPEN  149

Query  176  YLQTILDITKEMEDH  220
            YL  + ++TKE+++H
Sbjct  150  YLPFLAEMTKEIDEH  164



>ref|NP_850976.1| MLP-like protein 34 [Arabidopsis thaliana]
 ref|NP_001031265.1| MLP-like protein 34 [Arabidopsis thaliana]
 sp|Q9SSK7.1|MLP34_ARATH RecName: Full=MLP-like protein 34 [Arabidopsis thaliana]
 gb|AAD55503.1|AC008148_13 Unknown protein [Arabidopsis thaliana]
 gb|AAK49615.1|AF372899_1 At1g70850/F15H11_10 [Arabidopsis thaliana]
 emb|CAC83579.1| major latex-like protein [Arabidopsis thaliana]
 gb|AAL15356.1| At1g70850/F15H11_10 [Arabidopsis thaliana]
 dbj|BAF02039.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35127.1| MLP-like protein 34 [Arabidopsis thaliana]
 gb|AEE35129.1| MLP-like protein 34 [Arabidopsis thaliana]
Length=316

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 51/76 (67%), Gaps = 4/76 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV---HSNDDDHFVTWTLEYEKLSEEIPEPL  172
            A+D EK L+ FRV++GD+++ YKSF +T QV   H       V W  EYEK++EE+  P 
Sbjct  237  AVDPEKNLITFRVIEGDLMKEYKSFVITIQVTPKHGGSGS-VVHWHFEYEKINEEVAHPE  295

Query  173  SYLQTILDITKEMEDH  220
            + LQ  ++++KE+++H
Sbjct  296  TLLQFAVEVSKEIDEH  311


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 52/76 (68%), Gaps = 4/76 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV---HSNDDDHFVTWTLEYEKLSEEIPEPL  172
            A++ EK L+ FRV++GD+++ YKSF +T QV   H       V W LEYEK+S+E+  P 
Sbjct  81   AVEPEKNLITFRVIEGDLMKEYKSFLITIQVTPKHGGPGS-IVHWHLEYEKISDEVAHPE  139

Query  173  SYLQTILDITKEMEDH  220
            + LQ  +++++E+++H
Sbjct  140  TLLQFCVEVSQEIDEH  155



>ref|XP_009587470.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like [Nicotiana 
tomentosiformis]
Length=88

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 50/73 (68%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A D +KK V  +V++GD+LE Y  F++     ++ +D + TWT  YEK +E+ PEPL+++
Sbjct  16   AFDHQKKSVSVKVIEGDLLELYNYFTII----TSSEDQWTTWTFVYEKKTEDTPEPLTFM  71

Query  182  QTILDITKEMEDH  220
              +LD+TK+++ H
Sbjct  72   GVVLDLTKDIDAH  84



>ref|XP_002862769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39027.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV+ GD+++ YKSF LT QV          V W LEYEK+S+E+  P +
Sbjct  94   AVEPEKNLITFRVIDGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYEKISDEVAHPET  153

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  154  LLQFCVEVSKEIDEH  168



>ref|XP_009592037.1| PREDICTED: MLP-like protein 28 [Nicotiana tomentosiformis]
Length=300

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 53/73 (73%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID +KK + ++V++GD+LE Y SF++     ++ +  + TWTL Y+K +++IPEP++ L
Sbjct  228  AIDPQKKSITWKVIEGDLLELYNSFTII----TSCEQQWTTWTLVYDKKTKDIPEPIALL  283

Query  182  QTILDITKEMEDH  220
               LD+TK++EDH
Sbjct  284  GCALDMTKDIEDH  296


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID +KK + ++V+ GD+LE Y SF++     S++D  + TWT  YEK +E++PEPL  L
Sbjct  75   AIDHQKKSITWKVIGGDLLELYNSFTII----SSNDHQWTTWTFVYEKKTEDVPEPLVLL  130

Query  182  QTILDITKEMEDH  220
               L +TK++E H
Sbjct  131  GLALGVTKDIECH  143



>ref|XP_006303098.1| hypothetical protein CARUB_v100206591mg, partial [Capsella rubella]
 gb|EOA35996.1| hypothetical protein CARUB_v100206591mg, partial [Capsella rubella]
Length=279

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF LT QV          V W LEYEK+S E+  P +
Sbjct  200  AVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKQGGPGSIVHWHLEYEKISNEVAHPET  259

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  260  LLQFCVEVSKEIDEH  274


 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ +K L+ FRV+ GD+++ YKSF LT QV          V W LEYEK+S E+  P +
Sbjct  38   AVEPDKNLITFRVIDGDLMKEYKSFLLTIQVTPKQGGPGSIVHWHLEYEKISNEVAHPET  97

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  98   LLQFCVEVSKEIDEH  112



>ref|XP_006345291.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=146

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID  KK +  +V+ GD+L+ Y SF+      S+ +  ++TWT EYEK  E  PEPL++L
Sbjct  74   AIDSYKKSISRKVIGGDLLDFYSSFTFV----SSCEQQWITWTFEYEKKIESNPEPLNFL  129

Query  182  QTILDITKEMEDH  220
              IL++TK +E H
Sbjct  130  GFILNVTKNIEGH  142



>ref|XP_010427896.1| PREDICTED: MLP-like protein 43 [Camelina sativa]
Length=158

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A+D EK L+ F+V+ G +++ YKSF+ T QV          V W LEYEK+S E+  P +
Sbjct  79   AVDTEKNLITFKVIGGVLMKEYKSFAFTIQVTPKQGGPGSIVHWHLEYEKISNEVAHPET  138

Query  176  YLQTILDITKEMEDH  220
             LQ  +DI+K++++H
Sbjct  139  LLQFCVDISKDIDEH  153



>ref|XP_009607912.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like [Nicotiana 
tomentosiformis]
Length=155

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +2

Query  20   KLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQTILDI  199
            +LV F+  +G I+E YK+F  T  + +  +++ V WT+EYEK ++++ EP SYL+   ++
Sbjct  81   RLVTFKAFEGHIIEQYKAFKATVHIENEGENNLVLWTIEYEKQNDDVSEPFSYLEFATNL  140

Query  200  TKEMEDHHA  226
            TK+++ HH 
Sbjct  141  TKDVDAHHV  149



>ref|XP_002284527.1| PREDICTED: MLP-like protein 43 [Vitis vinifera]
 emb|CAN75773.1| hypothetical protein VITISV_033952 [Vitis vinifera]
 emb|CBI26885.3| unnamed protein product [Vitis vinifera]
Length=151

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            +ID+E + + F+V  G++L  YKS+  T Q     +   V WT+EYEK SE+ P+P  YL
Sbjct  75   SIDEENRSITFKVSDGEVLNDYKSYKFTTQAIPKGEGCLVKWTIEYEKASEDGPDPHDYL  134

Query  182  QTILDITKEMEDH  220
            +  + +TK++E H
Sbjct  135  EFAVTVTKDIESH  147



>ref|XP_010415773.1| PREDICTED: MLP-like protein 28 isoform X1 [Camelina sativa]
Length=320

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHF--VTWTLEYEKLSEEIPEPLS  175
            A++ +K L+ FRV+ GD+++ YKSF  T QV   D      V W LEYEK+SEE+  P +
Sbjct  241  AVEPDKNLITFRVIDGDLMKEYKSFVFTIQVTPKDGGSGSNVHWHLEYEKISEEVAHPET  300

Query  176  YLQTILDITKEMEDH  220
             LQ  ++I+KE+++H
Sbjct  301  LLQLCVEISKEIDEH  315


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ E  L+ FRV+ GD+++ Y SF  T QV          V W LEYEK+S+E+  P +
Sbjct  79   AVEPENNLITFRVLDGDLMKEYTSFVTTIQVTPKHGGPGSIVHWHLEYEKISDEVAHPET  138

Query  176  YLQTILDITKEMEDH  220
             LQ  ++I+KE+++H
Sbjct  139  LLQFCIEISKEIDEH  153



>ref|XP_010427894.1| PREDICTED: MLP-like protein 43 [Camelina sativa]
Length=158

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+KF+V++GD+++ YKSF +T QV          V W  EYEK++EE+  P +
Sbjct  79   AVEPEKNLIKFKVIEGDLMKEYKSFFVTIQVTPKHGGSGSVVHWLFEYEKINEEVAHPEN  138

Query  176  YLQTILDITKEMEDH  220
             LQ  + ++KE+++H
Sbjct  139  LLQFAVGMSKEIDEH  153



>ref|XP_004242814.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=159

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            +I++EKK++ F+  +GDI+  Y ++ ++  V    +   V+WT+EYE+ +E +PE  S L
Sbjct  75   SINEEKKIITFKEFEGDIVNEYDNWKVSLHVDEEGEKDLVSWTMEYERPNENVPELTSLL  134

Query  182  QTILDITKEMEDHHA  226
            Q  +D+TK ++DHH 
Sbjct  135  QFFIDMTKSIDDHHV  149



>ref|NP_849875.1| MLP-like protein 28 [Arabidopsis thaliana]
 sp|Q9SSK9.1|MLP28_ARATH RecName: Full=MLP-like protein 28 [Arabidopsis thaliana]
 gb|AAD55498.1|AC008148_8 Unknown protein [Arabidopsis thaliana]
 emb|CAC83581.1| major latex-like protein [Arabidopsis thaliana]
 gb|AAL49844.1| unknown protein [Arabidopsis thaliana]
 gb|AAM26677.1| At1g70830/F15H11_31 [Arabidopsis thaliana]
 gb|AAM67549.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18150.1| At1g70830/F15H11_31 [Arabidopsis thaliana]
 gb|AEE35122.1| MLP-like protein 28 [Arabidopsis thaliana]
Length=335

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ +K L+ FRV++GD+++ YKSF LT QV          V W LEYEK+SEE+  P +
Sbjct  94   AVEPDKNLITFRVIEGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYEKISEEVAHPET  153

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  154  LLQFCVEVSKEIDEH  168


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++  K L+ FRV+ GD+++ YKSF LT QV          V W LEYEK+SEE+  P +
Sbjct  256  AVEPNKNLITFRVIDGDLMKEYKSFLLTIQVTPKLGGPGSIVHWHLEYEKISEEVAHPET  315

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  316  LLQFCVEVSKEIDEH  330



>ref|XP_010471086.1| PREDICTED: MLP-like protein 34 [Camelina sativa]
Length=341

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV+ GD+++ YKSF LT QV          V W LEYEK++EE+  P +
Sbjct  262  AVEPEKNLITFRVIDGDLMKEYKSFLLTIQVTPKQGGPGSIVHWHLEYEKINEEVAHPET  321

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  322  LLQFCVEVSKEIDEH  336


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++G++++ YKSF LT QV          V W LEYEK+S E+  P +
Sbjct  95   AVEPEKNLITFRVIEGELMKEYKSFLLTIQVTPKQGGPGSIVHWHLEYEKISNEVAHPET  154

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  155  LLQFCVEVSKEIDEH  169



>gb|KDP32318.1| hypothetical protein JCGZ_13243 [Jatropha curcas]
Length=150

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 48/72 (67%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+      F+V+ GD+L+  KSF +T +  S      V WTLEYEKL++ IP+P S+LQ
Sbjct  75   IDNVNLSTTFKVIDGDLLKENKSFKITVKATSKGTGSVVHWTLEYEKLNKNIPDPQSFLQ  134

Query  185  TILDITKEMEDH  220
             +++++K+++ H
Sbjct  135  YLIEVSKDIDAH  146



>ref|XP_006367896.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=150

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = +2

Query  47   GDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQTILDITKEMEDHH  223
            GDILE YKSF +T  V +  +++ VTW +EYEK +  +P+P +Y+   L++TK++E HH
Sbjct  90   GDILEDYKSFYITTHVETKGENNLVTWIIEYEKKNANVPDPYTYMGFALNMTKDIETHH  148



>dbj|BAJ25787.1| putative PR-10 type pathogenesis-related protein [Nicotiana tabacum]
Length=147

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 51/77 (66%), Gaps = 8/77 (10%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSF--SLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLS  175
             IDDEKK   ++V+ GD+LE+Y  F  +++C      + H++TWTLEYEK +E+  EP++
Sbjct  75   VIDDEKKSNTWKVIGGDLLEAYNDFIVNISC------NQHWITWTLEYEKKTEDTSEPIT  128

Query  176  YLQTILDITKEMEDHHA  226
            +L     ++K++E HH 
Sbjct  129  FLGFFAYLSKDIEAHHV  145



>ref|XP_006390831.1| hypothetical protein EUTSA_v10019454mg [Eutrema salsugineum]
 gb|ESQ28117.1| hypothetical protein EUTSA_v10019454mg [Eutrema salsugineum]
Length=367

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF LT QV          V W LEYEK+S+E+  P +
Sbjct  79   AVEPEKNLITFRVIEGDLMKEYKSFLLTIQVTPKHGGPGSIVHWHLEYEKISDEVAHPET  138

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  139  LLQFCVEVSKEIDEH  153


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK ++ FRV++GD+L+ YKSF +T QV          V W +EYEK+ E++  P +
Sbjct  288  AVEPEKNMITFRVIEGDLLKEYKSFVITIQVTPKQGGPGSTVHWHVEYEKIDEKVAHPET  347

Query  176  YLQTILDITKEMEDH  220
            +L+  + ++KE+++H
Sbjct  348  FLEFCVQVSKEIDEH  362



>ref|XP_009759247.1| PREDICTED: kirola-like [Nicotiana sylvestris]
 dbj|BAJ25785.1| putative PR-10 type pathogenesis-related protein [Nicotiana tabacum]
Length=146

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D EKK + ++V+ GD+LE Y SF++     ++ D  + TWT  YEK +EE PEPL  L
Sbjct  75   AVDHEKKSITWKVIGGDLLELYNSFTII----TSHDHQWTTWTFVYEKKTEETPEPLVLL  130

Query  182  QTILDITKEMEDH  220
               L +TK++E H
Sbjct  131  AYALHVTKDVESH  143



>emb|CDY23474.1| BnaC06g24430D [Brassica napus]
Length=163

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 51/75 (68%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF +T QV          V W LEYEK+S+E+  P +
Sbjct  84   AVEPEKNLITFRVIEGDLMKEYKSFLITIQVTPKHGGPGSIVHWHLEYEKISDEVAHPET  143

Query  176  YLQTILDITKEMEDH  220
             LQ  +++++E+++H
Sbjct  144  LLQFCVEVSEEIDEH  158



>ref|XP_002315876.1| Csf-2 family protein [Populus trichocarpa]
 gb|EEF02047.1| Csf-2 family protein [Populus trichocarpa]
Length=158

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVT-WTLEYEKLSEEIPEPLSY  178
            AIDDEK    F+V++GDI   YK+F +  Q     +   +  WT EYEKL+E +P+P + 
Sbjct  75   AIDDEKLSTTFKVIEGDITTEYKNFIIIVQATPKGEGSCLAHWTFEYEKLNENVPDPQTL  134

Query  179  LQTILDITKEMEDHH  223
            L+  +  +K++EDHH
Sbjct  135  LEFCIHCSKDIEDHH  149



>ref|XP_004246324.1| PREDICTED: MLP-like protein 31 [Solanum lycopersicum]
Length=150

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
             +D EKK++ F+  +GD++  Y +F  T  + + D+   V+WT+EYE+ +E +PE ++ L
Sbjct  75   TVDHEKKVITFKEFEGDLVNKYDNFKATLHIETKDEIDLVSWTIEYERPNENVPELVNLL  134

Query  182  QTILDITKEMEDHHA  226
              I+ +TK ++DHH 
Sbjct  135  DFIIGMTKAIDDHHV  149



>gb|AFV29675.1| major latex-like protein, partial [Senecio aethnensis]
Length=76

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 49/65 (75%), Gaps = 0/65 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            +ID+E K V F+V++G+++E YKSF +T  V +  +++ VTWT+ YEKL++ + +P +++
Sbjct  12   SIDEENKTVHFKVIEGNLMELYKSFLITVHVDTKGEENLVTWTVTYEKLNDNVEDPHTFM  71

Query  182  QTILD  196
            + ++D
Sbjct  72   EFLVD  76



>ref|XP_010676168.1| PREDICTED: MLP-like protein 31 [Beta vulgaris subsp. vulgaris]
Length=151

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AI++E KLV+F++++G IL+ YKSF+ T QV    +   V WT+E+EK  +  P P   +
Sbjct  75   AIEEENKLVRFKMIEGSILKEYKSFTTTLQVVDKAEITAVKWTVEFEKFDDYGPYPNKIM  134

Query  182  QTILDITKEMEDHH  223
              I+ IT+++E HH
Sbjct  135  DFIIAITRDIEAHH  148



>ref|XP_010427877.1| PREDICTED: MLP-like protein 34 [Camelina sativa]
Length=336

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV+ GD+++ YKSF LT QV          V W LEYEK+S E+  P +
Sbjct  257  AVEPEKNLITFRVIDGDLMKEYKSFLLTIQVTPKQGGPGSIVHWHLEYEKISNEVAHPET  316

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  317  LLQFCVEVSKEIDEH  331


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++G++++ YKSF LT QV          V W LEYEK+S E+  P +
Sbjct  95   AVEPEKNLITFRVIEGELMKEYKSFLLTIQVTPKQGGPGSIVHWHLEYEKISNEVAHPET  154

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  155  LLQFCVEVSKEIDEH  169



>ref|XP_006361655.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=153

 Score = 64.7 bits (156),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EKK++ F+  +GDI+  Y+ + ++  V        V WT+EYE+ +E +PE  + L
Sbjct  75   AIDEEKKIITFKEFEGDIVNEYEKWKVSLHVDEEGVKDLVGWTMEYERPNENVPELTNLL  134

Query  182  QTILDITKEMEDHHA  226
            Q  +D+TK ++DHH 
Sbjct  135  QFFIDMTKSIDDHHV  149



>ref|XP_006367980.1| PREDICTED: MLP-like protein 28-like [Solanum tuberosum]
Length=153

 Score = 64.3 bits (155),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EKK++ F+  +GDI+  Y+ + ++  V        V WT+EYE+ +E +PE  + L
Sbjct  75   AIDEEKKIITFKEFEGDIVNEYEKWKVSLHVDEEGVKDLVGWTMEYERPNENVPELTNLL  134

Query  182  QTILDITKEMEDHHA  226
            Q  +D+TK ++DHH 
Sbjct  135  QFFIDMTKSIDDHHV  149



>ref|XP_009616726.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like [Nicotiana 
tomentosiformis]
Length=146

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 49/73 (67%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D +KK + ++V+ GD+LE Y SF++T    ++ D  + TWT  YEK +E+ P+PL  L
Sbjct  75   AVDHQKKSITWKVIGGDLLELYNSFTIT----TSHDHQWTTWTFVYEKKTEDTPDPLVLL  130

Query  182  QTILDITKEMEDH  220
              +L +TK++E H
Sbjct  131  GFVLHLTKDIEGH  143



>ref|NP_565003.3| MLP-like protein 34 [Arabidopsis thaliana]
 gb|AEE35128.1| MLP-like protein 34 [Arabidopsis thaliana]
Length=236

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 52/76 (68%), Gaps = 4/76 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV---HSNDDDHFVTWTLEYEKLSEEIPEPL  172
            A++ EK L+ FRV++GD+++ YKSF +T QV   H       V W LEYEK+S+E+  P 
Sbjct  81   AVEPEKNLITFRVIEGDLMKEYKSFLITIQVTPKHGGPGS-IVHWHLEYEKISDEVAHPE  139

Query  173  SYLQTILDITKEMEDH  220
            + LQ  +++++E+++H
Sbjct  140  TLLQFCVEVSQEIDEH  155



>ref|XP_007223651.1| hypothetical protein PRUPE_ppa012742mg [Prunus persica]
 ref|XP_008243382.1| PREDICTED: MLP-like protein 31 [Prunus mume]
 gb|AAK14060.1|AF239177_1 major latex-like protein [Prunus persica]
 gb|EMJ24850.1| hypothetical protein PRUPE_ppa012742mg [Prunus persica]
Length=156

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 51/77 (66%), Gaps = 6/77 (8%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDH----FVTWTLEYEKLSEEIPEP  169
            AID EK L+ F+V++GD+LE YKSF +T  +H+    H     V WT+EYEK   +I +P
Sbjct  76   AIDAEKNLITFKVIEGDLLEHYKSFKIT--IHATPKAHGQGSIVHWTMEYEKHHGDIEDP  133

Query  170  LSYLQTILDITKEMEDH  220
             + LQ  +D++K+++ H
Sbjct  134  HTLLQFAVDVSKDVDAH  150



>ref|XP_002888797.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65056.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata]
Length=335

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV+ GD+++ YKSF LT QV          V W LEYEK+S+E+  P +
Sbjct  94   AVEPEKNLITFRVIDGDLMKEYKSFLLTIQVTPKPGGPGSIVHWHLEYEKISDEVAHPET  153

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  154  LLQFCVEVSKEIDEH  168


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDD--HFVTWTLEYEKLSEEIPEPLS  175
            A++ +K L+ FRV+ GD+++ YKSF +T QV          V W LEYEK+SEE+  P +
Sbjct  256  AVEPDKNLITFRVIDGDLMKEYKSFVITIQVTPKHGGLGSIVHWHLEYEKISEEVAHPET  315

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  316  LLQFCVEVSKEIDEH  330



>ref|XP_010415772.1| PREDICTED: MLP-like protein 34 [Camelina sativa]
Length=498

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV+ GD+++ YKSF LT QV          V W LE+EK+SEE+  P +
Sbjct  419  AVEPEKNLITFRVIDGDLMKEYKSFLLTIQVTPKQGGPGSIVHWHLEFEKISEEVAHPET  478

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  479  LLQFCVEVSKEIDEH  493


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV+ GD+++ YKSF LT QV          V W LEYEK+S E+  P +
Sbjct  257  AVEPEKNLITFRVIDGDLMKEYKSFLLTIQVTPKQGGPGSIVHWHLEYEKISNEVAHPET  316

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  317  LLQFCVEVSKEIDEH  331


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++G++++ YKSF LT QV          V W LEYEK+S E+  P +
Sbjct  95   AVEPEKNLITFRVIEGELMKEYKSFLLTIQVTPKQGGPGSIVHWHLEYEKISNEVAHPET  154

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  155  LLQFCVEVSKEIDEH  169



>ref|XP_006367813.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=146

 Score = 64.3 bits (155),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D E K + ++V+ GD+LE Y SF++     S+ D  + TWT  YEK +E+ PEPL +L
Sbjct  75   AVDHETKTITWKVIGGDLLELYDSFTII----SSCDHLWTTWTFLYEKKTEDTPEPLVFL  130

Query  182  QTILDITKEMEDH  220
              +  +TKE+E+H
Sbjct  131  AFVFHVTKEIENH  143



>emb|CBI26888.3| unnamed protein product [Vitis vinifera]
Length=94

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 44/71 (62%), Gaps = 0/71 (0%)
 Frame = +2

Query  8    DDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQT  187
            D+E + + F+V+ G++L  YKS+  T Q     +   V WT EYEK SE+  +P  YL+ 
Sbjct  20   DEENRSITFKVLDGELLNDYKSYKFTTQAIPKGEGCLVKWTAEYEKASEDGSDPRGYLEL  79

Query  188  ILDITKEMEDH  220
             ++ITK++E H
Sbjct  80   AVNITKDIESH  90



>ref|XP_010688214.1| PREDICTED: MLP-like protein 34 [Beta vulgaris subsp. vulgaris]
Length=155

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFV-TWTLEYEKLSEEIPEPLSYL  181
            ID+EKK V++RV++GD+L+ YK+ +    V   D+   + TWTL+YEK    IPEP   L
Sbjct  77   IDEEKKYVRYRVIEGDLLDEYKTLTGEFHVIPKDEKTSIGTWTLKYEKQHPGIPEPSELL  136

Query  182  QTILDITKEMEDHH  223
             + L  TK+++DHH
Sbjct  137  DSWLAATKDLDDHH  150



>ref|XP_006355753.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=121

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 4/73 (5%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+EKK + F+ + G  +E YK+ S T     N    ++TWT EYEK +E+IPEPL  L 
Sbjct  50   IDEEKKRITFKFIDGYFMELYKTLSTTLDAEEN----WITWTFEYEKQNEDIPEPLILLG  105

Query  185  TILDITKEMEDHH  223
              +D+ K+++ HH
Sbjct  106  IGIDLIKDIDSHH  118



>ref|XP_007226386.1| hypothetical protein PRUPE_ppa023240mg, partial [Prunus persica]
 gb|EMJ27585.1| hypothetical protein PRUPE_ppa023240mg, partial [Prunus persica]
Length=123

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            AID EK L+ F+V++GD+LE YKSF +T      ++     V WT+EYEK   +I +P +
Sbjct  47   AIDAEKNLITFKVIEGDLLEHYKSFKMTFHATPKAHGQGSIVHWTMEYEKHHGDIEDPHT  106

Query  176  YLQTILDITKEMEDH  220
             LQ  +D++K+++ H
Sbjct  107  LLQFAVDVSKDVDAH  121



>ref|XP_010684158.1| PREDICTED: MLP-like protein 43 [Beta vulgaris subsp. vulgaris]
Length=181

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDD-HFVTWTLEYEKLSEEIPEPLSYL  181
            ID+E K++KF++++GD++E Y +F LT  V     +   V W  EYEK    +PEP S +
Sbjct  103  IDEENKIIKFKMLEGDLMEDYNTFVLTYHVIPEGKEISLVKWIFEYEKKHPGVPEPSSLM  162

Query  182  QTILDITKEMEDHH  223
              +L + KE++DHH
Sbjct  163  DALLGLAKEIDDHH  176



>ref|XP_009758199.1| PREDICTED: MLP-like protein 43 [Nicotiana sylvestris]
Length=147

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 48/74 (65%), Gaps = 4/74 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EK+ + F+ ++GD++E YK+ S T          ++ W+ EYEK +E+IPEP + L
Sbjct  75   AIDEEKQKITFKFIEGDLMELYKALSATLAAEGK----WIEWSFEYEKQNEDIPEPFTLL  130

Query  182  QTILDITKEMEDHH  223
               +D+ K+++ HH
Sbjct  131  GLAIDLIKDIDSHH  144



>ref|XP_002874413.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50672.1| bet v I allergen family protein [Arabidopsis lyrata subsp. lyrata]
Length=164

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 48/74 (65%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDD--DHFVTWTLEYEKLSEEIPEPLSY  178
            ++ EKKL+KFRV++GD++  YKSF +T QV   +      V W LEYEK+ E +  P + 
Sbjct  86   VEPEKKLIKFRVIEGDVMAEYKSFLITIQVTPKEGGVGSVVKWHLEYEKIDENVAHPENL  145

Query  179  LQTILDITKEMEDH  220
            L    ++T+E+++H
Sbjct  146  LPFFAEMTREIDEH  159



>ref|XP_010314987.1| PREDICTED: kirola-like isoform X2 [Solanum lycopersicum]
Length=88

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID E K +  +++ GD+LE Y SF+      S+ D  + TWT  Y+K +EE PEPL+ L
Sbjct  17   AIDPESKSITSKIIGGDMLELYDSFTFI----SSSDQQWATWTFLYKKKTEETPEPLALL  72

Query  182  QTILDITKEMEDH  220
              ++ +TK++E+H
Sbjct  73   GFLIGVTKDIENH  85



>ref|XP_009105750.1| PREDICTED: MLP-like protein 43 [Brassica rapa]
Length=208

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 48/74 (65%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLSY  178
            +D EK L+ FRV++GD+++ YKSF  T QV          V W  EYEK+SEE+  P + 
Sbjct  130  VDPEKNLISFRVIEGDLMKEYKSFLATIQVTPKHGGTGSIVHWHFEYEKISEEVAHPETL  189

Query  179  LQTILDITKEMEDH  220
            LQ  ++++KE+++H
Sbjct  190  LQLWVEMSKEIDEH  203



>gb|KFK41512.1| hypothetical protein AALP_AA2G139300 [Arabis alpina]
Length=171

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+L+ YKSF +T QV          V W +EYEK+ E++  P +
Sbjct  92   AVEPEKNLITFRVIEGDLLKEYKSFVITIQVTPKHGGSGSVVHWHVEYEKIDEKVAHPET  151

Query  176  YLQTILDITKEMEDH  220
            +LQ  + ++K++++H
Sbjct  152  FLQFCVHVSKDLDEH  166



>ref|XP_006300911.1| hypothetical protein CARUB_v10021281mg [Capsella rubella]
 gb|EOA33809.1| hypothetical protein CARUB_v10021281mg [Capsella rubella]
Length=160

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 48/75 (64%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ F+V+ GD+++ YKSF LT QV          V W LEYEK+S+E+  P +
Sbjct  81   AVEPEKNLITFKVIDGDLMKEYKSFLLTIQVTPKQGGSGSIVHWHLEYEKISDEVAHPET  140

Query  176  YLQTILDITKEMEDH  220
             LQ  +D++ +++ H
Sbjct  141  LLQFCIDVSNQIDAH  155



>ref|XP_006354582.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=152

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
             ID EKK++ F+  +GD+++ Y +F  T  + +  +   ++WT+EYE+ +E +PE +++L
Sbjct  75   TIDHEKKVLTFKEFEGDVVDIYDNFKSTLHIETKGEIDLISWTIEYERPNENVPELVNFL  134

Query  182  QTILDITKEMEDHHA  226
              I+ ITK ++DHH 
Sbjct  135  DFIVGITKAVDDHHV  149



>ref|XP_006469191.1| PREDICTED: MLP-like protein 28-like isoform X2 [Citrus sinensis]
Length=125

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +2

Query  35   RVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQTILDITKEM  211
            R   G++L+ YKSF    QV    +  FVTWTL+YEK +E +PEP + LQ  +D+TK++
Sbjct  59   RYANGNLLDQYKSFCCFFQVTPKGEGSFVTWTLKYEKPNENVPEPAAMLQLCVDVTKDV  117



>emb|CDX91696.1| BnaC08g06150D [Brassica napus]
Length=157

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
             ++ EKK+VKFRV++GD++E +KSF +T QV      +   V W  EYEK+ E I  P +
Sbjct  78   VVEPEKKIVKFRVLEGDLMEEFKSFVITIQVTPKQGGNGSIVKWHFEYEKIDENISHPET  137

Query  176  YLQTILDITKEMEDH  220
             L    D+ KE+++H
Sbjct  138  LLPFFADMIKEIDEH  152



>gb|EPS71115.1| hypothetical protein M569_03645, partial [Genlisea aurea]
Length=145

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            +DD+KKL+  R++ GD+L+ YK F  T  V S D    VTWT EYE L++E+  P + ++
Sbjct  76   VDDDKKLISLRIIGGDLLDEYKEFVATFHVESEDGKDLVTWTFEYETLNDEVGPPFTLIR  135

Query  185  TILDITKEME  214
                +  ++E
Sbjct  136  LAFRMIADVE  145



>gb|KDP32317.1| hypothetical protein JCGZ_13242 [Jatropha curcas]
Length=151

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+      F+V+ GD+L+  KSF +T +         V WTLEYEKL++ IP+P S+LQ
Sbjct  76   IDNVNLSTTFKVIDGDLLKENKSFKITVKATPKGTGSVVPWTLEYEKLNKNIPDPHSFLQ  135

Query  185  TILDITKEMEDH  220
             +++++K+++ H
Sbjct  136  FLIEVSKDIDAH  147



>ref|XP_002323752.1| major latex protein homologue [Populus trichocarpa]
 gb|ABK94022.1| unknown [Populus trichocarpa]
 gb|EEF03885.1| major latex protein homologue [Populus trichocarpa]
Length=153

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+ K    F V++GD++ +YKSF    Q         V WT+ YEKLSE IP P +++ 
Sbjct  76   IDNTKLSTTFNVIEGDLMGAYKSFKAIVQATPKGHGSVVRWTMIYEKLSENIPAPTAFVD  135

Query  185  TILDITKEMEDH  220
              +D+TK++  H
Sbjct  136  FAVDLTKDINAH  147



>emb|CDP00799.1| unnamed protein product [Coffea canephora]
Length=154

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 50/74 (68%), Gaps = 1/74 (1%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHS-NDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            I++EKK + F++++GD++E YK+F++   V    D +  +TWTL+YEKL E+ P P + L
Sbjct  77   INEEKKSIVFKMIEGDLMELYKTFTIIYHVDVLGDKESLITWTLDYEKLKEDTPHPGTLL  136

Query  182  QTILDITKEMEDHH  223
               L + +++E HH
Sbjct  137  NFFLHMVEDIESHH  150



>ref|XP_006302942.1| hypothetical protein CARUB_v10021082mg [Capsella rubella]
 gb|EOA35840.1| hypothetical protein CARUB_v10021082mg [Capsella rubella]
Length=158

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L++FRV++GD+++ Y +F +T QV          V W  EYEK++EE+  P +
Sbjct  79   AVEPEKNLIRFRVIEGDLMKEYNNFVITIQVTPKHGGSGSVVHWHFEYEKINEEVAHPEN  138

Query  176  YLQTILDITKEMEDH  220
             LQ  + ++KE+++H
Sbjct  139  LLQFAVGMSKEIDEH  153



>gb|KDO64615.1| hypothetical protein CISIN_1g031759mg [Citrus sinensis]
Length=125

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +2

Query  35   RVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQTILDITKEM  211
            R   G++L+ YKSF    QV    +  FVTWTL+YEK +E +PEP + LQ  +D+TK++
Sbjct  59   RYANGNLLDQYKSFCCFFQVTPKGEGSFVTWTLKYEKPNENVPEPAAMLQLCVDVTKDV  117



>ref|NP_001268151.1| ripening-related protein-like [Vitis vinifera]
 emb|CAB85634.1| putative ripening-related protein [Vitis vinifera]
Length=151

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+E + + F+V+ G++L+ YKS+  T Q     +   V WT+EYEK SE  P+P + L+
Sbjct  76   IDEENRSITFKVLDGEVLKDYKSYKFTTQAIPKGEGCLVIWTIEYEKASEGGPDPHNCLE  135

Query  185  TILDITKEMEDH  220
              ++ITK++E H
Sbjct  136  FSVNITKDIESH  147



>ref|XP_010427880.1| PREDICTED: MLP-like protein 43 isoform X2 [Camelina sativa]
Length=290

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHF--VTWTLEYEKLSEEIPEPLS  175
            A++ +K L+ FRV+ GD++  YKSF  T QV   D      V W LEYEK+SEE+  P +
Sbjct  211  AVEPDKNLITFRVIDGDLMTEYKSFVCTIQVTPKDGGSGSNVHWHLEYEKISEEVAHPET  270

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  271  LLQFCVEVSKEIDEH  285


 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ E  L+ FRV+ GD+++ Y SF  T QV          V W LEYEK+S+E+  P +
Sbjct  49   AVEPENNLITFRVLDGDLMKEYTSFVTTIQVTPKHGGPGSIVHWHLEYEKISDEVAHPET  108

Query  176  YLQTILDITKEMEDH  220
             LQ  ++I+KE+++H
Sbjct  109  LLQFCIEISKEIDEH  123



>emb|CDY00801.1| BnaCnng00010D [Brassica napus]
Length=177

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLSY  178
            +D E  L+ FRV++GD+L+ YKSF  T QV          V W  EYEK+SEE+  P + 
Sbjct  99   VDPETNLISFRVIEGDLLKEYKSFLATIQVAPKHGGTGSIVHWHFEYEKISEEVAHPETL  158

Query  179  LQTILDITKEMEDH  220
            LQ  ++++KE+++H
Sbjct  159  LQLWVEMSKEIDEH  172



>ref|XP_004237018.1| PREDICTED: kirola [Solanum lycopersicum]
Length=146

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID E K + ++++ GD+LE Y SF++     ++ D  + TWT  YEK +E+IPEPL  L
Sbjct  75   AIDHETKTITWKLIGGDLLELYNSFTII----TSCDHEWTTWTFLYEKKTEDIPEPLVLL  130

Query  182  QTILDITKEMEDH  220
              +L +TK++E H
Sbjct  131  GFVLHVTKDIEGH  143



>ref|XP_010471088.1| PREDICTED: MLP-like protein 28 isoform X2 [Camelina sativa]
Length=288

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHF--VTWTLEYEKLSEEIPEPLS  175
            A++ +K L+ FRV+ GD+++ YK+F  T QV   D      V W LEYEK+SEE+  P +
Sbjct  209  ALEPDKNLITFRVIDGDLMKEYKTFVFTIQVTPKDGGSGSNVHWHLEYEKISEEVAHPET  268

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  269  LLQLCVEVSKEIDEH  283


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ E  L+ FRV+ GD+++ Y SF +T QV          V W LEYEK+ +E+  P +
Sbjct  47   AVEPENNLITFRVLDGDLMKEYTSFVITIQVTPKHGGPGSIVHWHLEYEKICDEVAHPET  106

Query  176  YLQTILDITKEMEDH  220
             LQ  ++I+KE+++H
Sbjct  107  LLQFCIEISKEIDEH  121



>emb|CAN83049.1| hypothetical protein VITISV_030287 [Vitis vinifera]
 emb|CBI26886.3| unnamed protein product [Vitis vinifera]
Length=151

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+E + + F+V+ G++L+ YKS+  T Q     +   V WT+EYEK SE  P+P + L+
Sbjct  76   IDEENRSITFKVLDGEVLKDYKSYKFTTQAIPKGEGCLVIWTIEYEKASEGGPDPHNCLE  135

Query  185  TILDITKEMEDH  220
              ++ITK++E H
Sbjct  136  FSVNITKDIESH  147



>ref|XP_009767588.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=146

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 48/73 (66%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D +KK + ++V+ GD+LE Y SF++     S+ D  + TWT  YEK +E+ P+PL +L
Sbjct  75   AVDHQKKSITWKVIGGDLLELYNSFTMI----SSHDHQWTTWTFVYEKKTEDTPDPLVFL  130

Query  182  QTILDITKEMEDH  220
               L +T+++E H
Sbjct  131  GYALRVTRDIEGH  143



>ref|XP_004246759.2| PREDICTED: MLP-like protein 34 [Solanum lycopersicum]
Length=302

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            +D E K++  +  +GDI++ Y SF  T  + + D+   +TWTLEYE+ +E +PE +S L 
Sbjct  76   VDHENKVLVLKEFEGDIIDKYDSFKATLHIETKDEIDLITWTLEYERPNETVPELISLLD  135

Query  185  TILDITKEMEDHHA  226
             ++ +TK ++DHHA
Sbjct  136  FVVGMTKGIDDHHA  149


 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
             ID E K++  +  +GD+ + Y SF     + +  +   V WTLEYE+ +E +PE ++ L
Sbjct  227  TIDYENKVLTLKEFEGDVTDIYDSFKAILHIETKGEIDLVCWTLEYERPNENVPELINVL  286

Query  182  QTILDITKEMEDHHA  226
              ++ +TK ++DHHA
Sbjct  287  NFVVGMTKAIDDHHA  301



>ref|XP_004140475.1| PREDICTED: MLP-like protein 28-like [Cucumis sativus]
 ref|XP_004161192.1| PREDICTED: MLP-like protein 28-like [Cucumis sativus]
Length=152

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D+E  L+ F+V+ GD+L+ YK+F+ T Q         + WT+EYEKL E++ +  S L
Sbjct  75   AVDEENNLISFKVIDGDLLKDYKTFNYTIQAVPKGKGSVIHWTMEYEKLHEKVADSHSML  134

Query  182  QTILDITKEMEDH  220
            Q  L I+K+++ H
Sbjct  135  QFCLAISKDIDVH  147



>ref|XP_004246323.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=152

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
             ID+EKK++ F+  +GD++ +Y ++  T  + +  +   V+WT+EYE+ +E +PE ++ L
Sbjct  75   CIDEEKKVITFKEFEGDLVNTYDNWKATLHIETKGEVDLVSWTMEYERPNENVPELINLL  134

Query  182  QTILDITKEMEDHHA  226
              I+ +TK ++DHH 
Sbjct  135  DFIIGMTKAVDDHHV  149



>ref|XP_009759779.1| PREDICTED: kirola-like [Nicotiana sylvestris]
 gb|AAB23378.1| orf [Nicotiana tabacum]
Length=146

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 44/73 (60%), Gaps = 4/73 (5%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            IDD KK + F  V+GD+ E YKS + T     N    ++TWT  YEKL+E IPEPL   +
Sbjct  75   IDDAKKSITFNFVEGDMNELYKSMTATLTAEGN----WMTWTFVYEKLNENIPEPLDIFE  130

Query  185  TILDITKEMEDHH  223
              + + K++E HH
Sbjct  131  LAICLLKDLEPHH  143



>gb|KFK44401.1| hypothetical protein AALP_AA1G252600 [Arabis alpina]
Length=161

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDH--FVTWTLEYEKLSEEIPEPLSY  178
            ++ EKKL+KFRV++GD+++ YKSF +T QV      H   V W  EYEK  E +  P + 
Sbjct  83   VEPEKKLIKFRVLEGDLMKEYKSFVITIQVTPKQGGHGSIVRWHFEYEKTDENVAHPETL  142

Query  179  LQTILDITKEMEDH  220
            L    ++ KE+++H
Sbjct  143  LPFFAEMVKEIDEH  156



>ref|XP_006355259.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=146

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 4/74 (5%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            IDDE+K + F   +G + E YKS +LT     N     +TWTL YEKL+E  PEPL +++
Sbjct  75   IDDEEKTITFNFNEGFMNEIYKSMTLTLTAEEN----LITWTLVYEKLNENTPEPLDFME  130

Query  185  TILDITKEMEDHHA  226
             ++ + K++E HH 
Sbjct  131  FLVGLIKDLETHHV  144



>ref|XP_009783369.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=146

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D + K + ++V+ GD+LE Y SF++     S+ D  + TWT  YEK +E  PEPL +L
Sbjct  75   AVDHQNKSITWKVIGGDLLELYNSFTMI----SSHDHQWTTWTFVYEKKTENTPEPLVFL  130

Query  182  QTILDITKEMEDH  220
               L +T+++E H
Sbjct  131  GYALHVTRDIEGH  143



>ref|XP_010427878.1| PREDICTED: MLP-like protein 34 isoform X1 [Camelina sativa]
Length=320

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHF--VTWTLEYEKLSEEIPEPLS  175
            A++ +K L+ FRV+ GD++  YKSF  T QV   D      V W LEYEK+SEE+  P +
Sbjct  241  AVEPDKNLITFRVIDGDLMTEYKSFVCTIQVTPKDGGSGSNVHWHLEYEKISEEVAHPET  300

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  301  LLQFCVEVSKEIDEH  315


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ E  L+ FRV+ GD+++ Y SF  T QV          V W LEYEK+S+E+  P +
Sbjct  79   AVEPENNLITFRVLDGDLMKEYTSFVTTIQVTPKHGGPGSIVHWHLEYEKISDEVAHPET  138

Query  176  YLQTILDITKEMEDH  220
             LQ  ++I+KE+++H
Sbjct  139  LLQFCIEISKEIDEH  153



>ref|XP_011043108.1| PREDICTED: MLP-like protein 31 [Populus euphratica]
Length=154

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            ID+ +    F+V++GD++E+YKSF +  Q         V WTL +EKL+E IP P ++L 
Sbjct  77   IDNTELSTTFKVIEGDLMEAYKSFKVIVQATPKGHGSVVHWTLIFEKLNENIPAPTAFLD  136

Query  185  TILDITKEMEDH  220
              +D TK++  H
Sbjct  137  KTVDFTKDINAH  148



>gb|AAP34364.1| putative major latex-like protein [Gossypium barbadense]
Length=129

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDH--FVTWTLEYEKLSEEIPEPLSY  178
            +D EKK + F++++GD++E YKSF +T Q     D     V WTL+YEKL E I  P S 
Sbjct  51   MDHEKKSITFKMLEGDLMEEYKSFVITIQTSPKSDGKGSIVHWTLDYEKLHEGIGHPESL  110

Query  179  LQTILDITKEMEDH  220
            LQ  +++T +M  H
Sbjct  111  LQFFIELTADMAAH  124



>ref|XP_006355289.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=146

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 47/74 (64%), Gaps = 4/74 (5%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            IDD +K + +  ++G + E Y S  LT  V  N    ++TWT+ YEKL+E IPEPL +++
Sbjct  75   IDDAEKSITYHFIEGHMNELYNSMKLTLTVKEN----WLTWTIMYEKLNENIPEPLDFME  130

Query  185  TILDITKEMEDHHA  226
             I+ +TK++  HH 
Sbjct  131  FIIGLTKDIATHHV  144



>ref|XP_010471087.1| PREDICTED: MLP-like protein 34 isoform X1 [Camelina sativa]
Length=320

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHF--VTWTLEYEKLSEEIPEPLS  175
            A++ +K L+ FRV+ GD+++ YK+F  T QV   D      V W LEYEK+SEE+  P +
Sbjct  241  ALEPDKNLITFRVIDGDLMKEYKTFVFTIQVTPKDGGSGSNVHWHLEYEKISEEVAHPET  300

Query  176  YLQTILDITKEMEDH  220
             LQ  ++++KE+++H
Sbjct  301  LLQLCVEVSKEIDEH  315


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ E  L+ FRV+ GD+++ Y SF +T QV          V W LEYEK+ +E+  P +
Sbjct  79   AVEPENNLITFRVLDGDLMKEYTSFVITIQVTPKHGGPGSIVHWHLEYEKICDEVAHPET  138

Query  176  YLQTILDITKEMEDH  220
             LQ  ++I+KE+++H
Sbjct  139  LLQFCIEISKEIDEH  153



>ref|XP_010317813.1| PREDICTED: kirola-like isoform X2 [Solanum lycopersicum]
Length=137

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 8/75 (11%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSL--TCQVHSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            AID     +  +V+ GD+LE Y+SF+   +CQ      + + TWT+EYEK  E+ PEPL 
Sbjct  65   AIDHHTNSISRKVIDGDLLELYQSFTFVSSCQ------NQWATWTIEYEKKIEDTPEPLI  118

Query  176  YLQTILDITKEMEDH  220
            +L  ILD+TK++E H
Sbjct  119  FLDFILDMTKDIESH  133



>ref|XP_004234684.1| PREDICTED: kirola-like isoform X1 [Solanum lycopersicum]
Length=147

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 48/75 (64%), Gaps = 8/75 (11%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSL--TCQVHSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            AID     +  +V+ GD+LE Y+SF+   +CQ      + + TWT+EYEK  E+ PEPL 
Sbjct  75   AIDHHTNSISRKVIDGDLLELYQSFTFVSSCQ------NQWATWTIEYEKKIEDTPEPLI  128

Query  176  YLQTILDITKEMEDH  220
            +L  ILD+TK++E H
Sbjct  129  FLDFILDMTKDIESH  143



>ref|XP_004253390.1| PREDICTED: kirola-like isoform X1 [Solanum lycopersicum]
Length=146

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID E K +  +++ GD+LE Y SF+      S+ D  + TWT  Y+K +EE PEPL+ L
Sbjct  75   AIDPESKSITSKIIGGDMLELYDSFTFI----SSSDQQWATWTFLYKKKTEETPEPLALL  130

Query  182  QTILDITKEMEDH  220
              ++ +TK++E+H
Sbjct  131  GFLIGVTKDIENH  143



>ref|XP_002280830.1| PREDICTED: MLP-like protein 28 [Vitis vinifera]
 emb|CBI26889.3| unnamed protein product [Vitis vinifera]
Length=150

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+EK  + F ++ G++   YKSF  T +  S    + V W+LEYEK +E +P P S+L
Sbjct  74   AIDEEKGSMTFDLIGGEVTNYYKSFKATIEATSEAHTNLVKWSLEYEKANETVPSPESHL  133

Query  182  QTILDITKEMEDH  220
              +LD++KE++ +
Sbjct  134  AFLLDVSKEVDAY  146



>ref|XP_010092945.1| MLP-like protein 28 [Morus notabilis]
 gb|EXB52998.1| MLP-like protein 28 [Morus notabilis]
Length=308

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLS  175
            A+DDEK  + FRV++GD++E + SF +T Q +     +   V WTLEYEK   EI +P +
Sbjct  229  AVDDEKNSITFRVIEGDLMEHFNSFVVTIQANPKVGGEGSIVHWTLEYEKKHGEIVDPHT  288

Query  176  YLQTILDITKEMEDH  220
             L+ + D++K++E H
Sbjct  289  LLEFVADVSKDLETH  303


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 47/75 (63%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHS--NDDDHFVTWTLEYEKLSEEIPEPLS  175
            AID++K  + FR+++GD++E + SF +T Q +         + W LEYEK   EI +P +
Sbjct  77   AIDEKKNSITFRMLEGDLMEHFTSFVITIQGNPKIGGKGSIIHWHLEYEKKHGEIVDPHT  136

Query  176  YLQTILDITKEMEDH  220
             ++  ++++K++E H
Sbjct  137  LVEFFVELSKDLETH  151



>ref|XP_011038620.1| PREDICTED: MLP-like protein 43 [Populus euphratica]
Length=158

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVT-WTLEYEKLSEEIPEPLSY  178
            AIDDEK    ++V++GDI   YK+F +  Q     +   +  WT EYEKL+E +P+P + 
Sbjct  75   AIDDEKLSTTYKVIEGDITTEYKNFIVIVQATPKGEGSCLAHWTFEYEKLNENVPDPQTL  134

Query  179  LQTILDITKEMEDHH  223
            L+  +  +K++EDHH
Sbjct  135  LEFCIHCSKDIEDHH  149



>ref|XP_004244869.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=148

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 50/74 (68%), Gaps = 2/74 (3%)
 Frame = +2

Query  5    IDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYLQ  184
            IDDE+K + F   +G + E YKS +LT  + +  + +F+TWTL YEKL+E  PEPL +++
Sbjct  75   IDDEEKSITFNFKEGYMNELYKSMTLTLTLIA--EKNFITWTLVYEKLNENTPEPLDFIE  132

Query  185  TILDITKEMEDHHA  226
             ++ + K++E HH 
Sbjct  133  FLIYLIKDLETHHV  146



>ref|XP_006365611.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=117

 Score = 62.0 bits (149),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            A+D E K++  +  +GDI  +Y S   T  + + D+   V+WTL+YE+ +E +PE +S L
Sbjct  42   AVDHENKMLILKEFEGDITYNYDSIKATLHIETKDEIDLVSWTLKYERPNENVPELISLL  101

Query  182  QTILDITKEMEDHHA  226
              ++ +TK ++DHHA
Sbjct  102  DLVVGMTKGIDDHHA  116



>ref|XP_010666837.1| PREDICTED: MLP-like protein 43 [Beta vulgaris subsp. vulgaris]
Length=151

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 49/74 (66%), Gaps = 0/74 (0%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQVHSNDDDHFVTWTLEYEKLSEEIPEPLSYL  181
            AID+E K V+F++++GD+L+ +K  +++  V    ++  V W  E+EK++++ P P   +
Sbjct  75   AIDEENKSVRFKIIEGDLLKEFKCLTISVHVIPRGEETAVKWLAEFEKIADDGPYPTKIM  134

Query  182  QTILDITKEMEDHH  223
               + ITK++EDHH
Sbjct  135  DFCISITKDIEDHH  148



>ref|XP_006301818.1| hypothetical protein CARUB_v10022286mg [Capsella rubella]
 gb|EOA34716.1| hypothetical protein CARUB_v10022286mg [Capsella rubella]
Length=172

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 49/75 (65%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            A++ EK L+ FRV++GD+++ YKSF +T Q           V W LEYEK+SEE+  P +
Sbjct  84   ALEPEKNLITFRVIEGDLMKEYKSFVITVQGTPKQGGPGCIVHWHLEYEKISEEVAHPET  143

Query  176  YLQTILDITKEMEDH  220
             LQ  +D++K ++++
Sbjct  144  LLQFCVDMSKGIDEY  158



>ref|XP_008221417.1| PREDICTED: MLP-like protein 31 [Prunus mume]
Length=156

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 50/75 (67%), Gaps = 2/75 (3%)
 Frame = +2

Query  2    AIDDEKKLVKFRVVKGDILESYKSFSLTCQV--HSNDDDHFVTWTLEYEKLSEEIPEPLS  175
            AID EK L+ F+V++GD+LE YKSF +T Q    ++     V  T+EYEK   +I +P +
Sbjct  76   AIDAEKNLITFKVIEGDLLEHYKSFKITIQATPKAHGQGSIVHCTMEYEKHHGDIEDPHT  135

Query  176  YLQTILDITKEMEDH  220
             LQ ++D++K+++ H
Sbjct  136  LLQFVVDVSKDLDAH  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 897557564400