BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16538_g1_i1 len=234 path=[259:0-233]

Length=234
                                                                      Score     E

ref|XP_011075467.1|  PREDICTED: kirola-like                           73.9    2e-14   
gb|EYU23173.1|  hypothetical protein MIMGU_mgv1a020758mg              73.9    2e-14   
ref|XP_006355094.1|  PREDICTED: kirola-like                           71.6    1e-13   
gb|AAA70155.1|  22.8 kDa protein                                      70.1    7e-13   Ipomoea trifida
ref|XP_009798271.1|  PREDICTED: kirola-like                           69.3    9e-13   
ref|XP_006367964.1|  PREDICTED: MLP-like protein 34-like              70.5    1e-12   
ref|XP_010319391.1|  PREDICTED: kirola-like                           69.7    2e-12   
gb|EYU34509.1|  hypothetical protein MIMGU_mgv1a026388mg              67.8    3e-12   
gb|EYU31817.1|  hypothetical protein MIMGU_mgv1a015578mg              67.8    3e-12   
ref|XP_009803723.1|  PREDICTED: kirola-like                           68.6    5e-12   
emb|CDP21429.1|  unnamed protein product                              67.4    5e-12   
ref|XP_009591453.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  68.6    5e-12   
gb|EYU31820.1|  hypothetical protein MIMGU_mgv1a015676mg              66.6    7e-12   
ref|XP_006361655.1|  PREDICTED: MLP-like protein 34-like              67.0    7e-12   
gb|EYU31818.1|  hypothetical protein MIMGU_mgv1a024291mg              66.6    8e-12   
gb|EYU29497.1|  hypothetical protein MIMGU_mgv1a021619mg              66.6    8e-12   
ref|WP_039311017.1|  hypothetical protein                             67.0    9e-12   
ref|XP_006367636.1|  PREDICTED: MLP-like protein 34-like              67.0    2e-11   
emb|CDP14657.1|  unnamed protein product                              65.9    2e-11   
gb|EYU31821.1|  hypothetical protein MIMGU_mgv1a015566mg              65.1    3e-11   
ref|XP_006367980.1|  PREDICTED: MLP-like protein 28-like              64.7    5e-11   
ref|XP_009607912.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  63.5    1e-10   
ref|XP_004242814.1|  PREDICTED: kirola-like                           62.4    3e-10   
ref|XP_004246757.1|  PREDICTED: MLP-like protein 28                   61.6    6e-10   
gb|EYU17814.1|  hypothetical protein MIMGU_mgv1a015637mg              61.2    8e-10   
ref|XP_011070720.1|  PREDICTED: kirola-like                           60.8    1e-09   
ref|XP_004240136.1|  PREDICTED: kirola-like                           60.8    1e-09   
ref|XP_006367896.1|  PREDICTED: kirola-like                           60.5    1e-09   
ref|XP_004240133.1|  PREDICTED: kirola-like                           60.5    2e-09   
ref|XP_006367717.1|  PREDICTED: MLP-like protein 28-like              60.1    2e-09   
ref|XP_011092069.1|  PREDICTED: kirola-like                           59.7    3e-09   
emb|CDP21915.1|  unnamed protein product                              59.7    3e-09   
emb|CDP00799.1|  unnamed protein product                              58.5    8e-09   
ref|XP_011078290.1|  PREDICTED: kirola-like isoform X1                58.5    8e-09   
ref|XP_006367968.1|  PREDICTED: MLP-like protein 34-like              58.5    8e-09   
ref|XP_011078291.1|  PREDICTED: kirola-like isoform X2                57.8    1e-08   
ref|XP_011078439.1|  PREDICTED: MLP-like protein 28                   58.2    4e-08   
ref|XP_011070613.1|  PREDICTED: kirola-like                           56.2    5e-08   
ref|XP_006367514.1|  PREDICTED: MLP-like protein 34-like isoform X2   54.7    6e-08   
ref|XP_009626144.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  55.8    7e-08   
emb|CDP14655.1|  unnamed protein product                              55.5    8e-08   
ref|XP_006367513.1|  PREDICTED: MLP-like protein 34-like isoform X1   55.5    1e-07   
ref|XP_006366347.1|  PREDICTED: kirola-like                           54.7    2e-07   
ref|XP_006366346.1|  PREDICTED: MLP-like protein 34-like              54.7    2e-07   
ref|XP_006366344.1|  PREDICTED: MLP-like protein 34-like              54.7    2e-07   
ref|XP_010666838.1|  PREDICTED: MLP-like protein 43                   54.7    2e-07   
ref|XP_010325795.1|  PREDICTED: kirola-like                           54.3    2e-07   
ref|XP_010325794.1|  PREDICTED: kirola-like                           54.3    3e-07   
ref|XP_006367897.1|  PREDICTED: kirola-like                           53.9    3e-07   
ref|XP_009758199.1|  PREDICTED: MLP-like protein 43                   53.9    3e-07   
ref|XP_010666837.1|  PREDICTED: MLP-like protein 43                   53.9    3e-07   
ref|XP_011084196.1|  PREDICTED: kirola-like                           53.9    3e-07   
gb|ADG43176.1|  putative major latex-like protein                     53.9    4e-07   
gb|EYU18071.1|  hypothetical protein MIMGU_mgv1a023909mg              53.5    5e-07   
ref|XP_006354582.1|  PREDICTED: kirola-like                           53.1    7e-07   
gb|EYU32958.1|  hypothetical protein MIMGU_mgv1a015581mg              52.8    7e-07   
ref|XP_011070612.1|  PREDICTED: kirola-like                           52.4    1e-06   
ref|XP_006365602.1|  PREDICTED: MLP-like protein 28-like              52.4    1e-06   
ref|XP_006366345.1|  PREDICTED: MLP-like protein 34-like              52.0    1e-06   
gb|ACH72969.1|  major latex-like protein                              52.0    2e-06   Panax ginseng [Chinese ginseng]
sp|P85524.1|KIRO_ACTDE  RecName: Full=Kirola; AltName: Allergen=A...  52.0    2e-06   
pdb|4IHR|A  Chain A, Crystal Structure Of Recombinant Kirola (act...  52.0    2e-06   
ref|XP_004240135.1|  PREDICTED: kirola-like                           52.0    2e-06   
ref|XP_011038618.1|  PREDICTED: MLP-like protein 43                   51.6    2e-06   
ref|XP_004246324.1|  PREDICTED: MLP-like protein 31                   51.6    2e-06   
ref|XP_006367718.1|  PREDICTED: MLP-like protein 34-like              51.2    3e-06   
ref|XP_004246759.2|  PREDICTED: MLP-like protein 34                   52.4    5e-06   
ref|XP_004237027.1|  PREDICTED: kirola-like                           50.4    6e-06   
ref|XP_004290369.1|  PREDICTED: MLP-like protein 43-like              50.1    7e-06   
ref|XP_007226522.1|  hypothetical protein PRUPE_ppa025363mg           50.1    8e-06   
ref|XP_004246323.1|  PREDICTED: kirola-like                           50.1    8e-06   
gb|EPS58827.1|  hypothetical protein M569_15986                       49.7    1e-05   
ref|XP_009781868.1|  PREDICTED: kirola-like                           49.3    1e-05   
gb|KCW64564.1|  hypothetical protein EUGRSUZ_G02169                   49.3    1e-05   
ref|XP_010066609.1|  PREDICTED: MLP-like protein 28                   49.3    1e-05   
ref|XP_002284570.1|  PREDICTED: MLP-like protein 34                   49.3    1e-05   Vitis vinifera
dbj|BAJ25787.1|  putative PR-10 type pathogenesis-related protein     48.9    2e-05   
ref|XP_009620151.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  48.9    2e-05   
ref|XP_009759779.1|  PREDICTED: kirola-like                           48.9    2e-05   
gb|EYU32956.1|  hypothetical protein MIMGU_mgv1a015606mg              48.5    3e-05   
ref|XP_011038620.1|  PREDICTED: MLP-like protein 43                   48.1    3e-05   
ref|XP_010044193.1|  PREDICTED: MLP-like protein 34                   48.1    4e-05   
ref|XP_006367814.1|  PREDICTED: kirola-like                           47.8    4e-05   
ref|XP_011038619.1|  PREDICTED: MLP-like protein 28                   47.8    4e-05   
ref|XP_004237018.1|  PREDICTED: kirola                                47.8    4e-05   
ref|XP_009781869.1|  PREDICTED: kirola-like                           47.8    5e-05   
ref|XP_002315876.1|  Csf-2 family protein                             47.8    5e-05   Populus trichocarpa [western balsam poplar]
ref|XP_007223651.1|  hypothetical protein PRUPE_ppa012742mg           47.8    5e-05   
ref|XP_010684109.1|  PREDICTED: MLP-like protein 43                   47.4    6e-05   
ref|XP_009612966.1|  PREDICTED: MLP-like protein 43                   47.0    6e-05   
ref|XP_006367815.1|  PREDICTED: kirola-like                           47.4    6e-05   
ref|XP_007045183.1|  MLP-like protein 28                              47.4    6e-05   
ref|XP_006367051.1|  PREDICTED: kirola-like                           47.4    7e-05   
ref|XP_009780262.1|  PREDICTED: kirola-like                           47.0    7e-05   
gb|AAC14179.1|  major latex protein homolog                           47.0    7e-05   Mesembryanthemum crystallinum
dbj|BAA83470.1|  Csf-2                                                46.6    1e-04   Cucumis sativus [cucumbers]
emb|CAC43292.1|  major latex like protein homolog                     46.6    1e-04   Beta vulgaris [beet]
ref|XP_010672189.1|  PREDICTED: kirola-like                           46.6    1e-04   
ref|XP_009612232.1|  PREDICTED: kirola {ECO:0000303|PubMed:213097...  46.2    1e-04   
gb|EPS58825.1|  hypothetical protein M569_15989                       46.6    1e-04   
ref|XP_006368141.1|  PREDICTED: MLP-like protein 34-like              46.2    1e-04   
ref|XP_006367209.1|  PREDICTED: MLP-like protein 43-like              46.2    2e-04   
gb|AFK49330.1|  unknown                                               46.2    2e-04   
gb|KGN57232.1|  Csf-2 protein                                         46.2    2e-04   
ref|XP_004147648.1|  PREDICTED: MLP-like protein 34-like              46.2    2e-04   
ref|XP_004170313.1|  PREDICTED: MLP-like protein 28-like              46.2    2e-04   
ref|XP_008439040.1|  PREDICTED: MLP-like protein 43                   45.8    2e-04   
ref|XP_004237031.1|  PREDICTED: kirola-like                           45.4    3e-04   
ref|XP_009339700.1|  PREDICTED: MLP-like protein 28                   45.4    3e-04   
gb|EPS59252.1|  hypothetical protein M569_15558                       45.1    4e-04   
ref|XP_008221417.1|  PREDICTED: MLP-like protein 31                   45.1    4e-04   
gb|KHG17607.1|  MLP-like protein 31                                   45.1    4e-04   
ref|XP_010044191.1|  PREDICTED: MLP-like protein 28                   45.1    4e-04   
ref|XP_009592037.1|  PREDICTED: MLP-like protein 28                   46.6    4e-04   
ref|XP_007045188.1|  MLP protein 28                                   44.7    5e-04   
ref|XP_009608030.1|  PREDICTED: MLP-like protein 43                   44.3    5e-04   
ref|XP_007153302.1|  hypothetical protein PHAVU_003G023600g           44.7    5e-04   
ref|XP_009127831.1|  PREDICTED: MLP-like protein 31                   44.7    5e-04   
gb|KDP44595.1|  hypothetical protein JCGZ_22177                       44.7    6e-04   
gb|EPS71115.1|  hypothetical protein M569_03645                       44.7    6e-04   
ref|XP_004147670.1|  PREDICTED: MLP-like protein 28-like              46.6    6e-04   
ref|XP_002534267.1|  Major latex protein, putative                    44.7    6e-04   Ricinus communis
ref|XP_007045180.1|  MLP-like protein 28, putative                    45.1    6e-04   
ref|XP_006367041.1|  PREDICTED: MLP-like protein 28-like              44.7    6e-04   
ref|XP_006367813.1|  PREDICTED: kirola-like                           44.7    6e-04   
ref|XP_006366068.1|  PREDICTED: kirola-like                           44.3    7e-04   
gb|EYU17813.1|  hypothetical protein MIMGU_mgv1a014581mg              45.1    7e-04   
ref|NP_198153.1|  polyketide cyclase/dehydrase and lipid transpor...  44.3    0.001   Arabidopsis thaliana [mouse-ear cress]



>ref|XP_011075467.1| PREDICTED: kirola-like [Sesamum indicum]
Length=155

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 49/72 (68%), Gaps = 8/72 (11%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIHSI------EGQGGTVGSTITL  197
            MGL GK+V Q++I   GD++HEIFRERPHH+  M    H+I      EGQ GTVGS I  
Sbjct  1    MGLSGKLVSQIDIKCDGDVFHEIFRERPHHISGMTP--HNIQNCDLHEGQWGTVGSVIYW  58

Query  198  IFTHEGKTKMAE  233
             +TH+GK K+A+
Sbjct  59   NYTHDGKEKVAK  70



>gb|EYU23173.1| hypothetical protein MIMGU_mgv1a020758mg [Erythranthe guttata]
Length=153

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 8/72 (11%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA------IHSIEGQGGTVGSTITL  197
            MGL GK+V Q++I   GD++HEIFRERPHH+  M  A      +H  +GQ GTVGS I  
Sbjct  1    MGLSGKLVSQIDIKSDGDVFHEIFRERPHHISDMSPAHIQNCDLH--DGQWGTVGSVIYF  58

Query  198  IFTHEGKTKMAE  233
             +TH+GK ++A+
Sbjct  59   NYTHDGKERVAK  70



>ref|XP_006355094.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=149

 Score = 71.6 bits (174),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 46/69 (67%), Gaps = 3/69 (4%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIHSI---EGQGGTVGSTITLIFT  206
            M L+GK+V ++ I   GD++HEIFR RPHH  SMC  I ++   E +  TVGS ++  F 
Sbjct  1    MTLEGKLVSEINIKSDGDVFHEIFRHRPHHNSSMCDKIQNVDIHEDEWETVGSVLSWYFI  60

Query  207  HEGKTKMAE  233
            H+GK K+A+
Sbjct  61   HDGKEKVAK  69



>gb|AAA70155.1| 22.8 kDa protein [Ipomoea trifida]
Length=201

 Score = 70.1 bits (170),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 43/63 (68%), Gaps = 1/63 (2%)
 Frame = +1

Query  40   ALKAR*LGR*RSVF-MEIFIMKSLERDHIICPPCVQLFIQLKAREELWAPPSP*YLPMKG  216
             LK + LG+    F ME+F MKSLE+DHI+CPPC QLF +LKA  ELWA  S   L M G
Sbjct  131  GLKGKVLGQVEIKFSMEMFSMKSLEKDHIMCPPCAQLFSELKANGELWALSSSGKLAMMG  190

Query  217  RPK  225
            RPK
Sbjct  191  RPK  193



>ref|XP_009798271.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=151

 Score = 69.3 bits (168),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 48/70 (69%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIF  203
            MGLKGK++ Q+EI   GD++HE+FR +PHHLP++      A+   EG  GTVGS +   +
Sbjct  1    MGLKGKLISQIEIKGCGDLFHEMFRHKPHHLPNVTPDKIQAVDLHEGDWGTVGSVVNWNY  60

Query  204  THEGKTKMAE  233
            T EG+TK+ +
Sbjct  61   TIEGQTKVVK  70



>ref|XP_006367964.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=296

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 49/70 (70%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCS-AIHSI---EGQGGTVGSTITLIF  203
            M L+GK+V ++ I   GD++HEIFR RPHH+ +M S  I ++   EG+ GTVGS I   F
Sbjct  1    MSLEGKLVSEINIKCDGDVFHEIFRHRPHHISTMSSDKIQNVDIHEGEWGTVGSVIFWNF  60

Query  204  THEGKTKMAE  233
            TH+GK K+A+
Sbjct  61   THDGKEKVAK  70


 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 4/68 (6%)
 Frame = +3

Query  42   LKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA-IHSI---EGQGGTVGSTITLIFTH  209
            L GK+V ++ I   GD++HEIFR RPHH+ SM    I ++   EG+ GTVGS I   FTH
Sbjct  149  LTGKLVSEINIKSDGDVFHEIFRYRPHHISSMSPGYIQNVDIHEGEWGTVGSVIVWNFTH  208

Query  210  EGKTKMAE  233
            +GK K+A+
Sbjct  209  DGKEKVAK  216



>ref|XP_010319391.1| PREDICTED: kirola-like [Solanum lycopersicum]
 ref|XP_004253534.2| PREDICTED: kirola-like [Solanum lycopersicum]
Length=296

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 48/69 (70%), Gaps = 4/69 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCS-AIHSI---EGQGGTVGSTITLIF  203
            M L+GK+V ++ I   GD++HEIFR RPHH+ +M S  + ++   EG+ GTVGS I   F
Sbjct  1    MSLEGKLVSEINIKCDGDVFHEIFRHRPHHISTMSSDKVQNVDIHEGEWGTVGSVIFWNF  60

Query  204  THEGKTKMA  230
            TH+GK K+A
Sbjct  61   THDGKEKVA  69


 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 47/68 (69%), Gaps = 4/68 (6%)
 Frame = +3

Query  42   LKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIFTH  209
            L GK+V ++ I   GD++HEIFR RPHH+ SM  S I ++   EG+ GTVGS I   FTH
Sbjct  149  LTGKLVSEINIKSDGDVFHEIFRYRPHHISSMSPSYIQNVDIHEGEWGTVGSVIFWNFTH  208

Query  210  EGKTKMAE  233
            +GK K+A+
Sbjct  209  DGKEKVAK  216



>gb|EYU34509.1| hypothetical protein MIMGU_mgv1a026388mg [Erythranthe guttata]
Length=152

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIHSI----EGQGGTVGSTITLIF  203
            MGL GK+V    I   GD++HEIFRERPHH+P M   +       EGQ GTVGS I   +
Sbjct  1    MGLIGKLVSGTNIKSDGDVFHEIFRERPHHVPDMSPDLVQNCDLHEGQWGTVGSVIFWNY  60

Query  204  THEGKTKMAE  233
            TH+GK  +A+
Sbjct  61   THDGKECVAK  70



>gb|EYU31817.1| hypothetical protein MIMGU_mgv1a015578mg [Erythranthe guttata]
Length=152

 Score = 67.8 bits (164),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 45/73 (62%), Gaps = 10/73 (14%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSM-------CSAIHSIEGQGGTVGSTIT  194
            MGL GK+V +  I   GD++HEIFRERPHH+P M       C   H   G+ GTVGS I 
Sbjct  1    MGLSGKLVSKTNIKSDGDVFHEIFRERPHHVPDMSPDLIQNCDLHH---GEWGTVGSVIF  57

Query  195  LIFTHEGKTKMAE  233
              +TH+GK  +A+
Sbjct  58   WNYTHDGKECVAK  70



>ref|XP_009803723.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=299

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 4/68 (6%)
 Frame = +3

Query  42   LKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCS-AIHSI---EGQGGTVGSTITLIFTH  209
            L GK+  Q+EI   GD++HEIFR RPHH+ +MCS  I ++   EG+ GTVGS I   + H
Sbjct  149  LTGKLESQIEIKSDGDVFHEIFRYRPHHISTMCSDKIQNVDIHEGEWGTVGSVIFWNYVH  208

Query  210  EGKTKMAE  233
            +GK K+A+
Sbjct  209  DGKEKVAK  216


 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 46/69 (67%), Gaps = 4/69 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            M L+GK+V ++ I   GD++HEIFR RPHH+ +M    I ++   EG  GTVGS I   F
Sbjct  1    MSLEGKLVSEINIKSCGDVFHEIFRYRPHHISTMSPDKIQNVDIHEGDWGTVGSVIFWNF  60

Query  204  THEGKTKMA  230
            TH+GK K+A
Sbjct  61   THDGKEKVA  69



>emb|CDP21429.1| unnamed protein product [Coffea canephora]
Length=150

 Score = 67.4 bits (163),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 8/72 (11%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA------IHSIEGQGGTVGSTITL  197
            M L GK+V Q+EI   GD++HEIFR RPHH+ +M         +H  +G  GTVGS I  
Sbjct  1    MSLTGKLVNQIEIKSDGDVFHEIFRHRPHHVSAMSPTHIQGCDLH--DGNWGTVGSVIFW  58

Query  198  IFTHEGKTKMAE  233
             +TH+GK K+A+
Sbjct  59   NYTHDGKKKVAK  70



>ref|XP_009591453.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like [Nicotiana 
tomentosiformis]
Length=299

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 4/69 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            M L+GK+V ++ I   GD++HEIFR RPHH+ SM    I ++   EG+ GTVGS I   F
Sbjct  1    MSLEGKLVSEINIKSCGDVFHEIFRYRPHHISSMSPDKIQNVDIHEGEWGTVGSVIFWNF  60

Query  204  THEGKTKMA  230
            TH+GK K+A
Sbjct  61   THDGKEKVA  69


 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 47/68 (69%), Gaps = 4/68 (6%)
 Frame = +3

Query  42   LKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCS-AIHSI---EGQGGTVGSTITLIFTH  209
            L GK+  Q+EI   GD++HEIFR RPHH+ +MCS  I ++   EG+ GTVGS +   + H
Sbjct  149  LTGKLESQIEIKSDGDVFHEIFRYRPHHISTMCSDKIQNVDIHEGEWGTVGSVLFWNYVH  208

Query  210  EGKTKMAE  233
            +GK K+A+
Sbjct  209  DGKEKVAK  216



>gb|EYU31820.1| hypothetical protein MIMGU_mgv1a015676mg [Erythranthe guttata]
Length=149

 Score = 66.6 bits (161),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGL GK+V +  I   GD++HEIFR RPHH+    P     +   +G+ GTVGS I   +
Sbjct  1    MGLTGKLVSETNIKSDGDVFHEIFRHRPHHISDMSPDHIQGVDLHDGEWGTVGSQIFWNY  60

Query  204  THEGKTKMAE  233
            THEGK K+A+
Sbjct  61   THEGKKKVAK  70



>ref|XP_006361655.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=153

 Score = 67.0 bits (162),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA----IHSIEGQGGTVGSTITLIF  203
            MGLK K+  Q+E+    D++H+ FR +PHH+ +MC         +EG  GTVGS I   +
Sbjct  1    MGLKSKLCAQIEVKAKNDVFHDAFRHKPHHVSTMCPVHIQGCECLEGDFGTVGSKICWKY  60

Query  204  THEGKTKMAE  233
            TH+GK K ++
Sbjct  61   THDGKEKFSK  70



>gb|EYU31818.1| hypothetical protein MIMGU_mgv1a024291mg [Erythranthe guttata]
Length=147

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 41/61 (67%), Gaps = 3/61 (5%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIHSIE---GQGGTVGSTITLIFT  206
            MGL GK+V +  I   GD++HEIFRERPHH+P+M   I + +   G+ GTVGS I   +T
Sbjct  1    MGLSGKLVSETNIKSDGDVFHEIFRERPHHVPNMSPEIQNCDLHHGEWGTVGSIIFWSYT  60

Query  207  H  209
            H
Sbjct  61   H  61



>gb|EYU29497.1| hypothetical protein MIMGU_mgv1a021619mg [Erythranthe guttata]
Length=149

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 44/70 (63%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGL GK+V +  I   GD++HEIFR RPHH+    P     +   +G+ GTVGS I   +
Sbjct  1    MGLTGKLVSETNIKSDGDVFHEIFRHRPHHISDMSPDHIQGVDLHDGKWGTVGSQIFWNY  60

Query  204  THEGKTKMAE  233
            THEGK K+A+
Sbjct  61   THEGKKKVAK  70



>ref|WP_039311017.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91165.1| hypothetical protein QW71_36240, partial [Paenibacillus sp. IHB 
B 3415]
Length=178

 Score = 67.0 bits (162),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 4/69 (6%)
 Frame = +3

Query  33   KMGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA-IHSI---EGQGGTVGSTITLI  200
            +MGL GK+V QVEI   GD +HE+FR++PHH+ +M    IH +   EG  G VGS I+  
Sbjct  27   EMGLTGKLVRQVEIKSDGDAFHELFRDKPHHVSTMSPGNIHGVDLHEGDWGHVGSVISWN  86

Query  201  FTHEGKTKM  227
            +TH+GK K+
Sbjct  87   YTHDGKKKV  95



>ref|XP_006367636.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=280

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (68%), Gaps = 4/68 (6%)
 Frame = +3

Query  42   LKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA-IHSI---EGQGGTVGSTITLIFTH  209
            L GK+V ++ I   GD++HEIFR RPHH+ SM    I ++   EG+ GTVGS I   FTH
Sbjct  133  LTGKLVSEINIKSDGDVFHEIFRYRPHHISSMSPGYIQNVDIHEGEWGTVGSVIVWNFTH  192

Query  210  EGKTKMAE  233
            +GK K+A+
Sbjct  193  DGKEKVAK  200


 Score = 57.0 bits (136),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 4/61 (7%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCS-AIHSI---EGQGGTVGSTITLIF  203
            M L+GK+V ++ I   GD++HEIFR RPHH+ +M S  + ++   EG+ G VGS I   F
Sbjct  1    MSLEGKLVSEINIKCDGDVFHEIFRHRPHHISTMSSDKVQNVDIHEGEWGIVGSVIFWNF  60

Query  204  T  206
            T
Sbjct  61   T  61



>emb|CDP14657.1| unnamed protein product [Coffea canephora]
Length=150

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSIE---GQGGTVGSTITLIF  203
            M L GK+V Q+EI   GD++HEIFR RPHH+ +M  + +   +   G  GTVGS     F
Sbjct  1    MSLAGKLVNQIEIKSDGDVFHEIFRYRPHHISTMSPTNVQGCDLHGGDWGTVGSVTFWNF  60

Query  204  THEGKTKMAE  233
            TH+GK K+A+
Sbjct  61   THDGKEKVAK  70



>gb|EYU31821.1| hypothetical protein MIMGU_mgv1a015566mg [Erythranthe guttata]
Length=153

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 44/70 (63%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGL GK+V +  I   GD++HEIFR RPHH+    P     +   +G+ GTVGS I   +
Sbjct  1    MGLTGKLVSETSIKSDGDVFHEIFRHRPHHISDMSPDHIQGVDLHDGEWGTVGSQIFWKY  60

Query  204  THEGKTKMAE  233
            THEGK ++A+
Sbjct  61   THEGKKEVAK  70



>ref|XP_006367980.1| PREDICTED: MLP-like protein 28-like [Solanum tuberosum]
Length=153

 Score = 64.7 bits (156),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA----IHSIEGQGGTVGSTITLIF  203
            MGLK K+  Q+E+    D++H+ FR +PHH+ +MC         +EG  G VGS I   +
Sbjct  1    MGLKSKLCAQIEVKAKNDVFHDAFRHKPHHVSTMCPVHIQGCECLEGDFGIVGSKICWKY  60

Query  204  THEGKTKMAE  233
            TH+GK K ++
Sbjct  61   THDGKEKFSK  70



>ref|XP_009607912.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like [Nicotiana 
tomentosiformis]
Length=155

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 4/65 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIF  203
            MGLKGK++ Q+EI   GD++HE+FR +PHHLP++      A+   +G  GTVGS +   +
Sbjct  1    MGLKGKLISQIEIKGCGDLFHEMFRHKPHHLPNVTPHKIQAVDLHQGDWGTVGSIVNWNY  60

Query  204  THEGK  218
            T EG+
Sbjct  61   TIEGQ  65



>ref|XP_004242814.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=159

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 45/71 (63%), Gaps = 6/71 (8%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIH-----SIEGQGGTVGSTITLI  200
            MGLK K+  Q+E+    D++H+ FR +PHH+ +M + +H      +EG  GTVGS I   
Sbjct  1    MGLKSKLSAQIEVKAKNDVFHDAFRHKPHHISTM-TPVHVQGCDCLEGDFGTVGSKICWK  59

Query  201  FTHEGKTKMAE  233
            +TH+GK K ++
Sbjct  60   YTHDGKEKFSK  70



>ref|XP_004246757.1| PREDICTED: MLP-like protein 28 [Solanum lycopersicum]
Length=151

 Score = 61.6 bits (148),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 43/65 (66%), Gaps = 4/65 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIF  203
            MGLKGK++ ++EI    D++HEIF E+PHHLP++      A+   EG  GTVGS +   +
Sbjct  1    MGLKGKLISEIEIKGCKDLFHEIFCEKPHHLPNIVPQTIQAVDLHEGDWGTVGSVVNWNY  60

Query  204  THEGK  218
            T EG+
Sbjct  61   TIEGQ  65



>gb|EYU17814.1| hypothetical protein MIMGU_mgv1a015637mg [Erythranthe guttata]
Length=151

 Score = 61.2 bits (147),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGL GK++  +E    GD++HE+FR +PHHL    P         EGQ G VG+ IT  +
Sbjct  1    MGLTGKLIAAIEFKAGGDVFHELFRHKPHHLSNVTPEKVQGCDLHEGQFGHVGTIITWRY  60

Query  204  THEGKTKMAE  233
            TH+GK K A+
Sbjct  61   THDGKEKKAK  70



>ref|XP_011070720.1| PREDICTED: kirola-like [Sesamum indicum]
Length=151

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            MGL GK+  QVEI   GD++H++FR  PHH+  M    +H     EG  GTVGS I   +
Sbjct  1    MGLLGKLTAQVEIKSDGDLFHQVFRHTPHHISGMSPDLVHGCGLHEGDWGTVGSIICWSY  60

Query  204  THEGKTKMAE  233
            T +GK K+A+
Sbjct  61   TDDGKQKIAK  70



>ref|XP_004240136.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=150

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 4/69 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            M L GK+V ++EI   GDI++E++R RPHH+ +M  + I ++   EG+ GTV S I   F
Sbjct  1    MSLHGKLVSEIEIKCDGDIFYEVYRHRPHHISTMSPNNIQNVDVHEGEWGTVDSVIFWNF  60

Query  204  THEGKTKMA  230
             H+GK  +A
Sbjct  61   IHDGKEVVA  69



>ref|XP_006367896.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=150

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 43/67 (64%), Gaps = 4/67 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            M LKGK+V ++ I   GD++HEI   +PHH+ S+C   I ++   EG+ GTVGS  +   
Sbjct  1    MSLKGKLVSEINIKCDGDVFHEILGHKPHHISSICPDKIQNVNIHEGEWGTVGSVNSWNI  60

Query  204  THEGKTK  224
            TH+GK K
Sbjct  61   THDGKEK  67



>ref|XP_004240133.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=149

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 43/63 (68%), Gaps = 5/63 (8%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            M LKGK+V ++ +  +GD++HEIFR+RPHHL ++C   I ++   EG  GTVGS     F
Sbjct  1    MSLKGKLVSEITLC-NGDVFHEIFRQRPHHLSNICPDKIKNVNIHEGDWGTVGSVNFWNF  59

Query  204  THE  212
            TH+
Sbjct  60   THD  62



>ref|XP_006367717.1| PREDICTED: MLP-like protein 28-like [Solanum tuberosum]
Length=151

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 44/70 (63%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIF  203
            MGLKGK++ + EI    D++HE+F E+PHHLP++      A+   EG  GT+GS +   +
Sbjct  1    MGLKGKLISETEIKGCKDLFHEMFCEKPHHLPNVVPQTIQAVDLHEGDWGTIGSVVNWNY  60

Query  204  THEGKTKMAE  233
            T EG  K+ +
Sbjct  61   TIEGDEKVVK  70



>ref|XP_011092069.1| PREDICTED: kirola-like [Sesamum indicum]
Length=152

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 42/69 (61%), Gaps = 4/69 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGL GK+  QVEI   GD++H++F+  PHH+    P +       +G  GTVGS I   +
Sbjct  1    MGLLGKLTVQVEIKSEGDLFHQLFKHTPHHVSGMSPDIIQGCDLHQGNWGTVGSIICWSY  60

Query  204  THEGKTKMA  230
            TH+GK K+A
Sbjct  61   THDGKQKIA  69



>emb|CDP21915.1| unnamed protein product [Coffea canephora]
Length=150

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 46/70 (66%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAI-HSIE---GQGGTVGSTITLIF  203
            M L GK+V Q+EI  +GD++HE+F+ +P+ + S+   I H  E   G  GTVGS I   +
Sbjct  1    MSLTGKLVFQIEIKSNGDVFHELFKNKPYEVSSISPDIVHGCELHHGDWGTVGSIIFWTY  60

Query  204  THEGKTKMAE  233
            TH+G+ K+A+
Sbjct  61   THDGQKKVAK  70



>emb|CDP00799.1| unnamed protein product [Coffea canephora]
Length=154

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 44/71 (62%), Gaps = 5/71 (7%)
 Frame = +3

Query  36   MGLKGKVVGQVEI-SFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLI  200
            MGLKGK++GQ  I    GD++H++F +RPHHL    P        + G  GTVGS I   
Sbjct  1    MGLKGKMIGQTNIHGPAGDVFHDVFSKRPHHLATMTPEKVQGFTLLGGDLGTVGSKICWH  60

Query  201  FTHEGKTKMAE  233
            +TH+GK ++A+
Sbjct  61   YTHDGKDRVAK  71



>ref|XP_011078290.1| PREDICTED: kirola-like isoform X1 [Sesamum indicum]
Length=152

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGL GK+V  +E    GD++HE+FR +PHH+    P         EG+ G VGS I   +
Sbjct  1    MGLTGKLVAAIEFKAGGDVFHELFRHKPHHVSTTSPGKVQGCDLHEGEFGHVGSIICWKY  60

Query  204  THEGKTKMAE  233
            TH+GK K+A+
Sbjct  61   THDGKEKIAK  70



>ref|XP_006367968.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=151

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIF  203
            MGLKGK++ + EI    D++HE+F E+PHHLP++      A+   EG  GTVGS +   +
Sbjct  1    MGLKGKLISETEIKGCKDLFHEMFCEKPHHLPNVVPQTIQAVDLHEGDWGTVGSVVNWKY  60

Query  204  THEGKTKMAE  233
              EG  K+ +
Sbjct  61   IIEGDEKVVK  70



>ref|XP_011078291.1| PREDICTED: kirola-like isoform X2 [Sesamum indicum]
Length=152

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGL GK+V  +E    GD++HE+FR +PHH+    P         EG+ G VGS I   +
Sbjct  1    MGLTGKLVAAIEFKAGGDVFHELFRHKPHHVSTTSPGKVQGCDLHEGEFGHVGSIICWKY  60

Query  204  THEGKTKMAE  233
            TH+GK K A+
Sbjct  61   THDGKKKTAK  70



>ref|XP_011078439.1| PREDICTED: MLP-like protein 28 [Sesamum indicum]
Length=309

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGL GK+V  +E    GD++HE+FR +PHH+    P         EG+ G VGS I   +
Sbjct  1    MGLTGKLVAAIEFKAGGDVFHELFRHKPHHVSTTSPGKVQGCDLHEGEFGHVGSIICWKY  60

Query  204  THEGKTKMAE  233
            TH+GK K+A+
Sbjct  61   THDGKEKIAK  70


 Score = 57.4 bits (137),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 4/71 (6%)
 Frame = +3

Query  33   KMGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLI  200
            +MGL GK+V  +E    GD++HE+FR +PHH+    P         EG+ G VGS I   
Sbjct  157  EMGLTGKLVAAIEFKAGGDVFHELFRHKPHHVSTTSPGKIQGCDLHEGEFGHVGSIIFWN  216

Query  201  FTHEGKTKMAE  233
            +TH+GK K A+
Sbjct  217  YTHDGKAKTAK  227



>ref|XP_011070613.1| PREDICTED: kirola-like [Sesamum indicum]
Length=154

 Score = 56.2 bits (134),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGL GK+V Q+ I   GDI+  +F+ + HH+    P M  ++  I GQ GTVGS I+  +
Sbjct  1    MGLHGKLVTQISIKADGDIFFHLFKHKLHHITNICPQMVQSVKLIAGQWGTVGSVISWKY  60

Query  204  THEGKTKMAE  233
            T +G +  A+
Sbjct  61   TQDGASFTAK  70



>ref|XP_006367514.1| PREDICTED: MLP-like protein 34-like isoform X2 [Solanum tuberosum]
Length=67

 Score = 54.7 bits (130),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 4/67 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIF  203
            MGLKGK++ + EI    D++HE+F E+ HHLP++      A+   EG  GTVGS +   +
Sbjct  1    MGLKGKLISETEIKGCKDLFHEMFCEKTHHLPNVVPQTIQAVDLHEGDWGTVGSIVNWNY  60

Query  204  THEGKTK  224
            T E K K
Sbjct  61   TIERKRK  67



>ref|XP_009626144.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like [Nicotiana 
tomentosiformis]
Length=147

 Score = 55.8 bits (133),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 46/68 (68%), Gaps = 4/68 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            MGL+GK++ + E+   G+++H+ F  +PHH+P++    +H+    EG+ GTVGS ++  F
Sbjct  1    MGLRGKLIAKTEVKCGGELFHDHFSSKPHHIPNISPDKVHNFDIHEGELGTVGSVVSWKF  60

Query  204  THEGKTKM  227
            T +GK ++
Sbjct  61   TLDGKERV  68



>emb|CDP14655.1| unnamed protein product [Coffea canephora]
Length=150

 Score = 55.5 bits (132),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 8/70 (11%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA------IHSIEGQGGTVGSTITL  197
            M L G++V Q+EI   GD++HE+F  +PHH+P++         +H  EG  G VGS +  
Sbjct  1    MSLAGRLVKQIEIKSDGDVFHELFSSKPHHIPAISPTHVQGCDLH--EGNWGKVGSVLFW  58

Query  198  IFTHEGKTKM  227
             +T +GK ++
Sbjct  59   NYTRDGKQEV  68



>ref|XP_006367513.1| PREDICTED: MLP-like protein 34-like isoform X1 [Solanum tuberosum]
Length=151

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIF  203
            MGLKGK++ + EI    D++HE+F E+ HHLP++      A+   EG  GTVGS +   +
Sbjct  1    MGLKGKLISETEIKGCKDLFHEMFCEKTHHLPNVVPQTIQAVDLHEGDWGTVGSIVNWNY  60

Query  204  THEGK  218
            T EG+
Sbjct  61   TIEGQ  65



>ref|XP_006366347.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=152

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIF  203
            MGLK  +  ++E+  + D+++++F  +PHH+  MC         +EG  GTVGS I   +
Sbjct  1    MGLKSVLCAKIEMKANKDVFYDVFTNKPHHVSIMCPFHVQGCELLEGVFGTVGSKICWTY  60

Query  204  THEGKTKMAE  233
            T EGK K+++
Sbjct  61   TLEGKEKISK  70



>ref|XP_006366346.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=152

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIF  203
            MGLK  +  ++E+  + D++H++F  +PHH+ +MC         +EG  G++GS I   +
Sbjct  1    MGLKSVLCAKIEMKANKDVFHDVFTNKPHHVSTMCPLHVQGCELLEGDFGSIGSKICWTY  60

Query  204  THEGKTKMAE  233
            T +G+ K+++
Sbjct  61   TLDGEKKISK  70



>ref|XP_006366344.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=152

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/70 (31%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIF  203
            MGLK  +  ++E+  + D++H++F  +PHH+ +MC         +EG  G++GS I   +
Sbjct  1    MGLKSVLCAKIEMKANKDVFHDVFTNKPHHVSTMCPLHVQGCELLEGDFGSIGSKICWTY  60

Query  204  THEGKTKMAE  233
            T +G+ K+++
Sbjct  61   TLDGEKKISK  70



>ref|XP_010666838.1| PREDICTED: MLP-like protein 43 [Beta vulgaris subsp. vulgaris]
Length=171

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = +3

Query  18   YSLW*KMGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA----IHSIEGQGGTVGS  185
            Y ++  MG+ GK+  +V+I  HGD++HE+F ++PHHLP++        ++ EG  G  GS
Sbjct  15   YIVFLSMGVTGKLEVEVDIKCHGDLFHELFGKKPHHLPNITPDKVHICNAHEGDFGKPGS  74

Query  186  TITLIFTHEGKTKMAE  233
             I+  +T +GK  +A+
Sbjct  75   VISWDYTLDGKKCVAK  90



>ref|XP_010325795.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=152

 Score = 54.3 bits (129),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIF  203
            MGLK  +  ++E+  + D++H++F  +PHH+ +MC         +EG  GTVGS I   +
Sbjct  1    MGLKSVLCAKIEMKANKDVFHDVFTNKPHHVSTMCPLHIQGCELLEGVFGTVGSKICWTY  60

Query  204  THEGKTKMAE  233
              EG+ K+++
Sbjct  61   ILEGEKKISK  70



>ref|XP_010325794.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=152

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 44/70 (63%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIF  203
            MGLK  +  ++E++ + +++H++F+ +PHH+ +MC         +EG  G VGS I   +
Sbjct  1    MGLKSVLCAKIEMNANKNVFHDVFKNKPHHVFTMCPLHVQGCQLLEGTFGMVGSKICWTY  60

Query  204  THEGKTKMAE  233
            T EG+ K+++
Sbjct  61   TLEGEKKISK  70



>ref|XP_006367897.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=150

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            M L+GK+V ++ I   GD++H+I   +PHH+ ++C   I  +   EG+ GT+ S     F
Sbjct  1    MSLEGKLVSEINIKCDGDVFHQIIMYKPHHMCNICPDKIQKVDIHEGELGTIDSVRLWKF  60

Query  204  THEGKTKMAE  233
            TH+GK  +A+
Sbjct  61   THDGKEMVAK  70



>ref|XP_009758199.1| PREDICTED: MLP-like protein 43 [Nicotiana sylvestris]
Length=147

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 44/68 (65%), Gaps = 4/68 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            MGL+GK++ + E+   G+I+H+ F  +PHH+P +    +H+    EG+ GTVGS ++   
Sbjct  1    MGLRGKLIAKTEVKCAGEIFHDHFSSKPHHIPKISPDKVHNFDIHEGELGTVGSVVSWKI  60

Query  204  THEGKTKM  227
            T +GK ++
Sbjct  61   TLDGKERV  68



>ref|XP_010666837.1| PREDICTED: MLP-like protein 43 [Beta vulgaris subsp. vulgaris]
Length=151

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 45/70 (64%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA----IHSIEGQGGTVGSTITLIF  203
            MG+ GK+  +V+I  HGD++HE+F ++PHHLP++        ++ EG  G  GS I+  +
Sbjct  1    MGVTGKLEVEVDIKCHGDLFHELFGKKPHHLPNITPDKVHICNAHEGDFGKPGSVISWDY  60

Query  204  THEGKTKMAE  233
            T +GK  +A+
Sbjct  61   TLDGKKCVAK  70



>ref|XP_011084196.1| PREDICTED: kirola-like [Sesamum indicum]
Length=150

 Score = 53.9 bits (128),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 44/70 (63%), Gaps = 5/70 (7%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAI----HSIEGQGGTVGSTITLIF  203
            MGL GK+   V+I   GD++H+++R+ PH++ SM   I       +G  GT+GS I   +
Sbjct  1    MGLSGKLTADVQIK-SGDLFHKVYRDTPHNVSSMSPNIVQGCDLHQGNWGTIGSIICWSY  59

Query  204  THEGKTKMAE  233
            TH+G+ K+A+
Sbjct  60   THDGEQKIAK  69



>gb|ADG43176.1| putative major latex-like protein [Salvia miltiorrhiza]
Length=152

 Score = 53.9 bits (128),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 37/67 (55%), Gaps = 4/67 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGL GK++  +E    GD++HE+FR +PH L    P         EGQ G VGS I   +
Sbjct  1    MGLHGKLIAAIEFKAGGDVFHELFRHKPHDLSTISPGKTQGCDLHEGQFGQVGSIICWRY  60

Query  204  THEGKTK  224
             H+GK K
Sbjct  61   IHDGKEK  67



>gb|EYU18071.1| hypothetical protein MIMGU_mgv1a023909mg, partial [Erythranthe 
guttata]
Length=141

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  33   KMGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSM  137
             MGL GK+V +  I   GD++HEIFRERPHH+P M
Sbjct  21   NMGLSGKLVSKTNIKSDGDVFHEIFRERPHHVPDM  55



>ref|XP_006354582.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=152

 Score = 53.1 bits (126),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIF  203
            MGLK  +  ++E+  + D+++++F  +PH + +MC         ++G  GTVGS I  ++
Sbjct  1    MGLKSVLYAKIEMKANKDVFYDVFTNKPHLISTMCPLHVQGFELLDGVIGTVGSKICWMY  60

Query  204  THEGKTKMAE  233
            T EGK K+++
Sbjct  61   TFEGKKKISK  70



>gb|EYU32958.1| hypothetical protein MIMGU_mgv1a015581mg [Erythranthe guttata]
Length=152

 Score = 52.8 bits (125),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGL GK++  +E    GD++HE+ R  PH L    P         EG+ G VGS I   +
Sbjct  1    MGLTGKLIAAIEFKAGGDVFHELIRHNPHQLSNITPGNIQGCDLHEGEFGHVGSIINWRY  60

Query  204  THEGKTKMAE  233
            TH+GK K A+
Sbjct  61   THDGKEKTAK  70



>ref|XP_011070612.1| PREDICTED: kirola-like [Sesamum indicum]
Length=154

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIF  203
            MGL GK+V Q+ I   G ++  +F+ + HH  ++C      ++ ++GQ GTVGS IT  F
Sbjct  1    MGLDGKLVSQISIKADGGLFFHLFKYKLHHTMNICPQKIQTLNLVDGQWGTVGSVITSNF  60

Query  204  THEGKTKMAE  233
            T +G+  +A+
Sbjct  61   TADGEKFVAK  70



>ref|XP_006365602.1| PREDICTED: MLP-like protein 28-like [Solanum tuberosum]
Length=150

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 45/71 (63%), Gaps = 6/71 (8%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIH-----SIEGQGGTVGSTITLI  200
            MGLK  + G+VE+  + D++H+IF  +PHH+ +M S +H      +EG  G VGS I   
Sbjct  1    MGLKSVLCGKVEMKANKDVFHDIFTNKPHHVSTM-SPLHIQGFELLEGDIGIVGSKICWN  59

Query  201  FTHEGKTKMAE  233
            +T +G+ K+++
Sbjct  60   YTLDGEKKISK  70



>ref|XP_006366345.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=150

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 45/71 (63%), Gaps = 6/71 (8%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIHS-----IEGQGGTVGSTITLI  200
            MGLK  +  ++E+  + D++H++F  +PHH+ S+ S +H      +EG  GTVGS I   
Sbjct  1    MGLKSVLCAKIEMKANKDVFHDVFTNKPHHV-SIMSPLHVQGCELLEGVFGTVGSKICWT  59

Query  201  FTHEGKTKMAE  233
            +T EG+ K+++
Sbjct  60   YTLEGEKKISK  70



>gb|ACH72969.1| major latex-like protein [Panax ginseng]
Length=151

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 43/72 (60%), Gaps = 8/72 (11%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA------IHSIEGQGGTVGSTITL  197
            MGL GK++ Q  I   GD++HE+F  RPHH+P++  A      +H  EG+ G VGS +  
Sbjct  1    MGLTGKLICQTGIKSDGDVFHELFGTRPHHVPNITPANIQGCDLH--EGEFGKVGSVVIW  58

Query  198  IFTHEGKTKMAE  233
             ++ +G   +A+
Sbjct  59   NYSIDGNAMIAK  70



>sp|P85524.1|KIRO_ACTDE RecName: Full=Kirola; AltName: Allergen=Act d 11 [Actinidia deliciosa]
 pdb|4IGV|A Chain A, Crystal Structure Of Kirola (act D 11)
 pdb|4IGW|A Chain A, Crystal Structure Of Kirola (act D 11) In P6122 Space 
Group
 pdb|4IGW|B Chain B, Crystal Structure Of Kirola (act D 11) In P6122 Space 
Group
 pdb|4IGX|A Chain A, Crystal Structure Of Kirola (act D 11) - Triclinic Form
 pdb|4IGX|B Chain B, Crystal Structure Of Kirola (act D 11) - Triclinic Form
 pdb|4IGX|C Chain C, Crystal Structure Of Kirola (act D 11) - Triclinic Form
 pdb|4IGX|D Chain D, Crystal Structure Of Kirola (act D 11) - Triclinic Form
 pdb|4IGY|A Chain A, Crystal Structure Of Kirola (act D 11) - Triclinic Form
 pdb|4IGY|B Chain B, Crystal Structure Of Kirola (act D 11) - Triclinic Form
 pdb|4IGY|C Chain C, Crystal Structure Of Kirola (act D 11) - Triclinic Form
 pdb|4IGY|D Chain D, Crystal Structure Of Kirola (act D 11) - Triclinic Form
 pdb|4IH0|A Chain A, Crystal Structure Of Kirola (act D 11) From Crystal 
Soaked With Serotonin
 pdb|4IH2|A Chain A, Crystal Structure Of Kirola (act D 11) From Crystal 
Soaked With 2- Aminopurine
Length=150

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA----IHSIEGQGGTVGSTITLIF  203
            M L GK+V QVEI   G +++EIFR R + +  M       +  +EG  GTVGS I   +
Sbjct  1    MDLSGKMVKQVEILSDGIVFYEIFRYRLYLISEMSPVNIQGVDLLEGNWGTVGSVIFFKY  60

Query  204  THEGKTKMAE  233
            T +GK K A+
Sbjct  61   TIDGKEKTAK  70



>pdb|4IHR|A Chain A, Crystal Structure Of Recombinant Kirola (act D 11)
Length=153

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA----IHSIEGQGGTVGSTITLIF  203
            M L GK+V QVEI   G +++EIFR R + +  M       +  +EG  GTVGS I   +
Sbjct  4    MDLSGKMVKQVEILSDGIVFYEIFRYRLYLISEMSPVNIQGVDLLEGNWGTVGSVIFFKY  63

Query  204  THEGKTKMAE  233
            T +GK K A+
Sbjct  64   TIDGKEKTAK  73



>ref|XP_004240135.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=150

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSIE---GQGGTVGSTITLIF  203
            M L+GK+V ++ I   GD++HE    +PH++ ++C   I +++   G  GT+GS     F
Sbjct  1    MSLEGKLVSEINIKCDGDVFHETIMYKPHYMCNICPDKIQNVDIHKGDLGTIGSVRFWKF  60

Query  204  THEGKTKMAE  233
            TH+GK  +A+
Sbjct  61   THDGKEMVAK  70



>ref|XP_011038618.1| PREDICTED: MLP-like protein 43 [Populus euphratica]
Length=158

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA-IHSI---EGQGGTVGSTITLIF  203
            M L GK+  +VEI    + +H+IF  RPHH+P+M  A I ++   EG+ G  G+ I+  +
Sbjct  1    MTLFGKMEAEVEIKVSAETFHDIFSCRPHHIPNMSPAKIKNVDLHEGEWGKPGTVISWSY  60

Query  204  THEGKTKMAE  233
             H+G  K A+
Sbjct  61   VHDGVAKTAK  70



>ref|XP_004246324.1| PREDICTED: MLP-like protein 31 [Solanum lycopersicum]
Length=150

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIF  203
            MGLK  +  ++E+  + D++H+ F  +PHH+ +MC         +EG  G VG+ I   +
Sbjct  1    MGLKSVLCAKIEMKANKDVFHDAFTNKPHHVSTMCPLHVQGCELLEGAFGIVGTKICWTY  60

Query  204  THEGKTKMAE  233
            T EG  K+++
Sbjct  61   TLEGAKKISK  70



>ref|XP_006367718.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=114

 Score = 51.2 bits (121),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 45/71 (63%), Gaps = 6/71 (8%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIHS-----IEGQGGTVGSTITLI  200
            MGLK  +  ++E+  + D++H++F  +PHH+ +M S +H      +EG  GTVGS I   
Sbjct  1    MGLKSVLCVKIEMKANKDVFHDVFTNKPHHVSTM-SPLHVQGFDLLEGDIGTVGSKICWT  59

Query  201  FTHEGKTKMAE  233
            +T +G+ K+++
Sbjct  60   YTLDGEKKISK  70



>ref|XP_004246759.2| PREDICTED: MLP-like protein 34 [Solanum lycopersicum]
Length=302

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/71 (34%), Positives = 43/71 (61%), Gaps = 4/71 (6%)
 Frame = +3

Query  33   KMGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSM----CSAIHSIEGQGGTVGSTITLI  200
            KMGLK  +  ++E+  + D++H++F  +PHH+ +M          +EG  GTVGS I   
Sbjct  152  KMGLKSVLCAKIEMKANKDVFHDVFTNKPHHVSTMFPLHVQGFDLLEGDLGTVGSKICWT  211

Query  201  FTHEGKTKMAE  233
            +T +G+ K+++
Sbjct  212  YTLDGEKKISK  222


 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/71 (34%), Positives = 44/71 (62%), Gaps = 6/71 (8%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIHS-----IEGQGGTVGSTITLI  200
            MGLK  +  ++E+    D++H++F  +PHH+ +M S +H      +EG  GTVGS I   
Sbjct  1    MGLKSVLCAKIEMKADKDVFHDVFTNKPHHVSTM-SPLHVQGFDLLEGDLGTVGSKICWT  59

Query  201  FTHEGKTKMAE  233
            +T +G+ ++++
Sbjct  60   YTLDGEKRISK  70



>ref|XP_004237027.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=152

 Score = 50.4 bits (119),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 42/65 (65%), Gaps = 4/65 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCS-AIHSI---EGQGGTVGSTITLIF  203
            M L+GK++ ++ I  +GD++HEI + +P  + S+CS  I ++   EG+ G +GS  +  F
Sbjct  1    MSLQGKLISEINIKCNGDVFHEIIKYKPRDIFSICSDKIQNMDIHEGELGNIGSVKSWKF  60

Query  204  THEGK  218
            T+ GK
Sbjct  61   TYGGK  65



>ref|XP_004290369.1| PREDICTED: MLP-like protein 43-like [Fragaria vesca subsp. vesca]
Length=155

 Score = 50.1 bits (118),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 4/67 (6%)
 Frame = +3

Query  42   LKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIFTH  209
            L GK+  +VEI+     YHE+F  RPHHL    P    +   +EGQ G  GS I   + +
Sbjct  5    LFGKLETEVEINAPAAKYHELFTRRPHHLSSIRPDRIQSCELLEGQWGRQGSVIYWNYCY  64

Query  210  EGKTKMA  230
            +GKT +A
Sbjct  65   DGKTTVA  71



>ref|XP_007226522.1| hypothetical protein PRUPE_ppa025363mg [Prunus persica]
 gb|EMJ27721.1| hypothetical protein PRUPE_ppa025363mg [Prunus persica]
Length=150

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 38/72 (53%), Gaps = 8/72 (11%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCS------AIHSIEGQGGTVGSTITL  197
            M   GKV   VEI      +HE F +RPHHL S+ S       +H  +G  G VGS +  
Sbjct  1    MSYAGKVDTDVEIKAPAVKFHEFFSQRPHHLSSISSDKIKGCDLH--DGDWGKVGSVVNW  58

Query  198  IFTHEGKTKMAE  233
             + H+GK K+A+
Sbjct  59   NYVHDGKAKVAK  70



>ref|XP_004246323.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=152

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 40/69 (58%), Gaps = 4/69 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIF  203
            M LK  +  ++E+  + D++H++F  +PHH+ ++C         +EG  GTVGS I   +
Sbjct  1    MSLKSVLCAKIEMKANKDVFHDVFTNKPHHVSTICPLHVQGCELLEGVFGTVGSKICWRY  60

Query  204  THEGKTKMA  230
            T  GK K++
Sbjct  61   TLGGKEKIS  69



>gb|EPS58827.1| hypothetical protein M569_15986 [Genlisea aurea]
Length=149

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/72 (39%), Positives = 41/72 (57%), Gaps = 8/72 (11%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIHSI------EGQGGTVGSTITL  197
            MG KG++V   E    GDIYH++ +  PH L    ++ H+I      EG+ G  GS I  
Sbjct  1    MGAKGRIVVAQEFPSKGDIYHQLLKNNPHAL--TATSPHTIQGCVVHEGEFGKQGSVIFW  58

Query  198  IFTHEGKTKMAE  233
             +TH+GK K+A+
Sbjct  59   NYTHDGKEKVAK  70



>ref|XP_009781868.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=148

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGLKGK+V  +E+   G ++H++ + +PHHL    P+  +     EG+ G VGS +T  +
Sbjct  1    MGLKGKLVVSMEVKCGGHLFHDLCQTKPHHLSNISPNNVTGFDLHEGEIGEVGSVVTWKY  60

Query  204  THEGKTKMAE  233
              +G  K+A+
Sbjct  61   KEDGNAKIAK  70



>gb|KCW64564.1| hypothetical protein EUGRSUZ_G02169, partial [Eucalyptus grandis]
Length=152

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCS-AIHSI---EGQGGTVGSTITLIF  203
            M + GK+   +EI    D +H++F  RPHH+ +M +  IH +   +G  G  GS ++  +
Sbjct  1    MTVHGKMEIDLEIRAPADKFHDVFSCRPHHISNMSTDKIHGVDLHDGDWGKAGSVVSWSY  60

Query  204  THEGKTKMAE  233
            TH+G+TK+A+
Sbjct  61   THDGETKVAK  70



>ref|XP_010066609.1| PREDICTED: MLP-like protein 28 [Eucalyptus grandis]
Length=159

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 43/70 (61%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCS-AIHSI---EGQGGTVGSTITLIF  203
            M + GK+   +EI    D +H++F  RPHH+ +M +  IH +   +G  G  GS ++  +
Sbjct  1    MTVHGKMEIDLEIRAPADKFHDVFSCRPHHISNMSTDKIHGVDLHDGDWGKAGSVVSWSY  60

Query  204  THEGKTKMAE  233
            TH+G+TK+A+
Sbjct  61   THDGETKVAK  70



>ref|XP_002284570.1| PREDICTED: MLP-like protein 34 [Vitis vinifera]
Length=151

 Score = 49.3 bits (116),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 39/70 (56%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA----IHSIEGQGGTVGSTITLIF  203
            MGL GK+  +  I    D +HEIF  RPHH+ ++C A    +H  EG+ GT GS I   +
Sbjct  1    MGLIGKLQAETLIMASADKFHEIFWCRPHHISNVCPAKIQKVHLHEGEWGTSGSVIQWHY  60

Query  204  THEGKTKMAE  233
              +G   +A+
Sbjct  61   NIDGNDHVAK  70



>dbj|BAJ25787.1| putative PR-10 type pathogenesis-related protein [Nicotiana tabacum]
Length=147

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGLKGK+V  +E+   G ++H++++ +PHH+    P+  +     EG  G VGS +T  +
Sbjct  1    MGLKGKLVVSMEVKCGGHLFHDLYQTKPHHVSNISPNYVTGFDLHEGGIGEVGSVVTWKY  60

Query  204  THEGKTKMAE  233
              +G  K+A+
Sbjct  61   KEDGNAKIAK  70



>ref|XP_009620151.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like [Nicotiana 
tomentosiformis]
Length=147

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGLKGK+V  +E+   G ++H++++ +PHH+    P+  +     EG  G VGS +T  +
Sbjct  1    MGLKGKLVVSMEVKCGGHLFHDLYQTKPHHVSNISPNYVTGFDLHEGGIGEVGSVVTWKY  60

Query  204  THEGKTKMAE  233
              +G  K+A+
Sbjct  61   KEDGNAKIAK  70



>ref|XP_009759779.1| PREDICTED: kirola-like [Nicotiana sylvestris]
 gb|AAB23378.1| orf [Nicotiana tabacum]
Length=146

 Score = 48.9 bits (115),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            MGLKGK++ Q+E+   GD+ HE F+  PH   +M  + I +    EGQ G+ GS ++  F
Sbjct  1    MGLKGKLIAQIEMKCAGDLLHEHFKSNPHQTSTMSPNKITNFTLHEGQLGSTGSVVSWKF  60

Query  204  THEGKTKMAE  233
               GK + A+
Sbjct  61   VLGGKERHAK  70



>gb|EYU32956.1| hypothetical protein MIMGU_mgv1a015606mg [Erythranthe guttata]
Length=152

 Score = 48.5 bits (114),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 38/70 (54%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGL GK++  +E    GD++HE+ R  PH +    P         EG+ G VG+ +   +
Sbjct  1    MGLTGKLISAIEFKAGGDVFHELIRHNPHQITDITPEKVQGCDLHEGEFGHVGTIVNWRY  60

Query  204  THEGKTKMAE  233
            T++GK K A+
Sbjct  61   TYDGKEKTAK  70



>ref|XP_011038620.1| PREDICTED: MLP-like protein 43 [Populus euphratica]
Length=158

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA-IHSI---EGQGGTVGSTITLIF  203
            M L GK+  +VEI    + +H+IF  RPHH+ +M  A I ++   EG+ G  G+ I   +
Sbjct  1    MTLFGKMEAEVEIKVSAETFHDIFSCRPHHVSNMSPAKIKNVDLHEGEWGKTGTVICWSY  60

Query  204  THEGKTKMAE  233
             H+G  K A+
Sbjct  61   VHDGVAKTAK  70



>ref|XP_010044193.1| PREDICTED: MLP-like protein 34 [Eucalyptus grandis]
 gb|KCW86230.1| hypothetical protein EUGRSUZ_B02917 [Eucalyptus grandis]
Length=150

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIHS---IEGQGGTVGSTITLIFT  206
            M ++GK+  +V++    D ++  FR  PHHLP+ C+ +H+   +EG+  + GS     F+
Sbjct  1    MAVRGKLEVEVDLKSSADQFYGFFRSTPHHLPNACTDVHAGEILEGEWHSEGSIRKWTFS  60

Query  207  HEGK  218
             EGK
Sbjct  61   VEGK  64



>ref|XP_006367814.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=146

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 39/70 (56%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGLKGK++  VE+   G + H+IF  + HH+    PS   +    EG+   VGS +   +
Sbjct  1    MGLKGKLISSVEVKCGGHLVHDIFHAKTHHISNISPSKVKSFEIHEGETVDVGSIVEWTY  60

Query  204  THEGKTKMAE  233
              +GK KM++
Sbjct  61   NDDGKDKMSK  70



>ref|XP_011038619.1| PREDICTED: MLP-like protein 28 [Populus euphratica]
Length=158

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA-IHSI---EGQGGTVGSTITLIF  203
            M L GK+  +VEI    +  H+IF  RPHH+ +M  A I ++   EG+ G +G+ I+  +
Sbjct  1    MTLFGKMEAEVEIKVSAETLHDIFSCRPHHISNMSPAKIKNVDLHEGEWGKLGTVISWSY  60

Query  204  THEGKTKMAE  233
             H+G  K A+
Sbjct  61   VHDGVAKTAK  70



>ref|XP_004237018.1| PREDICTED: kirola [Solanum lycopersicum]
Length=146

 Score = 47.8 bits (112),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            MG+KGK++  VE+   G + H+IF  + HH+ ++C S I +    EG    VGS ++  +
Sbjct  1    MGVKGKLIASVEVKCGGHLVHDIFHTKTHHISNICPSKIQNFEIHEGDSVKVGSVVSWKY  60

Query  204  THEGKTKMAE  233
              +GK K+++
Sbjct  61   NDDGKDKISK  70



>ref|XP_009781869.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=148

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGLKGK+V  VE+   G ++H++++ +PHHL    P   +     EG    VGS +T  +
Sbjct  1    MGLKGKLVVSVEVKCGGYLFHDLYQTKPHHLSNISPDKVTGFDLHEGGICEVGSVVTWKY  60

Query  204  THEGKTKMAE  233
              +G  K+A+
Sbjct  61   KDDGNEKIAK  70



>ref|XP_002315876.1| Csf-2 family protein [Populus trichocarpa]
 gb|EEF02047.1| Csf-2 family protein [Populus trichocarpa]
Length=158

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 40/70 (57%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA-IHSI---EGQGGTVGSTITLIF  203
            M L GK+  +VEI    + +H+IF  RPHH+ +M  A I ++   EG+ G  G+ I   +
Sbjct  1    MTLFGKMEAEVEIKVSAETFHDIFSCRPHHVSNMSPAKIQNVDLHEGEWGKPGTVICWSY  60

Query  204  THEGKTKMAE  233
             H+G  K A+
Sbjct  61   VHDGVAKTAK  70



>ref|XP_007223651.1| hypothetical protein PRUPE_ppa012742mg [Prunus persica]
 ref|XP_008243382.1| PREDICTED: MLP-like protein 31 [Prunus mume]
 gb|AAK14060.1|AF239177_1 major latex-like protein [Prunus persica]
 gb|EMJ24850.1| hypothetical protein PRUPE_ppa012742mg [Prunus persica]
Length=156

 Score = 47.8 bits (112),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 8/68 (12%)
 Frame = +3

Query  48   GKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA------IHSIEGQGGTVGSTITLIFTH  209
            GKV   VEI      +HE+F  RPHH+ ++ S       +H  EG+ GTVGS +   + H
Sbjct  6    GKVETDVEIKAPATKFHEVFTHRPHHISNVSSNNIQGCDLH--EGEWGTVGSVVYWNYFH  63

Query  210  EGKTKMAE  233
            +GK K+A+
Sbjct  64   DGKAKVAK  71



>ref|XP_010684109.1| PREDICTED: MLP-like protein 43 [Beta vulgaris subsp. vulgaris]
Length=156

 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 40/70 (57%), Gaps = 5/70 (7%)
 Frame = +3

Query  39   GLKGKVVGQVEISFHG-DIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            GLK K+ G++EI   G D +HE+F++RPHH+    P         +G  GT GS I   +
Sbjct  3    GLKRKLEGEIEIRVAGGDAFHELFQDRPHHICNIHPEFVHGCDLHDGAFGTAGSKICWNY  62

Query  204  THEGKTKMAE  233
            T +GK + A+
Sbjct  63   TLDGKRQSAK  72



>ref|XP_009612966.1| PREDICTED: MLP-like protein 43 [Nicotiana tomentosiformis]
Length=103

 Score = 47.0 bits (110),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (57%), Gaps = 8/72 (11%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIHSIEG----QGGT--VGSTITL  197
            MG+KGK++  VE+   G + H+I     HHLP++C     + G    +GGT  VGS +  
Sbjct  1    MGVKGKLIASVEVKCGGHLVHDIIHTNTHHLPNICPG--KLNGFEIHEGGTVKVGSVVIW  58

Query  198  IFTHEGKTKMAE  233
             +  +GK K+A+
Sbjct  59   KYNDDGKDKIAK  70



>ref|XP_006367815.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=146

 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            MG+KGK++  VE+   G + H+IF  + HH+ +MC S I S    EG+   VGS +   +
Sbjct  1    MGVKGKLIASVEVKCGGHLVHDIFHTKTHHISNMCPSKIQSFEIHEGETVKVGSVVNWKY  60

Query  204  THEGKTKMAE  233
              + K K+++
Sbjct  61   NDDEKDKISK  70



>ref|XP_007045183.1| MLP-like protein 28 [Theobroma cacao]
 gb|EOY01015.1| MLP-like protein 28 [Theobroma cacao]
Length=156

 Score = 47.4 bits (111),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/71 (35%), Positives = 39/71 (55%), Gaps = 8/71 (11%)
 Frame = +3

Query  39   GLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCS------AIHSIEGQGGTVGSTITLI  200
             L GK+ G VEI    + +H++F  +PHH+ + CS       +H  +G  GT GS I   
Sbjct  4    ALTGKLEGDVEIKASAEKFHDMFCNKPHHVSNTCSEKVQGCELH--DGDWGTEGSIICWS  61

Query  201  FTHEGKTKMAE  233
            + H+G+ K A+
Sbjct  62   YVHDGEAKKAK  72



>ref|XP_006367051.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=155

 Score = 47.4 bits (111),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            MG+KGK++  VE+   G + H+IF  + HH+ ++C + I S    EG+   VGS +   +
Sbjct  1    MGVKGKLIASVEVKCGGHLVHDIFHTKTHHISNICPNKIQSFEIHEGETVKVGSVVNWKY  60

Query  204  THEGKTKMAE  233
              +GK K+++
Sbjct  61   NDDGKDKISK  70



>ref|XP_009780262.1| PREDICTED: kirola-like [Nicotiana sylvestris]
Length=146

 Score = 47.0 bits (110),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 41/70 (59%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            MGLKGK+V  +E+   G ++H++++ +P H+ ++    IH     +G+    GS I   F
Sbjct  1    MGLKGKLVASIEVKCRGHLFHDLYQTKPRHICNISPDKIHHFNIHKGESLKAGSVIGWKF  60

Query  204  THEGKTKMAE  233
             H+GK K+ +
Sbjct  61   NHDGKVKVTK  70



>gb|AAC14179.1| major latex protein homolog [Mesembryanthemum crystallinum]
Length=152

 Score = 47.0 bits (110),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 44/70 (63%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            MG+ GK+  +V+I   GD++HE+F ++PHH+ ++  S IH     EG+ G  GS I   +
Sbjct  1    MGITGKLEVEVDIKSCGDMFHELFGKKPHHVSNITPSKIHGCDVHEGEFGKPGSIINWDY  60

Query  204  THEGKTKMAE  233
            T +GK  +A+
Sbjct  61   TLDGKKCVAK  70



>dbj|BAA83470.1| Csf-2 [Cucumis sativus]
 gb|KGN57231.1| hypothetical protein Csa_3G172370 [Cucumis sativus]
Length=151

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 6/71 (8%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA--IHSI---EGQGGTVGSTITLI  200
            M L GK+   V I      +HE+F ++PHH+ + CS   IH +   EG+ G VGS I   
Sbjct  1    MSLCGKLEKDVPIRASASKFHEMFHKKPHHICN-CSTDKIHGVELQEGEWGQVGSIICWK  59

Query  201  FTHEGKTKMAE  233
            + HEGK K+A+
Sbjct  60   YFHEGKHKIAK  70



>emb|CAC43292.1| major latex like protein homolog [Beta vulgaris]
Length=150

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            M + GK+  +V+I+ HGDI+HEIF  RPH + +M    IH     +G+ G  G+ I   +
Sbjct  1    MHITGKLEVEVDINCHGDIFHEIFSTRPHDVSTMSPENIHGCDVHDGECGKPGAIIFWNY  60

Query  204  THEGKTKMAE  233
            T +GK  +A+
Sbjct  61   TLDGKKCVAK  70



>ref|XP_010672189.1| PREDICTED: kirola-like [Beta vulgaris subsp. vulgaris]
Length=154

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/70 (39%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC-SAIHSI---EGQGGTVGSTITLIF  203
            M + GK+  +V+I+ HGDI+HEIF  RPH + +M    IH     +G+ G  G+ I   +
Sbjct  1    MHITGKLEVEVDINCHGDIFHEIFSTRPHDVSTMSPENIHGCDVHDGECGKPGAIIFWNY  60

Query  204  THEGKTKMAE  233
            T +GK  +A+
Sbjct  61   TLDGKKCVAK  70



>ref|XP_009612232.1| PREDICTED: kirola {ECO:0000303|PubMed:21309790}-like [Nicotiana 
tomentosiformis]
Length=146

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 8/72 (11%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCS------AIHSIEGQGGTVGSTITL  197
            MGLKGK++ Q+E+   GD+ HE F+  PH   +M         +H  EGQ G  GS ++ 
Sbjct  1    MGLKGKLISQMEMKCAGDLLHEHFKSNPHQTSTMSPDKITNFTLH--EGQLGNTGSVVSW  58

Query  198  IFTHEGKTKMAE  233
             +   GK + A+
Sbjct  59   KYVLGGKERHAK  70



>gb|EPS58825.1| hypothetical protein M569_15989 [Genlisea aurea]
Length=152

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 37/71 (52%), Gaps = 5/71 (7%)
 Frame = +3

Query  36   MGLKGK-VVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLI  200
            MG +G+ VVG    S  GDI++++ +  PH L    P         EG+ G  GS I   
Sbjct  1    MGARGRLVVGHEFPSSKGDIFYQVLKNNPHRLSASSPQFVQGCKVEEGEFGKPGSVIVWT  60

Query  201  FTHEGKTKMAE  233
            FTHEGK  +A+
Sbjct  61   FTHEGKESVAK  71



>ref|XP_006368141.1| PREDICTED: MLP-like protein 34-like [Solanum tuberosum]
Length=146

 Score = 46.2 bits (108),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 38/70 (54%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGLKGK++  +E+   G + H+I   +PHH+    PS   +    EG+   VGS +   +
Sbjct  1    MGLKGKLISSIEVKCGGHLIHDILHAKPHHISNISPSKVKSFDFHEGETVDVGSIVQWTY  60

Query  204  THEGKTKMAE  233
              +GK K ++
Sbjct  61   NDDGKDKTSK  70



>ref|XP_006367209.1| PREDICTED: MLP-like protein 43-like [Solanum tuberosum]
Length=147

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCS-AIHSI---EGQGGTVGSTITLIF  203
            MGL GK+V  +E+   G ++H++++   HH+ ++ S  +H     EG+   VGS I   +
Sbjct  1    MGLNGKLVASMEVKCGGHLFHDLYQTSSHHVSNISSDKVHHFDIHEGEDLKVGSVIGWKY  60

Query  204  THEGKTKMAE  233
            TH+GK K+ +
Sbjct  61   THDGKVKVTK  70



>gb|AFK49330.1| unknown [Medicago truncatula]
 gb|KEH40554.1| polyketide cyclase/dehydrase and lipid transporter [Medicago 
truncatula]
Length=153

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 3/68 (4%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIHSI---EGQGGTVGSTITLIFT  206
            M L GKV  +VEI   G  ++ IFR++  HLP++ + IH     EG    +GS     FT
Sbjct  1    MALSGKVEAEVEIQAPGAKFYNIFRKQLEHLPNISNEIHEARVHEGDWENIGSIKHWEFT  60

Query  207  HEGKTKMA  230
             EG+ + A
Sbjct  61   VEGRKQSA  68



>gb|KGN57232.1| Csf-2 protein [Cucumis sativus]
Length=155

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 40/69 (58%), Gaps = 4/69 (6%)
 Frame = +3

Query  39   GLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCS-AIHSI---EGQGGTVGSTITLIFT  206
             L GK+   V I     ++HEIF ++PHH+ +  +  IH +   EG+ G VGS I   + 
Sbjct  3    DLYGKLETDVPIKASASMFHEIFHKKPHHISNASTDKIHGVDLHEGEWGQVGSIICWKYF  62

Query  207  HEGKTKMAE  233
            H+GK ++A+
Sbjct  63   HDGKARIAK  71



>ref|XP_004147648.1| PREDICTED: MLP-like protein 34-like [Cucumis sativus]
 gb|KGN57230.1| hypothetical protein Csa_3G171870 [Cucumis sativus]
Length=157

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA-IHSI---EGQGGTVGSTITLIF  203
            MGL GK+  +V I      +HEIF +RPHH+ ++ +  IH +   EG+ G VGS +   +
Sbjct  1    MGLYGKLEKEVPIRASASKFHEIFHKRPHHISNVSTNIIHGVDLHEGEWGKVGSIVYWRY  60

Query  204  THEGKTKMAE  233
              +GK+++ +
Sbjct  61   LLDGKSRVTK  70



>ref|XP_004170313.1| PREDICTED: MLP-like protein 28-like [Cucumis sativus]
Length=157

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 42/70 (60%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA-IHSI---EGQGGTVGSTITLIF  203
            MGL GK+  +V I      +HEIF +RPHH+ ++ +  IH +   EG+ G VGS +   +
Sbjct  1    MGLYGKLEKEVPIRASASKFHEIFHKRPHHISNVSTNIIHGVDLHEGEWGKVGSIVYWRY  60

Query  204  THEGKTKMAE  233
              +GK+++ +
Sbjct  61   LLDGKSRVTK  70



>ref|XP_008439040.1| PREDICTED: MLP-like protein 43 [Cucumis melo]
Length=156

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 4/67 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA-IHSI---EGQGGTVGSTITLIF  203
            MGL GK+   V I      +HEIF +RPHH+ ++ S  IH +   EG+ G VGS +   +
Sbjct  1    MGLYGKLEKDVPIKASASKFHEIFHKRPHHISNVSSDIIHGVNLHEGEWGKVGSIVCWRY  60

Query  204  THEGKTK  224
              +GK++
Sbjct  61   FLDGKSR  67



>ref|XP_004237031.1| PREDICTED: kirola-like [Solanum lycopersicum]
Length=134

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 15/35 (43%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC  140
            M L+GK+V ++ I   GD+++E++R+RPHH+ +M 
Sbjct  1    MSLQGKLVSEINIKCDGDVFYEVYRQRPHHISTMS  35



>ref|XP_009339700.1| PREDICTED: MLP-like protein 28 [Pyrus x bretschneideri]
Length=155

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 37/68 (54%), Gaps = 8/68 (12%)
 Frame = +3

Query  48   GKVVGQVEISFHGDIYHEIFRERPHHLPSMCS------AIHSIEGQGGTVGSTITLIFTH  209
            GKV   VEI      +HE+F  +PHH+ +  +       +H  EG  GTVGS I   + H
Sbjct  6    GKVEADVEIKASAAKFHEMFTHKPHHISNASNRNIQGCDLH--EGDWGTVGSVIYWNYFH  63

Query  210  EGKTKMAE  233
            +GK K+A+
Sbjct  64   DGKAKVAK  71



>gb|EPS59252.1| hypothetical protein M569_15558 [Genlisea aurea]
Length=151

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 38/71 (54%), Gaps = 5/71 (7%)
 Frame = +3

Query  36   MGLKGK-VVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLI  200
            MG KGK VVGQ      GDI+H++ +  PH      P +       EG+ G  GS I   
Sbjct  1    MGAKGKLVVGQEFFPSKGDIFHQLLKNNPHAFSTSSPQIIQGCVVHEGEFGKPGSVIFWN  60

Query  201  FTHEGKTKMAE  233
            +TH+GK ++A+
Sbjct  61   YTHDGKERVAK  71



>ref|XP_008221417.1| PREDICTED: MLP-like protein 31 [Prunus mume]
Length=156

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/66 (38%), Positives = 35/66 (53%), Gaps = 4/66 (6%)
 Frame = +3

Query  48   GKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIFTHEG  215
            GKV   VEI      +HE+   RPHH+    P+        EG+ GTVGS +   + H+G
Sbjct  6    GKVETDVEIKAPATKFHEVLTHRPHHISNVSPNNIQGCDLHEGEWGTVGSVVYWNYFHDG  65

Query  216  KTKMAE  233
            K K+A+
Sbjct  66   KAKVAK  71



>gb|KHG17607.1| MLP-like protein 31 [Gossypium arboreum]
Length=157

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/69 (33%), Positives = 37/69 (54%), Gaps = 4/69 (6%)
 Frame = +3

Query  39   GLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIFT  206
             L GK+   VEI      +HE+F  +PHH+   C         +EG+ G VG+ I+  + 
Sbjct  5    ALTGKIEADVEIKSSPGQFHEMFAHKPHHVHHTCYDKIQGCDLLEGEWGKVGTIISWRYV  64

Query  207  HEGKTKMAE  233
            H+GK K+++
Sbjct  65   HDGKAKVSK  73



>ref|XP_010044191.1| PREDICTED: MLP-like protein 28 [Eucalyptus grandis]
 ref|XP_010041872.1| PREDICTED: MLP-like protein 28 [Eucalyptus grandis]
 gb|KCW86227.1| hypothetical protein EUGRSUZ_B02914 [Eucalyptus grandis]
Length=150

 Score = 45.1 bits (105),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (58%), Gaps = 3/64 (5%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIHS---IEGQGGTVGSTITLIFT  206
            M ++GK+  +V++    D ++  FR  PHHLP+ C+ +H+    EG+  T GS     ++
Sbjct  1    MAVRGKMEVEVDLKSSADQFYGFFRNTPHHLPTACTDLHAGEIHEGEWHTEGSIRKWTYS  60

Query  207  HEGK  218
             EGK
Sbjct  61   VEGK  64



>ref|XP_009592037.1| PREDICTED: MLP-like protein 28 [Nicotiana tomentosiformis]
Length=300

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 41/72 (57%), Gaps = 8/72 (11%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIHSIEG----QGGT--VGSTITL  197
            MG+KGK++  VE+   G + H+I     HHLP++C     + G    +GGT  VGS +  
Sbjct  1    MGVKGKLIASVEVKCGGHLVHDIIHTNTHHLPNICPG--KLNGFEIHEGGTVKVGSVVIW  58

Query  198  IFTHEGKTKMAE  233
             +  +GK K+A+
Sbjct  59   KYNDDGKDKIAK  70



>ref|XP_007045188.1| MLP protein 28 [Theobroma cacao]
 gb|EOY01020.1| MLP protein 28 [Theobroma cacao]
Length=125

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 37/68 (54%), Gaps = 4/68 (6%)
 Frame = +3

Query  42   LKGKVVGQVEISFHGDIYHEIFRERPHHLPSMC----SAIHSIEGQGGTVGSTITLIFTH  209
            L GKVV  VEI    + ++ +F   P  L S+C     A H ++G+ G +GS     + H
Sbjct  4    LIGKVVADVEIRASAEKFYGVFCNTPSQLSSICPDVIQACHLLDGEWGRLGSITHWSYVH  63

Query  210  EGKTKMAE  233
            +G+ K+A+
Sbjct  64   DGQAKVAK  71



>ref|XP_009608030.1| PREDICTED: MLP-like protein 43 [Nicotiana tomentosiformis]
Length=67

 Score = 44.3 bits (103),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 40/67 (60%), Gaps = 5/67 (7%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGLKGK+V  +E+   G ++H++++ +PHH+    P+  +     EG  G VGS +T  +
Sbjct  1    MGLKGKLVVSMEVKCGGHLFHDLYQTKPHHVSNISPNYVTGFDLHEGGIGEVGSVVTWKY  60

Query  204  THEGKTK  224
              EGK K
Sbjct  61   K-EGKYK  66



>ref|XP_007153302.1| hypothetical protein PHAVU_003G023600g [Phaseolus vulgaris]
 gb|ESW25296.1| hypothetical protein PHAVU_003G023600g [Phaseolus vulgaris]
Length=154

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 36/65 (55%), Gaps = 4/65 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA-IHSI---EGQGGTVGSTITLIF  203
            M L GKV G+VEI    D +  IFR++ HH+P++ S  IH+    EG    VGS      
Sbjct  1    MSLSGKVEGEVEIQASADKFFHIFRKKLHHVPNISSERIHAAKVHEGDWENVGSVKHWDI  60

Query  204  THEGK  218
            T EGK
Sbjct  61   TIEGK  65



>ref|XP_009127831.1| PREDICTED: MLP-like protein 31 [Brassica rapa]
Length=158

 Score = 44.7 bits (104),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 38/70 (54%), Gaps = 8/70 (11%)
 Frame = +3

Query  39   GLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA------IHSIEGQGGTVGSTITLI  200
             L GK+  +VEI    + +H +F ERPHH+P           +H  +G+ G VGS I   
Sbjct  6    SLLGKLEIEVEIKASAEKFHHMFAERPHHIPKATPGHIKGCDLH--DGEWGKVGSIIVWN  63

Query  201  FTHEGKTKMA  230
            + H+G+ K+A
Sbjct  64   YVHDGEPKVA  73



>gb|KDP44595.1| hypothetical protein JCGZ_22177 [Jatropha curcas]
Length=151

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            M L GK+   VEI    D +H++F  RPHHL    P         +G+ G  GS +   +
Sbjct  1    MSLTGKLEADVEIKASADKFHDVFGSRPHHLKHATPHNVQGCELHDGEFGKEGSVVCWNY  60

Query  204  THEGKTKMAE  233
             H+G  K+A+
Sbjct  61   VHDGVPKVAK  70



>gb|EPS71115.1| hypothetical protein M569_03645, partial [Genlisea aurea]
Length=145

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 36/70 (51%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MG KGK+V   E    G+++H+I +  PH      P         EG+ G  GS I   F
Sbjct  1    MGAKGKLVVAHEFPSKGEVFHQILKNNPHSFSTSSPQFIQGCVVDEGEFGKEGSVIIGNF  60

Query  204  THEGKTKMAE  233
            TH+GK K+A+
Sbjct  61   THDGKEKVAK  70



>ref|XP_004147670.1| PREDICTED: MLP-like protein 28-like [Cucumis sativus]
 ref|XP_004170314.1| PREDICTED: MLP-like protein 28-like [Cucumis sativus]
Length=320

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 41/71 (58%), Gaps = 6/71 (8%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSA--IHSI---EGQGGTVGSTITLI  200
            M L GK+   V I      +HE+F ++PHH+ + CS   IH +   EG+ G VGS I   
Sbjct  1    MSLCGKLEKDVPIRASASKFHEMFHKKPHHICN-CSTDKIHGVELQEGEWGQVGSIICWK  59

Query  201  FTHEGKTKMAE  233
            + HEGK K+A+
Sbjct  60   YFHEGKHKIAK  70


 Score = 46.2 bits (108),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 40/69 (58%), Gaps = 4/69 (6%)
 Frame = +3

Query  39   GLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCS-AIHSI---EGQGGTVGSTITLIFT  206
             L GK+   V I     ++HEIF ++PHH+ +  +  IH +   EG+ G VGS I   + 
Sbjct  168  DLYGKLETDVPIKASASMFHEIFHKKPHHISNASTDKIHGVDLHEGEWGQVGSIICWKYF  227

Query  207  HEGKTKMAE  233
            H+GK ++A+
Sbjct  228  HDGKARIAK  236



>ref|XP_002534267.1| Major latex protein, putative [Ricinus communis]
 gb|EEF28116.1| Major latex protein, putative [Ricinus communis]
Length=151

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 35/70 (50%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            M L GKV   V+I    D +H++   RPHH+    P         +G+ G  GS I   +
Sbjct  1    MALSGKVEADVKIKTSADKFHDVMGGRPHHMTIASPQKLQTCDLHDGEFGRKGSVICWNY  60

Query  204  THEGKTKMAE  233
             H+GK K+A+
Sbjct  61   VHDGKAKVAK  70



>ref|XP_007045180.1| MLP-like protein 28, putative [Theobroma cacao]
 gb|EOY01012.1| MLP-like protein 28, putative [Theobroma cacao]
Length=175

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 37/69 (54%), Gaps = 4/69 (6%)
 Frame = +3

Query  39   GLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCS-AIHSI---EGQGGTVGSTITLIFT  206
             L GKV   VE+      +H++F  +PHH+ + CS  + S    EG  G  GS +   + 
Sbjct  23   SLIGKVETDVELKSSAVKFHDMFCNKPHHVSNACSDKVQSCDLHEGNWGNEGSIVCWNYV  82

Query  207  HEGKTKMAE  233
            HEGK K+A+
Sbjct  83   HEGKPKVAK  91



>ref|XP_006367041.1| PREDICTED: MLP-like protein 28-like [Solanum tuberosum]
Length=146

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/69 (32%), Positives = 38/69 (55%), Gaps = 3/69 (4%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIHSI---EGQGGTVGSTITLIFT  206
            MGLKGK++  +E+   G + H+IF    HH+P++  A +     EG+   +GS I+  + 
Sbjct  1    MGLKGKLIASIEVKCGGHLIHDIFHTNAHHVPTISRAFNRFEIHEGEIVKIGSIISWNYN  60

Query  207  HEGKTKMAE  233
              G+ K  +
Sbjct  61   DGGQNKFTK  69



>ref|XP_006367813.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=146

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/70 (33%), Positives = 37/70 (53%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGLKGK++  VE+   G ++H+I   + HH+    PS   +    EG+   VGS +   +
Sbjct  1    MGLKGKLISSVEVKCGGHLFHDILHAKTHHISNISPSKVKSFEIHEGETVDVGSIVQWTY  60

Query  204  THEGKTKMAE  233
              +GK K  +
Sbjct  61   NDDGKDKTCK  70



>ref|XP_006366068.1| PREDICTED: kirola-like [Solanum tuberosum]
Length=147

 Score = 44.3 bits (103),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 39/70 (56%), Gaps = 4/70 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHLPSMCSAIHS----IEGQGGTVGSTITLIF  203
            MGLKGK++G +E+   G   H+I    PHHLP++   + +     EG+   VGS ++  F
Sbjct  1    MGLKGKLIGSIEVKCGGHSIHDIIHINPHHLPNIAPNVLNHFEIHEGETIKVGSIVSWKF  60

Query  204  THEGKTKMAE  233
             H G   +++
Sbjct  61   NHGGNEILSK  70



>gb|EYU17813.1| hypothetical protein MIMGU_mgv1a014581mg [Erythranthe guttata]
Length=185

 Score = 45.1 bits (105),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 36/67 (54%), Gaps = 4/67 (6%)
 Frame = +3

Query  36   MGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLIF  203
            MGL GK++  +E    GD++HE+ R +P  L    P         EG+ G VG+ ++  +
Sbjct  34   MGLPGKLIAAIEFKAGGDVFHELIRHKPDQLSTIHPGKVQGCDLHEGEFGHVGTVLSFKY  93

Query  204  THEGKTK  224
            TH GK +
Sbjct  94   THGGKDR  100



>ref|NP_198153.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
 gb|AED93758.1| polyketide cyclase/dehydrase and lipid transport superfamily 
protein [Arabidopsis thaliana]
Length=166

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/70 (36%), Positives = 38/70 (54%), Gaps = 4/70 (6%)
 Frame = +3

Query  33   KMGLKGKVVGQVEISFHGDIYHEIFRERPHHL----PSMCSAIHSIEGQGGTVGSTITLI  200
            K  L GK+  +VEI     I++ I+  RPHH+    P    +    +G+ GTVGS +   
Sbjct  12   KSSLLGKLEVEVEIKAPAAIFYHIYAGRPHHVAKATPRNVQSCDLHDGEWGTVGSIVYWN  71

Query  201  FTHEGKTKMA  230
            + HEG+ K+A
Sbjct  72   YVHEGQAKVA  81



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 532237784247