BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16531_g1_i2 len=1105 path=[197:0-317 515:318-787 196:788-1104]

Length=1105
                                                                      Score     E

ref|XP_009620491.1|  PREDICTED: cytochrome P450 CYP72A219-like          522   7e-180   
ref|XP_009781171.1|  PREDICTED: cytochrome P450 CYP72A219-like          512   4e-177   
ref|XP_006363763.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      504   1e-172   
ref|XP_009617254.1|  PREDICTED: cytochrome P450 CYP72A219-like          500   3e-171   
ref|XP_009789309.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    496   1e-169   
ref|XP_004243845.1|  PREDICTED: cytochrome P450 CYP72A219-like          495   2e-169   
ref|XP_009789316.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    494   7e-169   
ref|XP_009617253.1|  PREDICTED: cytochrome P450 CYP72A219-like          493   1e-168   
ref|XP_006363756.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      488   2e-166   
ref|XP_006348901.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    486   5e-166   
ref|XP_004243263.1|  PREDICTED: cytochrome P450 CYP72A219-like          486   1e-165   
ref|XP_004243253.1|  PREDICTED: cytochrome P450 CYP72A219               484   4e-165   
ref|XP_006348911.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      484   5e-165   
gb|EYU43426.1|  hypothetical protein MIMGU_mgv1a018638mg                466   2e-160   
ref|XP_004243260.1|  PREDICTED: cytochrome P450 CYP72A219               472   3e-160   
ref|XP_006348303.1|  PREDICTED: secologanin synthase-like               469   3e-159   
ref|XP_006348304.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    469   5e-159   
ref|XP_004244272.1|  PREDICTED: cytochrome P450 CYP72A219-like          468   2e-158   
ref|XP_009615907.1|  PREDICTED: cytochrome P450 CYP72A219-like          465   1e-157   
ref|XP_011082968.1|  PREDICTED: cytochrome P450 CYP72A219-like          463   6e-157   
ref|XP_009758460.1|  PREDICTED: cytochrome P450 CYP72A219-like          464   6e-157   
gb|ABC69419.1|  CYP72A56                                                463   9e-157   Nicotiana tabacum [American tobacco]
ref|XP_004243258.1|  PREDICTED: cytochrome P450 CYP72A219-like          459   2e-155   
ref|XP_006348908.1|  PREDICTED: secologanin synthase-like               459   3e-155   
ref|XP_004243259.1|  PREDICTED: cytochrome P450 CYP72A219-like          458   7e-155   
ref|XP_006348907.1|  PREDICTED: secologanin synthase-like               457   3e-154   
ref|XP_004243256.1|  PREDICTED: cytochrome P450 CYP72A219-like          456   3e-154   
ref|XP_004243262.1|  PREDICTED: cytochrome P450 CYP72A219-like          455   1e-153   
ref|XP_004243255.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X1    455   1e-153   
ref|XP_006348910.1|  PREDICTED: secologanin synthase-like               452   1e-152   
ref|XP_004244274.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    450   7e-152   
gb|EYU31636.1|  hypothetical protein MIMGU_mgv1a004595mg                450   1e-151   
ref|XP_009797873.1|  PREDICTED: cytochrome P450 CYP72A219-like          449   3e-151   
ref|XP_009615908.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    449   3e-151   
gb|ABC69422.1|  CYP72A58                                                448   4e-151   Nicotiana tabacum [American tobacco]
ref|XP_006348909.1|  PREDICTED: secologanin synthase-like               447   1e-150   
emb|CDP19599.1|  unnamed protein product                                446   3e-150   
ref|XP_009796418.1|  PREDICTED: cytochrome P450 CYP72A219-like          446   6e-150   
emb|CDP19601.1|  unnamed protein product                                444   2e-149   
gb|ABC69417.1|  CYP72A54                                                444   2e-149   Nicotiana tabacum [American tobacco]
ref|XP_011082966.1|  PREDICTED: cytochrome P450 CYP72A219-like          443   4e-149   
ref|XP_004243261.1|  PREDICTED: cytochrome P450 CYP72A219-like          442   1e-148   
emb|CDP15976.1|  unnamed protein product                                442   1e-148   
ref|XP_002268319.1|  PREDICTED: cytochrome P450 CYP72A219               442   1e-148   Vitis vinifera
ref|XP_004243257.1|  PREDICTED: cytochrome P450 CYP72A219-like          442   2e-148   
emb|CDP15988.1|  unnamed protein product                                441   2e-148   
ref|XP_011082969.1|  PREDICTED: cytochrome P450 CYP72A219-like          441   3e-148   
ref|XP_009607556.1|  PREDICTED: cytochrome P450 CYP72A219-like          441   6e-148   
ref|XP_006348302.1|  PREDICTED: secologanin synthase-like               439   1e-147   
emb|CDP15975.1|  unnamed protein product                                439   2e-147   
ref|XP_002262693.1|  PREDICTED: cytochrome P450 CYP72A219               438   4e-147   Vitis vinifera
emb|CBI22139.3|  unnamed protein product                                434   5e-147   
sp|H2DH21.1|C7A29_PANGI  RecName: Full=Cytochrome P450 CYP72A219;...    438   5e-147   
ref|XP_006348982.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      448   2e-146   
ref|XP_004244273.1|  PREDICTED: cytochrome P450 CYP72A219-like          436   2e-146   
ref|XP_002270501.2|  PREDICTED: cytochrome P450 CYP72A219-like          436   3e-146   Vitis vinifera
ref|XP_006360179.1|  PREDICTED: secologanin synthase-like               434   1e-145   
ref|XP_010644780.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    433   4e-145   
ref|XP_002265455.1|  PREDICTED: cytochrome P450 CYP72A219               432   9e-145   Vitis vinifera
ref|XP_006348906.1|  PREDICTED: secologanin synthase-like               432   1e-144   
ref|XP_006364092.1|  PREDICTED: secologanin synthase-like               432   2e-144   
emb|CDP19600.1|  unnamed protein product                                431   2e-144   
emb|CBI39916.3|  unnamed protein product                                431   2e-144   
ref|XP_004248200.1|  PREDICTED: cytochrome P450 CYP72A219-like          431   5e-144   
ref|XP_009628921.1|  PREDICTED: cytochrome P450 CYP72A219-like          429   1e-143   
gb|AJD25167.1|  cytochrome P450 CYP72A326                               429   1e-143   
ref|XP_010644729.1|  PREDICTED: cytochrome P450 CYP72A219-like          429   2e-143   
ref|NP_001291324.1|  cytochrome P450 CYP72A219-like                     428   3e-143   
ref|XP_002265784.2|  PREDICTED: cytochrome P450 CYP72A219-like          429   3e-143   Vitis vinifera
ref|XP_004243254.1|  PREDICTED: cytochrome P450 CYP72A219-like          428   3e-143   
gb|ABC69389.1|  CYP72A52v1                                              428   3e-143   Nicotiana tabacum [American tobacco]
ref|XP_010644781.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    428   3e-143   
gb|EYU31635.1|  hypothetical protein MIMGU_mgv1a025572mg                427   1e-142   
gb|AFO64616.1|  cytochrome P450 mono-oxygenase                          426   3e-142   
ref|XP_004248734.1|  PREDICTED: cytochrome P450 CYP72A219               426   4e-142   
ref|XP_006349622.1|  PREDICTED: secologanin synthase-like               425   6e-142   
emb|CDP15973.1|  unnamed protein product                                425   6e-142   
emb|CDP19609.1|  unnamed protein product                                424   2e-141   
gb|AJD25168.1|  cytochrome P450 CYP72A327                               424   2e-141   
ref|XP_009790250.1|  PREDICTED: cytochrome P450 CYP72A219-like          424   3e-141   
gb|AJD25169.1|  cytochrome P450 CYP72A328                               424   3e-141   
ref|XP_002271303.2|  PREDICTED: cytochrome P450 CYP72A219-like          422   5e-141   Vitis vinifera
gb|AJD25171.1|  cytochrome P450 CYP72A330                               422   8e-141   
ref|XP_006477948.1|  PREDICTED: secologanin synthase-like               422   9e-141   
emb|CDP15983.1|  unnamed protein product                                422   9e-141   
ref|XP_003634773.1|  PREDICTED: cytochrome P450 CYP72A219               422   1e-140   
ref|XP_004242635.1|  PREDICTED: cytochrome P450 CYP72A219-like          422   1e-140   
ref|XP_006477946.1|  PREDICTED: secologanin synthase-like               421   2e-140   
emb|CDP15986.1|  unnamed protein product                                419   4e-140   
gb|AJD25170.1|  cytochrome P450 CYP72A329                               420   7e-140   
ref|XP_006343585.1|  PREDICTED: secologanin synthase-like               420   7e-140   
emb|CBI22133.3|  unnamed protein product                                424   8e-140   
ref|XP_009790251.1|  PREDICTED: cytochrome P450 CYP72A219-like          420   8e-140   
emb|CBI22129.3|  unnamed protein product                                417   9e-140   
gb|ABC69390.1|  CYP72A53v1                                              419   1e-139   Nicotiana tabacum [American tobacco]
gb|ABC69393.1|  CYP72A55v2                                              419   2e-139   Nicotiana tabacum [American tobacco]
ref|XP_009618785.1|  PREDICTED: cytochrome P450 CYP72A219-like          419   2e-139   
emb|CAN67740.1|  hypothetical protein VITISV_015554                     417   7e-139   Vitis vinifera
gb|ABC69392.1|  CYP72A55v1                                              417   9e-139   Nicotiana tabacum [American tobacco]
ref|XP_002270326.1|  PREDICTED: cytochrome P450 CYP72A219               416   3e-138   Vitis vinifera
ref|XP_002263609.1|  PREDICTED: cytochrome P450 CYP72A219               415   5e-138   Vitis vinifera
emb|CDP15978.1|  unnamed protein product                                414   8e-138   
ref|XP_010092742.1|  Secologanin synthase                               414   1e-137   
emb|CBI22134.3|  unnamed protein product                                414   1e-137   
emb|CBI39886.3|  unnamed protein product                                415   2e-137   
gb|EYU30753.1|  hypothetical protein MIMGU_mgv1a004802mg                413   2e-137   
ref|XP_004166892.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    412   6e-137   
gb|EYU30744.1|  hypothetical protein MIMGU_mgv1a004594mg                412   1e-136   
emb|CDP15985.1|  unnamed protein product                                411   2e-136   
ref|XP_006495014.1|  PREDICTED: secologanin synthase-like               411   2e-136   
ref|XP_006477949.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    411   2e-136   
gb|EYU31631.1|  hypothetical protein MIMGU_mgv1a004628mg                406   2e-136   
ref|XP_009356840.1|  PREDICTED: cytochrome P450 CYP72A219-like          410   3e-136   
emb|CDP11335.1|  unnamed protein product                                410   7e-136   
ref|XP_008386157.1|  PREDICTED: cytochrome P450 CYP72A219-like          409   1e-135   
ref|XP_009343587.1|  PREDICTED: cytochrome P450 CYP72A219-like          409   1e-135   
ref|XP_008226211.1|  PREDICTED: cytochrome P450 CYP72A219-like          409   2e-135   
ref|XP_006348902.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    405   2e-135   
emb|CDP15982.1|  unnamed protein product                                407   4e-135   
gb|EYU31630.1|  hypothetical protein MIMGU_mgv1a004628mg                406   1e-134   
emb|CDP15981.1|  unnamed protein product                                405   3e-134   
dbj|BAL45206.1|  cytochrome P450 monooxygenase                          406   3e-134   
ref|XP_009594691.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    400   2e-133   
gb|KEH38475.1|  cytochrome P450 family 72 protein                       403   2e-133   
ref|XP_006594768.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      403   3e-133   
ref|XP_004488669.1|  PREDICTED: secologanin synthase-like               403   3e-133   
gb|KHN14193.1|  Secologanin synthase                                    402   8e-133   
ref|XP_009339349.1|  PREDICTED: cytochrome P450 CYP72A219-like          402   9e-133   
ref|XP_006598136.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    397   1e-132   
ref|XP_009594690.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    401   1e-132   
gb|AHK60841.1|  CYP72A225                                               402   1e-132   
ref|XP_006364094.1|  PREDICTED: secologanin synthase-like               401   2e-132   
ref|XP_009339348.1|  PREDICTED: cytochrome P450 CYP72A219-like          401   2e-132   
gb|KHN36820.1|  Secologanin synthase                                    400   2e-132   
ref|XP_006598137.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    400   2e-132   
ref|XP_008386388.1|  PREDICTED: cytochrome P450 CYP72A219-like          400   3e-132   
gb|KEH38478.1|  cytochrome P450 family 72 protein                       400   3e-132   
ref|XP_008452436.1|  PREDICTED: cytochrome P450 CYP72A219-like          400   5e-132   
ref|XP_008226213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    400   5e-132   
ref|XP_007212438.1|  hypothetical protein PRUPE_ppa016770mg             399   5e-132   
gb|KHN44056.1|  Secologanin synthase                                    399   7e-132   
ref|XP_004488668.1|  PREDICTED: secologanin synthase-like               399   7e-132   
emb|CDP15979.1|  unnamed protein product                                399   7e-132   
ref|XP_008226215.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    399   8e-132   
gb|AIA82924.1|  SLS1                                                    399   1e-131   
ref|XP_004166890.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    399   1e-131   
ref|XP_008452438.1|  PREDICTED: cytochrome P450 CYP72A219-like          399   2e-131   
ref|XP_003546751.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    398   3e-131   
gb|AJD25172.1|  cytochrome P450 CYP72A331                               398   3e-131   
ref|XP_007213922.1|  hypothetical protein PRUPE_ppa004271mg             398   3e-131   
ref|XP_004146005.1|  PREDICTED: secologanin synthase-like               398   4e-131   
gb|KHN47456.1|  Secologanin synthase                                    398   5e-131   
ref|XP_003543171.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      398   5e-131   
ref|XP_009790240.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    397   6e-131   
ref|XP_008226214.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    397   7e-131   
ref|XP_004244382.2|  PREDICTED: cytochrome P450 CYP72A219-like          396   9e-131   
ref|XP_006364091.1|  PREDICTED: secologanin synthase-like               396   1e-130   
dbj|BAF98466.1|  cytochrome P450                                        396   1e-130   Coptis japonica var. dissecta
ref|XP_008226210.1|  PREDICTED: cytochrome P450 CYP72A219-like          396   1e-130   
ref|XP_006495013.1|  PREDICTED: secologanin synthase-like               397   1e-130   
gb|KHN44057.1|  Secologanin synthase                                    396   2e-130   
ref|XP_009394212.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    396   2e-130   
ref|XP_010092744.1|  Secologanin synthase                               397   2e-130   
ref|XP_006364093.1|  PREDICTED: secologanin synthase-like               396   2e-130   
ref|XP_002263652.1|  PREDICTED: cytochrome P450 CYP72A219-like          395   3e-130   Vitis vinifera
ref|XP_009394213.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    395   3e-130   
ref|XP_004169020.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    396   3e-130   
ref|XP_004295683.1|  PREDICTED: secologanin synthase-like               395   4e-130   
ref|XP_004135800.1|  PREDICTED: secologanin synthase-like               394   1e-129   
ref|XP_004307203.1|  PREDICTED: secologanin synthase-like               395   1e-129   
ref|XP_008450754.1|  PREDICTED: cytochrome P450 CYP72A219-like          393   2e-129   
emb|CDP15980.1|  unnamed protein product                                393   2e-129   
ref|XP_007149362.1|  hypothetical protein PHAVU_005G063900g             392   4e-129   
ref|XP_004248201.1|  PREDICTED: cytochrome P450 CYP72A219-like          392   4e-129   
ref|XP_004171842.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    394   5e-129   
ref|XP_004294187.1|  PREDICTED: secologanin synthase-like               391   2e-128   
ref|XP_009394216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    391   2e-128   
ref|XP_008386384.1|  PREDICTED: cytochrome P450 CYP72A219-like          390   2e-128   
ref|XP_009343590.1|  PREDICTED: cytochrome P450 CYP72A219-like          390   3e-128   
gb|EPS70870.1|  hypothetical protein M569_03891                         391   3e-128   
ref|XP_007149352.1|  hypothetical protein PHAVU_005G063200g             389   6e-128   
ref|XP_008366858.1|  PREDICTED: cytochrome P450 CYP72A219-like          389   6e-128   
ref|XP_007149353.1|  hypothetical protein PHAVU_005G063300g             389   1e-127   
ref|XP_009339350.1|  PREDICTED: cytochrome P450 CYP72A219-like          389   1e-127   
ref|XP_004166891.1|  PREDICTED: secologanin synthase-like               389   1e-127   
ref|XP_009339373.1|  PREDICTED: cytochrome P450 CYP72A219-like          388   1e-127   
ref|XP_011098148.1|  PREDICTED: cytochrome P450 CYP72A219-like          388   2e-127   
ref|XP_009602242.1|  PREDICTED: cytochrome P450 CYP72A219-like          388   2e-127   
ref|XP_009356829.1|  PREDICTED: cytochrome P450 CYP72A219-like          387   3e-127   
ref|XP_010060775.1|  PREDICTED: cytochrome P450 72A15-like              387   3e-127   
dbj|BAL45198.1|  cytochrome P450 monooxygenase                          387   3e-127   
ref|XP_009339365.1|  PREDICTED: cytochrome P450 CYP72A219-like          387   6e-127   
ref|XP_004146075.1|  PREDICTED: secologanin synthase-like               388   6e-127   
ref|XP_009394217.1|  PREDICTED: cytochrome P450 CYP72A219-like          387   6e-127   
ref|XP_008798317.1|  PREDICTED: LOW QUALITY PROTEIN: cytochrome P...    387   8e-127   
gb|ABC59078.1|  cytochrome P450 monooxygenase CYP72A59                  386   1e-126   Medicago truncatula
ref|XP_010926800.1|  PREDICTED: cytochrome P450 72A15-like isofor...    385   2e-126   
gb|EPS69403.1|  hypothetical protein M569_05363                         384   3e-126   
ref|XP_010060773.1|  PREDICTED: cytochrome P450 72A15-like              385   3e-126   
emb|CBI39937.3|  unnamed protein product                                383   3e-126   
gb|AEI59772.1|  cytochrome P450                                         385   3e-126   
ref|XP_010694547.1|  PREDICTED: cytochrome P450 72A15-like              385   4e-126   
gb|KHG14489.1|  Secologanin synthase                                    385   4e-126   
ref|XP_010275181.1|  PREDICTED: cytochrome P450 CYP72A219-like          385   4e-126   
ref|XP_010060783.1|  PREDICTED: cytochrome P450 72A15-like              384   4e-126   
ref|XP_010060778.1|  PREDICTED: cytochrome P450 72A15-like isofor...    384   5e-126   
ref|XP_007022097.1|  Cytochrome P450, family 72, subfamily A, pol...    384   7e-126   
ref|XP_008226217.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    384   8e-126   
ref|XP_009797437.1|  PREDICTED: cytochrome P450 CYP72A219-like          384   9e-126   
ref|XP_007022098.1|  Cytochrome P450, family 72, subfamily A, pol...    384   9e-126   
ref|XP_008226216.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    384   1e-125   
gb|KCW67646.1|  hypothetical protein EUGRSUZ_F01394                     383   2e-125   
ref|XP_008226302.1|  PREDICTED: cytochrome P450 CYP72A219-like          382   3e-125   
ref|XP_010060776.1|  PREDICTED: cytochrome P450 72A15-like              382   3e-125   
ref|XP_011082818.1|  PREDICTED: cytochrome P450 CYP72A219-like          382   3e-125   
ref|XP_010064522.1|  PREDICTED: cytochrome P450 72A15-like              382   4e-125   
ref|XP_010324391.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    380   6e-125   
ref|XP_007149376.1|  hypothetical protein PHAVU_005G065000g             382   6e-125   
ref|XP_009343589.1|  PREDICTED: cytochrome P450 CYP72A219-like          381   7e-125   
emb|CBI39923.3|  unnamed protein product                                379   7e-125   
ref|XP_011098146.1|  PREDICTED: cytochrome P450 CYP72A219-like          381   8e-125   
ref|XP_011098149.1|  PREDICTED: cytochrome P450 CYP72A219-like          381   1e-124   
ref|XP_007022099.1|  Cytochrome P450, family 72, subfamily A, pol...    380   2e-124   
emb|CDP15974.1|  unnamed protein product                                378   2e-124   
ref|XP_010926817.1|  PREDICTED: cytochrome P450 72A15-like isofor...    380   2e-124   
ref|XP_007149361.1|  hypothetical protein PHAVU_005G063800g             380   2e-124   
emb|CBI39929.3|  unnamed protein product                                378   2e-124   
ref|XP_009394210.1|  PREDICTED: cytochrome P450 CYP72A219-like          380   2e-124   
emb|CAN72865.1|  hypothetical protein VITISV_029731                     379   3e-124   Vitis vinifera
ref|XP_010926808.1|  PREDICTED: cytochrome P450 72A15-like isofor...    380   3e-124   
ref|XP_007022096.1|  Cytochrome P450, family 72, subfamily A, pol...    378   4e-124   
ref|XP_010060779.1|  PREDICTED: cytochrome P450 72A15-like isofor...    379   7e-124   
ref|XP_008219216.1|  PREDICTED: cytochrome P450 CYP72A219-like          378   1e-123   
ref|XP_010502007.1|  PREDICTED: cytochrome P450 72A15-like              377   2e-123   
ref|XP_006377672.1|  hypothetical protein POPTR_0011s101202g            373   4e-123   
ref|XP_010060780.1|  PREDICTED: cytochrome P450 72A15-like              377   4e-123   
ref|XP_010041835.1|  PREDICTED: cytochrome P450 72A15-like              372   5e-123   
ref|XP_010060782.1|  PREDICTED: cytochrome P450 72A15-like              376   5e-123   
ref|XP_010241316.1|  PREDICTED: cytochrome P450 CYP72A219-like          377   6e-123   
emb|CBI39938.3|  unnamed protein product                                374   1e-122   
ref|XP_010911572.1|  PREDICTED: cytochrome P450 CYP72A219-like          376   1e-122   
ref|XP_010465353.1|  PREDICTED: cytochrome P450 72A13-like              375   1e-122   
gb|KEH36886.1|  cytochrome P450 family monooxygenase                    370   2e-122   
ref|XP_004295684.1|  PREDICTED: secologanin synthase-like               375   2e-122   
ref|XP_006477887.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      375   2e-122   
gb|EYU38228.1|  hypothetical protein MIMGU_mgv1a004669mg                375   2e-122   
ref|XP_006442316.1|  hypothetical protein CICLE_v10024206mg             375   3e-122   
ref|XP_010465357.1|  PREDICTED: cytochrome P450 72A13-like              374   3e-122   
ref|XP_010487267.1|  PREDICTED: cytochrome P450 72A15-like              375   4e-122   
ref|XP_010465361.1|  PREDICTED: cytochrome P450 72A13-like              374   4e-122   
emb|CDX97592.1|  BnaA05g24870D                                          374   4e-122   
ref|XP_010060784.1|  PREDICTED: cytochrome P450 72A15-like              374   4e-122   
ref|XP_002882888.1|  CYP72A15                                           374   6e-122   
gb|KFK38819.1|  hypothetical protein AALP_AA3G164600                    373   1e-121   
ref|XP_006477888.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      373   1e-121   
ref|XP_008452437.1|  PREDICTED: cytochrome P450 CYP72A219-like          373   1e-121   
dbj|BAL45203.1|  cytochrome P450 monooxygenase                          373   2e-121   
ref|XP_007149364.1|  hypothetical protein PHAVU_005G064100g             372   3e-121   
ref|XP_010644766.1|  PREDICTED: cytochrome P450 CYP72A219-like          370   3e-121   
gb|AGX93044.1|  secologanin synthase-like protein                       372   3e-121   
emb|CDP19608.1|  unnamed protein product                                370   3e-121   
emb|CBI39917.3|  unnamed protein product                                370   3e-121   
ref|XP_006377693.1|  hypothetical protein POPTR_0011s10300g             372   3e-121   
ref|XP_006442317.1|  hypothetical protein CICLE_v10023602mg             372   4e-121   
ref|XP_010502032.1|  PREDICTED: cytochrome P450 72A13-like isofor...    372   4e-121   
ref|XP_010487266.1|  PREDICTED: cytochrome P450 72A13-like              371   5e-121   
ref|XP_010542332.1|  PREDICTED: cytochrome P450 72A13-like              371   5e-121   
gb|ADU19849.1|  putative secologanin synthase                           372   6e-121   
emb|CDX98485.1|  BnaC05g38900D                                          371   6e-121   
ref|XP_004168302.1|  PREDICTED: secologanin synthase-like               371   7e-121   
ref|XP_011082820.1|  PREDICTED: cytochrome P450 CYP72A219-like          371   7e-121   
ref|XP_009146334.1|  PREDICTED: cytochrome P450 72A15                   371   9e-121   
gb|EPS61577.1|  hypothetical protein M569_13217                         371   9e-121   
ref|XP_007224159.1|  hypothetical protein PRUPE_ppa016446mg             371   9e-121   
ref|XP_006407055.1|  hypothetical protein EUTSA_v10020534mg             370   1e-120   
ref|XP_011009102.1|  PREDICTED: cytochrome P450 72A15-like isofor...    372   1e-120   
ref|XP_008219294.1|  PREDICTED: cytochrome P450 CYP72A219-like          370   1e-120   
gb|KFK38823.1|  hypothetical protein AALP_AA3G165300                    370   2e-120   
ref|XP_010465355.1|  PREDICTED: cytochrome P450 72A15-like              370   2e-120   
ref|XP_006477952.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      370   2e-120   
ref|XP_007227257.1|  hypothetical protein PRUPE_ppa017915mg             370   3e-120   
ref|XP_010275170.1|  PREDICTED: cytochrome P450 CYP72A219-like          370   3e-120   
ref|XP_010926829.1|  PREDICTED: cytochrome P450 72A11-like              369   4e-120   
gb|ABC59075.1|  cytochrome P450 monooxygenase CYP72A67                  369   5e-120   
gb|AGX93058.1|  7-deoxyloganic acid 7-hydroxylase-like protein          369   5e-120   
ref|NP_188087.1|  cytochrome P450, family 72, subfamily A, polype...    369   6e-120   
ref|XP_006495010.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      369   6e-120   
gb|KCW67648.1|  hypothetical protein EUGRSUZ_F01396                     369   7e-120   
ref|XP_006495017.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    368   1e-119   
ref|XP_008785718.1|  PREDICTED: cytochrome P450 CYP72A219-like          368   1e-119   
ref|XP_006495016.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    368   1e-119   
ref|XP_008804072.1|  PREDICTED: cytochrome P450 72A15-like              368   1e-119   
gb|KEH38469.1|  cytochrome P450 family 709 protein                      368   2e-119   
gb|KHG18227.1|  Secologanin synthase                                    367   2e-119   
gb|AGX93046.1|  secologanin synthase-like protein                       367   3e-119   
ref|XP_010465360.1|  PREDICTED: cytochrome P450 72A15                   367   4e-119   
emb|CDP06075.1|  unnamed protein product                                370   4e-119   
ref|XP_010535012.1|  PREDICTED: cytochrome P450 72A13-like              366   5e-119   
gb|AEI59771.1|  cytochrome P450                                         365   8e-119   
ref|XP_009394812.1|  PREDICTED: cytochrome P450 72A15-like              366   8e-119   
ref|XP_011009101.1|  PREDICTED: cytochrome P450 CYP72A219-like          367   9e-119   
ref|XP_010502020.1|  PREDICTED: cytochrome P450 72A13 isoform X2        365   1e-118   
emb|CDX82468.1|  BnaA03g33530D                                          365   1e-118   
ref|XP_010927467.1|  PREDICTED: cytochrome P450 72A15-like              365   2e-118   
emb|CDP19607.1|  unnamed protein product                                363   3e-118   
ref|XP_010927457.1|  PREDICTED: cytochrome P450 72A15-like              365   3e-118   
ref|XP_011083293.1|  PREDICTED: cytochrome P450 CYP72A219-like          364   3e-118   
ref|XP_009395215.1|  PREDICTED: cytochrome P450 CYP72A219-like          364   3e-118   
ref|XP_004300362.1|  PREDICTED: secologanin synthase-like               364   3e-118   
ref|XP_006299550.1|  hypothetical protein CARUB_v10015724mg             364   4e-118   
gb|EPS61172.1|  hypothetical protein M569_13627                         364   4e-118   
gb|KFK38821.1|  hypothetical protein AALP_AA3G164800                    364   4e-118   
ref|XP_006407058.1|  hypothetical protein EUTSA_v10021993mg             363   5e-118   
ref|XP_010535013.1|  PREDICTED: cytochrome P450 72A13-like              363   6e-118   
gb|EYU26273.1|  hypothetical protein MIMGU_mgv1a004412mg                363   8e-118   
ref|NP_188082.1|  cytochrome P450, family 72, subfamily A, polype...    363   1e-117   
gb|EPS65653.1|  hypothetical protein M569_09124                         362   1e-117   
emb|CDX97589.1|  BnaA05g24900D                                          362   1e-117   
gb|KEH28455.1|  cytochrome P450 family 72 protein                       359   1e-117   
ref|XP_010927481.1|  PREDICTED: cytochrome P450 CYP72A219-like          363   2e-117   
ref|XP_010926866.1|  PREDICTED: cytochrome P450 72A15-like              362   2e-117   
emb|CDX97593.1|  BnaA05g24860D                                          361   4e-117   
ref|XP_010323670.1|  PREDICTED: cytochrome P450 CYP72A219 isoform X2    358   4e-117   
gb|KEH37984.1|  cytochrome P450 family 72 protein                       357   4e-117   
ref|XP_010465358.1|  PREDICTED: cytochrome P450 72A13-like isofor...    361   5e-117   
ref|XP_010502013.1|  PREDICTED: cytochrome P450 72A13 isoform X1        361   5e-117   
ref|XP_003525967.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      361   6e-117   
ref|XP_010465366.1|  PREDICTED: cytochrome P450 72A13-like              360   8e-117   
ref|NP_188080.1|  cytochrome P450, family 72, subfamily A, polype...    360   8e-117   
emb|CDX98486.1|  BnaC05g38890D                                          360   8e-117   
emb|CDY32348.1|  BnaC01g36670D                                          360   9e-117   
gb|AAL38603.1|AF446870_1  AT3g14620/MIE1_12                             360   1e-116   
gb|AGX93059.1|  7-deoxyloganic acid 7-hydroxylase-like protein          360   1e-116   
gb|EPS61578.1|  hypothetical protein M569_13218                         359   1e-116   
ref|XP_009146337.1|  PREDICTED: cytochrome P450 72A13                   360   2e-116   
ref|XP_010552154.1|  PREDICTED: cytochrome P450 72A15-like              361   2e-116   
ref|XP_006348305.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-lik...    356   2e-116   
ref|XP_009135394.1|  PREDICTED: cytochrome P450 72A15-like              359   2e-116   
ref|XP_003617766.1|  Cytochrome P450 monooxygenase CYP72A59             359   3e-116   
gb|AGX93061.1|  7-deoxyloganic acid 7-hydroxylase-like protein          359   3e-116   
gb|AGX93060.1|  7-deoxyloganic acid 7-hydroxylase-like protein          358   5e-116   
ref|XP_004969235.1|  PREDICTED: secologanin synthase-like               359   5e-116   
gb|KFK38824.1|  hypothetical protein AALP_AA3G165400                    370   6e-116   
ref|XP_004301212.1|  PREDICTED: secologanin synthase-like               358   6e-116   
ref|XP_003543172.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      358   8e-116   
gb|EPS68529.1|  hypothetical protein M569_06239                         352   8e-116   
ref|XP_010676732.1|  PREDICTED: cytochrome P450 CYP72A219-like          358   9e-116   
ref|XP_006495015.1|  PREDICTED: secologanin synthase-like               352   1e-115   
ref|XP_004294189.1|  PREDICTED: secologanin synthase-like               358   1e-115   
gb|EYU26264.1|  hypothetical protein MIMGU_mgv1a004586mg                358   1e-115   
gb|KFK38825.1|  hypothetical protein AALP_AA3G165400                    370   1e-115   
ref|XP_010676734.1|  PREDICTED: cytochrome P450 CYP72A219-like          358   1e-115   
ref|XP_006442298.1|  hypothetical protein CICLE_v10019876mg             357   1e-115   
ref|XP_009394814.1|  PREDICTED: cytochrome P450 72A13-like isofor...    358   1e-115   
ref|XP_009146335.1|  PREDICTED: cytochrome P450 72A15-like              357   2e-115   
emb|CDY51038.1|  BnaA06g03010D                                          357   2e-115   
gb|AGX93045.1|  secologanin synthase-like protein                       357   2e-115   
ref|XP_002458199.1|  hypothetical protein SORBIDRAFT_03g028600          357   3e-115   
gb|KEH37983.1|  cytochrome P450 family 72 protein                       357   3e-115   
ref|XP_004294188.1|  PREDICTED: secologanin synthase-like               357   3e-115   
gb|AGX93057.1|  7-deoxyloganic acid 7-hydroxylase-like protein          356   5e-115   
gb|ABC59077.1|  cytochrome P450 monooxygenase CYP72A68                  356   6e-115   
ref|NP_188084.1|  cytochrome P450, family 72, subfamily A, polype...    355   7e-115   
emb|CAN63404.1|  hypothetical protein VITISV_001871                     354   7e-115   
ref|XP_007212563.1|  hypothetical protein PRUPE_ppa015526mg             355   7e-115   
emb|CDP06076.1|  unnamed protein product                                355   7e-115   
ref|XP_010678727.1|  PREDICTED: cytochrome P450 CYP72A219-like          356   8e-115   
ref|XP_006299313.1|  hypothetical protein CARUB_v10015468mg             355   9e-115   
ref|XP_006300449.1|  hypothetical protein CARUB_v10020157mg             355   1e-114   
ref|XP_004488695.1|  PREDICTED: secologanin synthase-like               355   2e-114   
ref|NP_188086.1|  cytochrome P450, family 72, subfamily A, polype...    354   2e-114   
ref|XP_009394811.1|  PREDICTED: cytochrome P450 72A15-like isofor...    355   2e-114   
emb|CDX82471.1|  BnaA03g33500D                                          354   3e-114   
gb|AGX93062.1|  CYP72A224 7-deoxyloganic acid 7-hydroxylase             354   3e-114   
ref|XP_009116688.1|  PREDICTED: cytochrome P450 72A15-like              354   3e-114   
ref|XP_010487262.1|  PREDICTED: cytochrome P450 72A13-like              354   3e-114   
ref|XP_009394813.1|  PREDICTED: cytochrome P450 72A13-like isofor...    354   4e-114   
ref|XP_009116708.1|  PREDICTED: cytochrome P450 72A15-like isofor...    353   4e-114   
gb|AGX93049.1|  secologanin synthase-like protein                       354   5e-114   
dbj|BAB87118.1|  cytochrome P450                                        354   5e-114   
dbj|BAL45204.1|  cytochrome P450 monooxygenase                          353   6e-114   
ref|XP_009394809.1|  PREDICTED: cytochrome P450 72A13-like              354   6e-114   
ref|XP_010470433.1|  PREDICTED: cytochrome P450 72A13-like              353   6e-114   
emb|CDY28093.1|  BnaC06g02740D                                          353   6e-114   
gb|EYU26274.1|  hypothetical protein MIMGU_mgv1a004552mg                353   6e-114   
gb|EAY75042.1|  hypothetical protein OsI_02938                          353   6e-114   
gb|AGX93056.1|  7-deoxyloganic acid 7-hydroxylase-like protein          353   1e-113   
ref|NP_001043635.1|  Os01g0627900                                       353   1e-113   
gb|AEI59770.1|  cytochrome P450                                         353   1e-113   
emb|CDX98484.1|  BnaC05g38910D                                          352   1e-113   
ref|XP_010535014.1|  PREDICTED: cytochrome P450 72A13-like              352   1e-113   
ref|XP_006297414.1|  hypothetical protein CARUB_v10013438mg             353   2e-113   
ref|XP_003569397.1|  PREDICTED: cytochrome P450 72A15-like              352   2e-113   
ref|XP_009790241.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    350   2e-113   
ref|XP_010501999.1|  PREDICTED: cytochrome P450 72A13-like              352   2e-113   
emb|CDY20078.1|  BnaA01g29240D                                          352   2e-113   
gb|AGX93047.1|  secologanin synthase-like protein                       352   2e-113   
sp|Q05047.1|C72A1_CATRO  RecName: Full=Secologanin synthase; Shor...    352   2e-113   
dbj|BAP90521.1|  secologanin synthase                                   352   3e-113   
ref|NP_001172471.1|  Os01g0627933                                       347   3e-113   
gb|AFW83339.1|  putative cytochrome P450 superfamily protein            348   3e-113   
ref|XP_009394810.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    352   4e-113   
ref|XP_010275158.1|  PREDICTED: cytochrome P450 CYP72A219-like          351   5e-113   
ref|XP_008443405.1|  PREDICTED: cytochrome P450 CYP72A219-like          351   5e-113   
ref|NP_188079.1|  cytochrome P450, family 72, subfamily A, polype...    350   6e-113   
ref|XP_009394815.1|  PREDICTED: cytochrome P450 72A15-like              351   7e-113   
gb|AGX93064.1|  secologanin synthase                                    351   8e-113   
ref|XP_004488667.1|  PREDICTED: secologanin synthase-like               350   9e-113   
emb|CDX97591.1|  BnaA05g24880D                                          349   1e-112   
ref|XP_010501993.1|  PREDICTED: cytochrome P450 72A13-like              350   2e-112   
dbj|BAN19916.1|  cytochrome P450                                        350   2e-112   
gb|AAA17732.1|  cytochrome P450                                         350   2e-112   
dbj|BAN19928.1|  cytochrome P450                                        350   2e-112   
ref|XP_006299368.1|  hypothetical protein CARUB_v10015526mg             349   2e-112   
ref|XP_010683653.1|  PREDICTED: cytochrome P450 CYP72A219-like          348   2e-112   
ref|XP_009147881.1|  PREDICTED: cytochrome P450 72A15-like              349   2e-112   
ref|XP_010465352.1|  PREDICTED: cytochrome P450 72A13-like              349   2e-112   
gb|AGX93048.1|  secologanin synthase-like protein                       349   3e-112   
ref|XP_010683652.1|  PREDICTED: cytochrome P450 CYP72A219-like          348   3e-112   
ref|XP_010676733.1|  PREDICTED: cytochrome P450 CYP72A219-like          349   4e-112   
gb|AAM77716.1|AF465265_1  cytochrome P450 monooxygenase CYP72A16        349   4e-112   
ref|XP_010926840.1|  PREDICTED: cytochrome P450 CYP72A219-like is...    349   4e-112   
gb|EYU26281.1|  hypothetical protein MIMGU_mgv1a021321mg                343   4e-112   
ref|XP_008443404.1|  PREDICTED: cytochrome P450 CYP72A219-like          348   5e-112   
emb|CDY51036.1|  BnaA06g02990D                                          348   5e-112   
ref|XP_010644728.1|  PREDICTED: cytochrome P450 CYP72A219-like          340   7e-112   
ref|XP_004243784.1|  PREDICTED: cytochrome P450 CYP72A219-like          340   8e-112   
ref|NP_188083.1|  cytochrome P450, family 72, subfamily A, polype...    347   1e-111   
emb|CDY32349.1|  BnaC01g36680D                                          347   1e-111   
gb|AAA17746.1|  cytochrome P450                                         347   1e-111   
ref|XP_010487268.1|  PREDICTED: cytochrome P450 72A13-like              347   1e-111   
ref|NP_001170729.1|  uncharacterized protein LOC100384816 precursor     347   2e-111   
gb|AFW83341.1|  putative cytochrome P450 superfamily protein            347   3e-111   
gb|EYU26266.1|  hypothetical protein MIMGU_mgv1a0182362mg               342   3e-111   
ref|XP_009146333.1|  PREDICTED: cytochrome P450 72A13-like              346   4e-111   
ref|XP_010465356.1|  PREDICTED: cytochrome P450 72A13-like              346   4e-111   
ref|XP_004969232.1|  PREDICTED: secologanin synthase-like               346   4e-111   
ref|NP_001043632.1|  Os01g0627500                                       346   7e-111   
ref|XP_007149354.1|  hypothetical protein PHAVU_005G0634001g            343   8e-111   
ref|XP_004151605.1|  PREDICTED: secologanin synthase-like               339   1e-110   
dbj|BAJ98958.1|  predicted protein                                      345   1e-110   
gb|EAZ12776.1|  hypothetical protein OsJ_02693                          345   2e-110   
ref|XP_003569207.1|  PREDICTED: cytochrome P450 72A15-like              345   2e-110   
gb|KEH38476.1|  cytochrome P450 family 72 protein                       343   3e-110   
gb|EYU26272.1|  hypothetical protein MIMGU_mgv1a018891mg                343   8e-110   
ref|XP_003531823.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    343   8e-110   
ref|XP_007131275.1|  hypothetical protein PHAVU_011G000200g             343   8e-110   
ref|XP_009411224.1|  PREDICTED: cytochrome P450 72A15-like              338   8e-110   
gb|EAY75044.1|  hypothetical protein OsI_02940                          347   9e-110   
gb|EYU26282.1|  hypothetical protein MIMGU_mgv1a026663mg                343   1e-109   
ref|XP_003605472.1|  Cytochrome P450 monooxygenase CYP72A61             338   1e-109   
ref|XP_004488665.1|  PREDICTED: secologanin synthase-like               342   2e-109   
emb|CDX97588.1|  BnaA05g24910D                                          342   2e-109   
ref|XP_006646125.1|  PREDICTED: secologanin synthase-like               341   3e-109   
emb|CDY20075.1|  BnaA01g29270D                                          341   3e-109   
ref|XP_004151308.1|  PREDICTED: secologanin synthase-like               341   3e-109   
ref|XP_010685026.1|  PREDICTED: cytochrome P450 CYP72A219-like          341   3e-109   
ref|XP_010275244.1|  PREDICTED: cytochrome P450 CYP72A219-like          341   4e-109   
ref|XP_002458201.1|  hypothetical protein SORBIDRAFT_03g028620          341   6e-109   
gb|EAY74842.1|  hypothetical protein OsI_02734                          341   6e-109   
ref|NP_188081.1|  cytochrome P450, family 72, subfamily A, polype...    340   6e-109   
gb|KEH38471.1|  cytochrome P450 family monooxygenase                    341   6e-109   
ref|XP_004969234.1|  PREDICTED: secologanin synthase-like               340   8e-109   
gb|AET02537.2|  cytochrome P450 family 72 protein                       336   9e-109   
gb|AAQ13549.1|AF123610_5  cytochrome P450                               340   9e-109   
dbj|BAB02396.1|  cytochrome P450                                        339   1e-108   
ref|XP_009146340.1|  PREDICTED: cytochrome P450 72A13                   340   1e-108   
dbj|BAL45199.1|  cytochrome P450 monooxygenase                          339   2e-108   
ref|XP_004146006.1|  PREDICTED: LOW QUALITY PROTEIN: secologanin ...    339   2e-108   
gb|EYU26261.1|  hypothetical protein MIMGU_mgv1a004867mg                338   3e-108   
ref|XP_003546748.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase iso...    338   3e-108   
gb|EEC71125.1|  hypothetical protein OsI_02933                          339   3e-108   
ref|XP_002455998.1|  hypothetical protein SORBIDRAFT_03g028690          339   3e-108   
gb|AFK42047.1|  unknown                                                 339   4e-108   
ref|NP_001043631.1|  Os01g0627400                                       339   5e-108   
ref|XP_003628061.1|  Cytochrome P450 monooxygenase CYP72A65             336   5e-108   
emb|CDX98481.1|  BnaC05g38940D                                          357   5e-108   
gb|EEE55021.1|  hypothetical protein OsJ_02678                          339   5e-108   
sp|H1A988.1|C7254_GLYUR  RecName: Full=11-oxo-beta-amyrin 30-oxid...    338   6e-108   
dbj|BAJ85223.1|  predicted protein                                      338   6e-108   
ref|XP_010694548.1|  PREDICTED: cytochrome P450 CYP72A219-like          338   6e-108   
ref|XP_008778221.1|  PREDICTED: cytochrome P450 72A15-like              338   6e-108   
gb|KHN44046.1|  Secologanin synthase                                    338   7e-108   
ref|XP_006598147.1|  PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like      338   8e-108   
ref|XP_003605470.1|  Cytochrome P450 monooxygenase CYP72A61             338   1e-107   
gb|EPS69617.1|  hypothetical protein M569_05150                         337   1e-107   
gb|KDO52111.1|  hypothetical protein CISIN_1g046539mg                   336   1e-107   
ref|XP_010232048.1|  PREDICTED: cytochrome P450 72A15-like              337   1e-107   
ref|NP_001043498.1|  Os01g0602400                                       338   1e-107   
gb|EYU26263.1|  hypothetical protein MIMGU_mgv1a019274mg                337   1e-107   
gb|ABC59079.1|  cytochrome P450 monooxygenase CYP72A65                  337   1e-107   
gb|EAZ12763.1|  hypothetical protein OsJ_02680                          336   2e-107   
emb|CBI22131.3|  unnamed protein product                                335   2e-107   
gb|AAK38090.1|  putative cytochrome P450                                337   2e-107   
ref|NP_001044129.1|  Os01g0728300                                       336   3e-107   
gb|EAY75694.1|  hypothetical protein OsI_03601                          336   3e-107   
emb|CDP14360.1|  unnamed protein product                                332   3e-107   
ref|XP_004969231.1|  PREDICTED: secologanin synthase-like               336   4e-107   
gb|AAK38093.1|  putative cytochrome P450                                336   4e-107   
gb|EYU26262.1|  hypothetical protein MIMGU_mgv1a022102mg                335   5e-107   



>ref|XP_009620491.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   522 bits (1344),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 235/351 (67%), Positives = 301/351 (86%), Gaps = 1/351 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME+ + ++    A+  ++ +W++LNWAWFRPRKL + LRQQGLKG  YK IFGDLK++SK
Sbjct  1     MEMAYYIVLSLFAVTSVIYVWKLLNWAWFRPRKLDQCLRQQGLKGNSYKLIFGDLKELSK  60

Query  234   SVEDAKSKPINLSDD-ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
             S+E+AKSKP+N+SDD I PR LP+FI+AI+K G+NSF+WLGP PLVF++DP+++K+V TK
Sbjct  61    SIEEAKSKPLNVSDDDIPPRILPYFIEAIKKYGKNSFIWLGPNPLVFVRDPDVLKDVLTK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
             H+++QKP S PL++LLAQG++ +EEDKW KHRKI+NP F MEK+KHM+PA  LSCSEM+S
Sbjct  121   HSLYQKPKSTPLTRLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKHMLPAIQLSCSEMVS  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +W++    +G  ELD+WPYLQ+L+SD ISRTAFGS+YEEG KIFELQ+EQ  +V+ ISS+
Sbjct  181   QWKEAASVKGSCELDIWPYLQRLSSDAISRTAFGSNYEEGRKIFELQKEQAEHVIAISST  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRF+PTKRNRRMK+IEK+V A++  IIDKRVK M+ GEA+ DDLLGILL+SNF+E
Sbjct  241   LYIPGWRFMPTKRNRRMKEIEKEVQATVRGIIDKRVKTMKAGEANADDLLGILLDSNFKE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IEQ+G+KNFGM+T+EVIEECKLFY AGQETTS LLVWTMVLLS H EWQ R
Sbjct  301   IEQHGSKNFGMSTQEVIEECKLFYFAGQETTSVLLVWTMVLLSRHPEWQAR  351



>ref|XP_009781171.1| PREDICTED: cytochrome P450 CYP72A219-like, partial [Nicotiana 
sylvestris]
Length=449

 Score =   512 bits (1319),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 235/352 (67%), Positives = 296/352 (84%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCL-WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME+ + L+    A+  LV   W++L WAWFRPRKL++ LRQQGL G  YK IFGDLK++S
Sbjct  1     MEMAYYLVLSLFAVTLLVIYAWKLLKWAWFRPRKLEQCLRQQGLIGNSYKLIFGDLKELS  60

Query  231   KSVEDAKSKPINLSDD-ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
             KS+E+ KSKP+N+SDD I PR LP+FI+AI+K G+N FVWLGP PLVF+++PE++K+V T
Sbjct  61    KSIEEVKSKPLNVSDDDIPPRILPYFIEAIKKYGKNCFVWLGPNPLVFVREPEVIKDVLT  120

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             +H ++QKP S PL++LLAQG++ +EEDKW KHRKI+NP F MEK+KHM+PAF+LSCSEM+
Sbjct  121   RHALYQKPKSTPLTRLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKHMLPAFHLSCSEMV  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             S+WE+    +G  ELD+WPYLQ+L+SD ISRTAF S+YEEG KIFELQ+EQ  +V+ IS 
Sbjct  181   SQWEEAASVKGSCELDIWPYLQRLSSDAISRTAFESNYEEGRKIFELQKEQAEHVIAISR  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             ++YIPGWRF+PTKRNRRMKQIEK+V A+I  IIDKRVKAM+ GEA+ DDLLGILL+SNF+
Sbjct  241   TLYIPGWRFMPTKRNRRMKQIEKEVQATIRGIIDKRVKAMKAGEANADDLLGILLDSNFK  300

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EIEQ+GNK+FGM+T+EVIEECKLFY AGQETTS LLVWTM LLS H +WQ R
Sbjct  301   EIEQHGNKDFGMSTQEVIEECKLFYFAGQETTSVLLVWTMFLLSRHPDWQAR  352



>ref|XP_006363763.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   504 bits (1297),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 231/353 (65%), Positives = 295/353 (84%), Gaps = 3/353 (1%)
 Frame = +3

Query  54    MEIV-FGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEI  + L+ F +AI F++  WR+L+WAWF PRKL+K LRQQGLKG  YK I+GD+K++S
Sbjct  1     MEIAAYFLVLFLLAITFVIYAWRLLDWAWFMPRKLEKCLRQQGLKGNSYKLIYGDIKELS  60

Query  231   KSVEDAKSKPINLSDD-ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
             KS+EDA+SKP+N+SDD ++PR LP+F+  I+K G+N F+W+GPKPLV + DPE++++VF 
Sbjct  61    KSIEDAESKPLNVSDDDLTPRILPYFVQTIKKYGKNCFIWIGPKPLVIVGDPEVIRDVFN  120

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             KH ++QKP S PL+KLLAQG++ +EEDKW KHRKI+NP F MEK+K M+ A  LSCSEM+
Sbjct  121   KHALYQKPKSTPLTKLLAQGIVSYEEDKWAKHRKILNPAFHMEKIKDMLQAVLLSCSEMV  180

Query  588   SEWEKNVG-DQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQIS  764
             ++WE+ V   +   ELD+WPYLQ+L SDVISRTAFGS+YEEG KIFELQ+EQ  +V+++S
Sbjct  181   NQWEEAVSMKESSTELDIWPYLQRLTSDVISRTAFGSNYEEGRKIFELQKEQAEHVIEVS  240

Query  765   SSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF  944
              ++YIPGWRFLPTKRNRRMK+IE++V A+I  IIDKRVK M+ GEA+ DDLLGILLESNF
Sbjct  241   RTLYIPGWRFLPTKRNRRMKEIEREVQATIRGIIDKRVKGMKAGEANTDDLLGILLESNF  300

Query  945   EEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +EIEQ+GNKNFGMT +EVIEECKLFY AGQETTS  LVWTM+LLS H +WQ R
Sbjct  301   KEIEQHGNKNFGMTIKEVIEECKLFYFAGQETTSVWLVWTMILLSRHPDWQVR  353



>ref|XP_009617254.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   500 bits (1287),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 226/351 (64%), Positives = 289/351 (82%), Gaps = 0/351 (0%)
 Frame = +3

Query  48    EMMEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKI  227
             E ++I       +I I  +VC+WR+LNW WFRP+KL+K+LR+QGLKG  Y+ ++GD+K++
Sbjct  2     ETVQITVTASCAAIIITLVVCIWRVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMKEL  61

Query  228   SKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
             S  +++A SKP+NLSDDI+PR +PFF+D I+K G+ SFVWLGPKPLVF+ DPEL+K VF+
Sbjct  62    SGMIKEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFVMDPELIKEVFS  121

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             K+ ++QKP SNPL+KLLAQG++  EEDKW KHRKI+ P F +EKLKHM+PAF LSC+EML
Sbjct  122   KNYLYQKPHSNPLTKLLAQGLVSQEEDKWAKHRKIVTPAFHLEKLKHMLPAFCLSCTEML  181

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             S+WE  V  +G  E+D+WP LQQL SDVISRTAFGSSYE G +IFELQ+EQ  ++++   
Sbjct  182   SKWEDIVAVEGSHEIDIWPGLQQLTSDVISRTAFGSSYEAGRRIFELQKEQAQFLMEAIR  241

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             S+YIPGWRFLPTKRNRRMK+IEK V A +  IIDKRVK+M+ GE + +DLLGILLESNF+
Sbjct  242   SVYIPGWRFLPTKRNRRMKEIEKDVQALVRGIIDKRVKSMKAGEVNNEDLLGILLESNFK  301

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQT  1100
             EIEQ+GNK+FGM+  EVI+ECKLFY AGQETTS LLVWT++LLS HQ+WQ 
Sbjct  302   EIEQHGNKDFGMSIEEVIQECKLFYFAGQETTSVLLVWTLILLSRHQDWQA  352



>ref|XP_009789309.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=516

 Score =   496 bits (1276),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 230/352 (65%), Positives = 288/352 (82%), Gaps = 2/352 (1%)
 Frame = +3

Query  48    EMMEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKI  227
             E ++I       +I I  +VC+WR+LNW WFRP+KL+K+ R+QGLKG  Y+ ++GD+K++
Sbjct  2     ETVQITATASCAAIIITLMVCIWRVLNWVWFRPKKLEKLQRKQGLKGNSYRILYGDMKEL  61

Query  228   SKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
             S  +E+A SKP+NLSDDI+PR +PFF+D I+K G+ SFVWLGPKPLVFI DPEL+K VF+
Sbjct  62    SGMIEEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFIMDPELIKEVFS  121

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             K+ +++KP SNPL+KLLAQG++  E DKW KHRKII P F +EKLKHM+PAF LSC+EML
Sbjct  122   KNYLYEKPHSNPLTKLLAQGLVSQEGDKWAKHRKIITPAFHLEKLKHMLPAFCLSCTEML  181

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             S+WE  V  +G  E+D+WP LQQL+SDVISRTAFGSSYEEG +IFELQ+EQ  + ++   
Sbjct  182   SKWEDIVAVEGSHEIDIWPGLQQLSSDVISRTAFGSSYEEGRRIFELQKEQAQHFMKAIR  241

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             SIYIPGWRFLPTKRNRRMK+IEK V ASI  IIDKR  AM+ GE + +DLLGILLESNF+
Sbjct  242   SIYIPGWRFLPTKRNRRMKEIEKDVQASITGIIDKR--AMKAGEVNNEDLLGILLESNFK  299

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EIEQ+GNK+FGM+  EVIEECKLFY AGQETTS LLVWT++LLS HQ+WQ +
Sbjct  300   EIEQHGNKDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLILLSRHQDWQAQ  351



>ref|XP_004243845.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   495 bits (1275),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 229/353 (65%), Positives = 292/353 (83%), Gaps = 3/353 (1%)
 Frame = +3

Query  54    MEIV-FGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEIV + L+ F +AI F++  WR+L+WAWFRPRKL K LRQQGLKG  YK IFGD+K++S
Sbjct  1     MEIVAYFLVLFLLAITFVIYAWRLLDWAWFRPRKLDKCLRQQGLKGNSYKLIFGDIKELS  60

Query  231   KSVEDAKSKPINLSDD-ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
             KS+EDA+SKP+++SDD ++PR LP+F+  I+K G+N F+W+G KPLV + DPE++++VF 
Sbjct  61    KSIEDAESKPLDVSDDDLTPRILPYFVQTIKKYGKNCFIWIGTKPLVIVGDPEVIRDVFN  120

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             KH ++QKP S PL+KLLAQG++ +EE KW KHRKI+NP F MEK+K M+ A +LSCSEM+
Sbjct  121   KHALYQKPKSTPLTKLLAQGIVSYEEVKWAKHRKILNPAFHMEKIKDMLQAVHLSCSEMV  180

Query  588   SEWEKNVG-DQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQIS  764
             S+WE+ V   +   ELD+WPYLQ+L SDVIS TAFGS+YEEG KIFELQ+EQ  +V+ +S
Sbjct  181   SQWEEAVSMKESSTELDIWPYLQRLTSDVISHTAFGSNYEEGRKIFELQKEQAEHVIAVS  240

Query  765   SSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF  944
              ++YIPGWRFLPTKRNRRMK+IE +V  +I  IIDKRVK ++ GEA+ DDLLGILLESNF
Sbjct  241   RTLYIPGWRFLPTKRNRRMKEIEGKVQTTIRGIIDKRVKGIKAGEANTDDLLGILLESNF  300

Query  945   EEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +EIEQ+GNK+FGMT +EVIEECKLFY AGQETTS LLVWTM+LLS H +WQ R
Sbjct  301   KEIEQHGNKDFGMTIKEVIEECKLFYFAGQETTSVLLVWTMILLSRHPDWQVR  353



>ref|XP_009789316.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
sylvestris]
Length=516

 Score =   494 bits (1271),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 228/352 (65%), Positives = 288/352 (82%), Gaps = 2/352 (1%)
 Frame = +3

Query  48    EMMEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKI  227
             E ++I       +I I  +VC+WR+LNW WFRP+KL+K+ R+QGLKG  Y+ ++GD+K++
Sbjct  2     ETVQITATASCAAIIITLMVCIWRVLNWVWFRPKKLEKLQRKQGLKGNSYRILYGDMKEL  61

Query  228   SKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
             S  +E+A SKP+NLSDDI+PR +PFF+D I+K G+ SFVWLGPKPLVFI DPEL+K VF+
Sbjct  62    SGMIEEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVFIMDPELIKEVFS  121

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             K+ +++KP SNPL+KLLAQG++  E DKW KHRKII P F +EKLKHM+PAF LSC+EML
Sbjct  122   KNYLYEKPHSNPLTKLLAQGLVSQEGDKWAKHRKIITPAFHLEKLKHMLPAFCLSCTEML  181

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             S+WE  V  +G  E+D+WP LQQL+SDVISRTAFGSSYEEG +IFELQ+EQ  + ++   
Sbjct  182   SKWEDIVAVEGSHEIDIWPGLQQLSSDVISRTAFGSSYEEGRRIFELQKEQAQHFMKAIR  241

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             SIYIPGWRFLPTKRNRRMK+IEK   + +  IIDKRVKAM+ GE + +DLLGILLESNF+
Sbjct  242   SIYIPGWRFLPTKRNRRMKEIEKD--SKVTGIIDKRVKAMKAGEVNNEDLLGILLESNFK  299

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EIEQ+GNK+FGM+  EVIEECKLFY AGQETTS LLVWT++LLS HQ+WQ +
Sbjct  300   EIEQHGNKDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLILLSRHQDWQAQ  351



>ref|XP_009617253.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
 gb|ABC69414.1| CYP72A57 [Nicotiana tabacum]
Length=518

 Score =   493 bits (1269),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 224/352 (64%), Positives = 289/352 (82%), Gaps = 0/352 (0%)
 Frame = +3

Query  48    EMMEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKI  227
             E ++I+      +I I  +VC+WR+LNW WFRP+KL+K+LR+QGLKG  YK ++GD+K++
Sbjct  2     ETVQIIITASCAAIIITLVVCIWRVLNWVWFRPKKLEKLLRKQGLKGNSYKILYGDMKEL  61

Query  228   SKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
             S  +++A SKP+NLSDDI+PR +PFF+D I+K G+ SFVWLGPKPLV I DPEL+K +F+
Sbjct  62    SGMIKEANSKPMNLSDDIAPRLVPFFLDTIKKYGKKSFVWLGPKPLVLIMDPELIKEIFS  121

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             K+ ++QKP  NP++KLL QG++  EEDKW KHRKIINP F +EKLKHM+PAF LSC+EML
Sbjct  122   KYYLYQKPHGNPVTKLLVQGLVSLEEDKWAKHRKIINPAFHLEKLKHMLPAFCLSCTEML  181

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
              +WE  V  +G  E+DVWP+L+QL+SDVISRTAFGS++EEG +IFELQ+EQ  Y ++   
Sbjct  182   CKWEDIVSIKGSHEIDVWPHLEQLSSDVISRTAFGSNFEEGKRIFELQKEQAQYFVEAIR  241

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             S+YIPGWRFLPTKRNRRMK++EK V ASI  IIDKRVKAM+ GEAS +DLLGILLESNF 
Sbjct  242   SVYIPGWRFLPTKRNRRMKEVEKDVRASIRGIIDKRVKAMKAGEASNEDLLGILLESNFT  301

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             E EQ+ +K+  M+  EVI+ECKLFY+AGQETTS LLVWT++LLS HQ+WQ+R
Sbjct  302   EAEQHRHKDSAMSIEEVIQECKLFYVAGQETTSVLLVWTLILLSRHQDWQSR  353



>ref|XP_006363756.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=519

 Score =   488 bits (1255),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 225/354 (64%), Positives = 291/354 (82%), Gaps = 4/354 (1%)
 Frame = +3

Query  54    MEIV--FGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKI  227
             MEIV    L  F +AI F++  WR+L+WAWFRPRKL+K LR+QGLKG  YK I+GD+K++
Sbjct  1     MEIVTYHFLALFLLAITFVIYAWRLLDWAWFRPRKLEKCLRKQGLKGNSYKLIYGDIKEL  60

Query  228   SKSVEDAKSKPINLSDD-ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVF  404
             SKS+EDAKSKP+N SDD ++PR LP+F+  I+K G+N F+W+GPKPLV + DPE++++VF
Sbjct  61    SKSIEDAKSKPLNASDDDLTPRILPYFVQTIKKYGKNCFIWVGPKPLVIVGDPEVIRDVF  120

Query  405   TKHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEM  584
              KH ++QKP   P +KLLA+G++ +E+DKW KHR+I+NP F MEK+K M+   +LSCSEM
Sbjct  121   NKHALYQKPKYPPQTKLLAKGILSYEDDKWAKHRRILNPAFHMEKIKDMLHTVHLSCSEM  180

Query  585   LSEWEKNVG-DQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQI  761
             +S+WE+ V   +   ELD+WPYLQ+L SDVISRTAFGS+YEEG KIFELQ+EQ  +V+++
Sbjct  181   VSQWEEAVSMKESSTELDIWPYLQRLTSDVISRTAFGSNYEEGRKIFELQKEQAKHVIEV  240

Query  762   SSSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESN  941
             S ++YI GWRFLPTKRNRRMK+IE++V A+I  IIDKRVK M+ GEA+ DDLLGILLESN
Sbjct  241   SRTLYILGWRFLPTKRNRRMKEIEREVQATIRGIIDKRVKGMKAGEANTDDLLGILLESN  300

Query  942   FEEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             F+EIEQ+GNKNFGMT ++VIEECKLF+ AGQETTS  LVWTM+LLS H +WQ R
Sbjct  301   FKEIEQHGNKNFGMTIKDVIEECKLFFFAGQETTSVWLVWTMILLSRHPDWQVR  354



>ref|XP_006348901.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   486 bits (1252),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 223/341 (65%), Positives = 281/341 (82%), Gaps = 1/341 (0%)
 Frame = +3

Query  84    SIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPI  263
             +IAI  L+CLWR+LNW WFRP+KL+K+L++QG+KG  Y  ++GD K++S  +++  SK +
Sbjct  14    AIAITLLLCLWRVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKELSLRIKEVTSKSM  73

Query  264   NL-SDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSN  440
             +L  DDI+ R++PFF+D I+K G+ SF+WLGPKPLVFI DP+L+K VFTK  I+QK  +N
Sbjct  74    SLYDDDIAQRSMPFFLDTIKKYGKKSFIWLGPKPLVFIMDPDLIKEVFTKTYIYQKTKTN  133

Query  441   PLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQG  620
             PL+KLLAQG++  E DKW KHRKIINP F +EKLKHM+PAF LSC+EMLS+WE  V  + 
Sbjct  134   PLTKLLAQGLVREEGDKWAKHRKIINPAFHLEKLKHMLPAFCLSCTEMLSKWEDIVSVER  193

Query  621   LAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLP  800
               E+DVWP+LQQL SDVISRTAFGSSYEEG +IFELQ EQ  Y ++   S+YIPGW FLP
Sbjct  194   AYEIDVWPHLQQLTSDVISRTAFGSSYEEGRRIFELQTEQAQYFIEAVRSVYIPGWSFLP  253

Query  801   TKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFG  980
             TKRNRRMK+IE+ V A+I  IIDKRVKAM+GGEA+ +DLLGILLESNF+EIEQ+G+KNFG
Sbjct  254   TKRNRRMKEIERHVQATIRGIIDKRVKAMKGGEANNEDLLGILLESNFKEIEQHGDKNFG  313

Query  981   MTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ++  EVIEECKLFY AGQETTS+LLVWT++LL  H +WQTR
Sbjct  314   LSIEEVIEECKLFYFAGQETTSALLVWTLILLCRHHDWQTR  354



>ref|XP_004243263.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   486 bits (1250),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 222/340 (65%), Positives = 279/340 (82%), Gaps = 1/340 (0%)
 Frame = +3

Query  87    IAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPIN  266
             IAI  L+C+W +LNW WFRP+KL+K+L++QG+KG  Y  ++GD K++S  +++  SK ++
Sbjct  15    IAITLLLCIWSVLNWIWFRPKKLEKLLKEQGVKGNSYSILYGDTKELSMRIKEVTSKSMS  74

Query  267   L-SDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNP  443
             +  DDI+PR+LPFF+D I+K G+ SF+WLGPKPLVFI DP+L+K VFTK  I+QK  +NP
Sbjct  75    VYDDDIAPRSLPFFLDTIKKYGKKSFIWLGPKPLVFIMDPDLIKEVFTKTYIYQKTKTNP  134

Query  444   LSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGL  623
             L+KLLAQG++  E DKW KHRKIINP F +EKLKHM+PAFYLSC+EMLS+WE  V  +  
Sbjct  135   LTKLLAQGLVREEGDKWAKHRKIINPAFHLEKLKHMLPAFYLSCTEMLSKWEDVVSVERS  194

Query  624   AELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPT  803
              E+DVWP+LQQL SDVISRTAFGSSYEEG +IFELQ EQ  Y ++   S+YIPGW FLPT
Sbjct  195   HEIDVWPHLQQLTSDVISRTAFGSSYEEGRRIFELQTEQAQYFIEAVRSVYIPGWSFLPT  254

Query  804   KRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFGM  983
             KRNRRMK+IEK V A+I  IIDKRVKAM GGEA+  DLLGILLESNF+EI+Q+G+K+FG+
Sbjct  255   KRNRRMKEIEKHVQATIRGIIDKRVKAMTGGEANNKDLLGILLESNFKEIKQHGDKDFGL  314

Query  984   TTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +  EVIEECKLFY AGQETTS+LLVWT++LL  H +WQTR
Sbjct  315   SIEEVIEECKLFYFAGQETTSALLVWTLILLCRHHDWQTR  354



>ref|XP_004243253.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=518

 Score =   484 bits (1247),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 218/353 (62%), Positives = 294/353 (83%), Gaps = 3/353 (1%)
 Frame = +3

Query  54    MEIV-FGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEIV + L+ F + I  ++  W++L+WAWFRPRKL+K LR+QGLKG  YK IFGDLK+++
Sbjct  1     MEIVAYYLVSFLLTITSVIYAWKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELA  60

Query  231   KSVEDAKSKPINL-SDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
             KS ED KSKP+N+  DDI+PR +P+F+D I+K+G+N F+W+GPKP+V + D E++++VF 
Sbjct  61    KSFEDVKSKPLNVFDDDITPRIVPYFVDTIKKHGKNCFIWIGPKPMVLVNDAEVIRDVFN  120

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             K+ ++QKP   PL+KLLAQG+  +EEDKW  HRKI+NP F MEK+K+M+PA +LSC+EM+
Sbjct  121   KYVLYQKPKPTPLTKLLAQGLASYEEDKWAMHRKILNPAFHMEKIKNMVPAIHLSCTEMV  180

Query  588   SEWEKNVGDQGLA-ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQIS  764
             S+WE+++  +G + E+D+WPYLQ+L+SDVISRTAFGS+YEEG  IFELQ+EQ  + ++ +
Sbjct  181   SQWEESISTKGTSCEIDIWPYLQKLSSDVISRTAFGSNYEEGRMIFELQKEQAQHFIEAT  240

Query  765   SSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF  944
              ++YI G RFLPTK+NRRMK+I+K V A I  IIDKRVKA++ GEA+ DDLLG+LLESNF
Sbjct  241   RTLYILGSRFLPTKKNRRMKEIDKNVQAMIRGIIDKRVKALKAGEANTDDLLGMLLESNF  300

Query  945   EEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ++IEQ+GNK+FGM+TRE+IEECKLFY AGQETTS LLVWTM+LLS H +WQTR
Sbjct  301   KQIEQHGNKDFGMSTREIIEECKLFYFAGQETTSVLLVWTMILLSRHLDWQTR  353



>ref|XP_006348911.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=518

 Score =   484 bits (1246),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 218/353 (62%), Positives = 293/353 (83%), Gaps = 3/353 (1%)
 Frame = +3

Query  54    MEIV-FGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEIV + L+ F + I  ++  W++L+WAWFRPRKL+K LR+QGLKG  YK IFGDLK+++
Sbjct  1     MEIVAYYLVSFLLTITIVIYAWKLLDWAWFRPRKLEKCLRKQGLKGNSYKLIFGDLKELA  60

Query  231   KSVEDAKSKPINLSDD-ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
             KS EDA SKP+ +SDD I PR +P+F+D I+K+G+N F+W+GPKP+V +++PE++++VF 
Sbjct  61    KSFEDANSKPLKVSDDDICPRIVPYFVDTIKKHGKNCFIWIGPKPMVLVREPEVIRDVFN  120

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             K+ ++QKP S P++KLLAQGV  +EEDKW  HRKI+NP F MEK+K M+PA +LSC+EM+
Sbjct  121   KYVLYQKPKSTPITKLLAQGVSSYEEDKWEMHRKILNPAFHMEKIKSMVPAVHLSCTEMV  180

Query  588   SEWEKNVGDQGLA-ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQIS  764
             S+WE+++  +G + E+D+WPYLQ+L SDVISRTAFGS+YEEG KIFELQ+E   +V++ +
Sbjct  181   SQWEESISTKGTSCEIDIWPYLQRLTSDVISRTAFGSNYEEGRKIFELQKELAQHVIEAT  240

Query  765   SSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF  944
              ++YIPG RFLPTK+NRRMK+I+K+V A I  IIDKRVKA++ GEA+ DDLLG+LLESNF
Sbjct  241   RTLYIPGSRFLPTKKNRRMKEIDKKVQAMIRGIIDKRVKALKAGEANTDDLLGMLLESNF  300

Query  945   EEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ++IEQ+GNK+FGMTTRE+IEECKLFY AGQETTS LL W M+LLS H +WQ  
Sbjct  301   KQIEQHGNKDFGMTTREIIEECKLFYFAGQETTSVLLGWAMILLSKHPDWQAH  353



>gb|EYU43426.1| hypothetical protein MIMGU_mgv1a018638mg, partial [Erythranthe 
guttata]
Length=361

 Score =   466 bits (1200),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 273/352 (78%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME+V+ +   S   V L   WR+LNWA+ +P++L+K L  QGL G  YKF++GDLK++SK
Sbjct  1     MEVVYKIFAASFGFVVLFYTWRILNWAYIQPKRLEKSLGNQGLTGNTYKFLYGDLKEMSK  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
                 AKS PINL DDI PR L F     +K G+ SF+WLGP+P V I +PELVK V TK 
Sbjct  61    MFNHAKSTPINLHDDIKPRVLAFLHKTFEKYGQESFIWLGPRPTVMITEPELVKEVMTKF  120

Query  414   TIFQKPP-SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
              ++QKP  SNPL+KLLAQG+  +E DKW KHRKIINP F  EKLK MIPAFYLSC E+L+
Sbjct  121   NLYQKPKNSNPLTKLLAQGLFSYEGDKWSKHRKIINPAFHFEKLKLMIPAFYLSCEEVLN  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +WE ++  QG  E+DVWPYLQ L+SD ISRTAFGSSY+EG K+FELQ+EQ  Y+++   +
Sbjct  181   KWETSISQQGSCEMDVWPYLQNLSSDAISRTAFGSSYKEGRKVFELQKEQAEYIIKALQT  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEA-SPDDLLGILLESNFE  947
             IYIPGWRF+PTKRN RMK+IEK++ +SI  +IDKRVK M+ GEA + +DLLGILLESNF 
Sbjct  241   IYIPGWRFVPTKRNNRMKEIEKEIQSSIRGMIDKRVKVMKAGEAGNNEDLLGILLESNFN  300

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EIEQ GNK+FGMTT EV+EECKLFYLAGQETTS+L+VWT+VLLS + EWQ +
Sbjct  301   EIEQYGNKSFGMTTDEVVEECKLFYLAGQETTSALIVWTLVLLSQYPEWQMK  352



>ref|XP_004243260.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=517

 Score =   472 bits (1214),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 224/352 (64%), Positives = 279/352 (79%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAI-VFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEI++  I   I + + LV  WR+LNWAWFRP+KL+  LRQ+GLKG  YK ++GDL +++
Sbjct  1     MEILYNTIIAIICVAILLVYTWRVLNWAWFRPKKLENFLRQRGLKGNPYKLLYGDLNELT  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
             KS+ +AKSK IN+SDDI+ R +PFF+D+I KNG++SF+WLGP P V I +PE VK + TK
Sbjct  61    KSIVEAKSKSINISDDITQRLIPFFLDSINKNGKSSFMWLGPYPTVLITNPEHVKEILTK  120

Query  411   HTIFQKPPS-NPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             + ++ K    NP +KLLAQG++  EEDKW KHRKIINP F +EKLKHM+PAFY+SCSEM+
Sbjct  121   NYVYLKQTHPNPFAKLLAQGLVLVEEDKWAKHRKIINPAFHVEKLKHMLPAFYMSCSEMI  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             S+WE  V  +   ELDVWP LQ + S+VISRTAFGSSYEEG  +FELQ+EQ  +++ IS 
Sbjct  181   SKWEDIVSKETSYELDVWPDLQIMTSEVISRTAFGSSYEEGRIVFELQQEQAEHIMDISR  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             SIYIPG RFLPTKRN+RM +IEKQ+  +I  IIDKR++AM  GE S DDLLGILLESN +
Sbjct  241   SIYIPGSRFLPTKRNKRMLEIEKQIQTTIRHIIDKRLRAMEAGETSKDDLLGILLESNMK  300

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EIEQ+GNK+FG+TT EVIEECKLFY AGQETTS LLVWTMVLL +H EWQ R
Sbjct  301   EIEQHGNKDFGLTTTEVIEECKLFYFAGQETTSVLLVWTMVLLCLHPEWQVR  352



>ref|XP_006348303.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=519

 Score =   469 bits (1208),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 277/351 (79%), Gaps = 1/351 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ++I+  +    IA+   VCLW++LNW WFRP+KL+K+LR+QGLKG  Y+ ++GD+K  S 
Sbjct  4     IQILVTICCCVIAVALFVCLWKVLNWVWFRPKKLEKLLRKQGLKGNSYRILYGDMKDFSG  63

Query  234   SVEDAKSKPINLS-DDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
              +++A SKP+N+S DD+SPR +PFF++ I+K G+  F W+GP+P + I DPEL+K V +K
Sbjct  64    MIKEANSKPMNISNDDLSPRLVPFFLEIIKKYGKKCFTWMGPRPQILIMDPELIKEVLSK  123

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
               ++QKP +NPL  L  QG++ +E+DKW KHRKIINP F +EKLKHM+PAFYLSCSEMLS
Sbjct  124   TYVYQKPHANPLGTLFVQGLVTYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCSEMLS  183

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +WE  V  +G  E+DVWP+LQQL  DVISRTAFGSSYEEG KIFELQ+EQ  + L+++ S
Sbjct  184   KWEDVVQVEGSHEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQQEQTQHFLEVTRS  243

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRFLPTKRNRRMK+I+K V +SI  IIDKR+KAM  G A  +DLLGILLESNF+E
Sbjct  244   VYIPGWRFLPTKRNRRMKEIKKDVRSSIRGIIDKRLKAMEAGNADNEDLLGILLESNFKE  303

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IE +GNK+FGM+  EVIEECKLFY AG ETTS  ++WT+VLLS   +WQ R
Sbjct  304   IELHGNKDFGMSIEEVIEECKLFYFAGTETTSVWILWTLVLLSRCPDWQAR  354



>ref|XP_006348304.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Solanum 
tuberosum]
Length=519

 Score =   469 bits (1206),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 212/353 (60%), Positives = 279/353 (79%), Gaps = 1/353 (0%)
 Frame = +3

Query  48    EMMEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKI  227
             E +E++  +   + AI   VCLW++LNW WF P+KL+K+LR+QGL G  Y+ ++GD+K +
Sbjct  2     EKIEMIVTICCCATAITLFVCLWKVLNWVWFNPKKLEKLLRKQGLNGNSYRLLYGDMKDL  61

Query  228   SKSVEDAKSKPINLSD-DISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVF  404
             S  +++A SKP+N+SD +++PR +PFF++ I+K G+ SF+W+GP+P + I DPEL+K V 
Sbjct  62    SGMIKEANSKPMNMSDHNLAPRMVPFFLETIKKYGKKSFIWMGPRPQILIMDPELIKEVL  121

Query  405   TKHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEM  584
             +K+ ++QKP  NPL  L  QG++ +E+DKW KHRKIINP F +EKLKHM+PAFYLSCSEM
Sbjct  122   SKNYVYQKPHGNPLGTLFVQGLVSYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCSEM  181

Query  585   LSEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQIS  764
             LS+WE  V  +G  E+DVWP+LQQL  DVISRTAFGSSYEEG KIFELQ+EQ  + L++ 
Sbjct  182   LSKWEDVVQVEGSHEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQQEQAQHFLEVI  241

Query  765   SSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF  944
              S+YIPGWRFLPTKRNRRMK+I+K V +SI  IIDKR+KAM  G A  +DLLGILLESNF
Sbjct  242   RSVYIPGWRFLPTKRNRRMKEIKKDVRSSIRGIIDKRLKAMEAGNADNEDLLGILLESNF  301

Query  945   EEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +EIE +GNK+FGM+  EVIEECKLFY AG ETTS  ++WT+VLLS + +WQ R
Sbjct  302   KEIELHGNKDFGMSIEEVIEECKLFYFAGAETTSVWILWTLVLLSRYPDWQAR  354



>ref|XP_004244272.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=514

 Score =   468 bits (1203),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 211/349 (60%), Positives = 274/349 (79%), Gaps = 1/349 (0%)
 Frame = +3

Query  60    IVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSV  239
             ++  +   +IAI   VCLW++LNW WF+P+KL+K+LR+QGL G  Y+F++GD+K  SK +
Sbjct  1     MIVTIFCCAIAITLFVCLWKVLNWVWFQPKKLEKLLRKQGLNGNSYRFLYGDMKDFSKMI  60

Query  240   EDAKSKPINLSD-DISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHT  416
             ++A SKP+N+ D D++PR +PFF++ I+K G+  F W+GP+P + I DPEL+K V +K  
Sbjct  61    KEANSKPMNMDDHDLAPRMVPFFLETIKKYGKKCFTWMGPRPQILIMDPELIKEVLSKTY  120

Query  417   IFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEW  596
             ++QKP  NPL  L  QG++ +E+DKW KHRKIINP F +EKLKHM+PAFYLSCSEMLS+W
Sbjct  121   VYQKPHGNPLGTLFVQGLVSYEKDKWAKHRKIINPAFHLEKLKHMLPAFYLSCSEMLSKW  180

Query  597   EKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIY  776
             E  V  +G  E+DVWP+LQQL  DVISRTAFGSSYEEG KIFELQ+EQ  + L++  S+Y
Sbjct  181   EDVVRVEGSHEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQKEQAQHFLEVIRSVY  240

Query  777   IPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIE  956
             IPGWRFLPTKRNRRMK+++  V +SI  IIDKR+KAM  G A  +DLLGILLESNF+EIE
Sbjct  241   IPGWRFLPTKRNRRMKELKNDVRSSIRGIIDKRLKAMEAGNADNEDLLGILLESNFKEIE  300

Query  957   QNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              +GNK+FGM+  EVIEECKLFY AG ETTS  ++WT+VLLS H +WQ R
Sbjct  301   LHGNKDFGMSIEEVIEECKLFYFAGAETTSVWILWTLVLLSRHPDWQER  349



>ref|XP_009615907.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   465 bits (1197),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 224/351 (64%), Positives = 278/351 (79%), Gaps = 1/351 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME+++ +I  +   + LV  W++LNWAWF P+K++K LRQ+GLKG  YK ++GDL +++K
Sbjct  1     MEMMYSIIAAASIAIILVYTWKVLNWAWFGPKKMEKCLRQRGLKGNPYKLLYGDLNELTK  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
             S+ +AKSKPIN SDDI+ R +PFF+DAI KNG+NSFVWLGP P+V I DPE +K +FTK+
Sbjct  61    SIIEAKSKPINFSDDIAQRLIPFFLDAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKN  120

Query  414   TIFQKPPS-NPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
              ++QK    NP +KLLA G++  EEDKW KHRKII+P F +EKLKHM+PAFYLSCSEM+S
Sbjct  121   YVYQKQTHPNPYAKLLAHGLVSLEEDKWAKHRKIISPAFHVEKLKHMLPAFYLSCSEMIS  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +WE+ V  +   ELDVWP LQ + S+VISRTAFGSSYEEG  +FELQ+EQ  YV+ I  S
Sbjct  181   KWEEVVPKETSFELDVWPDLQIMTSEVISRTAFGSSYEEGRIVFELQKEQAEYVMDIGRS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             IYIPG RFLPTKRN+RM +IEKQV  +I  IIDKR+KAM  GE S DDLLGILLESN +E
Sbjct  241   IYIPGSRFLPTKRNKRMLEIEKQVQTTIRRIIDKRLKAMEEGETSKDDLLGILLESNLKE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IE +G  +FG+TT EVIEECKLFY AGQETTS LLVWTM+LL +H EWQ R
Sbjct  301   IELHGRNDFGITTSEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVR  351



>ref|XP_011082968.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   463 bits (1192),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 223/351 (64%), Positives = 281/351 (80%), Gaps = 1/351 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME+V+ ++  S A V L+  WR++NWA+ RP++L+K LR+QGL G  Y+ ++GDLK++ K
Sbjct  1     MEVVWQILAASSAFVVLMYSWRVVNWAYIRPKRLEKFLRKQGLSGNSYRLVYGDLKEMLK  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
              +ED +SKPINL DDI PR L F    +QK G  SF+WLGP+P V I DPELVK V  K+
Sbjct  61    MMEDGRSKPINLDDDIKPRVLHFVFKTVQKYGTESFLWLGPRPTVTISDPELVKEVMNKY  120

Query  414   TIFQKPPS-NPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
              I+QKP + NPL+KLLAQGV+ +E DKW KHRK+INP F MEKLK MIPAFYLSC E+L+
Sbjct  121   DIYQKPNNPNPLTKLLAQGVVSYEMDKWAKHRKLINPAFHMEKLKLMIPAFYLSCDEVLN  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +WEK++  +G  E+DVWPYLQ L SD ISRTAFGSSY+EG +IFELQREQ  +V++ S S
Sbjct  181   KWEKSLSPEGSCEVDVWPYLQNLTSDAISRTAFGSSYQEGTRIFELQREQAEHVIKASQS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             IYIPGWRF+PTKRN+RMK+IEK+V +SI  II +R+KAM+ GEAS +DLLGILLESNF+E
Sbjct  241   IYIPGWRFVPTKRNKRMKEIEKEVQSSIRSIISRRIKAMKAGEASSEDLLGILLESNFQE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             I+Q+GNK+FGMT  EV+EECKLFY AGQETTS LLVWT++LLS   +WQ R
Sbjct  301   IKQHGNKSFGMTIDEVVEECKLFYFAGQETTSVLLVWTLILLSRFPDWQKR  351



>ref|XP_009758460.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=525

 Score =   464 bits (1193),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 219/331 (66%), Positives = 268/331 (81%), Gaps = 1/331 (0%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             W++LNWAWFRP+K++  LRQ+GLKG  YK ++GDL +++KSV +AKSKPIN SDDI+ R 
Sbjct  30    WKVLNWAWFRPKKMENCLRQRGLKGNPYKLLYGDLNELTKSVIEAKSKPINFSDDIAQRL  89

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP-SNPLSKLLAQGV  470
             +PFF++AI KNG+NSFVWLGP P+V I DPE +K +FTK+ ++QK    NP +KLLA G+
Sbjct  90    IPFFLNAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKNYVYQKQTHPNPYAKLLAHGL  149

Query  471   IFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYL  650
             I  EEDKW KHRKIINP F ++KLKHM+P+FYLSCSEM+S+WE+ V  +   ELD+WP L
Sbjct  150   ISLEEDKWAKHRKIINPAFHVQKLKHMLPSFYLSCSEMISKWEEVVPKETSFELDIWPDL  209

Query  651   QQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQI  830
             Q + S+VISRTAFGSSYEEG  +FELQ+EQ  YV++I  SIYIPG RFLPTKRN+RM +I
Sbjct  210   QIMTSEVISRTAFGSSYEEGRIVFELQKEQAEYVMEIGRSIYIPGSRFLPTKRNKRMLEI  269

Query  831   EKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFGMTTREVIEEC  1010
             EKQV  +I  IIDKR+KAM  GE S DDLLGILLESN +EIE +G K FG+TT EVIEEC
Sbjct  270   EKQVQTTIKRIIDKRLKAMEEGETSKDDLLGILLESNLKEIELHGRKEFGITTSEVIEEC  329

Query  1011  KLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             KLFY AGQETTS LLVWTM+LL +H EWQ R
Sbjct  330   KLFYFAGQETTSVLLVWTMILLCLHPEWQVR  360



>gb|ABC69419.1| CYP72A56 [Nicotiana tabacum]
Length=516

 Score =   463 bits (1191),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 223/351 (64%), Positives = 277/351 (79%), Gaps = 1/351 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME+++ +I  +   + LV  W++LNWAWF P+K++K LRQ+GLKG  YK ++GDL +++K
Sbjct  1     MEMMYSIIAAASIAIILVYTWKVLNWAWFGPKKMEKCLRQRGLKGNPYKLLYGDLNELTK  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
             S+ +AKSKPIN SDDI+ R +PFF+DAI KNG+NSFVWLGP P+V I DPE +K +FTK+
Sbjct  61    SIIEAKSKPINFSDDIAQRLIPFFLDAINKNGKNSFVWLGPYPIVLITDPEHLKEIFTKN  120

Query  414   TIFQKPPS-NPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
              ++QK    NP +KLLA G++  EEDKW KHRKII+P F +EKLKHM+PAFYLSCSEM+S
Sbjct  121   YVYQKQTHPNPYAKLLAHGLVSLEEDKWAKHRKIISPAFHVEKLKHMLPAFYLSCSEMIS  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +WE+ V  +   ELDVWP LQ + S+VISRTAFGSSYEEG  +FELQ+EQ  YV+ I  S
Sbjct  181   KWEEVVPKETSFELDVWPDLQIMTSEVISRTAFGSSYEEGRIVFELQKEQAEYVMDIGRS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             IYIPG RFLPTKRN+RM +IEKQV  +I  IIDKR+KAM  GE S DDLLGILLESN +E
Sbjct  241   IYIPGSRFLPTKRNKRMLEIEKQVQTTIRRIIDKRLKAMEEGETSKDDLLGILLESNLKE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IE +G  + G+TT EVIEECKLFY AGQETTS LLVWTM+LL +H EWQ R
Sbjct  301   IELHGRNDLGITTSEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVR  351



>ref|XP_004243258.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   459 bits (1182),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 220/353 (62%), Positives = 271/353 (77%), Gaps = 4/353 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIV-FLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEI +  I  +I +V  LV  WR+LNWAWFRP+KL+K LR+ GLKG  YK  +GDL +I+
Sbjct  1     MEIPYNRIIEAICVVTLLVYTWRVLNWAWFRPKKLEKYLRKSGLKGNPYKLFYGDLNEIT  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               V +A+SKPIN SDDI+ R +PFF+D+I KNG+ SFVWLGP P V I DPE VK +FTK
Sbjct  61    NKVNEARSKPINFSDDIAQRLIPFFLDSINKNGKRSFVWLGPNPAVLITDPEHVKEIFTK  120

Query  411   HTIFQK-PPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             +  +QK P  NP +   A+G+ F EEDKW KHRKIINP F  EK KHM+PAFY SCSEM+
Sbjct  121   NYAYQKIPHPNPFANSFAKGLAFLEEDKWTKHRKIINPAFHFEKFKHMLPAFYQSCSEMI  180

Query  588   SEWEKNVGDQGLA-ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQIS  764
             S+W K +  +G + ELDVWP +Q +  +VISRT+FGS YEEG K+FELQREQ  YV+ ++
Sbjct  181   SKW-KEINPKGTSVELDVWPDIQLMTGEVISRTSFGSCYEEGRKVFELQREQAEYVMDMT  239

Query  765   SSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF  944
              S+YIPG RFLPTKRN+RM +IEKQ+  +I  IIDKR++AM  GEAS +DLLGILLESN 
Sbjct  240   HSVYIPGSRFLPTKRNKRMLEIEKQIQTTIRHIIDKRLRAMEAGEASKNDLLGILLESNM  299

Query  945   EEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +EIEQ+GNK+FGMTT E+IEECKLFY AGQE  S LLVWTM+LL +H EWQ R
Sbjct  300   KEIEQHGNKDFGMTTTELIEECKLFYFAGQEGNSVLLVWTMILLCLHPEWQVR  352



>ref|XP_006348908.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   459 bits (1181),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 273/352 (78%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAI-VFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEI +  I  +I + + LV  W++LNWAWF+P+KL+K LR+ GLKG  YK ++GD K+++
Sbjct  1     MEISYNRIIAAICVAILLVYTWKVLNWAWFKPKKLEKYLRKNGLKGNPYKLLYGDSKELT  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               + +A+SKPIN +DDI+ R +PFF+D+I KNG+NSFVWLGP P+V I DPE VK +FTK
Sbjct  61    NKLNEARSKPINFNDDIAQRLIPFFLDSINKNGKNSFVWLGPYPIVLITDPEHVKVIFTK  120

Query  411   HTIFQKPPS-NPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             +  +QK    NP +KLLA G+   EEDKW KHRKIINP F +EKLKHM+PAFY SCSEM+
Sbjct  121   NYGYQKQAHPNPFAKLLAIGLALLEEDKWAKHRKIINPAFHVEKLKHMLPAFYQSCSEMI  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             S+WE  V  +   ELDVWP LQ +  +VISRTAFGSSYEEG  +FELQ+EQ  YV+ I+ 
Sbjct  181   SKWEDIVPKETSVELDVWPDLQLMTGEVISRTAFGSSYEEGRIVFELQKEQAEYVIDITR  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             S+YIPG RFLPTKRN+RM  IEKQV  +I  IIDKR++AM  GE S +DLLGILLESN +
Sbjct  241   SVYIPGSRFLPTKRNKRMLAIEKQVQTTIRRIIDKRLRAMEAGETSKNDLLGILLESNMK  300

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EIEQ+G+K FGMTT E+IEECKLFY AGQE TS LLVWTM+LLS+H EWQ R
Sbjct  301   EIEQHGSKEFGMTTIELIEECKLFYFAGQEATSVLLVWTMILLSLHPEWQVR  352



>ref|XP_004243259.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   458 bits (1179),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 275/352 (78%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIV-FLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEI +  I  +I +V  LV  WR+LNWAWF+P+KL+K LR+ GLKG  YK ++GD K+++
Sbjct  1     MEISYNRIIEAICVVTLLVYTWRVLNWAWFKPKKLEKYLRKSGLKGNPYKLLYGDSKELT  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               + +A+SKPIN SDDI+ R +PFFID+I KNG++SFVWLGP P+V I  PE VK +FTK
Sbjct  61    NKLNEARSKPINFSDDIAQRLVPFFIDSINKNGKSSFVWLGPCPIVLITYPEHVKEIFTK  120

Query  411   HTIFQKPPS-NPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             +  +QK    NP +KLLA G+   EEDKW KHRKIINP F +EKLKHM+PAFY SC+EML
Sbjct  121   NCAYQKQAHPNPFAKLLAIGLALLEEDKWAKHRKIINPAFHVEKLKHMLPAFYQSCTEML  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             S+WE+ +  +   ELDVWP LQ +  +VISRTAFGSSYEEG  +FELQ+EQ  YV+ I+ 
Sbjct  181   SKWEEIIQKETSVELDVWPDLQLMTGEVISRTAFGSSYEEGRIVFELQKEQAEYVIDITR  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             S+YIPG RFLPTK+N+RM +IEKQV  +I  IIDKR++AM  GE S +DLLGILLESN +
Sbjct  241   SVYIPGSRFLPTKKNKRMLEIEKQVQTTIRRIIDKRLRAMEAGEPSKNDLLGILLESNMK  300

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EIEQ+G+K+FGMTT E+IEECKLFY AGQE TS LLVWTM+LLS+H EWQ R
Sbjct  301   EIEQHGSKDFGMTTIELIEECKLFYFAGQEATSVLLVWTMILLSVHPEWQVR  352



>ref|XP_006348907.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   457 bits (1175),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 216/352 (61%), Positives = 271/352 (77%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAI-VFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEI +  I  +I + + LV  WR+LNWAWF+P+KL+K LR+ GLKG  YK  +GDL +++
Sbjct  1     MEISYNRIIEAICVAILLVYTWRVLNWAWFKPKKLEKYLRKSGLKGNPYKLFYGDLNELT  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               + +A+SKPIN SDDI+ R +PFF+D+I KNG++SFVWLGP P V I DPE VK +FTK
Sbjct  61    NKLNEARSKPINFSDDIAQRLIPFFLDSIYKNGKSSFVWLGPYPAVLITDPEHVKEIFTK  120

Query  411   HTIFQK-PPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             +  +QK    NP +K  A+G+ F EEDKW KHRKIINP F  E LKHM+PAFY SCSEM+
Sbjct  121   NYGYQKIAHPNPFAKSFAKGLAFLEEDKWAKHRKIINPAFHFENLKHMLPAFYQSCSEMI  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             S+WE  V  +   ELDVWP LQ +  +VISRTAFGSSYEEG K+FELQ+EQ  YV+ ++ 
Sbjct  181   SKWEDIVPKETSVELDVWPDLQLMTGEVISRTAFGSSYEEGRKVFELQKEQAEYVMDMTH  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             S+YIPG RFLPTKRN+RMK+IEKQ+  +I  II+KR++AM  GE S +DLLGILLESN +
Sbjct  241   SVYIPGSRFLPTKRNKRMKEIEKQIQTTIRRIINKRLRAMEAGETSKNDLLGILLESNMK  300

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EIEQ+GNK+FGMTT E+IEECKLFY AGQE  S LL+WTM+LL +H EWQ R
Sbjct  301   EIEQHGNKDFGMTTIELIEECKLFYFAGQEGNSVLLIWTMILLCLHPEWQVR  352



>ref|XP_004243256.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=516

 Score =   456 bits (1174),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 214/351 (61%), Positives = 273/351 (78%), Gaps = 1/351 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME++  +I      + L+C W++LNWAWFRP+KL+K   Q GLKG  YK ++GDL +++K
Sbjct  1     MEMLSKIIATICVAILLICTWKVLNWAWFRPKKLEKYFIQNGLKGKPYKLLYGDLNELTK  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
             S+ +AKSKPIN SDDI+ R +PFF+D+I KNG++SF+WLGP P++ I DPE VK +FTK+
Sbjct  61    SIVEAKSKPINFSDDIAQRLIPFFLDSINKNGKSSFMWLGPYPVILITDPEHVKEIFTKN  120

Query  414   TIFQKPPS-NPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
              ++ K    NP++KLLAQG+   E DKW KHRKIINP F +EKLKHM+PAFY+SCSEMLS
Sbjct  121   YVYLKQTHPNPMTKLLAQGLANIEGDKWAKHRKIINPVFHVEKLKHMLPAFYMSCSEMLS  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +WE+ V      ELDVWP LQ + S+VISRTAFGSSYEEG  +FELQ+EQ  YV++   S
Sbjct  181   KWEEIVPTGTSFELDVWPDLQIMTSEVISRTAFGSSYEEGRTVFELQKEQAEYVIEKGQS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             IYIPG RFLPTKRN+RM +IEK++  +I  IIDKR++AM  G+ S DDLLGILLESN +E
Sbjct  241   IYIPGSRFLPTKRNKRMLEIEKEIQTTIRCIIDKRLRAMEAGDTSKDDLLGILLESNLKE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IE +G K+FGMT  +V++ECKLFY AGQETTS LLVWTM+LL +H EWQ R
Sbjct  301   IELHGKKDFGMTISDVVDECKLFYFAGQETTSVLLVWTMILLCLHPEWQVR  351



>ref|XP_004243262.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   455 bits (1171),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 217/352 (62%), Positives = 275/352 (78%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAI-VFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEI +  I  +I + + LV   R+LNWAWF+P+KL+K LR+ GLKG  YK  +GDL +I+
Sbjct  1     MEISYNRIIEAICVAILLVYTLRVLNWAWFKPKKLEKYLRKSGLKGNPYKLFYGDLNEIT  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               + +A+SKPIN SDDI+ R +PFFID+I KNG++SFVW GP P+V I DPE VK +FTK
Sbjct  61    NKLNEARSKPINFSDDIAQRLIPFFIDSINKNGKSSFVWQGPCPIVLITDPEHVKEIFTK  120

Query  411   HTIFQKPPS-NPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             + ++QK    NP SK LA G++  EE+KW KHRKIINP FQ+EKLKHM+PAFY SCSEM+
Sbjct  121   NYVYQKDTHPNPFSKFLAVGILKLEENKWAKHRKIINPVFQVEKLKHMLPAFYQSCSEMI  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             S+WE  V  +   ELDVWP LQ + +++ISRTAFGSS+EEG  +FELQ+EQ  +V++IS 
Sbjct  181   SKWEDIVPKETSVELDVWPDLQLMTAEIISRTAFGSSFEEGRIVFELQKEQAEHVMEISR  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             +IYIPG RFLPTKRN+RM +IEKQV  +I  IIDKR++AM  GE S +DLLGILLESN +
Sbjct  241   TIYIPGSRFLPTKRNKRMLEIEKQVQTTIRHIIDKRLRAMEAGETSKNDLLGILLESNMK  300

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EIEQ+G+K+FGMTT EVI+ECK FY AGQETT+ LLVWTM+LL +H EWQ R
Sbjct  301   EIEQHGSKDFGMTTTEVIDECKFFYFAGQETTAVLLVWTMILLCLHPEWQAR  352



>ref|XP_004243255.1| PREDICTED: cytochrome P450 CYP72A219 isoform X1 [Solanum lycopersicum]
Length=526

 Score =   455 bits (1171),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 211/336 (63%), Positives = 271/336 (81%), Gaps = 1/336 (0%)
 Frame = +3

Query  99    FLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDD  278
              L   W++LNWAWF P+KL+  LRQ+GLKG  YK ++GDL +++KS+ +AKSKPIN SDD
Sbjct  26    LLFYTWKVLNWAWFGPKKLENCLRQRGLKGNPYKLLYGDLNELTKSIVEAKSKPINFSDD  85

Query  279   ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPS-NPLSKL  455
             I+ R +PFF+++I KNG++SF+WLGP P+V I  PE VK +FTK+ ++ K    NP +KL
Sbjct  86    IAQRLIPFFLNSINKNGKSSFIWLGPYPIVLITKPEHVKEIFTKNYVYLKQTHPNPFTKL  145

Query  456   LAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELD  635
             LA+G++  EEDKW KHRKIINP F +EKLKHM+PAFY+ CSEM+S+WE+ V      E+D
Sbjct  146   LAKGLVSLEEDKWAKHRKIINPTFHVEKLKHMLPAFYVCCSEMISKWEEIVPKGTSTEID  205

Query  636   VWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNR  815
             VWP L+++ S+VISRTAFGSSYEEG  +FELQ+EQ  +V++++ SIYIPG RFLPTKRN+
Sbjct  206   VWPDLEKMTSEVISRTAFGSSYEEGRIVFELQKEQAEHVMEVARSIYIPGSRFLPTKRNK  265

Query  816   RMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFGMTTRE  995
             RM +IEK++  +I  IIDKR++AM GGE S DDLLGILLESN +EIEQ+G+K+FGMTT E
Sbjct  266   RMLEIEKEIQTTIRRIIDKRLRAMEGGETSKDDLLGILLESNMKEIEQHGSKDFGMTTVE  325

Query  996   VIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             VIEECKLFY AGQETTS LLVWTM+LL +H EWQ R
Sbjct  326   VIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQVR  361



>ref|XP_006348910.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   452 bits (1164),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 220/352 (63%), Positives = 270/352 (77%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAI-VFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             M+I +  I  +I + V LV  WR+LNWAW +P+KL+K LR+ GLKG  YK   GDLK+ +
Sbjct  1     MKISYNRIIEAICVAVLLVYTWRVLNWAWLKPKKLEKYLRKSGLKGNPYKLYHGDLKEFT  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               + +AKSKPIN SDDI+ R +PFF D+I KNG++SFVWLGP P+V I DPE VK +FTK
Sbjct  61    NKLNEAKSKPINFSDDIAQRLIPFFCDSINKNGKSSFVWLGPYPVVLITDPEHVKEIFTK  120

Query  411   HTIFQKPPS-NPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             + ++QK    NP SKLLA G+   EEDKW KHRKIINP FQ EKLKHM+PAFY SCSE++
Sbjct  121   NYVYQKETHPNPFSKLLAIGLAKLEEDKWAKHRKIINPAFQTEKLKHMLPAFYQSCSEII  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             S+WE+ +  +   ELDVWP LQ + ++VISRTAFGSSYEEG  +FELQ EQ  YV  I+ 
Sbjct  181   SKWEEIIPKETSFELDVWPDLQLMTAEVISRTAFGSSYEEGRIVFELQNEQAEYVTDINR  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             SIYIPG RFLPTKR +RM +IEKQV  +I  IIDKR++AM  GE S +DLLGILLESN +
Sbjct  241   SIYIPGSRFLPTKRYKRMLEIEKQVQTTIKRIIDKRLRAMEAGETSKNDLLGILLESNMK  300

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EIEQ+G+K+FGMTT EVI+ECK FY AGQETT+ LLVWTM+LL +H EWQ R
Sbjct  301   EIEQHGSKDFGMTTTEVIDECKFFYFAGQETTAVLLVWTMILLCLHPEWQAR  352



>ref|XP_004244274.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Solanum 
lycopersicum]
Length=513

 Score =   450 bits (1158),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 219/351 (62%), Positives = 278/351 (79%), Gaps = 4/351 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME+V      +I I   VCLW++LNW WFRP+KL+K+LR+QGL G  Y+ ++GD+K  SK
Sbjct  1     MELVTACCC-AITITLFVCLWKVLNWVWFRPKKLEKLLRKQGLNGNSYRLLYGDMKDFSK  59

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
              +++A SKP+NLS+DI+PR +PFF++ I+K G+ SF+WL PKP V I DPEL+K VF+K+
Sbjct  60    MIKEANSKPMNLSNDITPRLVPFFLETIKKYGKKSFIWLCPKPQVLIMDPELIKEVFSKN  119

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
               +QKP  NP + LL QG+  +EEDKW KHRKIINP F +EKLKHM+PAF+LSCSEMLS+
Sbjct  120   YFYQKPHGNPFAALLVQGLAAYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLSCSEMLSK  179

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WE  V  +G  E+DVWP+LQQL  DVISRTAFGSSYEEG KIFELQREQ  + +    S+
Sbjct  180   WEDAV--EGSCEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQREQAQHFIDTVRSV  237

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGG-EASPDDLLGILLESNFEE  950
              IP WRFLPTKRNRRMK+I+ +V  S+  IIDKR+KAM+ G +A  +DLLG+LLESNF+E
Sbjct  238   NIPRWRFLPTKRNRRMKEIKNEVRTSMKGIIDKRMKAMKAGHDADNEDLLGVLLESNFKE  297

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IEQ+GNK+FGM+  EVIEECKLFY AGQET + LLVWT+VLLS +Q+WQT+
Sbjct  298   IEQHGNKDFGMSIEEVIEECKLFYFAGQETIAVLLVWTLVLLSRYQDWQTQ  348



>gb|EYU31636.1| hypothetical protein MIMGU_mgv1a004595mg [Erythranthe guttata]
Length=519

 Score =   450 bits (1157),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 220/353 (62%), Positives = 277/353 (78%), Gaps = 1/353 (0%)
 Frame = +3

Query  48    EMMEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKI  227
             E++ I++ +IG  +A V L   WR+LNWA+ RP++L+K LR+QGL G  Y F++GDLK++
Sbjct  2     EVILILYKIIGACLAFVVLFYTWRILNWAYIRPKRLEKSLRKQGLIGNTYNFLYGDLKEM  61

Query  228   SKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
                +  AKS PINL DDI PR L F      K G+ SF+WLGP+P V I +PEL+K V T
Sbjct  62    LNMINHAKSHPINLDDDIKPRVLAFIHKTFLKYGKGSFIWLGPRPAVMITEPELIKEVMT  121

Query  408   KHTIFQKPP-SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEM  584
             K  ++QKP  SNPL+KLLAQGV+ +E DKW KHRKIINP F  EKLK MIPAFYLSC E+
Sbjct  122   KINLYQKPKNSNPLTKLLAQGVVAYEGDKWAKHRKIINPAFHFEKLKLMIPAFYLSCDEV  181

Query  585   LSEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQIS  764
             L++WEK++  +G  E+DVWPYLQ L+SD ISRTAFGSSY+EG K+FELQREQ  Y+++ S
Sbjct  182   LNKWEKSLSGKGSGEVDVWPYLQNLSSDAISRTAFGSSYKEGRKVFELQREQAEYIIKAS  241

Query  765   SSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF  944
              +IYIPGWRF+PTK N RMK+IEK+V +SI  +I+KRVKAM+ GEAS +DLLG+LLESN+
Sbjct  242   QTIYIPGWRFMPTKGNNRMKEIEKEVQSSIRGMINKRVKAMKAGEASNEDLLGLLLESNY  301

Query  945   EEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +EIEQ GNK+FGMT  EV+EECKLFY AGQETTS LLVW +VLLS + EWQT+
Sbjct  302   KEIEQYGNKSFGMTIDEVVEECKLFYFAGQETTSVLLVWALVLLSQYPEWQTK  354



>ref|XP_009797873.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=519

 Score =   449 bits (1155),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 214/340 (63%), Positives = 275/340 (81%), Gaps = 0/340 (0%)
 Frame = +3

Query  84    SIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPI  263
             +I I  LVC+WR+LNW WFRP+KL+ +LR+QGL+G  YK ++GD+K+ S  +++A SKP+
Sbjct  15    AIVITLLVCIWRVLNWIWFRPKKLELLLRKQGLEGNSYKVLYGDMKEFSGMIKEAYSKPM  74

Query  264   NLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNP  443
             +LSDD++PR +PFF++ I+K G+ SF+W GP+PLV I DPEL+K V +K  ++QKP  NP
Sbjct  75    SLSDDVAPRLMPFFLETIKKYGKRSFIWFGPRPLVLIMDPELIKEVLSKIHLYQKPGGNP  134

Query  444   LSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGL  623
             L+ LL QG+  +EEDKW KHRKIINP F +EKLK M+PAF LSCSEMLS+WE  V     
Sbjct  135   LATLLVQGIATYEEDKWAKHRKIINPAFHLEKLKLMLPAFRLSCSEMLSKWEDIVSADSS  194

Query  624   AELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPT  803
              E+DVW +L+QL  DVISRTAFGSSYEEG KIFELQ+EQ  Y++++  S+YIPG RFLPT
Sbjct  195   HEIDVWSHLEQLTCDVISRTAFGSSYEEGRKIFELQKEQAQYLVEVFRSVYIPGRRFLPT  254

Query  804   KRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFGM  983
             KRNRRMK+I+K V ASI  IIDKR+KAM+ G+ + +DLLGILLESN +EIEQ+GNK+FGM
Sbjct  255   KRNRRMKEIKKDVRASIKGIIDKRLKAMKAGDTNNEDLLGILLESNIKEIEQHGNKDFGM  314

Query  984   TTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +  EVIEECKLFY AGQETTS LL+W++VLLS +Q+WQ R
Sbjct  315   SIEEVIEECKLFYFAGQETTSVLLLWSLVLLSRYQDWQAR  354



>ref|XP_009615908.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=514

 Score =   449 bits (1154),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 214/340 (63%), Positives = 267/340 (79%), Gaps = 2/340 (1%)
 Frame = +3

Query  84    SIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPI  263
             S+AI FLV  W++LNW WFRP+KL+K LRQ+GLKG  YK ++GDL +++KS+ +AKSKPI
Sbjct  10    SVAI-FLVYTWKVLNWVWFRPKKLEKCLRQRGLKGNPYKLLYGDLNELTKSIIEAKSKPI  68

Query  264   NLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPS-N  440
             N SDDI+ R +PFF++AI KNG+ SFVWLGP P+V I  PE VK + TK  ++ K    N
Sbjct  69    NFSDDIAQRLIPFFLNAINKNGKTSFVWLGPYPVVLITAPEHVKEILTKSYVYLKQTHPN  128

Query  441   PLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQG  620
             PL+KLLAQ ++  EE+KW KHRKIINP F +EKLKHM+PAFY SCSEMLS+WE+ V  + 
Sbjct  129   PLTKLLAQSLVNLEEEKWAKHRKIINPAFHVEKLKHMLPAFYQSCSEMLSKWEEIVPKET  188

Query  621   LAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLP  800
               E DVWP LQ + S+VISRTAFGSSY+EG  +FELQ+EQ  YV++   SIY+PG RFLP
Sbjct  189   SFEFDVWPDLQVMTSEVISRTAFGSSYQEGRIVFELQKEQAEYVMEKGRSIYVPGSRFLP  248

Query  801   TKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFG  980
             TK N+RM +IEK++  +I  IIDKR++AM+ GE + +DLLGILLESN EEIE +G+K FG
Sbjct  249   TKTNKRMLEIEKEIQTTIRRIIDKRLRAMKAGETNNEDLLGILLESNLEEIELHGSKEFG  308

Query  981   MTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQT  1100
             MT  EVIEECKLFY AGQETTS LLVWTM+LL +H EWQ 
Sbjct  309   MTASEVIEECKLFYFAGQETTSVLLVWTMILLCLHPEWQV  348



>gb|ABC69422.1| CYP72A58 [Nicotiana tabacum]
Length=513

 Score =   448 bits (1153),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 214/340 (63%), Positives = 275/340 (81%), Gaps = 0/340 (0%)
 Frame = +3

Query  84    SIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPI  263
             +I I  LVC+WR+LNW WFRP+KL+ +LR+QGL+G  YK ++GD+K+ S  +++A SKP+
Sbjct  9     AIVITLLVCIWRVLNWIWFRPKKLELLLRKQGLEGNSYKVLYGDMKEFSGMIKEAYSKPM  68

Query  264   NLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNP  443
             +LSDD++PR +PFF++ I+K G+ SF+W GP+PLV I DPEL+K V +K  ++QKP  NP
Sbjct  69    SLSDDVAPRLMPFFLETIKKYGKRSFIWFGPRPLVLIMDPELIKEVLSKIHLYQKPGGNP  128

Query  444   LSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGL  623
             L+ LL QG+  +EEDKW KHRKIINP F +EKLK M+PAF LSCSEMLS+WE  V     
Sbjct  129   LATLLVQGIATYEEDKWAKHRKIINPAFHLEKLKLMLPAFRLSCSEMLSKWEDIVSADSS  188

Query  624   AELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPT  803
              E+DVW +L+QL  DVISRTAFGSSYEEG KIFELQ+EQ  Y++++  S+YIPG RFLPT
Sbjct  189   HEIDVWSHLEQLTCDVISRTAFGSSYEEGRKIFELQKEQAQYLVEVFRSVYIPGRRFLPT  248

Query  804   KRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFGM  983
             KRNRRMK+I+K V ASI  IIDKR+KAM+ G+ + +DLLGILLESN +EIEQ+GNK+FGM
Sbjct  249   KRNRRMKEIKKDVRASIKGIIDKRLKAMKAGDTNNEDLLGILLESNIKEIEQHGNKDFGM  308

Query  984   TTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +  EVIEECKLFY AGQETTS LL+W++VLLS +Q+WQ R
Sbjct  309   SIEEVIEECKLFYFAGQETTSVLLLWSLVLLSRYQDWQAR  348



>ref|XP_006348909.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   447 bits (1150),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 213/352 (61%), Positives = 272/352 (77%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAI-VFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEI +  I  +I++ + LV  W++LNWAWF+P+KL+K LR+ GLKG  YK ++GDLK+++
Sbjct  1     MEISYNRIIAAISVAILLVYTWKVLNWAWFKPKKLEKYLRKSGLKGNKYKLLYGDLKELT  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               + +AKSKPI+ S D+  R +PFF D+I KNG++SF+WLGP P+V I DPE VK + TK
Sbjct  61    NKLNEAKSKPIHFSGDVPQRLIPFFCDSINKNGKSSFMWLGPYPVVLITDPEHVKEILTK  120

Query  411   HTIFQKPPS-NPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             + ++Q+    NP +K LA G+   EEDKW KHRKII P FQ+EKLKHM+PAFY SCSEM+
Sbjct  121   NYVYQRQTHPNPFAKKLALGLAKLEEDKWAKHRKIIQPAFQLEKLKHMLPAFYQSCSEMI  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             S+WE+ +  +   ELDVWP LQ + ++VISRTAFGSSYEEG  +FELQ+EQ  YV+ I  
Sbjct  181   SKWEEIIPKETSFELDVWPDLQLITAEVISRTAFGSSYEEGRIVFELQKEQAEYVINIIR  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             S+YIPG RFLPTKRN+RM +IEKQV  +I  IIDKR++AM  GE S DDLLGILLESN  
Sbjct  241   SVYIPGTRFLPTKRNKRMLEIEKQVQTTIRRIIDKRLRAMEAGETSKDDLLGILLESNMR  300

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EIEQ+ +K+FG+TT E+IEECKLFY AGQET S LLVWTM+LLS+H EWQ R
Sbjct  301   EIEQHRSKDFGITTIEMIEECKLFYFAGQETASVLLVWTMILLSLHPEWQAR  352



>emb|CDP19599.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   446 bits (1148),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 205/350 (59%), Positives = 264/350 (75%), Gaps = 0/350 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME+++ L+    A   ++  WR+LNWAWF+P+K +K LRQQGL+G  Y  + GD+K+  +
Sbjct  1     MEVLYSLVAVLSASFLVILSWRILNWAWFKPKKREKCLRQQGLRGNSYNLVLGDMKETVR  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
               ++AKSKPIN ++DI  R +PF    I+  GENS+ W GP P V + DPE +K V  K 
Sbjct  61    MTQEAKSKPINFTNDIVSRVMPFIDKTIKTYGENSYAWAGPMPAVLLMDPEHIKEVMNKS  120

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
               + KPP NPLSKLLA G++ +E DKW KHRK+INP F +EK+K M+PAF LSC EM+S+
Sbjct  121   FNYLKPPGNPLSKLLATGLVSYETDKWSKHRKLINPAFHLEKVKLMLPAFRLSCFEMVSK  180

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WE+ + ++G  ELDVWP LQ L SDVISRTAFGS+YEEG KIFELQ+EQ   +L  + S 
Sbjct  181   WEQLISEKGSCELDVWPELQALTSDVISRTAFGSNYEEGQKIFELQKEQAELILLAARSP  240

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI  953
             Y+PGWRF+PTKRN+RMK I K+V + +MD+I+ RVKAM+ GEA  DDLL ILLESNF+EI
Sbjct  241   YVPGWRFVPTKRNKRMKGIAKEVRSLVMDMINNRVKAMKAGEAKNDDLLAILLESNFKEI  300

Query  954   EQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +++ +K FGMT  EVIEECKLFY AGQETTSSLLVWT++LLS HQ+WQ R
Sbjct  301   QEHEDKKFGMTLDEVIEECKLFYFAGQETTSSLLVWTLILLSKHQDWQDR  350



>ref|XP_009796418.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   446 bits (1146),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 201/353 (57%), Positives = 274/353 (78%), Gaps = 4/353 (1%)
 Frame = +3

Query  54    MEIVFGL---IGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKK  224
             ME +F +   +   I I+FL  +W+ LNW W +P+K++K L+ +G KG+ YK +FGD+K+
Sbjct  1     METLFNIKVAVSLVIVIIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLFGDMKE  60

Query  225   ISKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVF  404
             I+  VE+AK+KP+N ++D   R LP F   + + G+NSF+WLGPKP +FI DPEL++ + 
Sbjct  61    INTMVEEAKTKPMNFTNDYVARVLPHFTKLMLQYGKNSFMWLGPKPTMFITDPELIREIL  120

Query  405   TKHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEM  584
             +K  I+QK   NP++KLLAQG++ +E +KW KHRKIINP F ++KLKHM+P+FYLSC +M
Sbjct  121   SKSYIYQKIQGNPITKLLAQGLVSYEAEKWAKHRKIINPAFHLDKLKHMLPSFYLSCCDM  180

Query  585   LSEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQIS  764
             L +WE     +G +E+DVWP+L+ L SD ISRTAFGS+YE+G +IFELQ+EQ   +LQ +
Sbjct  181   LRKWESIASSEG-SEIDVWPFLETLTSDAISRTAFGSNYEDGRQIFELQKEQAELILQAA  239

Query  765   SSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF  944
               +YIPGWRF+PTKRN+RMKQI K+V + ++ II+KR++ M+ GEA+ DDLLGILLESNF
Sbjct  240   RWLYIPGWRFVPTKRNKRMKQIAKEVRSLVLGIINKRIREMKAGEAAKDDLLGILLESNF  299

Query  945   EEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +EI+ +GNKNFGMT  EVIEECKLFY AGQETTS LLVWT++LLS H +WQ R
Sbjct  300   KEIQMHGNKNFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHVDWQER  352



>emb|CDP19601.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   444 bits (1143),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 207/350 (59%), Positives = 271/350 (77%), Gaps = 1/350 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             M+  + LIG S  IV L+  WR LNWAW  P+K++K LR+QGL+G  Y+F+FGD + + +
Sbjct  1     MDFFYSLIGVSSVIVLLIGAWRFLNWAWITPKKMEKRLRRQGLQGNSYRFLFGDTRDMGR  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
              +E+AKSKPI+L+DDI PR +P   + +Q  G+NSF WLGP+P + I DPE VK VFTK+
Sbjct  61    MLEEAKSKPISLTDDIFPRIMPLINETMQHKGKNSFFWLGPRPAMVILDPEQVKEVFTKN  120

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
               +QKP +NP+SKLLA G+   + +KW KHR+++NP F +EKLK+M+PAFYLSC+EMLS+
Sbjct  121   FTYQKPRANPISKLLALGLASLDTEKWAKHRRLLNPAFHVEKLKYMVPAFYLSCNEMLSK  180

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WE     +G  ELDVWPYLQ   SDVISRTAFGS+YE+G +IFELQ EQ  Y  Q+  SI
Sbjct  181   WENLAPAEGSFELDVWPYLQIFTSDVISRTAFGSNYEKGRRIFELQSEQALYFEQVMQSI  240

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI  953
             Y+PGW F+PTKRN+RM++I K+V++ +M II++R+K ++ GEA+ DDLLGILLESN  EI
Sbjct  241   YLPGWSFVPTKRNKRMQKIFKEVNSLVMGIINERLKEIQTGEATSDDLLGILLESNLNEI  300

Query  954   EQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              Q+GNKN G++  EVIEECKLFYLAGQETTS LLVWT++LLS H +WQ R
Sbjct  301   RQHGNKN-GLSLEEVIEECKLFYLAGQETTSGLLVWTLILLSQHFDWQAR  349



>gb|ABC69417.1| CYP72A54 [Nicotiana tabacum]
Length=517

 Score =   444 bits (1142),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 200/353 (57%), Positives = 274/353 (78%), Gaps = 4/353 (1%)
 Frame = +3

Query  54    MEIVFGL---IGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKK  224
             ME +F +   +   I I+FL  +W+ LNW W +P+K++K L+ +G KG+ YK +FGD+K+
Sbjct  1     METLFNIKVAVSLVIVIIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLFGDMKE  60

Query  225   ISKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVF  404
             I+  VE+AK+KP+N ++D   R LP F   + + G+NSF+WLGPKP +FI DPEL++ + 
Sbjct  61    INTMVEEAKTKPMNFTNDYVARVLPHFTKLMLQYGKNSFMWLGPKPTMFITDPELIREIL  120

Query  405   TKHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEM  584
             +K  I+Q+   NP++KLLAQG++ +E +KW KHRKIINP F ++KLKHM+P+FYLSC +M
Sbjct  121   SKSYIYQEIQGNPITKLLAQGLVSYEAEKWAKHRKIINPAFHLDKLKHMLPSFYLSCCDM  180

Query  585   LSEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQIS  764
             L +WE     +G +E+DVWP+L+ L SD ISRTAFGS+YE+G +IFELQ+EQ   +LQ +
Sbjct  181   LRKWESIASSEG-SEIDVWPFLETLTSDAISRTAFGSNYEDGRQIFELQKEQAELILQAA  239

Query  765   SSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF  944
               +YIPGWRF+PTKRN+RMKQI K+V + ++ II+KR++ M+ GEA+ DDLLGILLESNF
Sbjct  240   RWLYIPGWRFVPTKRNKRMKQIAKEVRSLVLGIINKRIREMKAGEAAKDDLLGILLESNF  299

Query  945   EEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +EI+ +GNKNFGMT  EVIEECKLFY AGQETTS LLVWT++LLS H +WQ R
Sbjct  300   KEIQMHGNKNFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHVDWQER  352



>ref|XP_011082966.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=515

 Score =   443 bits (1140),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 206/351 (59%), Positives = 269/351 (77%), Gaps = 3/351 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             MEI++ L+     +   V  WR LNW W  PRK++K LR+QG  G  Y+F+ GD K++S 
Sbjct  1     MEILYSLVAVIFGVFVSVNAWRFLNWVWLEPRKVEKRLREQGFNGNSYRFLVGDSKEMSS  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
               E+A+SKPIN S+DI  R +PF   ++ K GEN F+W GPKP   I DPE++K + +K+
Sbjct  61    MGEEAQSKPINFSNDIVHRVMPFIHHSLHKYGENCFIWFGPKPAALISDPEMIKEIMSKN  120

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
              +FQK  SNPL +LLA+GV  +E DKW KHR++INP F +EKLKHM+P+FYLSC++MLS+
Sbjct  121   YVFQKI-SNPLDQLLAKGVAAYEADKWDKHRRLINPAFHLEKLKHMVPSFYLSCADMLSK  179

Query  594   W-EKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             W EK V  +G  E+DVWPYLQ ++SDVISRTAFGS+YEEG KIFELQREQ  ++LQ   +
Sbjct  180   WDEKIVAKEGSCEVDVWPYLQSMSSDVISRTAFGSNYEEGRKIFELQREQEEHLLQALQT  239

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRFLPTKRNRRMK+I K+V ++I+ II KR++ +  GE++ DDLLGILLESNF E
Sbjct  240   LYIPGWRFLPTKRNRRMKEIVKEVESTILGIIKKRMQMIEAGESNSDDLLGILLESNFRE  299

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             I+QNG ++ GM+ +EVI+ECKLFY+AGQETTSSL+ WTM+LLS H  WQ R
Sbjct  300   IQQNGTQS-GMSMKEVIDECKLFYIAGQETTSSLITWTMILLSKHSGWQAR  349



>ref|XP_004243261.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   442 bits (1138),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 212/352 (60%), Positives = 269/352 (76%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAI-VFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEI +  I  +I + + LV  W++LNWAWFRP+KL+K LR+ GLKG  YK ++GDLK++ 
Sbjct  1     MEISYNTILTAICVAILLVYTWKVLNWAWFRPKKLEKYLRKSGLKGNPYKLLYGDLKELK  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               + +AKSKPIN SD I+ R  PFF +AI KNG++SFVWLGP P+V I +PE VK + TK
Sbjct  61    NKLNEAKSKPINFSDGIAQRINPFFANAIDKNGKSSFVWLGPYPIVLITEPEHVKEILTK  120

Query  411   HTIFQKPP-SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             + ++Q+   +NP +K LA G+   EEDKW KHRKII P FQ+EKLKHM+PAFY SCSEM+
Sbjct  121   NYVYQRQTHANPFAKKLALGLAKLEEDKWAKHRKIIQPAFQVEKLKHMLPAFYQSCSEMI  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             S+WE+ +  +   ELDVWP LQ + ++VISRTAFGSSYEEG  +FELQ+EQ  YV+ I  
Sbjct  181   SKWEEIIPKETPFELDVWPDLQLITAEVISRTAFGSSYEEGRIVFELQKEQAEYVIDIIR  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             S+YIPG RFLPTKRN+RM +IE +V  +I  IIDKR++AM  GEAS  DLLGILLESN  
Sbjct  241   SVYIPGTRFLPTKRNKRMLEIENKVQTTIRSIIDKRLRAMEAGEASKTDLLGILLESNMR  300

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EI+Q+ + +FG+TT E+IEECKLFY AGQETTS LL WTM+LLS+H EWQ R
Sbjct  301   EIKQHRSNDFGITTAEMIEECKLFYFAGQETTSVLLAWTMILLSLHPEWQAR  352



>emb|CDP15976.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   442 bits (1138),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 208/353 (59%), Positives = 264/353 (75%), Gaps = 3/353 (1%)
 Frame = +3

Query  54    MEIVFGLIG-FSIAIVFLVCL--WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKK  224
             MEI +  I  FS  I+ L+ +  WR   WAW  P+KL+K L++QGL+G  YK ++GD K+
Sbjct  1     MEIAYSPIAVFSSCILLLISVLAWRAFKWAWLTPKKLEKRLKEQGLRGNPYKLLYGDFKE  60

Query  225   ISKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVF  404
             I+   ++A SKPIN+S+D  PR +P F  A++K GEN+++W GPKP+V I +PE ++ + 
Sbjct  61    IATHFKEAHSKPINVSEDFIPRVIPHFCAAVKKYGENTYIWHGPKPMVLILNPEHIREIT  120

Query  405   TKHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEM  584
             TK  IFQK P+NPL+KLLA G++ ++ DKW KHRK+I P F +EKLKHM+P+FY S SEM
Sbjct  121   TKLYIFQKAPANPLTKLLATGLVSYDGDKWAKHRKLITPAFHVEKLKHMVPSFYASASEM  180

Query  585   LSEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQIS  764
             L +WE  V   G  ELDVWP +Q L SD ISRTAFGS+Y+EG +IFELQREQ  + L+  
Sbjct  181   LDKWEAIVSTNGSCELDVWPDIQTLTSDAISRTAFGSNYQEGKRIFELQREQAEHFLKAV  240

Query  765   SSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF  944
              S+YIPGWRFLPTK NRRMKQI K V  SI +II+ R+KAM+ GEA  DDLLGILLESN 
Sbjct  241   ESVYIPGWRFLPTKLNRRMKQIAKDVQESIREIINARLKAMKEGEACADDLLGILLESNS  300

Query  945   EEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +EI+ +GNK+FGMT  +VIEECKLFY AGQETTS +LVWTMVLLS H  WQ R
Sbjct  301   KEIDDHGNKDFGMTIGDVIEECKLFYFAGQETTSVMLVWTMVLLSRHPNWQAR  353



>ref|XP_002268319.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   442 bits (1137),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 201/338 (59%), Positives = 261/338 (77%), Gaps = 1/338 (0%)
 Frame = +3

Query  93    IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLS  272
             IV L+  WR+LNW W RP+KL++ LRQQGL G  Y+ + GD +++S+ + +A S+PI+ S
Sbjct  13    IVLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSEMINEANSRPISFS  72

Query  273   DDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSK  452
             DDI  R LPF   +IQK G+NSF W GPKP+V+I +PEL+++V  KH +FQKPP +PLSK
Sbjct  73    DDIVQRVLPFHDHSIQKYGKNSFTWFGPKPVVYIMEPELIRDVLLKHNVFQKPPPHPLSK  132

Query  453   LLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAEL  632
             LLA GV+  E ++W K RKIINP F +EKLKHM+ AF LSCS+M+++WEK +   G  EL
Sbjct  133   LLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEKKLSLDGSCEL  192

Query  633   DVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRN  812
             DVWPYL+ LA DVISRTAFGSSYEEG +IF+LQREQ    +Q++ SIY+PGWRF PTK N
Sbjct  193   DVWPYLENLAGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSIYVPGWRFFPTKTN  252

Query  813   RRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTT  989
             RRM+QI  +V+A +  II+KR KAM+ GE +  DLLG+L+ESN+ ++++N   KN GM+ 
Sbjct  253   RRMRQISNEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNYRDMQENDERKNVGMSI  312

Query  990   REVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ++VIEECKLFYLAGQETTS LL+WTMVLLS H  WQT 
Sbjct  313   KDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQTH  350



>ref|XP_004243257.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   442 bits (1136),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 206/343 (60%), Positives = 262/343 (76%), Gaps = 3/343 (1%)
 Frame = +3

Query  84    SIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPI  263
              +AI+ ++  W++LNWAWFRP+K +K LR+ GL G  YK ++GDLK+++  + +AKSKPI
Sbjct  16    CVAILLVIYTWKVLNWAWFRPKKFEKYLRKSGLNGNPYKLLYGDLKELTNKLNEAKSKPI  75

Query  264   NLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQK-PPSN  440
             + S D+  R +PFF D+I KNG+NSF WLGPKP+VFI +P L+K +F KH ++ K   SN
Sbjct  76    SFSGDVPQRLIPFFCDSINKNGKNSFAWLGPKPIVFITEPSLIKKIFEKHYVYHKNKHSN  135

Query  441   PLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQG  620
             P +KLL QG++  EE KW KHRKIINP F  EKLKHM+PAFY SCSEML +WE+ V  + 
Sbjct  136   PFAKLLVQGLVTLEEQKWAKHRKIINPAFHFEKLKHMVPAFYQSCSEMLRKWEEAVPKET  195

Query  621   LAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLP  800
              AELDVWP+ Q +  DVISRTAFGSSYEEG  IFELQ+EQ  YV++   SIYIPG RFLP
Sbjct  196   SAELDVWPHFQLMTGDVISRTAFGSSYEEGRIIFELQKEQAEYVMEQIFSIYIPGSRFLP  255

Query  801   TKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEAS--PDDLLGILLESNFEEIEQNGNKN  974
             +K+ +RM +IEK++  +I  II+KR+  M+ GE S   +DLLGILLESN +EIEQ+GNK+
Sbjct  256   SKKKKRMVEIEKEIQTTIRRIIEKRLMTMKAGETSNNNEDLLGILLESNTKEIEQHGNKD  315

Query  975   FGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             FGMT  EVI+ECKLFY AGQ+TTS LLVWTM+LL  H EWQ R
Sbjct  316   FGMTITEVIDECKLFYFAGQDTTSVLLVWTMILLCQHPEWQVR  358



>emb|CDP15988.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   441 bits (1135),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 205/350 (59%), Positives = 263/350 (75%), Gaps = 0/350 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             MEI++ L+    A   ++  WR+LNWAWF+P+KL+K LRQQGL+G  Y  +FGD+K+  +
Sbjct  1     MEILYSLVAVLSASFLVILSWRILNWAWFKPKKLEKCLRQQGLRGNSYNLVFGDMKETVR  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
               ++AKSKP+N ++DI  R +PF    I+  GENS+ W GP P V +  PE +K V  K 
Sbjct  61    MTQEAKSKPMNFTNDIVSRVMPFIDKTIKTYGENSYTWAGPMPAVLLMYPEHIKEVMNKS  120

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
               + KPP NPL+KLLA G+  +E DKW KHRK+I+P F +EK+K M+PAF  SC EM+S+
Sbjct  121   FNYLKPPGNPLTKLLATGLANYETDKWSKHRKLISPAFHLEKVKFMLPAFRWSCFEMVSK  180

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WE+ V ++   ELDVWP LQ L SDVISRTAFGS+YEEG KIFELQ+EQ   +L  + S 
Sbjct  181   WEQLVSEKESCELDVWPELQTLTSDVISRTAFGSNYEEGQKIFELQKEQAELILLAARSP  240

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI  953
             Y+PGWRF+PTKRN+RMK I K+V + +MD+I+ RVKAM+ GEA  DDLL ILLESNF+EI
Sbjct  241   YVPGWRFVPTKRNKRMKGIAKEVRSLVMDMINNRVKAMKAGEAKNDDLLDILLESNFKEI  300

Query  954   EQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +Q+G+K FGMT  EVIEECKLFY AGQETTSSLLVWT++LLS HQ+WQ R
Sbjct  301   QQHGDKKFGMTLDEVIEECKLFYFAGQETTSSLLVWTLILLSKHQDWQDR  350



>ref|XP_011082969.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=516

 Score =   441 bits (1134),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 209/351 (60%), Positives = 270/351 (77%), Gaps = 1/351 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME V+ +I  S+  V L+  WR++ WA+ RP++++K+LR+QG  G+ Y+ +  +LK+  K
Sbjct  1     MEGVWQIIAASLGFVVLIWAWRVVKWAYMRPKRVEKLLRKQGFNGSSYRLVNRELKERLK  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
              V++AKS PINL DDI PR LPF+   IQ  G  SF+WLG  P V I DPEL+K V TK 
Sbjct  61    MVKEAKSNPINLDDDIKPRILPFYTKTIQTYGTESFMWLGLSPTVIISDPELIKEVMTKT  120

Query  414   TIFQK-PPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
              I++K   +NPL++LLAQG+  ++ DKW KH+KIINP F MEKLK MIPAFYLSC E+L+
Sbjct  121   HIYKKIKNANPLTRLLAQGLFSYDLDKWAKHKKIINPAFHMEKLKLMIPAFYLSCDEVLN  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +WEK++  +G  E+DVWP+LQ L+SD ISRTAFGSSY+EG +IFELQREQ G+    S S
Sbjct  181   KWEKSLSPEGSCEVDVWPFLQNLSSDAISRTAFGSSYQEGRRIFELQREQAGHFFIASRS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRF+PTKRN+RMK+I ++V + I  II +RV+AM+ GEA+ +DLLGILLESN  E
Sbjct  241   MYIPGWRFVPTKRNKRMKEIAEEVQSLIRGIISRRVEAMKAGEANNEDLLGILLESNARE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IEQ+GNK FGMT  EV+EECKLFY AGQETTSSLLVWT+VLLS + +WQ R
Sbjct  301   IEQHGNKTFGMTIDEVVEECKLFYFAGQETTSSLLVWTLVLLSRYPDWQKR  351



>ref|XP_009607556.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=516

 Score =   441 bits (1133),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 198/343 (58%), Positives = 267/343 (78%), Gaps = 1/343 (0%)
 Frame = +3

Query  75    IGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKS  254
             + F I I+FL  +W+ LNW W +P+K++K L+ +G KG+ YK + GD+K+I+  VE+AK+
Sbjct  10    VSFVIMIIFLRWVWKFLNWVWIQPKKMEKRLKMEGFKGSSYKLLLGDMKEINTMVEEAKT  69

Query  255   KPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP  434
             KP+N ++D   R LP F   + + G+N F+WLGPKP +FI DPEL++ + +K  I+QK  
Sbjct  70    KPMNFTNDYVARVLPHFTKLMLQYGKNCFMWLGPKPTMFITDPELIREILSKSYIYQKIQ  129

Query  435   SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD  614
              NP++KLLAQG+  +E +KW KHR+IINP F ++KLKHM+P+FYLSC +ML +WE  V  
Sbjct  130   GNPITKLLAQGLASYETEKWAKHRRIINPAFHLDKLKHMLPSFYLSCCDMLRKWESIVSS  189

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRF  794
             +G +E+DVWP+LQ L SD ISRTAFGS+YEEG +IFELQ+EQ   +LQ +  +YIPGWRF
Sbjct  190   EG-SEIDVWPFLQTLTSDAISRTAFGSNYEEGRQIFELQKEQAELILQAARWLYIPGWRF  248

Query  795   LPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKN  974
             +PTKRN+RMKQI K+V + ++ II+KR++ M+ GEA+ DDLLGILLESNF+EI+ + NKN
Sbjct  249   VPTKRNKRMKQIAKEVRSLVLGIINKRIREMKAGEAAKDDLLGILLESNFKEIQMHRNKN  308

Query  975   FGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             FGMT  EVIEECKLFY AGQETTS LLVWT++LLS H +WQ R
Sbjct  309   FGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHVDWQER  351



>ref|XP_006348302.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   439 bits (1130),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 210/350 (60%), Positives = 268/350 (77%), Gaps = 0/350 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ++I+  +  F+IAI   VCLW++LNW WF P+KL+ +LR+QGL G  YK ++GDL     
Sbjct  4     IQILVTVCCFAIAIALFVCLWKVLNWVWFNPKKLENLLRKQGLNGNSYKILYGDLNDFIG  63

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
              + +A SKP+NLSDDI+PR +PFF++ I+K G+  F+WLGPKP V I DP+L+K V +K 
Sbjct  64    MIREATSKPMNLSDDIAPRLVPFFLETIKKYGKKCFIWLGPKPQVIIMDPKLIKEVLSKT  123

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
              ++QKP  NP + LL QG+  +EEDKW KHRKIINP F +EKLKHM+PAF+L C+EML +
Sbjct  124   YLYQKPGGNPFAALLVQGLATYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLCCTEMLGK  183

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
              E  +      E+DVWP+LQQL  DVISRTAFGSSYEEG KIFELQ+EQ    +     +
Sbjct  184   LEDAIPVGSSHEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQKEQAQNFIDAVREV  243

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI  953
             Y+PG RFLPTKRNRRMK+I+ +V  S+  IIDKR+KAM+ G A  +DLLGILLESNF+EI
Sbjct  244   YVPGRRFLPTKRNRRMKEIKNEVRTSVKGIIDKRMKAMKAGNADNEDLLGILLESNFKEI  303

Query  954   EQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EQ+GNK+FGM+  EVIEECKLFY AGQETTS LLVWT+VLLS +Q+WQT+
Sbjct  304   EQHGNKDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLVLLSRNQDWQTQ  353



>emb|CDP15975.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   439 bits (1130),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 209/351 (60%), Positives = 270/351 (77%), Gaps = 1/351 (0%)
 Frame = +3

Query  54    MEIVF-GLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEI +  +   S   V LV  WR+LNWAW RP+KL+K L++QGLKG  Y+ ++GD K+IS
Sbjct  1     MEIGYIRIAAISSCAVILVLAWRVLNWAWLRPKKLEKQLKEQGLKGNPYRLLYGDFKEIS  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               + +A+SKPINLSDDI PR LP F DA++K G++++VWLGP P+V+I +PEL++ V  K
Sbjct  61    TLIREAQSKPINLSDDILPRILPAFPDALKKYGKSTYVWLGPTPMVYILEPELIREVMQK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
               +FQKP  NPLS LL +G++ ++ DKW K RK+INP F +EKLKHM+P+FY S S++L+
Sbjct  121   IYLFQKPRLNPLSLLLIEGLVNYDGDKWAKQRKLINPAFHVEKLKHMLPSFYTSASDILN  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +W++ V   G +ELDVWP L+ L SD ISRTAFGS+YEEG +IFELQREQ  Y L++  S
Sbjct  181   KWKEVVAPNGSSELDVWPDLETLTSDAISRTAFGSNYEEGRRIFELQREQSEYWLKVVQS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             + IPGWRF+PTKRNRRMKQI K V  +I++II+ R+KA+R G+A  DDLLGILLESNF+E
Sbjct  241   VDIPGWRFVPTKRNRRMKQIAKAVQDTILEIINSRIKAVREGKAYGDDLLGILLESNFKE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             I  +G    GMT REVIEECKLFY AGQETTS LLVWTM+LLS + +WQ R
Sbjct  301   INNHGQDGAGMTIREVIEECKLFYFAGQETTSVLLVWTMILLSRYPDWQAR  351



>ref|XP_002262693.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   438 bits (1127),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 202/340 (59%), Positives = 260/340 (76%), Gaps = 1/340 (0%)
 Frame = +3

Query  87    IAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPIN  266
             + I  L+  WR+LNW W RP+KL++ LRQQGL G  Y  ++GD K++S+ + +A S+PI+
Sbjct  11    VFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYSCLYGDFKEMSRMINEANSRPIS  70

Query  267   LSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPL  446
              SDDI  R LPF   +IQK G+NSF WLGPKP+V I +PEL+++VF KH  FQK P +PL
Sbjct  71    FSDDIVQRVLPFHDHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVFLKHNAFQKVPPHPL  130

Query  447   SKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLA  626
              KLLA GV+  E ++W K RKIINP F +EKLKHM+ AF LSCS+M+++WEK +   G  
Sbjct  131   GKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEKKLSLDGSC  190

Query  627   ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTK  806
             ELDVWPYL+ LA DVISRTAFGSSYEEG +IF+LQREQ    +Q++ SIY+PGWRF PTK
Sbjct  191   ELDVWPYLENLAGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSIYVPGWRFFPTK  250

Query  807   RNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGM  983
              NRRM+QI  +V+A +  II+KR KAM+ GE +  DLLG+L+ESN+ ++++N   KN GM
Sbjct  251   TNRRMRQISNEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNYRDMQENDERKNVGM  310

Query  984   TTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             + ++VIEECKLFYLAGQETTS LL+WTMVLLS H  WQTR
Sbjct  311   SIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQTR  350



>emb|CBI22139.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   434 bits (1117),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 200/344 (58%), Positives = 258/344 (75%), Gaps = 2/344 (1%)
 Frame = +3

Query  75    IGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKS  254
             I F    V + CLWR+LNW W RP++L++ LR+QGL G  Y+ + GD K++S  +++A S
Sbjct  8     ISFGFLTVLISCLWRLLNWVWLRPKRLERCLREQGLAGNSYRLLHGDFKEMSMMLKEAYS  67

Query  255   KPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP  434
             +PI+LSDDI+PR LPF    I+K G+N F W GP P+V I +PEL++++  K  +FQKPP
Sbjct  68    RPISLSDDIAPRVLPFHCHFIKKYGKNFFAWFGPNPMVNIMEPELIRDILLKSNVFQKPP  127

Query  435   SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD  614
              +PL KLL  G++  E ++W K RK INP F +EKLK+M+PAF+LSCS+M+++W K +  
Sbjct  128   PHPLGKLLVSGLVTLEGERWAKRRKNINPAFHLEKLKNMLPAFHLSCSDMVTKW-KMLSV  186

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRF  794
              G  ELDVWPYL+ L  DVISRTAFGSSYEEG +IF+LQ+EQ    +Q++ S+YIPGWRF
Sbjct  187   GGSCELDVWPYLENLTGDVISRTAFGSSYEEGRRIFQLQKEQTHLAIQVTMSVYIPGWRF  246

Query  795   LPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI-EQNGNK  971
             LPTK NRRMKQI K+V+A +  I++KR KAM+ GE +  DLLGIL+ESNF EI E   NK
Sbjct  247   LPTKTNRRMKQISKEVYALLRGIVNKREKAMKAGETANSDLLGILMESNFREIQEHQNNK  306

Query  972   NFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
               GM+ R+VIEECKLFYLAGQETTS LLVWTMVLLS H  WQ R
Sbjct  307   KIGMSVRDVIEECKLFYLAGQETTSVLLVWTMVLLSEHPNWQAR  350



>sp|H2DH21.1|C7A29_PANGI RecName: Full=Cytochrome P450 CYP72A219; AltName: Full=Cytochrome 
P450 CYP72A129 [Panax ginseng]
 gb|AEY75218.1| cytochrome P450 CYP72A129 [Panax ginseng]
Length=518

 Score =   438 bits (1127),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 213/352 (61%), Positives = 268/352 (76%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCL-WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME+V  LI    AIV ++ L WR+ NW W RPRKL+K LR QG  G  Y+  FGD+K++ 
Sbjct  1     MELVLKLISSFCAIVVVILLGWRIFNWVWLRPRKLEKYLRNQGFNGNSYRLFFGDVKEMI  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               +++AKSKPINL DDI PR +P     I   G+NSF+WLGPKP+V I +P+ +K+V +K
Sbjct  61    VMLKEAKSKPINLYDDIIPRIIPLNQKIITNYGKNSFLWLGPKPMVHIMNPDHIKDVLSK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                FQKP  NPL+KLLA GV   E D+W KHRK+INP F +EKLK+M+PA YLS SE+++
Sbjct  121   FYQFQKPRHNPLTKLLATGVADAEGDRWAKHRKLINPAFHLEKLKNMLPAIYLSSSEIVT  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +WE+ V  +G  ELDV PYL+ L SDVISRTAFGSSYEEG KIF+LQREQ   ++Q S +
Sbjct  181   KWEEMVSTKGQFELDVLPYLETLTSDVISRTAFGSSYEEGRKIFQLQREQAELIIQASQT  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGE-ASPDDLLGILLESNFE  947
             IY+PG RFLPTKRN+RMK+I K+V  ++  II+KR+KAM  GE +S DDLLGILLESN +
Sbjct  241   IYLPGMRFLPTKRNKRMKEIAKEVKIALKSIINKRLKAMEAGERSSHDDLLGILLESNSK  300

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EI+Q+GN NFG+T  EVIEECKLF+ AGQETTS+LLVWTM+LLS HQ+WQ R
Sbjct  301   EIKQHGNTNFGLTVDEVIEECKLFFFAGQETTSNLLVWTMILLSQHQDWQKR  352



>ref|XP_006348982.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Solanum tuberosum]
Length=860

 Score =   448 bits (1152),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 206/341 (60%), Positives = 267/341 (78%), Gaps = 1/341 (0%)
 Frame = +3

Query  84    SIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPI  263
              +AI+ ++  W++LNWAWFRP+KL+K LR+ GLKG  YK ++GDLK+++  + +AKSKPI
Sbjct  33    CVAILLVIYTWKVLNWAWFRPKKLEKYLRKSGLKGNPYKLLYGDLKELTNKLNEAKSKPI  92

Query  264   NLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQK-PPSN  440
             N SDD+  R +PFF D+I KNG+NSF WLGPKP+VFI +P L+K +F KH ++ K   SN
Sbjct  93    NFSDDVPQRIIPFFCDSINKNGKNSFAWLGPKPIVFITEPSLIKIIFEKHYVYNKNKHSN  152

Query  441   PLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQG  620
             P +KLL +G++  EE KW K+RKIINP F  EKLKHM+PAFY SCSEMLS+WE+ V  + 
Sbjct  153   PFAKLLVRGLVTLEEQKWAKYRKIINPAFHFEKLKHMVPAFYQSCSEMLSKWEEAVPKET  212

Query  621   LAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLP  800
               ELDVWP+ Q +  +VISRTAFGSSYEEG  +FELQ+EQ  YV++   SIYIPG RFLP
Sbjct  213   SVELDVWPHFQLMTGEVISRTAFGSSYEEGRIVFELQKEQAEYVMEQVFSIYIPGSRFLP  272

Query  801   TKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFG  980
             +K+ +RM +IEK++  +I  IIDKR+ AM+ GE + +DLLGILLESN +EIEQ+G+K+FG
Sbjct  273   SKKKKRMLEIEKEIQTTIRCIIDKRLMAMQAGETNNEDLLGILLESNTKEIEQHGSKDFG  332

Query  981   MTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +TT EVIEECKLFY AGQ+TTS LLVWT +LL +H EWQ R
Sbjct  333   LTTIEVIEECKLFYFAGQDTTSVLLVWTTILLCLHPEWQVR  373


 Score =   340 bits (871),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 161/260 (62%), Positives = 203/260 (78%), Gaps = 1/260 (0%)
 Frame = +3

Query  327   GENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQK-PPSNPLSKLLAQGVIFHEEDKWVKH  503
             G+NSF WLGPKP+VFI +P L+K +F KH ++ K   SNP +KLL +G++  EE KW K+
Sbjct  436   GKNSFAWLGPKPIVFITEPSLIKIIFEKHYVYNKNKHSNPFAKLLVRGLVTLEEQKWAKY  495

Query  504   RKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQQLASDVISRT  683
             RKIINP F  EKLKHM+ AFY SCSEMLS+WE+ V  +   ELDVWP+ Q +  +VISR 
Sbjct  496   RKIINPAFHFEKLKHMVLAFYQSCSEMLSKWEEAVPKETSVELDVWPHFQLMIGEVISRI  555

Query  684   AFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDI  863
             AFGSSYEEG K+FELQ+EQ  YV++   SIYIPG RFLP+K+ +RM +IEK++  +I  I
Sbjct  556   AFGSSYEEGRKVFELQKEQAEYVMEQVFSIYIPGSRFLPSKKKKRMLEIEKEIQTTIRRI  615

Query  864   IDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFGMTTREVIEECKLFYLAGQETT  1043
             IDKR+ AM+ GE + +DLLGILLESN +EIEQ+G+K+FG+TT EVIEECKLFY AGQ+TT
Sbjct  616   IDKRLMAMQAGETNNEDLLGILLESNTKEIEQHGSKDFGLTTIEVIEECKLFYFAGQDTT  675

Query  1044  SSLLVWTMVLLSMHQEWQTR  1103
             S LLVWT +LL +H EWQ R
Sbjct  676   SVLLVWTTILLCLHPEWQVR  695



>ref|XP_004244273.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=519

 Score =   436 bits (1122),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 213/351 (61%), Positives = 268/351 (76%), Gaps = 1/351 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ++I+  +   +IAI   VCLW++LNW W  P+KL+ +LR+QGL G  YK ++GDL     
Sbjct  4     IQILVRVCCSAIAIALFVCLWKVLNWVWLNPKKLENLLRKQGLNGNSYKILYGDLNDFIG  63

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
              + +A SKP+NLSDDI+PR +PFF++  +K G+  F+WLGPKP V I DPEL+K V +K 
Sbjct  64    MIREASSKPMNLSDDIAPRLVPFFLETTKKYGKKCFIWLGPKPQVIIMDPELIKEVLSKT  123

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
              ++QKP  NP + LL QG+  +EEDKW KHRKIINP F +EKLKHM+PAF+LSC+EMLS+
Sbjct  124   YLYQKPGGNPFAALLVQGLATYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLSCTEMLSK  183

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WE  V      E+DVWP+LQQL  DVISRTAFGSSYEEG KIFELQ EQ    +     +
Sbjct  184   WEDAVPLGSSREIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQTEQAQNFIDAVREV  243

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEA-SPDDLLGILLESNFEE  950
             YIPG RFLPTKRNRRMK+I+ +V  S+  IIDKR+KAM+ G A + +DLLGILLESNF+E
Sbjct  244   YIPGRRFLPTKRNRRMKEIKNEVRTSVKGIIDKRMKAMKAGNADNNEDLLGILLESNFKE  303

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IEQ+GNK+FGM+  EVIEECKLFY AGQETTS LLVWT+VLLS +Q+WQT+
Sbjct  304   IEQHGNKDFGMSIEEVIEECKLFYFAGQETTSVLLVWTLVLLSRYQDWQTQ  354



>ref|XP_002270501.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   436 bits (1122),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 198/340 (58%), Positives = 258/340 (76%), Gaps = 1/340 (0%)
 Frame = +3

Query  87    IAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPIN  266
             + I  L+  WR+LNW W RP+KL++ LRQQGL G  Y+ + GD +++S+ + +A S+PI+
Sbjct  11    VFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRMINEANSRPIS  70

Query  267   LSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPL  446
              SDDI  R LPF   +IQK G+N+F+WLGPKP+V I  PEL+++V  KH  FQKPP +PL
Sbjct  71    FSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELIRDVLLKHNAFQKPPRHPL  130

Query  447   SKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLA  626
              KLLA GV   E ++W K RKIINP F +EKLKHM+ AF LSCS+M+++WEK +   G  
Sbjct  131   GKLLASGVASLEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEKQLSLDGSC  190

Query  627   ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTK  806
             ELD+WPYLQ L  DVISRTAFGSSYEEG +IF+LQ+EQ    +Q++ S+Y+PGWRF PTK
Sbjct  191   ELDIWPYLQNLTGDVISRTAFGSSYEEGRRIFQLQKEQALLTVQVTRSVYVPGWRFFPTK  250

Query  807   RNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGM  983
              NRRM+QI  +V A +  II+KR KAM+ GE + DDLLG+L+ESN+ E+++N   KN GM
Sbjct  251   TNRRMRQISSEVDALLKGIIEKREKAMQAGETANDDLLGLLMESNYREMQENDERKNVGM  310

Query  984   TTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             + ++VIEECKLFYLAGQETTS+LL+WTMVLLS H  WQ R
Sbjct  311   SIKDVIEECKLFYLAGQETTSALLLWTMVLLSKHSNWQAR  350



>ref|XP_006360179.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=514

 Score =   434 bits (1117),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 208/352 (59%), Positives = 271/352 (77%), Gaps = 5/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME +  ++      + +  LW++LNW WF P+KL+ +LR+QGLKG  Y+ ++GD+K +++
Sbjct  1     METIQMIVTICCCAIAITLLWKVLNWVWFNPKKLENLLRKQGLKGNSYRLLYGDMKDVTR  60

Query  234   SVEDAKSKPINLSD-DISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
              +++A SKP+N+SD D++PR +PFF++ I K G+  F W+GPKP V I DPEL+K V +K
Sbjct  61    MIKEANSKPMNMSDHDLAPRMMPFFLETINKYGKKCFTWMGPKPQVLIMDPELIKEVLSK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
               ++QKP  NPL  L  QG++ +E+DKW K+RKIINP F +EKLKHM+PAFYLSCSEMLS
Sbjct  121   TYLYQKPGGNPLGSLFVQGLVSYEKDKWAKNRKIINPAFHLEKLKHMLPAFYLSCSEMLS  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +WE   G     E+DVWP+LQQL SDVISRTAFGSSYEEG KIFELQ EQV + ++   S
Sbjct  181   KWEDVEGSH---EIDVWPHLQQLTSDVISRTAFGSSYEEGRKIFELQNEQVPHFIEAMRS  237

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRFLPTKRNRRMK+I+K V + I  IIDKR+KAM  G+A  +DLLGILLESNF+E
Sbjct  238   VYIPGWRFLPTKRNRRMKEIKKDVRSLIRGIIDKRLKAMEAGDADNEDLLGILLESNFKE  297

Query  951   IE-QNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IE Q GNK+FGM+  E+IEECKLFY AG ETTS  L+WT+VLLS +Q+WQ +
Sbjct  298   IEQQGGNKDFGMSIDEIIEECKLFYFAGSETTSVWLLWTLVLLSRYQDWQAQ  349



>ref|XP_010644780.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Vitis vinifera]
Length=518

 Score =   433 bits (1114),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 202/348 (58%), Positives = 266/348 (76%), Gaps = 2/348 (1%)
 Frame = +3

Query  66    FGLIGFSIA-IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVE  242
               L+  S A I  L+  WR+LNW W RP++L++ L+QQGL G  Y+ ++GD K++S  ++
Sbjct  6     LNLVALSFAFITILIYAWRVLNWMWLRPKRLERCLKQQGLAGNSYRLLYGDFKEMSMMIK  65

Query  243   DAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
             +A S+PI++SDDI  R  PF   +I+K G++SF+W+GPKP V I +PEL+++V + HT+F
Sbjct  66    EATSRPISISDDIVQRVAPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVF  125

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
             +KP  + L KLL  G++F + +KW KHRKIINP F++EKLK+M+PAF+LSCS+M+S+WE 
Sbjct  126   RKPRVHALVKLLVSGLLFLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMISKWEG  185

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
              +  +G  ELDVWPYLQ L  D ISRTAFGS+YEEG  IFELQREQ   ++Q S S +IP
Sbjct  186   KLSTEGSCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFIP  245

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQN  962
             GWRFLPTK N+RMKQI K+V+A +  IIDKR KAM+ GE   DDLLGILLESNF+EI+++
Sbjct  246   GWRFLPTKSNKRMKQIRKEVNALLWGIIDKRGKAMKAGETLNDDLLGILLESNFKEIQEH  305

Query  963   GN-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              N KN GM+ ++VIEECKLFY AGQETTS LL+WTMVLLS H  WQ R
Sbjct  306   ENDKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHPNWQAR  353



>ref|XP_002265455.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   432 bits (1111),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 196/338 (58%), Positives = 262/338 (78%), Gaps = 1/338 (0%)
 Frame = +3

Query  93    IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLS  272
             I  L+  WR+LN  W +P+K+++ LRQQGL G  Y+ + GD +++S+ +++A S+PI+LS
Sbjct  13    ITLLIYAWRLLNSVWLKPKKIERYLRQQGLIGNSYRLLHGDFREMSRMIDEANSRPISLS  72

Query  273   DDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSK  452
             DDI  R LPF   +I+K G+N F+W+GPKP+V I +PEL+++V  KH  FQKPP +PL K
Sbjct  73    DDIVQRVLPFHYHSIKKYGKNCFIWMGPKPVVNIMEPELIRDVLLKHNAFQKPPVHPLGK  132

Query  453   LLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAEL  632
             LLA GVI  E ++W K RKIINP F +EKLKHM+PAF LSCSEM+++WEK +   G  EL
Sbjct  133   LLATGVIALEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCSEMVNKWEKKLSKDGSCEL  192

Query  633   DVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRN  812
             D+WP L+ LA DVISRTAFGSSYEEG +IF+LQ+EQ    +Q+S SIYIPGWRF+PTK N
Sbjct  193   DIWPDLENLAGDVISRTAFGSSYEEGRRIFQLQKEQAHLAVQVSQSIYIPGWRFVPTKTN  252

Query  813   RRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTT  989
             +RM+QI  +V+A +  II++R KAM+ GE + DDLLG+L+ESN++E++++G  KN GM+ 
Sbjct  253   KRMRQISNEVNALLKGIIERREKAMKVGETANDDLLGLLMESNYKEMQEHGERKNVGMSN  312

Query  990   REVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ++VIEECKLFY AGQETTS LL+WTMVLLS H  WQ R
Sbjct  313   KDVIEECKLFYFAGQETTSVLLLWTMVLLSKHSNWQAR  350



>ref|XP_006348906.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=518

 Score =   432 bits (1111),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 207/353 (59%), Positives = 268/353 (76%), Gaps = 3/353 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAI-VFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME +  +I  +I++ + LV  W++LNWAWFRP+KL+K LRQQGL G  Y+ + GDLK+ S
Sbjct  1     METLSNIIIATISVAILLVYTWKVLNWAWFRPKKLEKFLRQQGLCGNSYRLLHGDLKEFS  60

Query  231   KSVEDAKSKPI-NLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
             KS+++A+SKPI NLS+DI+PR +P+FI  I K G+  FVW GPKP++ I + E ++ +F 
Sbjct  61    KSIKEAQSKPIDNLSNDIAPRIIPYFIQTISKYGKKCFVWFGPKPMILIMESEQIREIFA  120

Query  408   KHTIFQKPP-SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEM  584
             K+ ++QKP  SNP++ LLA+G+  +EEDKW KHRKI+ P F MEKLK M+PAFYLSC EM
Sbjct  121   KNYVYQKPHHSNPVANLLARGIANYEEDKWAKHRKILKPAFHMEKLKLMLPAFYLSCIEM  180

Query  585   LSEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQIS  764
             L EWEK V D+   ELD+WP  Q+L SD+ISRTAFGSSYEEG +IFELQ+EQ   +++  
Sbjct  181   LKEWEKIVPDERSKELDIWPQFQKLTSDMISRTAFGSSYEEGRRIFELQKEQAEIIMKQF  240

Query  765   SSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF  944
             +SIYIPG RFLPTK N++MK+ EK+V  SI  +ID R+KA   G+   DDLLG LLESN 
Sbjct  241   NSIYIPGSRFLPTKSNKKMKETEKEVQESIRRLIDNRLKAKEAGQEFGDDLLGTLLESNS  300

Query  945   EEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              EIE+ G+K FG+T  EVI ECKLFY AGQETTS  LVWTM+LLS HQ+WQ +
Sbjct  301   NEIEEQGSKEFGLTIDEVIRECKLFYFAGQETTSVWLVWTMILLSRHQDWQAK  353



>ref|XP_006364092.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=521

 Score =   432 bits (1110),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 207/348 (59%), Positives = 266/348 (76%), Gaps = 4/348 (1%)
 Frame = +3

Query  66    FGLIGFSIAIVFLV-CLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVE  242
               L+ FS AI+ ++   WR+LNW WF+P+KL+K LRQQG KG  YKF+FGD+K++ K  +
Sbjct  10    LNLVLFSCAIILVLRWAWRILNWVWFKPKKLEKCLRQQGFKGNSYKFLFGDVKEMMKMGK  69

Query  243   DAKSKPINLSDD-ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTI  419
             +A SKPI+ S D I PR +PFF   I   G+N F W GP+P V I DPEL++ V TK+ I
Sbjct  70    EALSKPIDFSHDMIWPRVMPFFHKTINNYGKNCFAWYGPRPAVVIVDPELIREVLTKNYI  129

Query  420   FQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWE  599
             +QKPP NPL++L A G+  +E DKW KHR+I+NP F ++KLKHM+PAF L+ SE+L +W+
Sbjct  130   YQKPPGNPLTRLAANGLAGYEADKWAKHRRIVNPAFHLDKLKHMLPAFQLTSSELLKKWK  189

Query  600   KNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYI  779
             + +  +G +E+DVWPYLQ L SD ISRTAFGSSYEEG KIFELQ+EQ+G +LQ++ S+YI
Sbjct  190   EIISKEG-SEIDVWPYLQTLTSDAISRTAFGSSYEEGKKIFELQKEQMGLLLQVARSLYI  248

Query  780   PGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQ  959
             PGWRF+PTK NRRMKQI  +V A I+ II KR+K +  GE   DDLL ILL SN +EI+Q
Sbjct  249   PGWRFVPTKTNRRMKQIFNEVGALILGIIKKRIKMIEDGEIH-DDLLSILLTSNLQEIQQ  307

Query  960   NGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +G+K FGM+  EVIEECKLFYLAGQETTS+LLVWTM+LLS +  WQ R
Sbjct  308   HGHKKFGMSIDEVIEECKLFYLAGQETTSALLVWTMILLSKYPIWQER  355



>emb|CDP19600.1| unnamed protein product [Coffea canephora]
Length=516

 Score =   431 bits (1109),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 265/350 (76%), Gaps = 0/350 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             M++ + +IG   ++   +  W +LNW WF+P+KL+K LRQQGL G+ Y+ +FGD+K+ ++
Sbjct  1     MDMFYSIIGVLCSVFLTIWAWIILNWVWFKPKKLEKYLRQQGLGGSHYRLLFGDMKETAQ  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
              V+ A SKPIN ++DI PR LPF    I+ +G N+  W+GP P + + DPELVK V TK+
Sbjct  61    MVKQAYSKPINFTNDIVPRILPFVDKLIRSSGTNTLTWMGPSPALLLIDPELVKEVLTKN  120

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
              ++QKP +NPL KLLA+G   ++ DKW K+R+II+P F +EKLKHM+PAF LSCSEMLS+
Sbjct  121   YVYQKPRNNPLGKLLAEGFATYDTDKWAKNRRIISPAFHLEKLKHMVPAFCLSCSEMLSK  180

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WE      G  ELDVWP ++ LA D+ISRTAFGS+YEEG KIFELQ +Q     Q   SI
Sbjct  181   WENGALADGSLELDVWPDIRTLAGDMISRTAFGSNYEEGRKIFELQMQQSELFEQAIQSI  240

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI  953
             Y+PGWRFLPTKRN++MK+I K V + I+ II+KRV+AM+ GEA+  DLLG+LLESNF+EI
Sbjct  241   YVPGWRFLPTKRNKKMKKIFKDVRSLILGIINKRVRAMQEGEATHSDLLGLLLESNFKEI  300

Query  954   EQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +++GN+ FGMT+ EVI+ECKLFY AG ETT+ LLVWT++LLS H +WQ R
Sbjct  301   QEHGNERFGMTSEEVIQECKLFYFAGHETTAILLVWTLILLSKHSDWQAR  350



>emb|CBI39916.3| unnamed protein product [Vitis vinifera]
Length=505

 Score =   431 bits (1108),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 196/338 (58%), Positives = 262/338 (78%), Gaps = 1/338 (0%)
 Frame = +3

Query  93    IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLS  272
             I  L+  WR+LN  W +P+K+++ LRQQGL G  Y+ + GD +++S+ +++A S+PI+LS
Sbjct  13    ITLLIYAWRLLNSVWLKPKKIERYLRQQGLIGNSYRLLHGDFREMSRMIDEANSRPISLS  72

Query  273   DDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSK  452
             DDI  R LPF   +I+K G+N F+W+GPKP+V I +PEL+++V  KH  FQKPP +PL K
Sbjct  73    DDIVQRVLPFHYHSIKKYGKNCFIWMGPKPVVNIMEPELIRDVLLKHNAFQKPPVHPLGK  132

Query  453   LLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAEL  632
             LLA GVI  E ++W K RKIINP F +EKLKHM+PAF LSCSEM+++WEK +   G  EL
Sbjct  133   LLATGVIALEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCSEMVNKWEKKLSKDGSCEL  192

Query  633   DVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRN  812
             D+WP L+ LA DVISRTAFGSSYEEG +IF+LQ+EQ    +Q+S SIYIPGWRF+PTK N
Sbjct  193   DIWPDLENLAGDVISRTAFGSSYEEGRRIFQLQKEQAHLAVQVSQSIYIPGWRFVPTKTN  252

Query  813   RRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTT  989
             +RM+QI  +V+A +  II++R KAM+ GE + DDLLG+L+ESN++E++++G  KN GM+ 
Sbjct  253   KRMRQISNEVNALLKGIIERREKAMKVGETANDDLLGLLMESNYKEMQEHGERKNVGMSN  312

Query  990   REVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ++VIEECKLFY AGQETTS LL+WTMVLLS H  WQ R
Sbjct  313   KDVIEECKLFYFAGQETTSVLLLWTMVLLSKHSNWQAR  350



>ref|XP_004248200.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=523

 Score =   431 bits (1107),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 206/343 (60%), Positives = 266/343 (78%), Gaps = 4/343 (1%)
 Frame = +3

Query  81    FSIAIVF-LVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSK  257
             FS AI+  L+  WR+LNW WF+P+ L+K LRQQG KG  YKF+FGD+K++ K  ++A SK
Sbjct  17    FSCAIILVLIWAWRILNWVWFKPKMLEKCLRQQGFKGNSYKFLFGDVKEMMKMGKEALSK  76

Query  258   PINLSDDIS-PRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP  434
             PI+ S D++ PR +PFF   I   G+N F W GP+P V I DPEL++ V +K+ I+QKPP
Sbjct  77    PIDFSHDMTWPRVMPFFHKTINNYGKNCFGWYGPRPAVVIVDPELIREVLSKNYIYQKPP  136

Query  435   SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD  614
              NPL++L A G+  +E DKW KHR+IINPGF ++KLKHM+PAF L+ SEML++W++ +  
Sbjct  137   GNPLTRLAANGLAGYEADKWAKHRRIINPGFHLDKLKHMLPAFQLTSSEMLNKWKEIISK  196

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRF  794
             +G +E+DVWPYLQ L SD ISRTAFGSSYEEG KIFELQ+EQ+  +LQ++ S+YIPGWRF
Sbjct  197   EG-SEIDVWPYLQTLTSDAISRTAFGSSYEEGKKIFELQKEQMELLLQVARSLYIPGWRF  255

Query  795   LPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKN  974
             +PTK NRRMKQI  +V A I+ II+KR+K +  GE   DDLL ILL SN +EI+Q+G+K 
Sbjct  256   VPTKTNRRMKQIFNEVGALILGIINKRIKMIEDGEIH-DDLLSILLASNLQEIQQHGHKK  314

Query  975   FGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             FGM+  EVIEECKLFYLAGQETTS+LLVWTM+LLS +  WQ R
Sbjct  315   FGMSIDEVIEECKLFYLAGQETTSALLVWTMILLSKYPIWQQR  357



>ref|XP_009628921.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=518

 Score =   429 bits (1104),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 207/344 (60%), Positives = 258/344 (75%), Gaps = 5/344 (1%)
 Frame = +3

Query  81    FSIAIVFLV-CLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSK  257
             FS AI+F++   W++LN+ W +P++L+K +RQQG KG  YKF+FGD+K+I K  E+A SK
Sbjct  13    FSFAIIFVLRWAWKILNYVWLKPKELEKCIRQQGFKGNSYKFLFGDMKEIKKMGEEAMSK  72

Query  258   PINLSDD-ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP  434
             PIN S D I PR +PF    I   G+N FVW GP+P V I DPELVK V TK+ ++QKPP
Sbjct  73    PINFSHDMIWPRVMPFIHKTITNYGKNCFVWFGPRPAVLITDPELVKEVLTKNFVYQKPP  132

Query  435   SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD  614
               PL+KL A G+  +E DKW  HR+++NP F ++KLKHM+PAF  +  EMLS+ EK V  
Sbjct  133   GTPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTACEMLSKLEKVVSP  192

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRF  794
              G  E+DVWPYLQ L SD ISRTAFGSSYEEG KIFELQ+EQ+  +L++S +IYIPGWRF
Sbjct  193   NG-TEIDVWPYLQTLTSDAISRTAFGSSYEEGRKIFELQKEQLSLILEVSRTIYIPGWRF  251

Query  795   LPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NK  971
             LPTKRN+RMKQI  +V A ++ II KR+  +  GEA PDDLLGILL SN +EI+Q+G NK
Sbjct  252   LPTKRNKRMKQIFNEVRALVLGIIKKRLSMIENGEA-PDDLLGILLASNLKEIQQHGNNK  310

Query  972   NFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              FGM+  EVIEECKLFY AGQETTSSLLVWTM+LL  H  WQ +
Sbjct  311   KFGMSIDEVIEECKLFYFAGQETTSSLLVWTMILLCKHPSWQDK  354



>gb|AJD25167.1| cytochrome P450 CYP72A326 [Salvia miltiorrhiza]
Length=518

 Score =   429 bits (1104),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 194/352 (55%), Positives = 266/352 (76%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCL-WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             M+ V+ ++    AI  +V   WR+LNWA+ RP++L+KILR+QGL G  Y  + GD+K++ 
Sbjct  1     MQRVYSIVAACFAIAVVVTYAWRLLNWAYLRPKRLEKILRKQGLNGNSYIPVSGDMKEMV  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
             K++++A SKPINL DDI PR  PF ++ I+K+G   F+W GP P+V I + EL+K V  K
Sbjct  61    KAMQEANSKPINLDDDIKPRLQPFLLNTIRKHGNECFMWKGPTPVVVITETELIKQVLNK  120

Query  411   HTIFQKPPS-NPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             H++F+KP   NPL ++ +QG+  HE+DKW KHRKIINP F ++KLK M+PAF+LSC E+L
Sbjct  121   HSVFEKPRVLNPLVRMFSQGIFSHEKDKWSKHRKIINPAFHLDKLKLMVPAFHLSCDEVL  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
              EWEK V  +G  E DV PYL+ + SD ISRTAFGSSY++G ++FELQ EQ   +++   
Sbjct  181   KEWEKRVSREGWCEFDVCPYLESITSDAISRTAFGSSYKQGRRVFELQLEQSALIMKAMQ  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             S+YIPG RFLPTKRNRR+KQI ++V ++I  +IDKR+ AM+ GEA  +DLLG++L+SN +
Sbjct  241   SVYIPGSRFLPTKRNRRIKQIYEEVRSNIRGLIDKRIDAMKAGEAIDEDLLGLMLQSNLQ  300

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EIE+NGN+ FGMT  +VIEECKLFY AGQET SSLLVW+++LLS H +WQ +
Sbjct  301   EIEENGNRKFGMTIDQVIEECKLFYFAGQETISSLLVWSLILLSRHPDWQAK  352



>ref|XP_010644729.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=514

 Score =   429 bits (1103),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 197/338 (58%), Positives = 255/338 (75%), Gaps = 1/338 (0%)
 Frame = +3

Query  93    IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLS  272
             I  L+  WR+LNW W RP+KL++ LR+QGL G  Y+ + GD +++S+   +A S PI+ S
Sbjct  13    ITLLIFAWRLLNWVWLRPKKLERCLRKQGLTGNSYRLLHGDFREMSRMNNEANSGPISFS  72

Query  273   DDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSK  452
             DDI  R LPFF  +IQK G+NSF WLGPKP+V I +PEL+++V  KH +FQKPP +PL K
Sbjct  73    DDIVKRVLPFFNHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVLLKHNVFQKPPPHPLGK  132

Query  453   LLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAEL  632
             LLA GV+  E ++W K RKIINP F +EKLKHM+ AF LSCS+M+++WEK +      EL
Sbjct  133   LLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEKKLSMDDSCEL  192

Query  633   DVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRN  812
             D+WPYLQ L  DVISRTAFGSSYEEG +IF+LQ+EQ   V Q++ S+Y+PGWRF PTK N
Sbjct  193   DIWPYLQILTGDVISRTAFGSSYEEGRRIFQLQKEQAHLVAQVTQSVYVPGWRFFPTKIN  252

Query  813   RRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTT  989
             RRM+QI  +V+A +  II+KR KAM+ GE +  DLLG+L+ESN+ E+++N   KN GM+ 
Sbjct  253   RRMRQIRNEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNYREMQENDERKNVGMSI  312

Query  990   REVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ++VIEECKLFY AGQETTS LL+WTMVLLS H  WQ R
Sbjct  313   KDVIEECKLFYFAGQETTSVLLLWTMVLLSKHSNWQAR  350



>ref|NP_001291324.1| cytochrome P450 CYP72A219-like [Sesamum indicum]
 gb|AAZ07706.1| cytochrome P450 monooxygenase [Sesamum indicum]
Length=514

 Score =   428 bits (1101),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 202/350 (58%), Positives = 265/350 (76%), Gaps = 1/350 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME +   +      V LV  W++LNW WFRPRKL+KILRQQG KG  YK  FGD  ++  
Sbjct  1     METLLSSLALISCAVALVYAWKILNWVWFRPRKLEKILRQQGFKGNSYKLFFGDFNELKA  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
               ++AKSKP++ S +I PR  P  I  ++  GE SF+W GP+P V + DPE+V+ + +K 
Sbjct  61    MTKEAKSKPMSFSHEIVPRVAPSIIKTVKNYGEQSFLWFGPRPAVIVLDPEMVREILSKS  120

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
              +FQ P  NP S++LA+G+  +E DKW KHR++INP F +EKLKHM+PAFYLSC++MLS+
Sbjct  121   YVFQMPGGNPTSRMLARGIASYETDKWAKHRRLINPAFHVEKLKHMVPAFYLSCADMLSK  180

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WEK V  +GL ELDVWPYLQ L SD ISRTAFGSSYEEG +IFELQ+EQ   +++   ++
Sbjct  181   WEKIVPREGLCELDVWPYLQTLTSDAISRTAFGSSYEEGRRIFELQKEQAELIMEALRTV  240

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI  953
              IPG RFLPTK N+RM +I ++V +S++ II+KR+KA++ GE + DDLLG+LLESN +EI
Sbjct  241   CIPGSRFLPTKNNKRMNKIVREVESSVLGIINKRMKAIKAGETAGDDLLGLLLESNLKEI  300

Query  954   EQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EQ+GNK FGM+ +EVIEECKLFY AGQETTS+LLVWTM+LLS H++WQ R
Sbjct  301   EQHGNK-FGMSLKEVIEECKLFYFAGQETTSTLLVWTMILLSKHKDWQER  349



>ref|XP_002265784.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=526

 Score =   429 bits (1102),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 195/339 (58%), Positives = 254/339 (75%), Gaps = 1/339 (0%)
 Frame = +3

Query  87    IAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPIN  266
             + I  L+  WR+LNW W RP+KL++ LRQQGL G  Y+ + GD +++S+ + +A S+PI+
Sbjct  22    VFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMSRMINEANSRPIS  81

Query  267   LSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPL  446
              SDDI  R LPF   +IQK G+N+F+WLGPKP+V I  PEL+ +V  KH  FQK P +PL
Sbjct  82    FSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELISDVLLKHNAFQKAPRHPL  141

Query  447   SKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLA  626
              KLLA G+   E ++W K RKIINP F +EKLKHM+ AF LSCS+M+++WEK +   G  
Sbjct  142   RKLLASGIASLEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEKQLSLDGSC  201

Query  627   ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTK  806
             ELD+WPYLQ L  DVISRTAFGSSYEEG +IF+LQ+EQ    +Q++ S+Y+PGWRF PTK
Sbjct  202   ELDIWPYLQNLTGDVISRTAFGSSYEEGRRIFQLQKEQALLAVQVTRSVYVPGWRFFPTK  261

Query  807   RNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGM  983
              NRRM+QI  +V A +  II+KR KAM+ GE + DDLLG+L+ESN+ E+++N   KN GM
Sbjct  262   TNRRMRQISSEVDALLKGIIEKREKAMQAGETANDDLLGLLMESNYREMQENDERKNVGM  321

Query  984   TTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQT  1100
             + ++VIEECKLFYLAGQETTS LL+WTMVLLS H  WQ 
Sbjct  322   SIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQA  360



>ref|XP_004243254.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=518

 Score =   428 bits (1101),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 205/353 (58%), Positives = 266/353 (75%), Gaps = 3/353 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAI-VFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME +  +I  +I + + LV  W++LNWAWFRP+KL+K  RQQGL G  Y+ + GDLK+ S
Sbjct  1     METLNNIIIATIFVTILLVHTWKVLNWAWFRPKKLEKFFRQQGLCGNSYRLLHGDLKEFS  60

Query  231   KSVEDAKSKPIN-LSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
             KS+++A+SKPIN LS+DI+PR +P+FI  I K G+N FVW GPKP++ I + E ++ +F 
Sbjct  61    KSIKEAQSKPINNLSNDIAPRIIPYFIQTISKYGKNCFVWFGPKPMILIMESEQIREIFA  120

Query  408   KHTIFQKPP-SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEM  584
             K+ ++QKP  SNP++ LLA+G+  +EEDKW KHRKI+ P F MEKLK M+PAFYLSC EM
Sbjct  121   KNYVYQKPHHSNPVANLLARGIANYEEDKWAKHRKILKPAFHMEKLKLMLPAFYLSCIEM  180

Query  585   LSEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQIS  764
             L EWE+ +  +G  ELD+WP  Q+L SD+ISRTAFGSSYEEG +IFELQ+EQ   +++  
Sbjct  181   LKEWEQIIPYEGSKELDIWPQFQKLTSDMISRTAFGSSYEEGRRIFELQKEQAEIIMKQF  240

Query  765   SSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF  944
             +SIYIPG RFLPTK N++MK+ EK+V  SI  +ID R+KA   G+   DDLLG LLESN 
Sbjct  241   NSIYIPGSRFLPTKSNKKMKETEKEVQESIRRLIDNRLKAKEAGQEFGDDLLGTLLESNS  300

Query  945   EEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              EIE+ G+K FG+T  EVI ECKLFY AGQETTS  LVWTM+LLS HQ WQ +
Sbjct  301   NEIEEQGSKEFGLTIDEVIRECKLFYFAGQETTSVWLVWTMILLSRHQNWQAK  353



>gb|ABC69389.1| CYP72A52v1 [Nicotiana tabacum]
Length=518

 Score =   428 bits (1101),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 206/344 (60%), Positives = 258/344 (75%), Gaps = 5/344 (1%)
 Frame = +3

Query  81    FSIAIVFLV-CLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSK  257
             FS AI+F++   W++LN+ W +P++L+K +RQQG KG  YKF+FGD+K+I K  E+A SK
Sbjct  13    FSFAIIFVLRWAWKILNYVWLKPKELEKCIRQQGFKGNSYKFLFGDMKEIKKMGEEAMSK  72

Query  258   PINLSDD-ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP  434
             PIN S D I PR +PF    I   G+N FVW GP+P V I DPELVK V TK+ ++QKPP
Sbjct  73    PINFSHDMIWPRVMPFIHKTITNYGKNCFVWFGPRPAVLITDPELVKEVLTKNFVYQKPP  132

Query  435   SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD  614
               PL+KL A G+  +E DKW  HR+++NP F ++KLKHM+PAF  +  EMLS+ EK V  
Sbjct  133   GTPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTACEMLSKLEKVVSP  192

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRF  794
              G  E+DVWPYLQ L SD ISRTAFGSSYEEG K+FELQ+EQ+  +L++S +IYIPGWRF
Sbjct  193   NG-TEIDVWPYLQTLTSDAISRTAFGSSYEEGRKLFELQKEQLSLILEVSRTIYIPGWRF  251

Query  795   LPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NK  971
             LPTKRN+RMKQI  +V A ++ II KR+  +  GEA PDDLLGILL SN +EI+Q+G NK
Sbjct  252   LPTKRNKRMKQIFNEVRALVLGIIKKRLSMIENGEA-PDDLLGILLASNLKEIQQHGNNK  310

Query  972   NFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              FGM+  EVIEECKLFY AGQETTSSLLVWTM+LL  H  WQ +
Sbjct  311   KFGMSIDEVIEECKLFYFAGQETTSSLLVWTMILLCKHPSWQDK  354



>ref|XP_010644781.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Vitis vinifera]
Length=518

 Score =   428 bits (1101),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 202/348 (58%), Positives = 265/348 (76%), Gaps = 2/348 (1%)
 Frame = +3

Query  66    FGLIGFSIA-IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVE  242
               L+  S A I  L+  WR+LNW W RP++L++ L+QQGL G  Y+ + GDLK++   ++
Sbjct  6     LNLVALSFAFITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDLKEMFMMIK  65

Query  243   DAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
             +A S+PI++SDDI  R  PF   +I+K G++SF+W+GPKP V I +PEL+++V + HT+F
Sbjct  66    EASSRPISISDDIVQRIAPFQYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVF  125

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
             +KP  + L KLL  G++F + +KW KHRKIINP F++EKLK+M+PAF+LSCS+M+S+WE 
Sbjct  126   RKPRVHALVKLLVSGLLFLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMISKWEG  185

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
              +  +G  ELDVWPYLQ L  D ISRTAFGS+YEEG  IFELQREQ   ++Q S S +IP
Sbjct  186   KLSTEGSCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSESAFIP  245

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQN  962
             GWRFLPTK N+RMKQI K+V+A +  IIDKR KAM+ GE   DDLLGILLESNF+EI+++
Sbjct  246   GWRFLPTKSNKRMKQIRKEVNALLWGIIDKRGKAMKAGETLNDDLLGILLESNFKEIQEH  305

Query  963   GN-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              N KN GM+ ++VIEECKLFY AGQETTS LL+WTMVLLS H  WQ R
Sbjct  306   ENDKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHPNWQAR  353



>gb|EYU31635.1| hypothetical protein MIMGU_mgv1a025572mg [Erythranthe guttata]
Length=515

 Score =   427 bits (1097),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 202/350 (58%), Positives = 260/350 (74%), Gaps = 2/350 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME++   +     +V L+  W+++N  WFRPRK++KILRQQG  G  Y+F+ GDL ++  
Sbjct  1     MELLQSFLALCCTVVVLIYGWKIMNLVWFRPRKMEKILRQQGFGGKSYRFLIGDLNEMKN  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
               E+A SKPI+ SDD  PR + F    +  +GENSFVWLGP   V I DPE V+ V +K 
Sbjct  61    MGEEALSKPIDFSDDFVPRTISFIHKTVTNHGENSFVWLGPYAAVIISDPENVREVLSKS  120

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
              +FQKP  NPL KL+AQG+  +E DKW KHR++INP F ++K+KHM+P+F+ SC+EMLS+
Sbjct  121   YVFQKP-YNPLGKLVAQGLASYETDKWAKHRRLINPAFHLDKVKHMLPSFHKSCAEMLSK  179

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WEK V  +G  ELDVWPYLQ + SD IS TAFGSSYE+G KIFELQ+EQ   +++   S 
Sbjct  180   WEKIVPSEGCFELDVWPYLQTMTSDAISLTAFGSSYEQGIKIFELQKEQAALLIKAILSA  239

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI  953
             +IPGWRFLPTK NRRMK I  +V + ++ IIDKR KA+  GEA+ +DLL ILLESN +EI
Sbjct  240   FIPGWRFLPTKTNRRMKHIITEVESLLLAIIDKRTKAIEAGEATSNDLLDILLESNSKEI  299

Query  954   EQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +QNG+K FGM+ ++VIEECKLFYLAGQETTSSLLVWTM+LLS H +WQ R
Sbjct  300   KQNGHK-FGMSLQDVIEECKLFYLAGQETTSSLLVWTMILLSKHLDWQAR  348



>gb|AFO64616.1| cytochrome P450 mono-oxygenase [Artemisia annua]
Length=515

 Score =   426 bits (1094),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 195/351 (56%), Positives = 265/351 (75%), Gaps = 2/351 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME         +A +F+  ++R+ NW WF+P+K++K LR+QGL GT YKF+FGDLK++ +
Sbjct  1     MESPTSFFALGVASIFIYLIYRIANWLWFKPKKIEKFLRKQGLNGTSYKFMFGDLKELVQ  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
                +AKSKP++L+ DI+ R LPF+ +A+  +G+  F WLG KP+V + +P +++ V   +
Sbjct  61    MSNEAKSKPMSLNHDIANRVLPFYYNALSTHGKTCFTWLGIKPVVHLSEPTMIREVLNNY  120

Query  414   TIFQKP-PSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
               +QKP   NPL+KLLA+GV   E D+WVKHRKIINP F +EKLKHM+PAFY+SCSEML 
Sbjct  121   NQYQKPRAGNPLTKLLARGVADAEADQWVKHRKIINPAFHVEKLKHMVPAFYVSCSEMLD  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +W + V  +   E+DVW YL   ++DVISRTAFGSSYEEG KIFELQREQ   +++ S S
Sbjct  181   KWGETVTKESSGEVDVWTYLSTFSADVISRTAFGSSYEEGRKIFELQREQAVLIIKASQS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPG RFLPTK N+RMK+I++++ ASI +IIDKRV AM+  E S DDLLGILL+SN +E
Sbjct  241   VYIPGLRFLPTKSNKRMKEIDREIKASIKNIIDKRVVAMKAKETSNDDLLGILLDSNDKE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             I+Q+G+K +G++  +VIEECKLFY AGQETT ++LVWTM+LL  H +WQ R
Sbjct  301   IKQHGSK-YGLSIEDVIEECKLFYFAGQETTGTMLVWTMILLGHHTDWQRR  350



>ref|XP_004248734.1| PREDICTED: cytochrome P450 CYP72A219 [Solanum lycopersicum]
Length=516

 Score =   426 bits (1094),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 209/348 (60%), Positives = 265/348 (76%), Gaps = 4/348 (1%)
 Frame = +3

Query  66    FGLIGFSIAIVFLV-CLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVE  242
             F L  FS AI+F++   WR+LN+ W +P+ L+K LR+QG KG  YKF+FGD+K++SK  E
Sbjct  7     FKLAIFSFAIIFVLRWAWRILNYVWLKPKYLEKQLRKQGFKGHTYKFLFGDMKEMSKMGE  66

Query  243   DAKSKPINLSDD-ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTI  419
             +A SKP+N S D I PR  PF    I   G+N FVW GP+P V I DPE++K V  K+ +
Sbjct  67    EAWSKPVNFSHDTIWPRVNPFIHKIITNYGKNCFVWFGPRPAVVIMDPEVIKEVMMKNYV  126

Query  420   FQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWE  599
             FQKP  NPL+KLLA G+  +E DKW  HR+++NP F ++KLKHM+PAF L+ +EMLS+WE
Sbjct  127   FQKPGGNPLTKLLATGIADYEADKWAVHRRLLNPAFHLDKLKHMLPAFKLTGNEMLSKWE  186

Query  600   KNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYI  779
             K V  +G +E+DV PYLQ L SD ISRTAFGSSYEEG KIFELQ+EQ+  +L++S +IYI
Sbjct  187   KIVSREG-SEIDVLPYLQTLTSDAISRTAFGSSYEEGIKIFELQKEQIQLILEVSRTIYI  245

Query  780   PGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQ  959
             PGWRFLPTKRN+RMKQI  +V   I++II+KR++ +  GE S DDLLGILL SN +EI+Q
Sbjct  246   PGWRFLPTKRNKRMKQIFNEVRTLILEIINKRMRMIEAGE-SHDDLLGILLSSNLKEIQQ  304

Query  960   NGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +GNK FGM+  EVIEECKLFY AGQETTS+LLVWTM+LLS H  WQ R
Sbjct  305   HGNKKFGMSIDEVIEECKLFYFAGQETTSTLLVWTMILLSQHPNWQDR  352



>ref|XP_006349622.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=516

 Score =   425 bits (1093),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 209/348 (60%), Positives = 261/348 (75%), Gaps = 4/348 (1%)
 Frame = +3

Query  66    FGLIGFSIAIVFLV-CLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVE  242
             F L  FS AI+F++   WR+LN+ W +P+ L+K LRQ+G KG  YKF+FGD+K++SK  E
Sbjct  7     FKLAIFSFAIIFVLRWAWRILNYVWLKPKYLEKQLRQEGFKGNSYKFLFGDMKEMSKMGE  66

Query  243   DAKSKPINLSDD-ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTI  419
             +A SKP+N S D I PR  PF    I   G+NSFVW GPKP V I DPE++K V  K+ +
Sbjct  67    EALSKPVNFSHDMIWPRVNPFIHKIITNYGKNSFVWFGPKPAVVIMDPEVIKEVMMKNYV  126

Query  420   FQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWE  599
             FQKP  NPL+KLLA G+  +E DKW  HR+++NP F ++KLKHM+PAF L+ SEML +WE
Sbjct  127   FQKPGGNPLTKLLATGIADYEADKWAVHRRLLNPAFHLDKLKHMLPAFKLTASEMLGKWE  186

Query  600   KNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYI  779
             K V   G +E+DV  YLQ L SD ISRTAFGSSYEEG KIFELQ+EQ+  +LQ+S ++YI
Sbjct  187   KIVSRDG-SEIDVLSYLQTLTSDAISRTAFGSSYEEGIKIFELQKEQIQLILQVSRTVYI  245

Query  780   PGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQ  959
             PGWRFLPTKRN+RMKQI  +V   I +II+KR++ +  GE S DDLLGILL SN +EI+Q
Sbjct  246   PGWRFLPTKRNKRMKQIFNEVRTLIFEIINKRMRMIEAGE-SHDDLLGILLSSNLKEIQQ  304

Query  960   NGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +GNK F M+  EVIEECKLFY AGQETTS+LLVWTM+LLS H  WQ R
Sbjct  305   HGNKKFSMSIDEVIEECKLFYFAGQETTSTLLVWTMILLSQHPNWQDR  352



>emb|CDP15973.1| unnamed protein product [Coffea canephora]
Length=522

 Score =   425 bits (1093),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 208/343 (61%), Positives = 266/343 (78%), Gaps = 0/343 (0%)
 Frame = +3

Query  75    IGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKS  254
             IG S A+   V  WR+LN  W RP+KL+K LR  GL G  Y+ + GD K I+  +++A S
Sbjct  13    IGVSCAVALAVFAWRVLNCMWLRPKKLEKRLRNLGLNGNSYRLVCGDFKDIAVMLKEANS  72

Query  255   KPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP  434
             KPINLSDDI PR +PFFI+ I+K G+NSFVWLG  P V I DP L++ +  K+ IF+KP 
Sbjct  73    KPINLSDDIVPRVIPFFIEIIKKYGKNSFVWLGLNPSVVILDPVLMREILLKNYIFKKPR  132

Query  435   SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD  614
              +P+ KLLAQGVIF E DKW KHRKII+  F ++KLKHM+PAFY S SEMLS+WE+ V  
Sbjct  133   PHPIVKLLAQGVIFSEGDKWAKHRKIISSAFHLQKLKHMLPAFYSSASEMLSKWEERVSP  192

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRF  794
             +G  ELDVWPYLQ L +D ISRTAFGS+YEEG +IFELQ EQ  Y ++ + S+Y PG RF
Sbjct  193   EGSCELDVWPYLQTLGADSISRTAFGSNYEEGRRIFELQMEQAQYAVRATRSVYFPGLRF  252

Query  795   LPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKN  974
             LPT+RN+RMK IEK++ A I DII+KRVKA++ GE S DDLLGI+LESNF+EI+ +G+K+
Sbjct  253   LPTRRNKRMKDIEKEIQAKIRDIINKRVKALKAGETSNDDLLGIMLESNFKEIDLHGDKS  312

Query  975   FGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             FGMT ++VI+ECKLFY AGQE++S+LLVWT+VLL  H+EWQ++
Sbjct  313   FGMTMQDVIDECKLFYFAGQESSSTLLVWTLVLLGRHREWQSK  355



>emb|CDP19609.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   424 bits (1091),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 198/353 (56%), Positives = 267/353 (76%), Gaps = 11/353 (3%)
 Frame = +3

Query  78    GFSIAIVFLVCL---------WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             G S+  V+  CL         W+ LNW WFRP+KL+K L++Q  +G  YK + GD K++S
Sbjct  6     GVSMFTVYSSCLLLLLVVAVSWKALNWVWFRPKKLEKRLKEQRFRGNPYKLLHGDFKEMS  65

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
                 +A+SK +NLSDDI PR +P ++ A++K G+N+++W GP+P + I DP L+K V  K
Sbjct  66    TLYTEAQSKNLNLSDDIVPRVIPQYLGAVKKYGKNTYLWFGPRPALVIMDPNLIKAVTQK  125

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
               +FQKP  NPL +LLAQG++ +E +KW K RK++NP F +EKLK M+PAFY S SEM++
Sbjct  126   VDVFQKPRVNPLGRLLAQGLVSYEGEKWAKQRKLLNPAFHVEKLKLMLPAFYKSASEMVT  185

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +WE  V  +GLAE+DVWP LQ L SD ISRTAFGS+YEEG +IFELQREQ  +++Q++ S
Sbjct  186   KWENVVSPKGLAEVDVWPNLQALTSDAISRTAFGSNYEEGRRIFELQREQTEHLMQLARS  245

Query  771   IY--IPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF  944
             +Y  IPG+RFLPTKRNRRMKQI ++V+ S+ ++I+ R KAMR GEA  DDLLG++L+SN 
Sbjct  246   VYINIPGFRFLPTKRNRRMKQIAREVNGSVREMINTRRKAMRAGEAGSDDLLGLMLQSNS  305

Query  945   EEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +EIE++GNK+ GMTT E+++ECKLFY AGQETTS+LLVWTMVLL  + EWQ R
Sbjct  306   QEIEKHGNKDSGMTTEEIVDECKLFYFAGQETTSALLVWTMVLLCRYPEWQAR  358



>gb|AJD25168.1| cytochrome P450 CYP72A327 [Salvia miltiorrhiza]
Length=518

 Score =   424 bits (1089),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 195/352 (55%), Positives = 264/352 (75%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFG-LIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEIVF  +I  +  +     + ++LNWA+ RP++L+K LR+QGL G  Y+ + GDL+   
Sbjct  1     MEIVFSQIIVAAAVVAAFALVVKLLNWAYLRPKRLEKALRKQGLNGNSYRLLIGDLRDFM  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
             K+ E+AK+KPINL DDI  R +PFF++ + K G++SF W GP P + + DP+L K +  K
Sbjct  61    KATEEAKTKPINLDDDIKTRVVPFFVNTLSKFGKDSFFWFGPHPTLIVTDPDLAKEILGK  120

Query  411   HTIFQKP-PSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
               +F K   SNPLS+LL QGV+ HE++KW KHRKIINP F ++KLK MIPAF LSC +++
Sbjct  121   SDLFSKARSSNPLSRLLVQGVLSHEKEKWAKHRKIINPAFHLDKLKLMIPAFCLSCDQVV  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             SEWEK++  +G  E+DVWPYLQ++ SD ISRTAFGSSY++G +IFELQ EQ GY +    
Sbjct  181   SEWEKSLSPEGCCEVDVWPYLQKVTSDAISRTAFGSSYQQGRRIFELQSEQAGYAIHALR  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             S+YIPGWR++PTKRN+RMK+I K+V + I  +ID+RV+AM   E   +DLL +LLESN +
Sbjct  241   SVYIPGWRYVPTKRNKRMKEIAKEVRSIIQQLIDRRVEAMGREEGKHEDLLSMLLESNSQ  300

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EIE++G+K+FGM+  +V+EECKLFY AGQETT+SLLVW +VLLS H  WQTR
Sbjct  301   EIEEHGSKSFGMSMDDVVEECKLFYFAGQETTASLLVWALVLLSKHPHWQTR  352



>ref|XP_009790250.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=517

 Score =   424 bits (1089),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 202/338 (60%), Positives = 254/338 (75%), Gaps = 3/338 (1%)
 Frame = +3

Query  87    IAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPIN  266
             + I  L   W++LNW WF+P++L+K LRQQG KG  Y+F+FGD+ ++ K  ++A SKPI+
Sbjct  16    VVIFILKWAWKILNWVWFKPKELEKCLRQQGFKGNSYRFLFGDVNEMMKMGKEALSKPID  75

Query  267   LSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPL  446
              S +I PR +PFF   I   G+N   W GP+P + I DPEL++ V TK+ IFQKPP  PL
Sbjct  76    FSHNIWPRVMPFFHKTITTYGKNCLAWYGPRPAIVIVDPELIREVLTKNYIFQKPPGTPL  135

Query  447   SKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLA  626
             +KL A G+  +E DKW KHR++INP F ++KLKHM+PAF L+ SEMLS+WEK V   G +
Sbjct  136   TKLAANGLAGYEADKWAKHRRLINPAFHLDKLKHMLPAFLLTASEMLSKWEKVVSTGG-S  194

Query  627   ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTK  806
             E+DVWPYLQ L SD ISRTAFGSSYEEG KIFELQ+EQ+  +LQI+ S+YIPGWRF+PTK
Sbjct  195   EIDVWPYLQTLTSDAISRTAFGSSYEEGRKIFELQKEQMELLLQIARSLYIPGWRFIPTK  254

Query  807   RNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGM  983
              NRRMKQI  +V   I+ II KR+  +  GEA PDDLLG LL SN +EI+Q+G NK FGM
Sbjct  255   TNRRMKQIFNEVRVLILGIIKKRMSMIENGEA-PDDLLGTLLASNLKEIQQHGNNKKFGM  313

Query  984   TTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQ  1097
             +  EVIEECKLFYLAGQETTS+LLVWTM+LL  +  WQ
Sbjct  314   SIDEVIEECKLFYLAGQETTSALLVWTMILLCKYPIWQ  351



>gb|AJD25169.1| cytochrome P450 CYP72A328 [Salvia miltiorrhiza]
Length=517

 Score =   424 bits (1089),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 198/350 (57%), Positives = 263/350 (75%), Gaps = 2/350 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             M+ +  L   S AIV    + ++LNW WFRPR L+K LR+QG  G  Y+ ++GDLK +  
Sbjct  1     MDFIICLQTLS-AIVAFTYVCKILNWVWFRPRNLEKRLRRQGFTGNSYRVLYGDLKDMRL  59

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
               ++A SKP++ S D   R +P F  A++K GEN FVW GP P + + +PE V+ V +K 
Sbjct  60    MSKEASSKPLDFSHDFVHRIMPIFHFALKKYGENCFVWFGPSPAILVMNPESVREVVSKS  119

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
              +FQKPP  P  +L+++G++  E DKW KHR++INP F + KL+HM+P+FYLSC EMLS+
Sbjct  120   NVFQKPPGRPFIRLMSKGLVTLETDKWAKHRRLINPAFHVHKLEHMVPSFYLSCDEMLSK  179

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             W+K VG++G  E+DVWPYLQ L SDVISRTAFGSSY EG KIFELQRE   +V++ + S+
Sbjct  180   WDKIVGNEGCCEVDVWPYLQTLTSDVISRTAFGSSYLEGRKIFELQRELAQHVMEGNRSV  239

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI  953
             YIPG+RFLPTK NRR+K+I K+V +S++ II+ R KAM  GEAS +DLLGILLESN +EI
Sbjct  240   YIPGYRFLPTKVNRRVKEITKEVRSSMLGIINTRSKAMEAGEASKEDLLGILLESNSKEI  299

Query  954   EQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EQ+G+K+ GM+  EVIEECKLFY AG ETT+SLLVWTM+LLS H++WQ+R
Sbjct  300   EQHGSKH-GMSMDEVIEECKLFYFAGXETTASLLVWTMILLSKHEDWQSR  348



>ref|XP_002271303.2| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=515

 Score =   422 bits (1086),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 191/338 (57%), Positives = 255/338 (75%), Gaps = 1/338 (0%)
 Frame = +3

Query  93    IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLS  272
             I  L+  WR+LNW W RP+KL++ LRQQGL G  Y+ + GD +++ + + +A S+ I+LS
Sbjct  13    ITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREMLRMISEANSRSISLS  72

Query  273   DDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSK  452
             DDI  R LPF   +I+K G+N F+W+GPKP+V I DPEL+++VF K+  F+KPP +PL K
Sbjct  73    DDIVQRVLPFHCHSIKKYGKNYFIWMGPKPVVNIMDPELIRDVFLKYNAFRKPPPHPLGK  132

Query  453   LLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAEL  632
             LLA G++  E ++W K RKIINP F +EKLKHM+PAF LSCS+M+++WEK +   G  EL
Sbjct  133   LLATGLVTLEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCSDMVNKWEKKLSKDGSCEL  192

Query  633   DVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRN  812
             D+WP L+ LA D ISRTAFGSSYEEG +IF+LQ+EQ    +++  S+YIPGWRF+PTK N
Sbjct  193   DIWPDLENLAGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRSVYIPGWRFVPTKTN  252

Query  813   RRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI-EQNGNKNFGMTT  989
             +RM+QI  +VHA +  II++R KAM+ GE + DDLL +L+ESNF E+ E +  KN GM+ 
Sbjct  253   KRMRQISNEVHALLKGIIERREKAMKVGETANDDLLSLLMESNFREMQEHDERKNVGMSI  312

Query  990   REVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ++VIEECKLFY AGQETTS LL+WTMVLLS H  WQ R
Sbjct  313   KDVIEECKLFYFAGQETTSDLLLWTMVLLSKHSNWQAR  350



>gb|AJD25171.1| cytochrome P450 CYP72A330 [Salvia miltiorrhiza]
Length=517

 Score =   422 bits (1085),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 203/335 (61%), Positives = 263/335 (79%), Gaps = 2/335 (1%)
 Frame = +3

Query  105   VCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDIS  284
             +  W++LNWA+  P++L + LR+QG KG  YK ++GDLK++++   +A+SKPINL DDI 
Sbjct  18    IYTWKLLNWAYITPKRLGEALRKQGFKGNAYKLVYGDLKELTQLSMEARSKPINLDDDIK  77

Query  285   PRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPS-NPLSKLLA  461
              R  PF ++AI K+G  SFVWLGP+P + + DPELVK V +K  ++ +P + NP++KLL 
Sbjct  78    NRVAPFIVNAIHKHGNESFVWLGPRPSIILTDPELVKEVLSKSYLYLRPENRNPMTKLLL  137

Query  462   QGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVW  641
             QG+  +E+D+W KHRKIINP F +EKLK MIPAFY+SC E+L  WEKNV  +G  E+DVW
Sbjct  138   QGLASYEKDEWAKHRKIINPAFHLEKLKLMIPAFYMSCDEVLKTWEKNVSSEGSYEVDVW  197

Query  642   PYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRM  821
             PYLQ L SD ISRTAFGSSY+EG +IFELQREQV +++Q   SIY+PGWRF+PTKRNRRM
Sbjct  198   PYLQNLTSDAISRTAFGSSYQEGRRIFELQREQVEHIIQALRSIYVPGWRFVPTKRNRRM  257

Query  822   KQIEKQVHASIMDIIDKRVKAMRGGEASPD-DLLGILLESNFEEIEQNGNKNFGMTTREV  998
             KQIE++V ++I  +I KR++AM+ GEA  D DLL ILL SNF+EIE+ GNK+FGMT   V
Sbjct  258   KQIEREVQSTIRGLISKRIEAMKTGEARHDEDLLSILLASNFQEIEKGGNKSFGMTIDAV  317

Query  999   IEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +EECKLFY AGQETTS LLVWT+VLLS + +WQTR
Sbjct  318   VEECKLFYFAGQETTSVLLVWTLVLLSRYPDWQTR  352



>ref|XP_006477948.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   422 bits (1085),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 205/352 (58%), Positives = 260/352 (74%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIV-FLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME+    I  +I IV  L   WR+LNW W RP KL+K LRQQGLKG  Y+ +FGDLK+ S
Sbjct  1     MELPLKSIALTIVIVTVLTWAWRVLNWVWLRPEKLEKFLRQQGLKGNSYRLLFGDLKENS  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               +++AK++P++L DDI+ R  PF    +   G+NSF+W GP P V I +P+ +K +FTK
Sbjct  61    IELKEAKARPLSLDDDIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKAIFTK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                FQK  S PL++LL  G+   E +KW KHRK+INP F  EKLK M+PAFYLSC E+++
Sbjct  121   INDFQKVNSIPLARLLIVGLATLEGEKWAKHRKLINPAFHQEKLKLMLPAFYLSCIEIIT  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +WEK +  +G +ELDVWPYL  L SDVISRTAFGSSYEEG +IF+LQ E     +Q+  S
Sbjct  181   KWEKQMSVEGSSELDVWPYLANLTSDVISRTAFGSSYEEGRRIFQLQAELAELTMQVFRS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             ++IPGWRFLPTKRNRRMK+I+K++ AS+M II  R KAMR GEA+ DDLLGIL+E++F E
Sbjct  241   VHIPGWRFLPTKRNRRMKEIDKEIRASLMGIIKNREKAMRAGEAANDDLLGILMETSFRE  300

Query  951   IEQNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IE++G NKN G +  +VIEECKLFY AGQETTS LL WTMVLLS HQ+WQ R
Sbjct  301   IEEHGNNKNVGFSMNDVIEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQER  352



>emb|CDP15983.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   422 bits (1085),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 194/349 (56%), Positives = 268/349 (77%), Gaps = 2/349 (1%)
 Frame = +3

Query  63    VFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVE  242
              + +    + +V +   W+ LNW WFRPRKL+K L++QG +G  YK + GD+K++S   +
Sbjct  8     AYTVYSSCLLLVVVGVSWKALNWVWFRPRKLEKRLKEQGFRGNPYKLLHGDIKEMSTLHK  67

Query  243   DAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
             +A+SK +NLSDDI PR +P ++ A++K G+ +++WLGPKP + I DPE VK +  K  +F
Sbjct  68    EAQSKNLNLSDDIVPRVIPQYLGAVKKYGKKTYLWLGPKPAMVIMDPEQVKEITQKVYVF  127

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
             QKP  NPL ++L  G++ +E DKW +HRK++NP F +EKLK M+PAF+ S SE++++WEK
Sbjct  128   QKPHGNPLRRMLTPGIVMYEGDKWTQHRKLLNPAFHIEKLKLMLPAFHKSASEVVNKWEK  187

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS--IY  776
              V  +G AE+DVWP LQ L SD ISRTAFGS+YEEG +IFELQREQ  ++++   S  IY
Sbjct  188   VVSPKGSAEVDVWPNLQALTSDAISRTAFGSNYEEGRRIFELQREQAEHIVEAGGSVYIY  247

Query  777   IPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIE  956
             IPG+RFLPTKR+RRMKQI K+V+ SI ++ID R KAMR GEA  D+LLG++L+SN +EIE
Sbjct  248   IPGFRFLPTKRHRRMKQITKEVNDSIREMIDTRKKAMRAGEARTDNLLGLMLQSNSQEIE  307

Query  957   QNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ++GNK++GMTT E+I+ECKLFYLAGQETTS+LLVWTM+ LS + +WQ R
Sbjct  308   KHGNKDYGMTTEEIIDECKLFYLAGQETTSALLVWTMIYLSRYPDWQAR  356



>ref|XP_003634773.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
 emb|CBI22132.3| unnamed protein product [Vitis vinifera]
Length=518

 Score =   422 bits (1084),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 196/353 (56%), Positives = 266/353 (75%), Gaps = 2/353 (1%)
 Frame = +3

Query  48    EMMEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKI  227
             EM ++    + F+  I  L+  WR+LNW W RP++L++ L+QQGL G  Y+ + GD K++
Sbjct  2     EMKQLNLVALSFTF-ITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDFKEM  60

Query  228   SKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
                +++A S+PI++SDDI  R  PF   +I+K G++SF+W+GPKP V I +PEL+++V +
Sbjct  61    FMMIKEATSRPISISDDIVQRIAPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLS  120

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
              HT+F+KP  + L KLL  G++F + +KW KHRKIINP F++EK+K+M+PAF+LSCS+M+
Sbjct  121   MHTVFRKPRVHALVKLLVSGLLFLDGEKWAKHRKIINPAFRLEKVKNMLPAFHLSCSDMI  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             S+WE  +  +G  ELDVWPYLQ L  D ISRTAFGS+YEEG  IFELQREQ   ++Q S 
Sbjct  181   SKWEGKLSTEGSCELDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSE  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             S +IPGWRFLPTK N+RMKQ  K+V+  +  IIDKR KAM+ GE   DDLLGILLESNF+
Sbjct  241   SAFIPGWRFLPTKSNKRMKQNRKEVNELLWGIIDKREKAMKAGETLNDDLLGILLESNFK  300

Query  948   EIEQNGN-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EI+++GN KN GM+ ++VI+ECK+FY AGQETTS LL+WTM+LLS H  WQ R
Sbjct  301   EIQEHGNDKNVGMSIKDVIDECKIFYFAGQETTSVLLLWTMILLSKHPNWQAR  353



>ref|XP_004242635.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=517

 Score =   422 bits (1084),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 194/344 (56%), Positives = 262/344 (76%), Gaps = 2/344 (1%)
 Frame = +3

Query  75    IGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKS  254
             I F I I+FL  +W+ L+W W  P+KL+K L+ +GLKG+ YKF+ GD+K+I+  VE+AKS
Sbjct  10    ISFVIVIIFLRWIWKFLDWVWIHPKKLEKRLKLEGLKGSSYKFLLGDMKEINSMVEEAKS  69

Query  255   KPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP  434
             KPIN ++D   R  P F   + + G+N + WLGPKP + I +PE V+ + +K  I+QK  
Sbjct  70    KPINFTNDYISRVFPHFNKLMMQYGKNCYTWLGPKPTMLISEPEFVREILSKSYIYQKIQ  129

Query  435   SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD  614
              NP++KLLAQG+  +E DKW KHR+IINP F ++KLKHM+P+FYLSC +M+++ +  V  
Sbjct  130   GNPITKLLAQGLASYETDKWAKHRRIINPAFHLDKLKHMLPSFYLSCCDMINKLDNIVSS  189

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRF  794
             +G +E+DVWP+LQ L SD ISRTAFGS+YEEG +IFELQ+EQ   ++Q +  IYIPGWRF
Sbjct  190   KG-SEIDVWPFLQTLTSDAISRTAFGSNYEEGRQIFELQKEQADLIIQAARWIYIPGWRF  248

Query  795   LPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIE-QNGNK  971
             +PTKRN+R+KQI  +V + ++ II+ R+K M+ GEA+ DDLLGILLESNF+EI+  + NK
Sbjct  249   VPTKRNKRIKQIANEVRSLVLGIINNRIKEMKEGEATKDDLLGILLESNFKEIQIHHENK  308

Query  972   NFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             NFGMT  EVIEECKLFY AGQETTS LLVWT++LLS H +WQ +
Sbjct  309   NFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHLDWQEK  352



>ref|XP_006477946.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=522

 Score =   421 bits (1083),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 204/352 (58%), Positives = 261/352 (74%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIV-FLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME+    I  +I IV  L   WR+LNW W RP+KL+K LRQQGLKG  Y+ +FGDLK+ S
Sbjct  1     MELPLKSIALTIVIVTVLTWAWRVLNWVWLRPKKLEKFLRQQGLKGNSYRLLFGDLKENS  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               +++AK++P++L DDI+ R  PF    +   G+NSF+W GP P V I +P+ +K +FTK
Sbjct  61    IELKEAKARPLSLDDDIAIRVNPFLHKLVNDYGKNSFMWFGPTPRVNIMNPDQIKAIFTK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                FQK  S PL++LL  G+   E +KW KHRK+INP F  EKLK M+PAFYLSC E+++
Sbjct  121   INDFQKVNSIPLARLLIVGLATLEGEKWAKHRKLINPAFHQEKLKLMLPAFYLSCIEIIT  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +WEK +  +G +ELDVWPYL  L SDVISRTAFGSSYEEG +IF+LQ E     +Q+  S
Sbjct  181   KWEKQMSVEGSSELDVWPYLANLTSDVISRTAFGSSYEEGRRIFQLQAELAELTMQVFRS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             ++IPGWRFLPTKRNRRMK+I+K++ AS+M II  R KAMR GEA+ +DLLGIL+E++F E
Sbjct  241   VHIPGWRFLPTKRNRRMKEIDKEIRASLMGIIKNREKAMRAGEAANNDLLGILMETSFRE  300

Query  951   IEQNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IE++G NKN G +  +VIEECKLFY AGQETTS LL WTMVLLS HQ+WQ R
Sbjct  301   IEEHGNNKNVGFSMNDVIEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQER  352



>emb|CDP15986.1| unnamed protein product [Coffea canephora]
Length=479

 Score =   419 bits (1077),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 199/353 (56%), Positives = 263/353 (75%), Gaps = 11/353 (3%)
 Frame = +3

Query  78    GFSIAIVFLVCL---------WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             G S+  V+  CL         W+ LNW WFRP+KL+K L++QG +G  YK + GD K++S
Sbjct  6     GVSMFTVYSSCLLLLLVVAVSWKALNWVWFRPKKLEKRLKEQGFRGNPYKLLHGDFKEMS  65

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
                 +A SK +NLSDDI PR +P ++ A++K G+N+++W GP+P V I DP L+K V  K
Sbjct  66    TMHTEAGSKNLNLSDDIVPRVIPQYLGAVKKYGKNTYLWFGPRPAVVIMDPNLIKAVTQK  125

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
               +F K   NPL +LLAQG+  +E +KW K RK++NP F +EKLK M+PAFY S SEM++
Sbjct  126   VDVFHKLGVNPLGRLLAQGLRTYEGEKWAKQRKLLNPAFHVEKLKLMLPAFYKSASEMVT  185

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQI--S  764
             +WE  V  +GLAE+DVWP LQ L+SD ISR AFGS+YEEG + FELQREQ  +V+Q   S
Sbjct  186   KWENVVSPKGLAEVDVWPNLQALSSDAISRAAFGSNYEEGRRTFELQREQTEHVMQAARS  245

Query  765   SSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF  944
              SI IPG+RFLPTKRNRRMKQI ++V+ S+ ++I+ R KAMR GEA  DDLLG++L+SN 
Sbjct  246   VSINIPGFRFLPTKRNRRMKQIAREVNGSVREMINTRRKAMRAGEAGSDDLLGLMLQSNS  305

Query  945   EEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +EIE++GNK+FGMTT E+++ECKLFYLAGQETTS++LVWTMVLL  + EWQ R
Sbjct  306   QEIEKHGNKDFGMTTEEIVDECKLFYLAGQETTSAVLVWTMVLLCRYPEWQAR  358



>gb|AJD25170.1| cytochrome P450 CYP72A329 [Salvia miltiorrhiza]
Length=512

 Score =   420 bits (1079),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 191/350 (55%), Positives = 260/350 (74%), Gaps = 3/350 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             M++    +  S A V L+ LW++LNW WF P+KL+KILRQQG  G  YK  +GD K+I  
Sbjct  1     MDVFISTVEISCAAVALIYLWKLLNWVWFTPKKLEKILRQQGFNGNSYKLFYGDFKEIRS  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
               ++A SKP+N S+DI+PRA+P +    ++ GE SF W GPKP + I +PE+++ + +K+
Sbjct  61    IAKEAVSKPMNFSNDIAPRAIPIYHQTCKRYGEKSFTWFGPKPAINITEPEMIREITSKN  120

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
              +F KP  NP  K+LA+GV  +E DKW KHRK+INP F ++KLKHM+PAF++S ++ML +
Sbjct  121   YVFLKPTGNPFGKMLAKGVALYETDKWAKHRKLINPAFHVQKLKHMVPAFHVSTADMLKK  180

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             W++ V D G  E+DVWP LQ + SDVISRTAFGSSYEEG KIF+LQREQV  +++    +
Sbjct  181   WDELVPDGGSCEVDVWPGLQTMTSDVISRTAFGSSYEEGTKIFQLQREQVERIIEAGRHM  240

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI  953
              +PGW  LPTK NRR+K+I  +V + ++ II+KR+KAM  GE S DDLLGILLESN +E+
Sbjct  241   PVPGW--LPTKNNRRLKEIVAEVESRVLGIINKRMKAMEAGEPSMDDLLGILLESNAKEM  298

Query  954   EQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              ++GN + GMT  EV+EECK+FY AGQET++SLLVWTM+LLS HQ+WQ R
Sbjct  299   REHGNAS-GMTIEEVMEECKVFYFAGQETSASLLVWTMILLSKHQDWQDR  347



>ref|XP_006343585.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   420 bits (1079),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 190/344 (55%), Positives = 262/344 (76%), Gaps = 2/344 (1%)
 Frame = +3

Query  75    IGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKS  254
             I   I I+FL  +W+ L+W W  P+K++K L+ +G KG+ YKF+ GD+K+++  VE+AKS
Sbjct  10    ISLVIVIIFLRWIWKFLDWVWIHPKKMEKRLKLEGFKGSSYKFLLGDMKEMNSMVEEAKS  69

Query  255   KPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP  434
             KPIN ++D   R  P F   + + G+N ++WLGPKP + I +PE ++ + +K  I+QK  
Sbjct  70    KPINFTNDYISRVFPHFNKFMMQYGKNCYIWLGPKPTMLISEPEFIREILSKSYIYQKIQ  129

Query  435   SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD  614
              NP++KLLAQG+  +E +KW KHR+IINP F ++KLKHM+P+FYLSC +M+++W+  V  
Sbjct  130   GNPITKLLAQGLASYETEKWAKHRRIINPAFHLDKLKHMLPSFYLSCCDMINKWDNIVSS  189

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRF  794
             +G +E+DVWP+LQ L SD ISRTAFGS+YEEG +IFELQ+EQ   ++Q +  IYIPGWRF
Sbjct  190   KG-SEVDVWPFLQTLTSDAISRTAFGSNYEEGRQIFELQKEQADLIIQAARWIYIPGWRF  248

Query  795   LPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIE-QNGNK  971
             +PTKRN+R+KQI  +V + ++ II+ R+K M+ GEA+ DDLLGILLESNF+EI+  + NK
Sbjct  249   VPTKRNKRIKQIANEVRSLVLGIINNRIKEMKEGEATKDDLLGILLESNFKEIQIHHENK  308

Query  972   NFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             NFGMT  EVIEECKLFY AGQETTS LLVWT++LLS H +WQ R
Sbjct  309   NFGMTIDEVIEECKLFYFAGQETTSVLLVWTLILLSKHLDWQER  352



>emb|CBI22133.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   424 bits (1089),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 194/352 (55%), Positives = 261/352 (74%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIA-IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             +E+    +  S A I  L+  WR+LNW W RP+KL++ LRQQGL G  Y+ + GD +++ 
Sbjct  69    LEMKLSSVAISFAFITLLIYAWRLLNWVWLRPKKLERCLRQQGLTGNSYRLLHGDFREML  128

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
             + + +A S+ I+LSDDI  R LPF   +I+K G+N F+W+GPKP+V I DPEL+++VF K
Sbjct  129   RMISEANSRSISLSDDIVQRVLPFHCHSIKKYGKNYFIWMGPKPVVNIMDPELIRDVFLK  188

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
             +  F+KPP +PL KLLA G++  E ++W K RKIINP F +EKLKHM+PAF LSCS+M++
Sbjct  189   YNAFRKPPPHPLGKLLATGLVTLEGEQWTKRRKIINPAFHLEKLKHMVPAFQLSCSDMVN  248

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +WEK +   G  ELD+WP L+ LA D ISRTAFGSSYEEG +IF+LQ+EQ    +++  S
Sbjct  249   KWEKKLSKDGSCELDIWPDLENLAGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRS  308

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRF+PTK N+RM+QI  +VHA +  II++R KAM+ GE + DDLL +L+ESNF E
Sbjct  309   VYIPGWRFVPTKTNKRMRQISNEVHALLKGIIERREKAMKVGETANDDLLSLLMESNFRE  368

Query  951   I-EQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             + E +  KN GM+ ++VIEECKLFY AGQETTS LL+WTMVLLS H  WQ R
Sbjct  369   MQEHDERKNVGMSIKDVIEECKLFYFAGQETTSDLLLWTMVLLSKHSNWQAR  420



>ref|XP_009790251.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
 gb|ABC69391.1| CYP72A53v2 [Nicotiana tabacum]
Length=518

 Score =   420 bits (1079),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 204/343 (59%), Positives = 256/343 (75%), Gaps = 5/343 (1%)
 Frame = +3

Query  84    SIAIVFLV-CLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKP  260
             S AI+F++   W++LN+ W +P++L+K LRQQG KG  YKF+FGD+K++ K  E+A SKP
Sbjct  14    SFAIIFVLRWAWKILNYVWLKPKELEKYLRQQGFKGNSYKFLFGDMKEMKKMGEEAMSKP  73

Query  261   INLSDD-ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPS  437
             IN S D I PR +PF    I   G+N  VW GP+P V I DPELVK V TK+ ++QKP  
Sbjct  74    INFSHDMIWPRVMPFIHKTITNYGKNCIVWFGPRPAVLITDPELVKEVLTKNFVYQKPLG  133

Query  438   NPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQ  617
             NPL+KL A G+  +E DKW  HR+++NP F ++KLKHM+PAF  + SEMLS+ EK V   
Sbjct  134   NPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTASEMLSKLEKVVSPN  193

Query  618   GLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFL  797
             G  E+DVWPYLQ L SD ISRTAFGSSYEEG KIF+LQ+EQ+  +L++S +IYIPGWRFL
Sbjct  194   G-TEIDVWPYLQTLTSDAISRTAFGSSYEEGRKIFDLQKEQLSLILEVSRTIYIPGWRFL  252

Query  798   PTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKN  974
             PTKRN+RMKQI  +V A +  II KR+  +  GEA PDDLLGILL SN +EI+Q+G NK 
Sbjct  253   PTKRNKRMKQIFNEVRALVFGIIKKRMSMIENGEA-PDDLLGILLASNLKEIQQHGNNKK  311

Query  975   FGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             FGM+  EVIEECKLFY AGQETTSSLLVWTM+LL  +  WQ +
Sbjct  312   FGMSIDEVIEECKLFYFAGQETTSSLLVWTMILLCKYPNWQDK  354



>emb|CBI22129.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   417 bits (1071),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 198/348 (57%), Positives = 260/348 (75%), Gaps = 2/348 (1%)
 Frame = +3

Query  66    FGLIGFSIA-IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVE  242
               L+  S A I  L+  WR+LNW W RP++L++ L+QQGL G  Y+ + GD K++   ++
Sbjct  6     LNLVALSFAFITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDFKEMFMMIK  65

Query  243   DAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
             +A S+PI++SDDI  R  PF   +I+K G++SF+W+GPKP V I +PEL+++V + HT+F
Sbjct  66    EASSRPISISDDIVQRITPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVF  125

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
             +K   +   KLL  G+ F + +KW KHRKIINP F++EKLK+M+PAF+LSCS+M+S+WE 
Sbjct  126   RKSRVHAFVKLLVSGLPFLDGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMISKWEG  185

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
              +  +G  ELDVWPYLQ L SD ISRTAFGS+YEEG  IFELQREQ   ++Q S S YIP
Sbjct  186   KLSTEGSCELDVWPYLQNLTSDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSDSAYIP  245

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQN  962
             GW FLPTK N+RMKQI K+V+A +  IIDKR KAM+ GE   DDLLGILLESNF+EI+++
Sbjct  246   GWWFLPTKSNKRMKQIRKEVNALLWGIIDKRGKAMKAGETLNDDLLGILLESNFKEIQEH  305

Query  963   GN-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              N KN GM  ++VIEECK+FY AGQETTS+LL+WTMVLLS H   Q R
Sbjct  306   ENDKNVGMCIKDVIEECKIFYFAGQETTSALLLWTMVLLSKHPNLQAR  353



>gb|ABC69390.1| CYP72A53v1 [Nicotiana tabacum]
Length=518

 Score =   419 bits (1077),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 204/343 (59%), Positives = 255/343 (74%), Gaps = 5/343 (1%)
 Frame = +3

Query  84    SIAIVFLV-CLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKP  260
             S AI+F++   W++LN+ W +P++L+K LRQQG KG  YKF+FGD+K+  K  E+A SKP
Sbjct  14    SFAIIFVLRWAWKILNYVWLKPKELEKYLRQQGFKGNSYKFLFGDMKETKKMGEEAMSKP  73

Query  261   INLSDD-ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPS  437
             IN S D I PR +PF    I   G+N  VW GP+P V I DPELVK V TK+ ++QKP  
Sbjct  74    INFSHDMIWPRVMPFIHKTITNYGKNCIVWFGPRPAVLITDPELVKEVLTKNFVYQKPLG  133

Query  438   NPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQ  617
             NPL+KL A G+  +E DKW  HR+++NP F ++KLKHM+PAF  + SEMLS+ EK V   
Sbjct  134   NPLTKLAATGIAGYETDKWATHRRLLNPAFHLDKLKHMLPAFQFTASEMLSKLEKVVSPN  193

Query  618   GLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFL  797
             G  E+DVWPYLQ L SD ISRTAFGSSYEEG KIF+LQ+EQ+  +L++S +IYIPGWRFL
Sbjct  194   G-TEIDVWPYLQTLTSDAISRTAFGSSYEEGRKIFDLQKEQLSLILEVSRTIYIPGWRFL  252

Query  798   PTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKN  974
             PTKRN+RMKQI  +V A +  II KR+  +  GEA PDDLLGILL SN +EI+Q+G NK 
Sbjct  253   PTKRNKRMKQIFNEVRALVFGIIKKRMSMIENGEA-PDDLLGILLASNLKEIQQHGNNKK  311

Query  975   FGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             FGM+  EVIEECKLFY AGQETTSSLLVWTM+LL  +  WQ +
Sbjct  312   FGMSIDEVIEECKLFYFAGQETTSSLLVWTMILLCKYPNWQDK  354



>gb|ABC69393.1| CYP72A55v2 [Nicotiana tabacum]
Length=521

 Score =   419 bits (1077),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 199/342 (58%), Positives = 264/342 (77%), Gaps = 5/342 (1%)
 Frame = +3

Query  93    IVFLVC-LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPI-N  266
             I+FLV   W +L W W +P+KL+  LR+QGLKG  Y+  +GD+K++SKS+++  SKPI N
Sbjct  15    IIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYRLFYGDMKELSKSLKEINSKPIIN  74

Query  267   LSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPS-NP  443
             LS++++PR +P++++ IQK G+  FVW GP P + I +PEL+K +F K+ +FQKP + NP
Sbjct  75    LSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQKPNNPNP  134

Query  444   LSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGL  623
             L+KLLA+GV+ +EE+KW KHRKI+NP F MEKLKHM+PAFYLSCSEML++WE+ +  +  
Sbjct  135   LTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKHMLPAFYLSCSEMLNKWEEIIPVKES  194

Query  624   AELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPT  803
              ELD+WP+LQ++ SDVISR AFGSSYEEG +IFELQ EQ  Y+ +  +S+YIPG RF P 
Sbjct  195   NELDIWPHLQRMTSDVISRAAFGSSYEEGRRIFELQEEQAEYLTKTFNSVYIPGSRFFPN  254

Query  804   KRNRRMKQIEKQVHASIMDIIDKRVKAMR--GGEASPDDLLGILLESNFEEIEQNGNKNF  977
             K N+RMK+ EK+V  +I  +ID R+KA     G+A  DDLLGILLESN  EIE++GNK F
Sbjct  255   KMNKRMKECEKEVRETITCLIDNRLKAKEEGNGKALNDDLLGILLESNSIEIEEHGNKKF  314

Query  978   GMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             GM+  EVIEECKLFY AGQETTS LLVWT++LL  + EWQ R
Sbjct  315   GMSIPEVIEECKLFYFAGQETTSVLLVWTLILLGRNPEWQER  356



>ref|XP_009618785.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=531

 Score =   419 bits (1077),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 199/342 (58%), Positives = 264/342 (77%), Gaps = 5/342 (1%)
 Frame = +3

Query  93    IVFLVC-LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPI-N  266
             I+FLV   W +L W W +P+KL+  LR+QGLKG  Y+  +GD+K++SKS+++  SKPI N
Sbjct  25    IIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYRLFYGDMKELSKSLKEINSKPIIN  84

Query  267   LSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPS-NP  443
             LS++++PR +P++++ IQK G+  FVW GP P + I +PEL+K +F K+ +FQKP + NP
Sbjct  85    LSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQKPNNPNP  144

Query  444   LSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGL  623
             L+KLLA+GV+ +EE+KW KHRKI+NP F MEKLKHM+PAFYLSCSEML++WE+ +  +  
Sbjct  145   LTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKHMLPAFYLSCSEMLNKWEEIIPVKES  204

Query  624   AELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPT  803
              ELD+WP+LQ++ SDVISR AFGSSYEEG +IFELQ EQ  Y+ +  +S+YIPG RF P 
Sbjct  205   NELDIWPHLQRMTSDVISRAAFGSSYEEGRRIFELQEEQAEYLTKTFNSVYIPGSRFFPN  264

Query  804   KRNRRMKQIEKQVHASIMDIIDKRVKAMR--GGEASPDDLLGILLESNFEEIEQNGNKNF  977
             K N+RMK+ EK+V  +I  +ID R+KA     G+A  DDLLGILLESN  EIE++GNK F
Sbjct  265   KMNKRMKECEKEVRETITRLIDNRLKAKEEGNGKALNDDLLGILLESNSIEIEEHGNKKF  324

Query  978   GMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             GM+  EVIEECKLFY AGQETTS LLVWT++LL  + EWQ R
Sbjct  325   GMSIPEVIEECKLFYFAGQETTSVLLVWTLILLGRNPEWQER  366



>emb|CAN67740.1| hypothetical protein VITISV_015554 [Vitis vinifera]
Length=518

 Score =   417 bits (1072),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 197/348 (57%), Positives = 258/348 (74%), Gaps = 2/348 (1%)
 Frame = +3

Query  66    FGLIGFSIA-IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVE  242
               L+  S A I  L+  WR+LNW W RP++L++ L+QQGL G  Y+ ++GD K++S  ++
Sbjct  6     LNLVALSFAFITILIYAWRVLNWMWLRPKRLERCLKQQGLAGNSYRLLYGDFKEMSMMIK  65

Query  243   DAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
             +A S+PI+ SDDI  R  PF   +I+K G++SF+W+G KP V I +PEL+++V + HT+F
Sbjct  66    EATSRPISFSDDILQRVAPFHYHSIKKYGKSSFIWMGLKPRVNIMEPELIRDVLSMHTVF  125

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
             +KP  + L K  A G+ F E +KW KHRKIINP F++EKLK+M+PAF+LSCS+M+S+WE 
Sbjct  126   RKPRVHALGKQPASGLFFLEGEKWAKHRKIINPAFRLEKLKNMLPAFHLSCSDMISKWEX  185

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
              +   G  E DVWPYLQ L  D ISRTAFGS+YEEG  IFELQREQ   ++Q S S  IP
Sbjct  186   KLSTXGSCEXDVWPYLQNLTGDAISRTAFGSNYEEGRMIFELQREQAQLLVQFSQSACIP  245

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQN  962
             GWRFLPTK N+RMKQ  K+V+  +  IIDKR KAM+ GE   DDLLGILLESNF+EI+++
Sbjct  246   GWRFLPTKSNKRMKQNRKEVNELLWGIIDKREKAMKAGETLNDDLLGILLESNFKEIQEH  305

Query  963   GN-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             GN KN GM+ ++VI+ECK+FY AGQETTS LL+WTMVLLS H  WQ R
Sbjct  306   GNDKNVGMSIKDVIDECKIFYFAGQETTSVLLLWTMVLLSKHPNWQAR  353



>gb|ABC69392.1| CYP72A55v1 [Nicotiana tabacum]
Length=521

 Score =   417 bits (1072),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 199/342 (58%), Positives = 263/342 (77%), Gaps = 5/342 (1%)
 Frame = +3

Query  93    IVFLVC-LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPI-N  266
             I+FLV   W +L W W +P+KL+  LR+QGLKG  Y   +GD+K++SKS+++  SKPI N
Sbjct  15    IIFLVYKAWELLKWIWIKPKKLESCLRKQGLKGNSYGLFYGDMKELSKSLKEINSKPIIN  74

Query  267   LSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPS-NP  443
             LS++++PR +P++++ IQK G+  FVW GP P + I +PEL+K +F K+ +FQKP + NP
Sbjct  75    LSNEVAPRIIPYYLEIIQKYGKRCFVWQGPTPAILITEPELIKEIFGKNYVFQKPNNPNP  134

Query  444   LSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGL  623
             L+KLLA+GV+ +EE+KW KHRKI+NP F MEKLKHM+PAFYLSCSEML++WE+ +  +  
Sbjct  135   LTKLLARGVVSYEEEKWAKHRKILNPAFHMEKLKHMLPAFYLSCSEMLNKWEEIIPVKES  194

Query  624   AELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPT  803
              ELD+WP+LQ++ SDVISR AFGSSYEEG +IFELQ EQ  Y+ +  +S+YIPG RF P 
Sbjct  195   NELDIWPHLQRMTSDVISRAAFGSSYEEGRRIFELQEEQAEYLTKTFNSVYIPGSRFFPN  254

Query  804   KRNRRMKQIEKQVHASIMDIIDKRVKAMR--GGEASPDDLLGILLESNFEEIEQNGNKNF  977
             K N+RMK+ EK+V  +I  +ID R+KA     G+A  DDLLGILLESN  EIE++GNK F
Sbjct  255   KMNKRMKECEKEVRETITCLIDNRLKAKEEGNGKALNDDLLGILLESNSIEIEEHGNKKF  314

Query  978   GMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             GM+  EVIEECKLFY AGQETTS LLVWT++LL  + EWQ R
Sbjct  315   GMSIPEVIEECKLFYFAGQETTSVLLVWTLILLGRNPEWQER  356



>ref|XP_002270326.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=516

 Score =   416 bits (1068),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 188/351 (54%), Positives = 259/351 (74%), Gaps = 2/351 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME++   I F+  I  L+  WR+LNW W RP+KL++ LRQQG+ G  Y+ + GD++++ +
Sbjct  1     MELISVAISFAF-ITLLIYAWRLLNWVWLRPKKLERCLRQQGITGNSYRLLHGDVREMLR  59

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
              + +A S+PI+LSD+I  R LPF   +++K G+N F+W+GPKP+V I DPEL+++VF ++
Sbjct  60    MISEANSRPISLSDEIVQRVLPFHYHSLKKYGKNYFIWMGPKPVVNIMDPELIRDVFLRY  119

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
               F KP  +PL KLLA G++  E ++W KHRKIINP F +EKLKHM+PAF LSC +M+++
Sbjct  120   NAFHKPAPHPLGKLLATGLVTLEGEQWTKHRKIINPAFHLEKLKHMVPAFQLSCGDMVNK  179

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WEK +   G  ELD+WP L+ L  D ISRTAFGSSYEEG +IF+LQ+EQ    +++  S+
Sbjct  180   WEKKLSKDGSCELDIWPDLENLTGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRSV  239

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI  953
             YIPGWRF+PTK N+R++QI  ++HA +  II+KR KAM  GE + DDLL +L+ESNF E+
Sbjct  240   YIPGWRFVPTKTNKRIRQIRNELHALLKGIIEKREKAMLVGETANDDLLSLLMESNFREM  299

Query  954   -EQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              E +  KN GM+  +VIEECKLFY AGQETTS LL+WTM+LLS H  WQ R
Sbjct  300   QEHDERKNVGMSIDDVIEECKLFYFAGQETTSDLLLWTMILLSKHSNWQAR  350



>ref|XP_002263609.1| PREDICTED: cytochrome P450 CYP72A219 [Vitis vinifera]
Length=515

 Score =   415 bits (1067),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 195/344 (57%), Positives = 256/344 (74%), Gaps = 2/344 (1%)
 Frame = +3

Query  75    IGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKS  254
             I F    V + C+WR+LNW W RP++L++ LR+QGL G  Y+ + GD K++S+ +++A S
Sbjct  8     ISFGFLTVLISCVWRLLNWVWLRPKRLERCLREQGLAGNSYRLLQGDSKEMSRMMKEAYS  67

Query  255   KPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP  434
             +PI+LSDDI  R LPF    I+K G+N F W+GP P V I +PEL+++V  K  IFQK P
Sbjct  68    RPISLSDDIVQRVLPFHCHFIKKYGKNFFTWVGPSPRVNIMEPELMRDVLLKSNIFQKTP  127

Query  435   SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD  614
             S+PL KLL  G++  E ++W K RKIINP F  EKLK+M+ AF+LSCS+M+++W+K +  
Sbjct  128   SHPLVKLLVSGLVALEGEQWAKRRKIINPAFHPEKLKNMLSAFHLSCSDMVNKWKK-LSV  186

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRF  794
             +G  ELDVWPYL+ L  DVISRTAFGSSYEEG +IF+LQ+EQ    ++++ S+YIPGWRF
Sbjct  187   EGSCELDVWPYLENLTGDVISRTAFGSSYEEGIRIFQLQKEQTYLAIKVAMSVYIPGWRF  246

Query  795   LPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI-EQNGNK  971
              PTK N+RMKQI K+VHA +  II+KR KAM  GE +  DLLGIL+ESNF EI E   N 
Sbjct  247   FPTKTNKRMKQISKEVHALLGGIINKREKAMEAGETANSDLLGILMESNFREIQEHQNNT  306

Query  972   NFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
               GM+ ++VI+ECKLFYLAGQETTS LL+WTMVLLS H +WQ R
Sbjct  307   KIGMSAKDVIDECKLFYLAGQETTSVLLLWTMVLLSQHPDWQAR  350



>emb|CDP15978.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   414 bits (1065),  Expect = 8e-138, Method: Compositional matrix adjust.
 Identities = 200/353 (57%), Positives = 256/353 (73%), Gaps = 3/353 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFL---VCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKK  224
             MEIV+  I    + + L   V  W++ N  W  P+KL+K L++QG +G  YK ++GD K+
Sbjct  1     MEIVYNPIAVLSSCILLLILVLAWKVFNQVWLTPKKLEKRLKEQGFRGNPYKLLYGDFKE  60

Query  225   ISKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVF  404
             IS   ++A SKPINL+DD  PR +P F  A +K G+++++W G +  V I DPE ++ V 
Sbjct  61    ISTLFKEALSKPINLTDDFVPRVIPHFYAATKKYGKHTYLWQGTELTVVIMDPEHIREVT  120

Query  405   TKHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEM  584
              K  IFQ+P SNPL KLL QG+  +  DKW KHRK+INP F +EKLKHM+P+FY S SEM
Sbjct  121   QKVYIFQRPHSNPLLKLLVQGLASYNGDKWTKHRKLINPAFHVEKLKHMLPSFYTSASEM  180

Query  585   LSEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQIS  764
             + +WE  V   G +ELDVWP LQ L  D ISRTAFGS+Y+EG++IFELQREQ  + ++ +
Sbjct  181   MCKWEDIVSSNGSSELDVWPDLQTLTCDAISRTAFGSNYKEGSRIFELQREQTEHFIEAA  240

Query  765   SSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF  944
              S+YIPGWRF+PTKRN RMKQI + V  SI DII+ R+KAM+  +A  DDLLGILLESN 
Sbjct  241   RSLYIPGWRFIPTKRNTRMKQIARDVQESIKDIINARLKAMKAAKACDDDLLGILLESNS  300

Query  945   EEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +EI+ +GNKNFGMT  EVIEECKLFY AGQETTS LLVWTM+LLS + EWQ R
Sbjct  301   KEIDHHGNKNFGMTVLEVIEECKLFYFAGQETTSVLLVWTMILLSRYPEWQMR  353



>ref|XP_010092742.1| Secologanin synthase [Morus notabilis]
 gb|EXB52087.1| Secologanin synthase [Morus notabilis]
Length=518

 Score =   414 bits (1064),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 198/353 (56%), Positives = 259/353 (73%), Gaps = 3/353 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLW--RMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKI  227
             ME+ F  +   +  + L+  W  R+LNW W RP++L+  LR+QGLKG  Y+   GDLK+ 
Sbjct  1     MEVSFLKLSSVVFAILLITTWAWRVLNWVWLRPKRLENCLRKQGLKGNSYRLWSGDLKES  60

Query  228   SKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
             S  +++A SKPINLS+DI+ R  PF +  +   G++SF+W+GP P V I +PE +K++F 
Sbjct  61    SLMIKEASSKPINLSEDITARIFPFGLHTVNNYGKDSFMWIGPTPRVSITNPEYIKDIFN  120

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             K   F KP S PL KLLA GV  +E +KW +HRKIINP F MEKLK ++PAFYLSCSEML
Sbjct  121   KLGDFPKPQSIPLVKLLATGVATYEGEKWTRHRKIINPAFHMEKLKRLVPAFYLSCSEML  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             ++WE+ +  +G  ELDVW YLQ +  DVISRTAFGSSYEEG +IF+LQ+EQ    ++   
Sbjct  181   NKWERLLNSEGSCELDVWSYLQNMTGDVISRTAFGSSYEEGRRIFQLQKEQGELAIKSLQ  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             ++YIPGWRF+PTK NRRMK+I  ++ A + +II KR  AMR GEA  DDLLGIL+ESN +
Sbjct  241   TVYIPGWRFVPTKLNRRMKKIYNEIEALVKNIIHKREGAMRAGEAPNDDLLGILMESNLK  300

Query  948   EIEQNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EI+++G NKN G++ R+VIEECKLFY+AGQETTS+LLVWTMVLLS    WQ R
Sbjct  301   EIQEHGNNKNMGISIRDVIEECKLFYIAGQETTSTLLVWTMVLLSRFPSWQDR  353



>emb|CBI22134.3| unnamed protein product [Vitis vinifera]
Length=529

 Score =   414 bits (1065),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 187/348 (54%), Positives = 257/348 (74%), Gaps = 4/348 (1%)
 Frame = +3

Query  72    LIGFSIAIVFLVCL---WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVE  242
             LI  +I+  F+  L   WR+LNW W RP+KL++ LRQQG+ G  Y+ + GD++++ + + 
Sbjct  16    LISVAISFAFITLLIYAWRLLNWVWLRPKKLERCLRQQGITGNSYRLLHGDVREMLRMIS  75

Query  243   DAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
             +A S+PI+LSD+I  R LPF   +++K G+N F+W+GPKP+V I DPEL+++VF ++  F
Sbjct  76    EANSRPISLSDEIVQRVLPFHYHSLKKYGKNYFIWMGPKPVVNIMDPELIRDVFLRYNAF  135

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
              KP  +PL KLLA G++  E ++W KHRKIINP F +EKLKHM+PAF LSC +M+++WEK
Sbjct  136   HKPAPHPLGKLLATGLVTLEGEQWTKHRKIINPAFHLEKLKHMVPAFQLSCGDMVNKWEK  195

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
              +   G  ELD+WP L+ L  D ISRTAFGSSYEEG +IF+LQ+EQ    +++  S+YIP
Sbjct  196   KLSKDGSCELDIWPDLENLTGDAISRTAFGSSYEEGRRIFQLQKEQAHLAVKVFRSVYIP  255

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI-EQ  959
             GWRF+PTK N+R++QI  ++HA +  II+KR KAM  GE + DDLL +L+ESNF E+ E 
Sbjct  256   GWRFVPTKTNKRIRQIRNELHALLKGIIEKREKAMLVGETANDDLLSLLMESNFREMQEH  315

Query  960   NGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +  KN GM+  +VIEECKLFY AGQETTS LL+WTM+LLS H  WQ R
Sbjct  316   DERKNVGMSIDDVIEECKLFYFAGQETTSDLLLWTMILLSKHSNWQAR  363



>emb|CBI39886.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   415 bits (1066),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 195/344 (57%), Positives = 256/344 (74%), Gaps = 2/344 (1%)
 Frame = +3

Query  75    IGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKS  254
             I F    V + C+WR+LNW W RP++L++ LR+QGL G  Y+ + GD K++S+ +++A S
Sbjct  8     ISFGFLTVLISCVWRLLNWVWLRPKRLERCLREQGLAGNSYRLLQGDSKEMSRMMKEAYS  67

Query  255   KPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP  434
             +PI+LSDDI  R LPF    I+K G+N F W+GP P V I +PEL+++V  K  IFQK P
Sbjct  68    RPISLSDDIVQRVLPFHCHFIKKYGKNFFTWVGPSPRVNIMEPELMRDVLLKSNIFQKTP  127

Query  435   SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD  614
             S+PL KLL  G++  E ++W K RKIINP F  EKLK+M+ AF+LSCS+M+++W+K +  
Sbjct  128   SHPLVKLLVSGLVALEGEQWAKRRKIINPAFHPEKLKNMLSAFHLSCSDMVNKWKK-LSV  186

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRF  794
             +G  ELDVWPYL+ L  DVISRTAFGSSYEEG +IF+LQ+EQ    ++++ S+YIPGWRF
Sbjct  187   EGSCELDVWPYLENLTGDVISRTAFGSSYEEGIRIFQLQKEQTYLAIKVAMSVYIPGWRF  246

Query  795   LPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI-EQNGNK  971
              PTK N+RMKQI K+VHA +  II+KR KAM  GE +  DLLGIL+ESNF EI E   N 
Sbjct  247   FPTKTNKRMKQISKEVHALLGGIINKREKAMEAGETANSDLLGILMESNFREIQEHQNNT  306

Query  972   NFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
               GM+ ++VI+ECKLFYLAGQETTS LL+WTMVLLS H +WQ R
Sbjct  307   KIGMSAKDVIDECKLFYLAGQETTSVLLLWTMVLLSQHPDWQAR  350



>gb|EYU30753.1| hypothetical protein MIMGU_mgv1a004802mg [Erythranthe guttata]
Length=509

 Score =   413 bits (1062),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 191/345 (55%), Positives = 255/345 (74%), Gaps = 3/345 (1%)
 Frame = +3

Query  75    IGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKS  254
             + F + ++     W++LNW WF PR L+K LR+QG  G  YK +FGDLK+++  ++   S
Sbjct  3     LCFVVVVLLFYYAWKVLNWVWFTPRNLEKRLREQGYNGNSYKILFGDLKEMAFIIKQFNS  62

Query  255   KPINLS-DDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKP  431
             KP++ S D + PR +PF    ++K G  S +W GP+P +   DPE+V+ V +K  +FQ+P
Sbjct  63    KPVSFSRDTVVPRVIPFISKTVEKYGPKSIMWFGPRPAILCFDPEIVREVLSKSYVFQRP  122

Query  432   PSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNV-  608
             P  PL+KLL QGV  +E +KW KHR+++ P F  +KLK+M+PAFYLSC++MLS+WE+ V 
Sbjct  123   PLTPLTKLLVQGVGAYETEKWAKHRRLVTPAFHPDKLKNMLPAFYLSCNDMLSKWEEIVI  182

Query  609   GDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGW  788
              D G  E+DVWPYLQ ++SDVISRTAFGSSYEEG  +FELQREQ       S S+YIPGW
Sbjct  183   SDDGSCEVDVWPYLQNMSSDVISRTAFGSSYEEGRIVFELQREQTELYGLASQSVYIPGW  242

Query  789   RFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN  968
             RFLPTK N+RMK+I K+V + ++ II+KR++ M  GEA+ DDLL ILLESN +EI+QNGN
Sbjct  243   RFLPTKINKRMKEIAKEVQSCVLGIINKRMREMETGEANSDDLLSILLESNSKEIQQNGN  302

Query  969   KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             K +GM+  EVIEECKLFY AGQETTS+LL WTM+LLS H +WQ+R
Sbjct  303   K-YGMSCEEVIEECKLFYFAGQETTSALLAWTMILLSKHLDWQSR  346



>ref|XP_004166892.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=516

 Score =   412 bits (1059),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 193/331 (58%), Positives = 251/331 (76%), Gaps = 1/331 (0%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             W++ +W WFRP+KL+K+LRQQG  G  Y+ + GDLK+ +   E+A SKP+N S+ I+PR 
Sbjct  21    WKLADWIWFRPKKLEKLLRQQGFAGNSYRILHGDLKERAAMREEAMSKPMNFSNHIAPRV  80

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGVI  473
             +P     IQ+ G+NSF+WLGP P V I DPE +K VF+ +  FQKP  NP +KLL QG++
Sbjct  81    IPSIYHTIQRYGKNSFMWLGPIPRVHIMDPEQLKTVFSFYNDFQKPTMNPFTKLLVQGIV  140

Query  474   FHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQ  653
               + +KWVKHRKIINP F +EKLK M+PAFY SC+EM+S+WE  V  +G  ELDV PYL+
Sbjct  141   NLDGEKWVKHRKIINPAFHLEKLKDMVPAFYHSCNEMVSKWESMVSKEGSCELDVMPYLK  200

Query  654   QLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQIE  833
              +ASDVISRTAFGSSYE+G KIF+LQ E   +V+Q +  IYIPGWRFLPTK NR+MK+I 
Sbjct  201   XMASDVISRTAFGSSYEKGKKIFKLQTELTNFVIQTTLGIYIPGWRFLPTKLNRKMKEIS  260

Query  834   KQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKN-FGMTTREVIEEC  1010
             K++   I+ I+D+R K+M+ GEA   DLL IL+ESN  EI+Q+GNK   GM+  +VIEEC
Sbjct  261   KEITTLILGIMDEREKSMKAGEAIQTDLLSILMESNMNEIKQHGNKKXIGMSIEDVIEEC  320

Query  1011  KLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             KLFY+AGQETT++LLVWTM+LLS + EWQ R
Sbjct  321   KLFYIAGQETTATLLVWTMILLSSYSEWQER  351



>gb|EYU30744.1| hypothetical protein MIMGU_mgv1a004594mg [Erythranthe guttata]
Length=519

 Score =   412 bits (1058),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 202/339 (60%), Positives = 253/339 (75%), Gaps = 7/339 (2%)
 Frame = +3

Query  102   LVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPIN-LSDD  278
             +V  W++LNW WFRPR L+K LRQ G +G  Y+ +FGD K++S  +++AKSKPI+  S+D
Sbjct  17    IVYAWKVLNWVWFRPRNLEKWLRQLGFEGNSYRVLFGDSKEMSNMIKEAKSKPISAFSND  76

Query  279   ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLL  458
             I  R +P    A+   GE   +W GPKP V + D EL++ + +K  +FQK  SNPL + L
Sbjct  77    IVARVIPAIHHAVSMYGEKCILWFGPKPAVLVTDTELIREILSKSYVFQKN-SNPLGRQL  135

Query  459   AQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDV  638
             A+GV  +E DKW KHR++INP FQ +K+K M+P+FYLSC +MLS+WE+ +  +G +E+DV
Sbjct  136   ARGVATYETDKWAKHRRLINPAFQPDKIKQMLPSFYLSCCDMLSKWEEKLAKEGSSEVDV  195

Query  639   WPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI--YIPGWRFLPTKRN  812
             WPYLQ L SD ISRTAFGSSYEEG KIFELQ+EQ   ++Q   SI   IPGWRFLPTK N
Sbjct  196   WPYLQTLTSDAISRTAFGSSYEEGRKIFELQKEQAELIMQAVQSINFQIPGWRFLPTKMN  255

Query  813   RRMKQIEKQVHASIMDIIDKRVKAM--RGGEASPDDLLGILLESNFEEIEQNGNKNFGMT  986
              RMKQI K+V +SI  IIDKR+K M  R G  S DDLLGILL+SNF EI+QNGNK FGM+
Sbjct  256   IRMKQIVKEVESSIRGIIDKRMKEMEAREGSYSSDDLLGILLDSNFREIKQNGNK-FGMS  314

Query  987   TREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
               EVIEECKLFY AGQETTSSLLVWTM+LLS H +WQ+R
Sbjct  315   LDEVIEECKLFYFAGQETTSSLLVWTMILLSKHSDWQSR  353



>emb|CDP15985.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   411 bits (1057),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 199/356 (56%), Positives = 263/356 (74%), Gaps = 10/356 (3%)
 Frame = +3

Query  36    ETHTEMMEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGD  215
             E H+ M+ +V      S  +V  V  WR+LNWAWF+P+KLQK L+QQG KG  YK I+GD
Sbjct  3     EAHSFMIALVS-----SCCVVLSVLAWRVLNWAWFQPKKLQKHLKQQGFKGNPYKLIYGD  57

Query  216   LKKISKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVK  395
             LK+IS   ++A SKPI+LSD I PR  P F++A+ K G+N+++W GP+P++ I DPEL++
Sbjct  58    LKQISSLFQEANSKPISLSDGIVPRIAPHFLEAVNKYGKNTYLWSGPRPMMLIMDPELIR  117

Query  396   NVFTKHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSC  575
              V  K  IFQK   +P + LL  G++ +E +KWVK RK++N  F MEKLK M+PAFY S 
Sbjct  118   KVTQKMDIFQKVKFHPQASLLVAGILGYEGEKWVKQRKLLNQAFHMEKLKLMVPAFYKSA  177

Query  576   SEMLSEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVL  755
              EMLS+WE+ +  +G  E+DVWP +Q + SD ISRTAFGS YEEG KIFELQREQ G+++
Sbjct  178   CEMLSKWEEMISVKGSFEVDVWPTIQTMTSDAISRTAFGSRYEEGRKIFELQREQAGHLV  237

Query  756   QISSSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLE  935
               + SIYIPG RFLPTKRNRRMKQI K+V  SI +II+ R+KA+R GEA   D+LG+LL 
Sbjct  238   LATRSIYIPGSRFLPTKRNRRMKQIAKEVEGSIREIINARLKALRAGEAIDTDMLGLLLA  297

Query  936   SNFEEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ++    ++ G ++ GMTT E+I+ECKLFY+AGQETT+ LLVWTM+LLSMH +WQ R
Sbjct  298   TS----QETGGES-GMTTGEIIQECKLFYVAGQETTAVLLVWTMILLSMHPDWQER  348



>ref|XP_006495014.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=518

 Score =   411 bits (1057),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 198/353 (56%), Positives = 260/353 (74%), Gaps = 3/353 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVC-LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME     I FSI IV +V    ++LNWAW +P+KL+K LR+QG +G  Y+F+FGD+K+  
Sbjct  1     MEFSVKSIAFSIVIVTVVTWACKILNWAWLKPKKLEKQLRRQGFRGNSYRFLFGDVKEHG  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
                  AKSKPI+L DDI+PR +P +    +  G+N++ W+GP P++ I DP+ +K VFT 
Sbjct  61    ILSRQAKSKPISLDDDIAPRVVPLYDQREKLYGKNTYWWIGPIPMINIMDPDQIKEVFTN  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                FQKP +NPL K+L  G+   E +KW KHRKIINP F  EKLK M+PAFY SC+E++S
Sbjct  121   INDFQKPKTNPLGKILTTGLAIREGEKWAKHRKIINPAFHQEKLKLMLPAFYQSCTEIIS  180

Query  591   EWEK-NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             +WEK  +GDQG  ELDVWPYL +L SDVISRTAFGS+YEEG +IF+LQ E     LQ   
Sbjct  181   KWEKLMIGDQGSCELDVWPYLVKLTSDVISRTAFGSNYEEGIRIFQLQTELADIALQALQ  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             S+YIPGWR++PTKRNRRMK+++K++  S+ DII KR  AM+ GEA+ DDLLG+L+ESN +
Sbjct  241   SVYIPGWRYVPTKRNRRMKELDKEIRVSLADIIRKREIAMKTGEAAKDDLLGLLMESNLK  300

Query  948   EIEQNGNKNF-GMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EI+++GN    G++  +VI+ECKLFY AGQETTS LL+WTMVLLS HQ+WQ  
Sbjct  301   EIKEHGNNKLKGISRDDVIDECKLFYFAGQETTSVLLLWTMVLLSKHQDWQAH  353



>ref|XP_006477949.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Citrus 
sinensis]
Length=517

 Score =   411 bits (1056),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 196/352 (56%), Positives = 259/352 (74%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVC-LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME+    I F+I IV LV   W +LNW W RP+KL+K LRQQGLKG  Y+ +FGDLK+ S
Sbjct  1     MELTLKSIAFTIVIVTLVTWAWMVLNWLWLRPKKLEKFLRQQGLKGNSYRLLFGDLKESS  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               ++ AK++P++L DD + R  PF     +  G+NSF+W GP P V I +P+ +K +FTK
Sbjct  61    IMLKKAKARPLSLDDDAAVRVNPFLPKLFKDYGKNSFMWFGPTPRVNITNPDQIKEIFTK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                F K  SNPL+++L  G++ +E ++W KHRKIINP F+ EKLK M+PAF  S S++++
Sbjct  121   INDFPKINSNPLARILGVGLVNYEGEQWAKHRKIINPAFRQEKLKLMLPAFCQSSSDIIT  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             EWEK +  +G  ELDVWPYL  L  DVISRTAFGS+YEEG +IF+LQ E     +Q+  S
Sbjct  181   EWEKLMSTEGSCELDVWPYLANLTGDVISRTAFGSNYEEGRRIFQLQSELAELTIQVIRS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRFLPTKRN+RMK+++K++  ++M II  R KAM+ GEA+ DDLLGIL+++NF E
Sbjct  241   VYIPGWRFLPTKRNKRMKELDKEISTALMGIIKNREKAMKAGEAANDDLLGILMDTNFRE  300

Query  951   IEQNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IE++G NKN GM+  +V+EECKLFY AGQETTS LL WTMVLLS HQ+WQ R
Sbjct  301   IEEHGNNKNVGMSFNDVMEECKLFYFAGQETTSVLLNWTMVLLSKHQDWQER  352



>gb|EYU31631.1| hypothetical protein MIMGU_mgv1a004628mg [Erythranthe guttata]
Length=380

 Score =   406 bits (1043),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 189/351 (54%), Positives = 259/351 (74%), Gaps = 3/351 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME++   +     +V ++  W+++N+ WFRP+K++KILRQQG  G  Y+F+ GDL ++  
Sbjct  1     MELIHSFLSLCCTVVVVIYAWKIMNFVWFRPKKMEKILRQQGFVGKPYRFLVGDLNEMKN  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
                +A SKPI+ SDD  PR +PF    +  +GEN F+WLGP P V I DP++V+ V +K 
Sbjct  61    MGNEALSKPIDFSDDFVPRIIPFIHKTVTNHGENCFIWLGPYPAVLIFDPDIVREVLSKT  120

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
              +FQKP  NPL+ +LA+G+  +E DKW KHR++INP F ++K+KHMIP+F+  C+EMLS+
Sbjct  121   YVFQKP-YNPLANVLARGLASYETDKWAKHRRLINPAFHLDKVKHMIPSFHKCCAEMLSK  179

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS-S  770
             WEK V  +G  ELDVWPYLQ + SD IS TAFG+SYE+G KIFELQ+EQ   + + +  S
Sbjct  180   WEKIVPSEGCFELDVWPYLQTMTSDAISLTAFGTSYEQGRKIFELQKEQATLITKSNLFS  239

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
              +I  WR+LPTK NRRMK+I  ++ + +  IID+R KA+  GEA+ +DLL ILLESN +E
Sbjct  240   TFILAWRYLPTKTNRRMKRIITELESLLRAIIDQRTKAIEAGEATSNDLLDILLESNSKE  299

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             I+QNG+K FGM+ ++VIEECKLFYLAGQETTSSLLVWTM+LLS + +WQ R
Sbjct  300   IKQNGHK-FGMSLQDVIEECKLFYLAGQETTSSLLVWTMILLSKYLDWQAR  349



>ref|XP_009356840.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   410 bits (1054),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 191/329 (58%), Positives = 249/329 (76%), Gaps = 1/329 (0%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             WR++NW W RP+KL++ LRQQGL G  Y+F+ GD+K+IS + E A SKP++LS DI+PR 
Sbjct  21    WRVVNWLWLRPKKLERYLRQQGLAGNLYRFMSGDMKEISMTTEQAYSKPMSLSHDIAPRV  80

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGVI  473
             +PF    +   G+NSFVW+G  P V I +PE +K + TK  +F +P  NPL KLLA G+ 
Sbjct  81    IPFHHRLVNTYGKNSFVWMGSIPRVIITNPEDLKYILTKMEVFPQPEPNPLVKLLATGIA  140

Query  474   FHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQ  653
             F+E +KW KHR+IINP F +EKLK M+PAFY SCSEM+ EWE  V  +   ELDVWPY Q
Sbjct  141   FYEGEKWAKHRRIINPVFHLEKLKRMLPAFYESCSEMIVEWESLVLKESSCELDVWPYFQ  200

Query  654   QLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQIE  833
              L +DVISRTAFGSSY+EG KIF+L +EQV  V ++  S+YIPGWRFLPTK N++MK I+
Sbjct  201   NLTADVISRTAFGSSYKEGRKIFQLLKEQVQLVTKVVQSVYIPGWRFLPTKTNKKMKGID  260

Query  834   KQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTTREVIEEC  1010
             +++ A +M II+KR  A++ G+A+ DDLLG+L+ESN +EI ++G NK  GM+  +VIEEC
Sbjct  261   REIRALLMGIINKREGAIKAGKATKDDLLGVLMESNVKEIREHGNNKKVGMSMHDVIEEC  320

Query  1011  KLFYLAGQETTSSLLVWTMVLLSMHQEWQ  1097
             KLFY AGQETTS LLVWTMVLL  +Q+WQ
Sbjct  321   KLFYFAGQETTSGLLVWTMVLLGQYQDWQ  349



>emb|CDP11335.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   410 bits (1053),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 198/360 (55%), Positives = 254/360 (71%), Gaps = 10/360 (3%)
 Frame = +3

Query  54    MEIVFGLIGF---SIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKK  224
             ME  +  I      I + FL+  W++ N AW  P++L+K L++QGL+G  YKF+ GD K+
Sbjct  1     METAYSPIAVLCSCILLYFLMLAWKVFNCAWLTPKRLEKRLKEQGLRGNPYKFLHGDFKQ  60

Query  225   ISKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGE-------NSFVWLGPKPLVFIKDP  383
             IS  +++A SK INLSDD+ PR +P   +A++K G+       N+++WLGPK  V I +P
Sbjct  61    ISTLLKEAHSKTINLSDDLFPRVIPHLHEAVKKYGKYYLLFNYNTYIWLGPKLRVVIMNP  120

Query  384   ELVKNVFTKHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAF  563
             E ++ + +K +IFQKP   P +KLL QG+  ++ DKW KHRK+I P F +EKLKHM+P+F
Sbjct  121   EHIREITSKLSIFQKPGGTPDTKLLVQGLASYDGDKWAKHRKLITPAFHVEKLKHMVPSF  180

Query  564   YLSCSEMLSEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQV  743
                  EMLS+WEK V   G  ELDVWP L+ L  D ISRTAFGS+Y+EG +IFELQ EQ 
Sbjct  181   CTCAGEMLSKWEKIVSTNGSCELDVWPDLRTLTCDAISRTAFGSNYKEGTRIFELQTEQA  240

Query  744   GYVLQISSSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLG  923
              Y L+   S+Y PGWRFLPTKRNRRMKQI K VH SI  II+ R++AM  G+A  DDLL 
Sbjct  241   QYHLKAVQSVYFPGWRFLPTKRNRRMKQIAKDVHESIRKIINARLEAMEAGDACADDLLS  300

Query  924   ILLESNFEEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ILLESN +EI+ +GNK FGM+ REVIEECKLFY AGQETTS LLVWTM+LLS +  WQ R
Sbjct  301   ILLESNSKEIDYHGNKGFGMSIREVIEECKLFYFAGQETTSVLLVWTMILLSRYPNWQAR  360



>ref|XP_008386157.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   409 bits (1051),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/348 (55%), Positives = 248/348 (71%), Gaps = 1/348 (0%)
 Frame = +3

Query  63    VFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVE  242
               G +   I ++ +   WR+LNW W RP+KL++ LRQQGL G  Y+F  GD+K+IS  ++
Sbjct  7     TIGAVLVGITVIIIAGAWRLLNWLWLRPKKLERYLRQQGLTGNSYRFYTGDMKEISTMIK  66

Query  243   DAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
              A SKP++LS DI+PR +PF    +   G+N FVW+GP P V I DPE +K + TK   F
Sbjct  67    QAYSKPVSLSHDIAPRVIPFDYQLVNTYGKNYFVWMGPTPRVNITDPEDMKTILTKMDDF  126

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
              KP +NPL KLL  G+   E +KW KHR+IINP F +EKLK M+P FY SCSEM+ EWE 
Sbjct  127   PKPXANPLXKLLXTGIALCEGEKWAKHRRIINPVFHIEKLKRMLPEFYQSCSEMIVEWES  186

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
              V  +G  ELDVWPY + + +DVISRTAFGSSY+EG KIF+L +EQ    +++  S+YIP
Sbjct  187   LVLKEGSCELDVWPYFENMTADVISRTAFGSSYKEGRKIFQLLKEQAKLAIKVVQSVYIP  246

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQN  962
             G RFLPTK N +MK+I++++ A +M II+ R  A+R GEA+ DDLLG+L+ESN  EI+++
Sbjct  247   GARFLPTKINMKMKEIDREIRALLMGIINXREDAIRAGEATKDDLLGVLMESNLNEIKEH  306

Query  963   G-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             G NK  GM+  +VIEECKLFY AGQETTS LLVWTMVLL  +Q WQ R
Sbjct  307   GNNKKVGMSMHDVIEECKLFYFAGQETTSVLLVWTMVLLGQYQNWQDR  354



>ref|XP_009343587.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   409 bits (1050),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/329 (58%), Positives = 248/329 (75%), Gaps = 1/329 (0%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             WR++NW W RP+KL++ LRQQGL G  Y+F+ GD+K+IS + E A SKP++LS DI+PR 
Sbjct  21    WRVVNWLWLRPKKLERYLRQQGLAGNLYRFMSGDMKEISMTTEQAYSKPMSLSHDIAPRV  80

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGVI  473
             +PF    +   G+NSFVW+G  P V I +PE +K + TK  +F +P  NPL KLLA G+ 
Sbjct  81    IPFHHRLVNTYGKNSFVWMGSIPRVIITNPEDLKYILTKMEVFPQPEPNPLVKLLATGIA  140

Query  474   FHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQ  653
             F+E +KW KHR+IINP F +EKLK M+PAFY SCSEM+ EWE  V  +   ELDVWPY Q
Sbjct  141   FYEGEKWAKHRRIINPVFHLEKLKRMLPAFYESCSEMIVEWESLVLKESSCELDVWPYFQ  200

Query  654   QLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQIE  833
              L +DVISRTAFGSSY+EG KIF+L +EQV  V ++  S+Y PGWRFLPTK N++MK I+
Sbjct  201   NLTADVISRTAFGSSYKEGRKIFQLLKEQVQLVTKVVQSVYTPGWRFLPTKTNKKMKGID  260

Query  834   KQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTTREVIEEC  1010
             +++ A +M II+KR  A++ G+A+ DDLLG+L+ESN +EI ++G NK  GM+  +VIEEC
Sbjct  261   REIRALLMGIINKREGAIKAGKATKDDLLGVLMESNVKEIREHGNNKKVGMSMHDVIEEC  320

Query  1011  KLFYLAGQETTSSLLVWTMVLLSMHQEWQ  1097
             KLFY AGQETTS LLVWTMVLL  +Q+WQ
Sbjct  321   KLFYFAGQETTSGLLVWTMVLLGQYQDWQ  349



>ref|XP_008226211.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   409 bits (1050),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 205/347 (59%), Positives = 260/347 (75%), Gaps = 7/347 (2%)
 Frame = +3

Query  84    SIAI-VFLVCL-----WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVED  245
             S+A+ VFLV       WR+LNW W RP+KL++ LRQQGL G  Y+ + GD K+ S  V++
Sbjct  8     SVALRVFLVSTVITLAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLVGDTKESSMMVKE  67

Query  246   AKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQ  425
             AKSKP+NLS DI+PR LPF   ++   G+N F+W+GP P V I +P  VK+VFT +  FQ
Sbjct  68    AKSKPMNLSHDITPRVLPFLHQSVTTYGKNFFIWIGPTPRVNISNPADVKDVFTNYEDFQ  127

Query  426   KPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKN  605
             KP  NPL KLLA G+  +E +KW KHRKIINP F +EKLK M+PAF+LSCSEM+ EWE+ 
Sbjct  128   KPVINPLVKLLATGLPNYEGEKWAKHRKIINPAFHLEKLKRMLPAFHLSCSEMIEEWERL  187

Query  606   VGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPG  785
             V  +G  ELDVWPYL+ LA+DVISR +FGSSY+EG KIF+L +EQ    ++   S+YIPG
Sbjct  188   VSKEGSCELDVWPYLESLAADVISRASFGSSYQEGRKIFQLLKEQAKLTIRALQSVYIPG  247

Query  786   WRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG  965
             WRFLPT+ N+RMK I+K++  S+ DII  R +A+R GEA+ DDLLGILLESN +EI +NG
Sbjct  248   WRFLPTRSNKRMKAIDKEIKGSLRDIISTREEAIRMGEATKDDLLGILLESNLKEIRENG  307

Query  966   N-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             N KN GM+  +VIEECKLFY AGQETTS LL+WT+VLLS +Q WQ R
Sbjct  308   NTKNVGMSIEDVIEECKLFYFAGQETTSVLLLWTLVLLSQNQNWQAR  354



>ref|XP_006348902.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Solanum 
tuberosum]
Length=435

 Score =   405 bits (1041),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 188/270 (70%), Positives = 225/270 (83%), Gaps = 0/270 (0%)
 Frame = +3

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGVI  473
             +PFF+D I K G+ SF+WLGPKPLVFI DP+L+K VFTK  I+QK  +NPL+KLLAQG++
Sbjct  1     MPFFLDTINKYGKKSFIWLGPKPLVFIMDPDLIKEVFTKTYIYQKTKTNPLTKLLAQGLV  60

Query  474   FHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQ  653
               E DKW KHRKIINP F +EKLKHM+PAF LSC+EMLS+WE  V  +   E+DVWP+LQ
Sbjct  61    REEGDKWAKHRKIINPAFHLEKLKHMLPAFCLSCTEMLSKWEDIVSVERAYEIDVWPHLQ  120

Query  654   QLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQIE  833
             QL SDVISRTAFGSSYEEG +IFELQ EQ  Y ++   S+YIPGW FLPTKRNRRMK+IE
Sbjct  121   QLTSDVISRTAFGSSYEEGRRIFELQTEQAQYFIEAVRSVYIPGWSFLPTKRNRRMKEIE  180

Query  834   KQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFGMTTREVIEECK  1013
             + V A+I  IIDKRVKAM+GGEA+ +DLLGILLESNF+EIEQ+G+KNFG++  EVIEECK
Sbjct  181   RHVQATIRGIIDKRVKAMKGGEANNEDLLGILLESNFKEIEQHGDKNFGLSIEEVIEECK  240

Query  1014  LFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             LFY AGQETTS+LLVWT++LL  H +WQTR
Sbjct  241   LFYFAGQETTSALLVWTLILLCRHHDWQTR  270



>emb|CDP15982.1| unnamed protein product [Coffea canephora]
Length=515

 Score =   407 bits (1047),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 196/341 (57%), Positives = 252/341 (74%), Gaps = 5/341 (1%)
 Frame = +3

Query  84    SIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPI  263
             S  +V  V  WR LNWAWF+P+KLQK L+QQG KG  YK I+GD K+IS   ++A SKPI
Sbjct  14    SCCVVLSVLAWRALNWAWFQPKKLQKHLKQQGFKGNPYKLIYGDFKQISSLFQEANSKPI  73

Query  264   NLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNP  443
             +LSDDI PR +P F++A+ K G+N+++W GP+P++ I DPEL++ V  K  IFQK    P
Sbjct  74    SLSDDIVPRIVPHFLEAVNKYGKNTYLWFGPRPMMLIMDPELIRKVTHKMDIFQKVRFRP  133

Query  444   LSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGL  623
              ++LL  G++ +E +KW K RK++N  F  EKLK M+PAFY S SEMLS+WE+ +  +G 
Sbjct  134   QARLLIGGILVYEGEKWAKQRKLLNQAFHTEKLKLMVPAFYKSASEMLSKWEEMISVKGS  193

Query  624   AE-LDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLP  800
              E +DVWP +Q + SD ISRTAFGS YEEG KIFELQREQ  ++++ + SIYIPG RFLP
Sbjct  194   FEVVDVWPNIQTMTSDAISRTAFGSRYEEGRKIFELQREQARHLVEATRSIYIPGSRFLP  253

Query  801   TKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFG  980
             TKRNRRMKQI K+V  SI +II+ R+KA+R GEA   D+LGILLES  +E +       G
Sbjct  254   TKRNRRMKQIAKEVEGSIREIINARLKALRAGEAIDADMLGILLESTSQETDGES----G  309

Query  981   MTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             MTT E+I+ECKLFY AGQETT+ LLVWTM+LLSMH +WQ R
Sbjct  310   MTTGEIIQECKLFYFAGQETTAVLLVWTMILLSMHPDWQER  350



>gb|EYU31630.1| hypothetical protein MIMGU_mgv1a004628mg [Erythranthe guttata]
Length=517

 Score =   406 bits (1044),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 189/351 (54%), Positives = 259/351 (74%), Gaps = 3/351 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME++   +     +V ++  W+++N+ WFRP+K++KILRQQG  G  Y+F+ GDL ++  
Sbjct  1     MELIHSFLSLCCTVVVVIYAWKIMNFVWFRPKKMEKILRQQGFVGKPYRFLVGDLNEMKN  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
                +A SKPI+ SDD  PR +PF    +  +GEN F+WLGP P V I DP++V+ V +K 
Sbjct  61    MGNEALSKPIDFSDDFVPRIIPFIHKTVTNHGENCFIWLGPYPAVLIFDPDIVREVLSKT  120

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
              +FQKP  NPL+ +LA+G+  +E DKW KHR++INP F ++K+KHMIP+F+  C+EMLS+
Sbjct  121   YVFQKP-YNPLANVLARGLASYETDKWAKHRRLINPAFHLDKVKHMIPSFHKCCAEMLSK  179

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS-S  770
             WEK V  +G  ELDVWPYLQ + SD IS TAFG+SYE+G KIFELQ+EQ   + + +  S
Sbjct  180   WEKIVPSEGCFELDVWPYLQTMTSDAISLTAFGTSYEQGRKIFELQKEQATLITKSNLFS  239

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
              +I  WR+LPTK NRRMK+I  ++ + +  IID+R KA+  GEA+ +DLL ILLESN +E
Sbjct  240   TFILAWRYLPTKTNRRMKRIITELESLLRAIIDQRTKAIEAGEATSNDLLDILLESNSKE  299

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             I+QNG+K FGM+ ++VIEECKLFYLAGQETTSSLLVWTM+LLS + +WQ R
Sbjct  300   IKQNGHK-FGMSLQDVIEECKLFYLAGQETTSSLLVWTMILLSKYLDWQAR  349



>emb|CDP15981.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   405 bits (1042),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 199/353 (56%), Positives = 259/353 (73%), Gaps = 10/353 (3%)
 Frame = +3

Query  39    THTEMMEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDL  218
             TH+ M+ +V      S  +V  V  W++L+W WF+PRKL+K L+QQG KG  YK  +GD 
Sbjct  4     THSFMIVLV------SSCLVLSVLAWKVLSWVWFKPRKLEKHLKQQGFKGNPYKLFYGDF  57

Query  219   KKISKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKN  398
             K+I    ++A SKPI+LSDDI PR +P F+  + K G+N+++W GPKP + I DPEL + 
Sbjct  58    KEIGTLFQEAYSKPISLSDDIVPRVIPHFLGTVNKYGKNAYLWFGPKPTMLIMDPELTRK  117

Query  399   VFTKHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCS  578
             V  K  IFQKP  +PLSKLLAQG + +E DKW KHRK++N  F MEKLK M+PAFY S S
Sbjct  118   VTQKMEIFQKPQFHPLSKLLAQGTLVYEGDKWAKHRKLLNQAFHMEKLKLMVPAFYTSAS  177

Query  579   EMLSEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQ  758
             EMLS+WE+ +  +G  ELDVWP+LQ +  D ISRTAFGS YE+G +IFELQ EQ  ++++
Sbjct  178   EMLSKWEEGISAKGSIELDVWPHLQTMTGDAISRTAFGSKYEKGRRIFELQTEQAQHLVK  237

Query  759   ISSSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLES  938
                S+YIPG RFLPTKRNRRMKQI  +V+ SI +II  R+ A+R GEAS DD+L +LLES
Sbjct  238   AVQSMYIPGLRFLPTKRNRRMKQIATEVNDSIGEIIRTRLNALRTGEASDDDMLSLLLES  297

Query  939   NFEEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQ  1097
             + +E     +K FGMTT+E++EECKLFY AGQETT+ LLVWTM+LLSM+ +WQ
Sbjct  298   SSQET----DKEFGMTTKEIVEECKLFYFAGQETTAVLLVWTMILLSMYPDWQ  346



>dbj|BAL45206.1| cytochrome P450 monooxygenase [Glycyrrhiza uralensis]
Length=522

 Score =   406 bits (1043),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 186/344 (54%), Positives = 260/344 (76%), Gaps = 2/344 (1%)
 Frame = +3

Query  78    GFSIAIVFLVC-LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKS  254
             G ++ IV  V   WRMLNW W RP+KL+++LR+QGL+G  Y+ I GDLK + K  ++AKS
Sbjct  12    GITLVIVLAVTWAWRMLNWLWLRPKKLERLLREQGLQGNPYRLIVGDLKDLMKMRKEAKS  71

Query  255   KPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP  434
             KP+NLSDDI PR  P+   ++ K+G+NSF+W GP P V + DPE +K+V  K   F K  
Sbjct  72    KPMNLSDDILPRVFPYVQQSVTKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFPKSD  131

Query  435   SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD  614
              + L KLLA G++ +E +KW KHR+IINP F +EKLK M+P F+ SC++++++WE  +  
Sbjct  132   GDRLVKLLATGLVSYEGEKWSKHRRIINPAFNLEKLKIMLPIFFQSCNDLITKWEGMLSS  191

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRF  794
              G  E+D+WP+LQ LASDVI+R AFGSSYEEG +IF+LQ+EQV + + +   +YIPGWRF
Sbjct  192   DGSCEMDIWPFLQNLASDVIARAAFGSSYEEGRRIFQLQKEQVEHTMSVLVKVYIPGWRF  251

Query  795   LPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NK  971
             LPT  +RRMK+I++++ AS+ ++I+KR +A++ GEA+ ++LL ILLESN +E+E++G N+
Sbjct  252   LPTTTHRRMKKIDREIKASLKEMINKRERALKAGEATKNNLLDILLESNHKEVEEHGNNR  311

Query  972   NFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             N GM+  +VIEECKLFY AGQETTS LLVWTMVLLS + +WQ R
Sbjct  312   NVGMSLEDVIEECKLFYFAGQETTSGLLVWTMVLLSRYPDWQAR  355



>ref|XP_009594691.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Nicotiana 
tomentosiformis]
Length=419

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/344 (56%), Positives = 251/344 (73%), Gaps = 5/344 (1%)
 Frame = +3

Query  75    IGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKS  254
             I F I I+ L   WR +NW W +P+ L+K L++ G +G  YK ++GD+K++    E+AKS
Sbjct  9     ISFVIIIILLRWGWRFMNWLWLQPKCLEKCLKELGFRGNSYKLLYGDMKEVVMMDEEAKS  68

Query  255   KPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP  434
             KPI  S DI PR +PF    I   G+NSF+WL P P + I DPEL++ + +K  IFQKPP
Sbjct  69    KPIKFSHDIVPRIMPFIHKTIIDYGKNSFIWLWPTPAMLITDPELIREILSKSNIFQKPP  128

Query  435   SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD  614
                 +KLL +G++ +E DKW KHR+IINP F ++KLKHMIP+F+LS  EMLSEWEK    
Sbjct  129   PTAHTKLLVEGILSYEADKWAKHRRIINPAFHLDKLKHMIPSFHLSTCEMLSEWEKVASA  188

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRF  794
             +G +E+DVWPYLQ L SD ISRTAFGSSYEEG KIFELQ+E    +L+++ S YI    F
Sbjct  189   EG-SEVDVWPYLQSLTSDAISRTAFGSSYEEGRKIFELQQELAKIILKVTESSYI---MF  244

Query  795   LPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEA-SPDDLLGILLESNFEEIEQNGNK  971
             LPTK NRRMKQI ++V + ++ II+KR+ A+   EA + DDLLGILL+SN +EI+++GNK
Sbjct  245   LPTKENRRMKQIYQEVRSLVLGIINKRMDAIEAREAFNNDDLLGILLDSNLKEIKEHGNK  304

Query  972   NFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              FGM+  EVIEECKLFY AGQETTS+LL W+M++LS H +WQ R
Sbjct  305   KFGMSLDEVIEECKLFYFAGQETTSALLTWSMIVLSKHSDWQAR  348



>gb|KEH38475.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   403 bits (1036),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/351 (54%), Positives = 252/351 (72%), Gaps = 1/351 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             M     +I F++  + L+  WR+LNW W +P+KL+K LR+QGLKG  Y+ + GD+K + K
Sbjct  1     MATTTAIILFTLMTLSLIWAWRILNWIWLKPKKLEKELREQGLKGNSYRLLVGDIKDLLK  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
               ++A SKP+NLSDDI PR   F    + K+G+NSF+W GP P V I DPE +K+V  K 
Sbjct  61    IRKEATSKPMNLSDDIVPRVYSFVQQTVAKHGKNSFIWFGPTPRVNITDPEQIKDVINKI  120

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
               FQKP  NPL +LL  G++  E ++W KHRKIINP F +EKLK ++P F+ SC +++S+
Sbjct  121   YDFQKPNVNPLVRLLGCGLVCLEGEQWSKHRKIINPAFHLEKLKIILPIFHKSCDDLISK  180

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WEK +   G  E+DVWP+LQ LASD+ISR AFGSSYEEG +IF+LQ EQ     +I   +
Sbjct  181   WEKMLSSDGSCEMDVWPFLQNLASDLISRAAFGSSYEEGKRIFQLQTEQAELTTKIIEKV  240

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI  953
             YIPGWRFLPT   RRMK+IE+ V AS+ D+I+ R +A+  GEA+ DDLLGILLESN +E+
Sbjct  241   YIPGWRFLPTTTPRRMKEIERDVRASLTDMINTRERALMAGEATKDDLLGILLESNHKEM  300

Query  954   EQ-NGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             E+ + NKN GM+  +VIEECKLFY AG ETTS LLVWT+VLLS + +WQ R
Sbjct  301   EEHDNNKNVGMSLDDVIEECKLFYFAGAETTSVLLVWTIVLLSRYPDWQAR  351



>ref|XP_006594768.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=523

 Score =   403 bits (1036),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 189/348 (54%), Positives = 260/348 (75%), Gaps = 8/348 (2%)
 Frame = +3

Query  84    SIAIVFLVCL-------WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVE  242
             S +IVF++ +       WRMLNW W RP++L+++LR+QGL+G  Y+ + GDLK+I K   
Sbjct  9     SSSIVFVIVILALTSWAWRMLNWLWIRPKRLERLLREQGLQGNPYRILVGDLKEIVKLQM  68

Query  243   DAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
             +A+SKP+NLS DI PR       ++ K+G+NSF+W GPKP V + DPEL+K+V  K + F
Sbjct  69    EARSKPMNLSHDIVPRVFAHLHQSVLKHGKNSFIWFGPKPRVTLTDPELIKDVLNKISDF  128

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
             +KP +NPL+KLLA G++ ++ +KW KHR++INP F +EKLK M+P F+ SC++++ +WE 
Sbjct  129   RKPEANPLAKLLATGLVNYDGEKWNKHRRLINPAFSLEKLKIMLPIFFKSCNDLIIKWEG  188

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
              +   G  E+DVWP+LQ LASDVI+RTAFGSS+EEG +IF+LQ+E     +++   +YIP
Sbjct  189   MLSYDGSCEMDVWPFLQNLASDVIARTAFGSSFEEGKRIFQLQKELAELTMKVIMKVYIP  248

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI-EQ  959
             GWRF+PT  NRRMK+I++ + AS+ D+I KR KA + GEA+ DDLLGILLESN +EI E 
Sbjct  249   GWRFVPTATNRRMKEIDRYIKASLTDMIKKREKAPKTGEATRDDLLGILLESNHKEIQEH  308

Query  960   NGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
               N+N GM   +VIEECKLFY AGQETTS LLVWTMVLLS + +WQ+R
Sbjct  309   RNNENVGMNLNDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQSR  356



>ref|XP_004488669.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=518

 Score =   403 bits (1035),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 198/351 (56%), Positives = 256/351 (73%), Gaps = 1/351 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME    + G  I ++ LV  W+ML+W W RP+KL+K+LR+QGLKG  Y+ + GD+K+  K
Sbjct  1     MEATSAIFGCIILLIMLVWAWKMLHWLWLRPKKLEKLLREQGLKGNPYRLLVGDMKEFFK  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
             S   A+SKP+NLSDDI  R  P+    + K+G+NSF+W GP P V + DPELVK+VF K 
Sbjct  61    SEMKARSKPMNLSDDIVSRVFPYGQQTVTKHGKNSFIWFGPTPRVILTDPELVKDVFNKM  120

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
               FQKP SNPL +LLA G+I HEE+KW  HRKIINP F +EKLK M+P  + SC++M+++
Sbjct  121   YDFQKPNSNPLIRLLATGLITHEEEKWRMHRKIINPAFHLEKLKMMLPVIFESCNDMINK  180

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WE+ +   G  E+DVWP +Q LASDVI+RTAFGSSYEEG +IF+LQ+EQ    ++I   +
Sbjct  181   WERMLSSDGSCEIDVWPSIQNLASDVIARTAFGSSYEEGIRIFQLQKEQAEITMEILMKV  240

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF-EE  950
             YIPGWRFLPT  NRR+K+I++ + AS+  II+KR  A++ GE   +DLLGILLESN  E 
Sbjct  241   YIPGWRFLPTTTNRRLKEIDRVIIASLTKIINKRENAIKAGETPKNDLLGILLESNHKEI  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              E N NKN GM   +VI+ECKLFYLAG+ETTS LLVWTM+LLS H  WQ R
Sbjct  301   KENNNNKNVGMNIDDVIKECKLFYLAGEETTSVLLVWTMILLSRHPNWQAR  351



>gb|KHN14193.1| Secologanin synthase [Glycine soja]
Length=518

 Score =   402 bits (1032),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 185/340 (54%), Positives = 253/340 (74%), Gaps = 1/340 (0%)
 Frame = +3

Query  87    IAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPIN  266
             I I+ L   WR+LNW W RP++L+++LR+QGL+G  Y+ + GDLK+I    ++  SKP+N
Sbjct  12    ILILALTLAWRVLNWLWLRPKRLERLLREQGLQGNPYRLLVGDLKEIMNMQKEVTSKPMN  71

Query  267   LSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPL  446
             LS DI PR   F    +  +G+NSF+W G KP V I +PEL+K+V  K   F KP ++PL
Sbjct  72    LSHDIVPRVFSFLQHTLNTHGKNSFIWFGRKPRVIITEPELIKDVLNKMHDFPKPDTSPL  131

Query  447   SKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLA  626
              KLLA G++ HE +KW KHR+II+P F +EKLK+M+P FY SC++++ +WE+ +   G  
Sbjct  132   VKLLATGLLNHEGEKWNKHRRIISPAFNLEKLKNMLPIFYKSCNDLIIKWEEMLSSDGSC  191

Query  627   ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTK  806
             E+DVWP+LQ L+SD I+RTAFGSSYEEG KIF+L +EQ    ++    +YIPGWRFLPT 
Sbjct  192   EIDVWPFLQNLSSDAIARTAFGSSYEEGRKIFQLLKEQAELAMKAIMKLYIPGWRFLPTA  251

Query  807   RNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN-KNFGM  983
              +RRMK+I++++ AS+ D+I  R KA++ GEA+ +DLLGILLESN +E E++GN KN GM
Sbjct  252   NHRRMKEIDREIKASLTDMISNREKALKAGEATENDLLGILLESNHKETEEHGNSKNVGM  311

Query  984   TTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +  +VIEECKLFY AGQETTS+LLVWTMVLLS + +WQ R
Sbjct  312   SLEDVIEECKLFYFAGQETTSALLVWTMVLLSRYPDWQAR  351



>ref|XP_009339349.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=532

 Score =   402 bits (1033),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 187/334 (56%), Positives = 248/334 (74%), Gaps = 1/334 (0%)
 Frame = +3

Query  105   VCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDIS  284
              C WR+LNW W RP+KL+K LRQQGL G  Y+   GDLK+IS  +++A SKP+N S D +
Sbjct  34    ACAWRVLNWVWLRPKKLEKCLRQQGLAGNSYRLWSGDLKEISMMLKEAVSKPMNHSHDTA  93

Query  285   PRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQ  464
             PR LP+   ++   G+NSF+W+GP P V I +PE +KN+FTKH  F K  +NPL KLL  
Sbjct  94    PRVLPYAHQSVSTYGKNSFIWIGPTPRVNITNPEDLKNIFTKHEDFPKLTANPLVKLLLT  153

Query  465   GVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWP  644
             G+  +  +KW KHRKIINP F  EKLK M+PA Y SCSEM+ EWE  V  +   ELDVWP
Sbjct  154   GLANYGGEKWAKHRKIINPAFHSEKLKRMLPAIYQSCSEMIEEWESLVSKESSYELDVWP  213

Query  645   YLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMK  824
             YLQ + +DVISRT+FGSSY+EG +IF+L + Q+   ++   S+YIPGWRFLPTK N+R+K
Sbjct  214   YLQNMTADVISRTSFGSSYKEGREIFQLLKLQIELTMKTKQSVYIPGWRFLPTKMNKRLK  273

Query  825   QIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKN-FGMTTREVI  1001
              ++K++   +M II+KR +A++ GEA+ DDLLG+LLESN +EI+++GNK   GM+ ++++
Sbjct  274   GVDKEIRELLMGIINKREEAIKAGEAAKDDLLGLLLESNNKEIKEHGNKKEVGMSIQDIL  333

Query  1002  EECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              ECKLFY AGQETTS+LLVWTMVLLS +Q WQ R
Sbjct  334   GECKLFYFAGQETTSTLLVWTMVLLSENQNWQDR  367



>ref|XP_006598136.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X2 [Glycine 
max]
Length=389

 Score =   397 bits (1020),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 189/335 (56%), Positives = 252/335 (75%), Gaps = 3/335 (1%)
 Frame = +3

Query  108   CLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISP  287
             C W++L W W RP++L+K+LR+QGL+G  Y    GD K+  K  ++A SKP+NLSDDI P
Sbjct  19    CAWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNLSDDIIP  78

Query  288   RALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQG  467
             R   +   ++ K+G+NSF+WLGP P V I DPE +K+VF K   F KP  NPL KLLA G
Sbjct  79    RVSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLATG  138

Query  468   VIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPY  647
             +  +E +KW KHR+IINP F +EKLK M+P F+ SC++++S+WE  +  +G  E+D WP+
Sbjct  139   LAGYEGEKWSKHRRIINPAFNLEKLKIMLPLFFKSCNDLVSKWEGMLSSEGSCEMDAWPF  198

Query  648   LQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQ  827
             LQ LASDVI+R+AFGSSYEEG +IF+LQREQ   ++++   I IPGWRFLPT  +RRMK+
Sbjct  199   LQNLASDVIARSAFGSSYEEGRRIFQLQREQAELLIKVLLKIQIPGWRFLPTNTHRRMKE  258

Query  828   IEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG---NKNFGMTTREV  998
             I++ + AS+ D+I+KR KA++ GEA+ +DLLGILLESN +EI+++G   NKN GM+  EV
Sbjct  259   IDRDIKASLKDMINKREKALKAGEATKNDLLGILLESNHKEIQEHGNRNNKNVGMSLEEV  318

Query  999   IEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IEECKLFY AGQETTS LLVWTMVLLS + +WQ R
Sbjct  319   IEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQAR  353



>ref|XP_009594690.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   401 bits (1031),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 191/344 (56%), Positives = 251/344 (73%), Gaps = 5/344 (1%)
 Frame = +3

Query  75    IGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKS  254
             I F I I+ L   WR +NW W +P+ L+K L++ G +G  YK ++GD+K++    E+AKS
Sbjct  9     ISFVIIIILLRWGWRFMNWLWLQPKCLEKCLKELGFRGNSYKLLYGDMKEVVMMDEEAKS  68

Query  255   KPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP  434
             KPI  S DI PR +PF    I   G+NSF+WL P P + I DPEL++ + +K  IFQKPP
Sbjct  69    KPIKFSHDIVPRIMPFIHKTIIDYGKNSFIWLWPTPAMLITDPELIREILSKSNIFQKPP  128

Query  435   SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD  614
                 +KLL +G++ +E DKW KHR+IINP F ++KLKHMIP+F+LS  EMLSEWEK    
Sbjct  129   PTAHTKLLVEGILSYEADKWAKHRRIINPAFHLDKLKHMIPSFHLSTCEMLSEWEKVASA  188

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRF  794
             +G +E+DVWPYLQ L SD ISRTAFGSSYEEG KIFELQ+E    +L+++ S YI    F
Sbjct  189   EG-SEVDVWPYLQSLTSDAISRTAFGSSYEEGRKIFELQQELAKIILKVTESSYI---MF  244

Query  795   LPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEA-SPDDLLGILLESNFEEIEQNGNK  971
             LPTK NRRMKQI ++V + ++ II+KR+ A+   EA + DDLLGILL+SN +EI+++GNK
Sbjct  245   LPTKENRRMKQIYQEVRSLVLGIINKRMDAIEAREAFNNDDLLGILLDSNLKEIKEHGNK  304

Query  972   NFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              FGM+  EVIEECKLFY AGQETTS+LL W+M++LS H +WQ R
Sbjct  305   KFGMSLDEVIEECKLFYFAGQETTSALLTWSMIVLSKHSDWQAR  348



>gb|AHK60841.1| CYP72A225 [Catharanthus roseus]
Length=538

 Score =   402 bits (1033),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 204/365 (56%), Positives = 266/365 (73%), Gaps = 6/365 (2%)
 Frame = +3

Query  27    HYSETHTEMMEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFI  206
             H  +     M++ +  I       FL+  W+MLNWAW +P+KL+K LRQ GLKG  Y+ +
Sbjct  9     HMFQIRNREMDVFYRGISVLGTCFFLLLAWKMLNWAWIKPKKLEKRLRQLGLKGNSYRLL  68

Query  207   FGDLKKISKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPE  386
              GDL + S+  ++AKSKPIN ++ I PR +PF    IQ +G+N F+W GP P V I DPE
Sbjct  69    IGDLGETSQMDKEAKSKPINFTNHIIPRIMPFLHKIIQSHGKNPFIWQGPNPAVIITDPE  128

Query  387   LVKNVFTKHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFY  566
             L+K V TK+  +QKPPS+ L KL++QGV  +++DKW KHR+++NP F +EKLKHM+PAF+
Sbjct  129   LIKEVLTKNYTYQKPPSDDLGKLISQGVAAYDKDKWAKHRRLLNPAFHIEKLKHMLPAFH  188

Query  567   LSCSEMLSEWEK--NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQ  740
             LSCSEML +WEK  +   +G  ELDVWPYLQ + SDVISRTAFGS+ EEG  IF+LQ+E 
Sbjct  189   LSCSEMLKKWEKLASASAEGSFELDVWPYLQDMTSDVISRTAFGSNLEEGKNIFKLQKEI  248

Query  741   VGYVLQISSSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLL  920
             + ++LQI  S Y PG  +LPTKR RRMK+I K+VH+S+++II KRV+AM+ GE S DDLL
Sbjct  249   LEHILQILQSFYFPGMLYLPTKRIRRMKKISKEVHSSVLNIIMKRVEAMKAGEPSNDDLL  308

Query  921   GILLESNFEEIEQNGNKNF----GMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQ  1088
             GILL+SNF+EIE +   N     GM+  EVIEECKLFY AGQETT+ LLVWT++LLS H 
Sbjct  309   GILLDSNFKEIENDNGNNSNKNCGMSFEEVIEECKLFYFAGQETTAVLLVWTLLLLSKHP  368

Query  1089  EWQTR  1103
             EWQ R
Sbjct  369   EWQMR  373



>ref|XP_006364094.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=517

 Score =   401 bits (1030),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 193/343 (56%), Positives = 254/343 (74%), Gaps = 4/343 (1%)
 Frame = +3

Query  81    FSIAIVFLVC-LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSK  257
             FS AI+ ++   WR+LN+ WF+P+KL+K LRQQG KG  YK ++GD+K++ K +E+A SK
Sbjct  13    FSFAIILVLGWAWRILNYVWFKPKKLEKQLRQQGFKGNSYKLLYGDMKEMKKMIEEATSK  72

Query  258   PINLSDD-ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP  434
             PI+ S D I PR  PF    I   G+N FVW GPKP V I +P+L+K V TK+ ++QK  
Sbjct  73    PIDFSHDLIWPRINPFIHKTITNYGKNCFVWFGPKPAVLITEPKLIKEVLTKNYVYQKAR  132

Query  435   SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD  614
              +PL KL   G+  HE+DKW  HR+I+NP F ++KLKHM+PAF L+ +EML+ W++ +  
Sbjct  133   GSPLLKLAISGLAAHEKDKWATHRRILNPAFHIDKLKHMLPAFKLTVNEMLNIWKEVISK  192

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRF  794
              G  E+DVWPYLQ L SD ISRTAFGS+YEEG K FELQ+EQ+  + +++ SIYIPGWRF
Sbjct  193   DG-TEIDVWPYLQTLTSDAISRTAFGSNYEEGKKNFELQKEQIELISKMTHSIYIPGWRF  251

Query  795   LPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKN  974
             +PTK+N+RM QI  +V A I+ II+KR++ +  GE S DDLL ILL SN +EI+Q+GNK 
Sbjct  252   VPTKKNKRMMQIFYEVKALILGIINKRMRMIEAGE-SHDDLLSILLTSNLKEIQQHGNKK  310

Query  975   FGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             FGM+  EVIEECKLFY AGQETTS+LLVWTM+LL  +  WQ R
Sbjct  311   FGMSIDEVIEECKLFYFAGQETTSTLLVWTMILLCKYPIWQER  353



>ref|XP_009339348.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=525

 Score =   401 bits (1030),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 195/357 (55%), Positives = 260/357 (73%), Gaps = 7/357 (2%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVC-LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME   G I  ++ +V +V   W +LNW WFRP+KL++ LRQQGL G  Y+ +FGDLK+IS
Sbjct  1     MEASLGSIALTVVLVSIVAWAWSLLNWVWFRPKKLERYLRQQGLAGNSYRLLFGDLKEIS  60

Query  231   KSVEDAKSKPIN-LSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
                + A+SKPIN LS DI P  LPF    +   G+NSF+W+GP   V I +PE +++V  
Sbjct  61    MMHKQARSKPINHLSHDIVPHILPFLHQTVITYGKNSFIWMGPTLRVNILNPEDLRDVLN  120

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             ++  F+KP SNP++K+L+QG++  + +KW KHRKIINP F ++KLK M+P FY SCSEM+
Sbjct  121   RYDDFRKPLSNPITKVLSQGLVNIDGEKWTKHRKIINPAFHLDKLKFMVPIFYQSCSEMI  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQV---GYVLQ  758
               WE  V ++GL ELDVWP+LQ LA DVISR AFGSSYEEG KIF+L +EQ      +L+
Sbjct  181   DTWENLVANEGLFELDVWPWLQSLAGDVISRAAFGSSYEEGKKIFQLLKEQARIGATLLR  240

Query  759   ISSSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGG-EASPDDLLGILLE  935
              ++S+YIPGWRFLP+K N+RMK+I + +   IMDII+KR + ++ G + + DDLL +LLE
Sbjct  241   SATSVYIPGWRFLPSKMNKRMKEINRVIKVLIMDIINKRERTIKAGDDINKDDLLRMLLE  300

Query  936   SNFEEIEQNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             SN  EI+++G NKN GM+  EVIEECKLFY  GQETT++LLVW MVLLS +Q WQ R
Sbjct  301   SNSNEIKEHGNNKNLGMSIEEVIEECKLFYFVGQETTAALLVWAMVLLSHNQNWQNR  357



>gb|KHN36820.1| Secologanin synthase [Glycine soja]
Length=496

 Score =   400 bits (1027),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 185/329 (56%), Positives = 251/329 (76%), Gaps = 1/329 (0%)
 Frame = +3

Query  120   MLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRALP  299
             MLNW W RP++L+++LR+QGL+G  Y+ + GDLK+I K   +A+SKP+NLS DI PR   
Sbjct  1     MLNWLWIRPKRLERLLREQGLQGNPYRILVGDLKEIVKLQMEARSKPMNLSHDIVPRVFA  60

Query  300   FFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGVIFH  479
                 ++ K+G+NSF+W GPKP V + DPEL+K+V  K + F+KP +NPL+KLLA G++ +
Sbjct  61    HLHQSVLKHGKNSFIWFGPKPRVTLTDPELIKDVLNKISDFRKPEANPLAKLLATGLVNY  120

Query  480   EEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQQL  659
             + +KW KHR++INP F +EKLK M+P F+ SC++++ +WE  +   G  E+DVWP+LQ L
Sbjct  121   DGEKWNKHRRLINPAFSLEKLKIMLPIFFKSCNDLIIKWEGMLSSDGSCEMDVWPFLQNL  180

Query  660   ASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQIEKQ  839
             ASDVI+RTAFGSS+EEG +IF+LQ+E     +++   +YIPGWRF+PT  NRRMK+I++ 
Sbjct  181   ASDVIARTAFGSSFEEGKRIFQLQKELAELTMKVIMKVYIPGWRFVPTATNRRMKEIDRY  240

Query  840   VHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI-EQNGNKNFGMTTREVIEECKL  1016
             + AS+MD+I KR KA + GEA+ DDLLGILLESN +EI E   NKN GM   +VIEECKL
Sbjct  241   IKASLMDMIKKREKAPKTGEATRDDLLGILLESNHKEIQEHRNNKNVGMNLNDVIEECKL  300

Query  1017  FYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             FY AGQETTS LLVWTMVLLS + +WQ+R
Sbjct  301   FYFAGQETTSVLLVWTMVLLSRYPDWQSR  329



>ref|XP_006598137.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   400 bits (1029),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 186/335 (56%), Positives = 253/335 (76%), Gaps = 3/335 (1%)
 Frame = +3

Query  108   CLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISP  287
             C W++LNW W RP++L+K+LR+QG +G  Y   FGD K+  K  ++A SKP+ LSDDI P
Sbjct  19    CSWKVLNWLWLRPKRLEKLLREQGFRGNPYTLFFGDSKEFLKMRKEAVSKPMTLSDDIVP  78

Query  288   RALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQG  467
             R   +   ++ K+G+NSF+W GP P V I DPE +K+VF K+  F KP  NPL KLLA G
Sbjct  79    RVSAYVQHSVNKHGKNSFIWFGPMPRVTILDPEQIKDVFNKNYDFPKPNLNPLVKLLATG  138

Query  468   VIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPY  647
             +  +E +KW KHR+IINP F +EKLK M+P F  SC++++S+WE  +  +G  E+D WP+
Sbjct  139   LAGYEGEKWSKHRRIINPAFNLEKLKIMLPLFLQSCNDLVSKWEGMLSSEGSCEMDAWPF  198

Query  648   LQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQ  827
             LQ L SDVI+R+AFGSSYEEG +IF+LQREQ  +++++   I IPGWRFLPTK +RRMK+
Sbjct  199   LQNLTSDVIARSAFGSSYEEGRRIFQLQREQTEHLMKVILKIQIPGWRFLPTKTHRRMKE  258

Query  828   IEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN---KNFGMTTREV  998
             I++++ AS+ ++I+KR KA++ GEA+ +DLLGILLESN +EI+++GN   KN GM+  +V
Sbjct  259   IDREIKASLKNMINKREKALKSGEATKNDLLGILLESNHKEIQEHGNRNSKNVGMSLEDV  318

Query  999   IEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IEECKLFY AGQETTS LLVWTMVLLS + +WQ R
Sbjct  319   IEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQAR  353



>ref|XP_008386388.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=519

 Score =   400 bits (1029),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 187/334 (56%), Positives = 248/334 (74%), Gaps = 1/334 (0%)
 Frame = +3

Query  105   VCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDIS  284
              C WR+LNW W RP+KL+K LRQQGL G  Y+   GDLK+IS  +++A SKP+NLS D +
Sbjct  21    ACAWRVLNWVWLRPKKLEKCLRQQGLAGNSYRLWSGDLKEISMMLKEAVSKPMNLSHDTA  80

Query  285   PRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQ  464
             PR +P+   ++   G+NSF+W+GP P V I +PE +KN+FTKH  F KP  +PL KLL  
Sbjct  81    PRVVPYAHQSVSTYGKNSFIWIGPTPRVNITNPEDLKNIFTKHEDFPKPALSPLVKLLLT  140

Query  465   GVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWP  644
             G+  +  +KW KHRKII P F  EKLK M+PA Y SCSEM+ EWE  V  +   ELDVWP
Sbjct  141   GLANYGGEKWAKHRKIIKPAFHSEKLKRMLPAIYQSCSEMIEEWESLVSKESSYELDVWP  200

Query  645   YLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMK  824
             YLQ + +DVISRT+FGSSY+EG +IF+L + Q+   +++  S+YIPGWRFLPTK N+R+K
Sbjct  201   YLQNMTADVISRTSFGSSYKEGREIFQLLKLQIELTVKMKHSVYIPGWRFLPTKTNKRLK  260

Query  825   QIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN-KNFGMTTREVI  1001
             +++K++    M II+KR +A++ GEA+ DDLLG+LLESN +EI+++GN K  GM+ ++V+
Sbjct  261   EVDKEIRELFMGIINKREEAIKAGEAAKDDLLGLLLESNNKEIKEHGNKKKVGMSIQDVL  320

Query  1002  EECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              ECKLFY AGQETTS LLVWTMVLLS +Q WQ R
Sbjct  321   GECKLFYFAGQETTSILLVWTMVLLSENQNWQDR  354



>gb|KEH38478.1| cytochrome P450 family 72 protein [Medicago truncatula]
Length=518

 Score =   400 bits (1028),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 185/351 (53%), Positives = 257/351 (73%), Gaps = 1/351 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             M     ++ F +  + L+  W++LNW W +P+KL+K LR+QGLKG  Y+ + GD++ + K
Sbjct  1     MATTTAIVLFILMTLSLIWAWKILNWLWLKPKKLEKFLREQGLKGNSYRLLVGDIRDLLK  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
               ++  SKP+NLSDDI+PR   +F  ++ K G+NSF+W GP P V I DPEL+K V  K 
Sbjct  61    MRKETTSKPMNLSDDIAPRVFSYFHHSVAKYGKNSFMWFGPTPRVNISDPELIKYVLNKI  120

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
               FQKP ++PL +LLA G++  E +KW KHRK+INP F +EKLK M+P F+ SC +++++
Sbjct  121   YDFQKPNASPLVRLLANGLVNLEGEKWSKHRKLINPAFNIEKLKIMLPIFFKSCDDLITK  180

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WE+ +   G  ELDVWP+LQ LASDVISRTAFGSSYEEG +IF+LQ EQ     ++   +
Sbjct  181   WERMLSSDGSCELDVWPFLQNLASDVISRTAFGSSYEEGKRIFQLQIEQAELTKKVMIQV  240

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI  953
             +IPGWRFLPT  +RRMK+I++++ AS+ D+I+KR  A++ GEA+ DDLLGILLE N +E+
Sbjct  241   FIPGWRFLPTSTHRRMKEIDREIKASLTDMINKREIALKAGEATKDDLLGILLELNHKEM  300

Query  954   EQ-NGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             E+ + NK+ GM+  +VIEECKLFY AGQETTS LLVW M+LLS + +WQ R
Sbjct  301   EEHDNNKDVGMSLDDVIEECKLFYFAGQETTSVLLVWAMMLLSRYPDWQAR  351



>ref|XP_008452436.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=529

 Score =   400 bits (1028),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 247/333 (74%), Gaps = 3/333 (1%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             W++++W WFRP+KL+K+LRQQG  G  Y+ ++GDLK+ +   + A SKP+N S+ I+PR 
Sbjct  28    WKLVDWIWFRPKKLEKLLRQQGFTGNSYRILYGDLKERAAMRDQAISKPMNFSNHIAPRV  87

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPS--NPLSKLLAQG  467
             +P     IQ  G+NSF+W+GP P V I DPE +K VF+    +QKP +  NPL+KLLA G
Sbjct  88    IPSVHHTIQHYGKNSFMWIGPIPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLADG  147

Query  468   VIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPY  647
             ++ HE  KWVKHRKIINP F +EKLK M+PAFY SC EM+S+WE  V  QG  ELDV PY
Sbjct  148   LLNHEGHKWVKHRKIINPAFHLEKLKDMVPAFYHSCDEMISKWESMVSVQGSCELDVMPY  207

Query  648   LQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQ  827
             LQ + +DVISRTAFGSSYE+G KIF+LQ E    V++ +  IYIPGWRFLPTK N +MK 
Sbjct  208   LQNMTADVISRTAFGSSYEKGKKIFKLQTELAEMVIRSTLGIYIPGWRFLPTKSNNKMKV  267

Query  828   IEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTTREVIE  1004
             I K++   IM II++R  +M+ GEA+  DLL IL+ESN  EI+Q+G NK+ GM+  +VI+
Sbjct  268   ISKEISTLIMGIINERETSMKAGEATQTDLLSILMESNLNEIKQHGNNKDIGMSIEDVID  327

Query  1005  ECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ECKLFY+AGQETT++LL WTMVLLS + EWQ R
Sbjct  328   ECKLFYIAGQETTATLLTWTMVLLSSYSEWQER  360



>ref|XP_008226213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   400 bits (1027),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 192/351 (55%), Positives = 247/351 (70%), Gaps = 6/351 (2%)
 Frame = +3

Query  60    IVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSV  239
             +   ++  SI I +    WR+LNW W RP+KL+K LR+QGL G  Y+ +FGD K +SK +
Sbjct  9     VALCVVWVSIVITWA---WRVLNWVWLRPKKLEKCLREQGLAGNSYRLLFGDTKDLSKML  65

Query  240   EDAKSKPINLS--DDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
             E  +SKPI LS   DI+P   PFF   +   G+NSFVW+GP P V I +PE +K+ F +H
Sbjct  66    EQTQSKPIKLSTSHDIAPHVTPFFHQTVNSYGKNSFVWMGPIPRVHIMNPEDLKDTFNRH  125

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
               F K   NP+ K L QG++  E ++W KHRKIINP F +EKLK M+P FY SCSEM+++
Sbjct  126   DDFHKVVKNPIMKSLPQGIVGIEGEQWAKHRKIINPAFHLEKLKGMVPIFYRSCSEMINK  185

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WE  V  +   ELDVWPYL+   SDVISR AFGSSYEEG KIF+L RE+         S+
Sbjct  186   WESLVSKESSCELDVWPYLENFTSDVISRAAFGSSYEEGRKIFQLLREEAKIYTVAMRSV  245

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI  953
             YIPGWRFLPTK+N++ K+I  ++   +  II+KR +AM+ GEA+ DDLLGIL+ESNF EI
Sbjct  246   YIPGWRFLPTKQNKKAKEIHNEIKGLLKGIINKREEAMKAGEATKDDLLGILMESNFREI  305

Query  954   EQNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +++G NKN GM+  +VI ECKLFY AGQETTS LLVWTMVLLS +Q+WQ R
Sbjct  306   QEHGNNKNAGMSIEDVIGECKLFYFAGQETTSVLLVWTMVLLSQNQDWQAR  356



>ref|XP_007212438.1| hypothetical protein PRUPE_ppa016770mg [Prunus persica]
 gb|EMJ13637.1| hypothetical protein PRUPE_ppa016770mg [Prunus persica]
Length=506

 Score =   399 bits (1026),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 195/331 (59%), Positives = 249/331 (75%), Gaps = 1/331 (0%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             WR+LNW W RP+KL++ LRQQGL G  Y+ + GD K+ S  V++AKSKP+NLS DI+PR 
Sbjct  11    WRVLNWVWLRPKKLERCLRQQGLAGNSYRLLVGDTKESSMMVKEAKSKPMNLSHDITPRV  70

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGVI  473
             LPF   ++   G+N F+W+GP P V I +P  VK+VFT +  FQKP  NPL K LA G+ 
Sbjct  71    LPFLHQSVTTYGKNFFIWIGPTPRVNISNPADVKDVFTNYEDFQKPVINPLVKFLATGLP  130

Query  474   FHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQ  653
              +E +KW KHRKIINP F +EKLK M+PAF+ SCSEM+ +WE+ V  +G  ELDVWPYL+
Sbjct  131   NYEGEKWAKHRKIINPAFHLEKLKRMLPAFHQSCSEMIEKWERLVSKEGSCELDVWPYLE  190

Query  654   QLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQIE  833
              LA+DVISR +FGSSY+EG KIF+L +EQ    ++   S YIPGWRFLPT+ N+RMK I+
Sbjct  191   SLAADVISRASFGSSYQEGRKIFQLLKEQAKLTIRALQSFYIPGWRFLPTRSNKRMKAID  250

Query  834   KQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN-KNFGMTTREVIEEC  1010
             K++  S+ DII  R +A+R GEA+ DDLLGIL+ESN +EI +NGN KN GM+  +VIEEC
Sbjct  251   KEIKGSLRDIISTREEAIRMGEAAKDDLLGILMESNLKEIRENGNTKNVGMSIEDVIEEC  310

Query  1011  KLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             KLFY AGQETTS LL+WT+VLLS +Q WQ R
Sbjct  311   KLFYFAGQETTSVLLLWTLVLLSQNQNWQAR  341



>gb|KHN44056.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   399 bits (1026),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 186/335 (56%), Positives = 252/335 (75%), Gaps = 3/335 (1%)
 Frame = +3

Query  108   CLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISP  287
             C W++LNW W RP++L+K+LR+QG +G  Y   FGD K+  K  ++A SKP+ LSDDI P
Sbjct  19    CSWKVLNWLWLRPKRLEKLLREQGFRGNPYTLFFGDSKEFLKMRKEAVSKPMTLSDDIVP  78

Query  288   RALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQG  467
             R   +   ++ K+G+NSF+W GP P V I DPE +K+VF K+  F KP  NPL KLLA G
Sbjct  79    RVSAYVQHSVNKHGKNSFIWFGPMPRVTILDPEQIKDVFNKNYDFPKPNLNPLVKLLATG  138

Query  468   VIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPY  647
             +  +E +KW KHR+IINP F +EKLK M+P F  SC++++S+WE  +  +G  E+D WP+
Sbjct  139   LAGYEGEKWSKHRRIINPAFNLEKLKIMLPLFLQSCNDLVSKWEGMLSSEGSCEMDAWPF  198

Query  648   LQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQ  827
             LQ L SDVI+R+AFGSSYEEG +IF+LQREQ   ++++   I IPGWRFLPTK +RRMK+
Sbjct  199   LQNLTSDVIARSAFGSSYEEGRRIFQLQREQTELLMKVILKIQIPGWRFLPTKTHRRMKE  258

Query  828   IEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN---KNFGMTTREV  998
             I++++ AS+ ++I+KR KA++ GEA+ +DLLGILLESN +EI+++GN   KN GM+  +V
Sbjct  259   IDREIKASLKNMINKREKALKSGEATKNDLLGILLESNHKEIQEHGNRNSKNVGMSLEDV  318

Query  999   IEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IEECKLFY AGQETTS LLVWTMVLLS + +WQ R
Sbjct  319   IEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQAR  353



>ref|XP_004488668.1| PREDICTED: secologanin synthase-like [Cicer arietinum]
Length=519

 Score =   399 bits (1026),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 196/352 (56%), Positives = 262/352 (74%), Gaps = 1/352 (0%)
 Frame = +3

Query  51    MMEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             M  +   +I F++ I+ L   WRMLNW W +P+KL+K+LR+QG KG  Y+ + GD++ + 
Sbjct  1     MATVTTAIILFTLTILSLTWAWRMLNWLWLKPKKLEKLLREQGFKGNSYRLLVGDVRDLL  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
             K+ ++A SKP+NLSDDI PR   +   ++ K G+NSF+W GP P V I DPE +K+V  K
Sbjct  61    KTRKEATSKPMNLSDDIGPRVFSYVHHSVTKYGKNSFMWFGPIPRVNITDPEQIKDVLNK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                F+KP SNPL +LLA G++ +E +KW KHRKIINP F +EKLK M+P F+ SC +++S
Sbjct  121   IYDFRKPNSNPLVRLLANGLVSYEGEKWNKHRKIINPAFHLEKLKIMLPIFFKSCDDLIS  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +WEK +  +G  E+DVWP+LQ LASDVISRTAFGSS+EEG +IF+LQ EQ     QI   
Sbjct  181   KWEKMLSLEGSCEMDVWPFLQNLASDVISRTAFGSSFEEGKRIFQLQIEQAELTKQIMMK  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRFLPT  ++RMK+I++ + AS+ D+I+KR KA++ GEA+ DDLLGILLESN  E
Sbjct  241   VYIPGWRFLPTTTHKRMKEIDRDIKASLTDMINKREKALKAGEATKDDLLGILLESNHRE  300

Query  951   IEQNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +E++G NKN GM+  +VIEECKLFY AGQETTS LLVWTMV LS + +WQ R
Sbjct  301   MEEHGNNKNVGMSLEDVIEECKLFYFAGQETTSVLLVWTMVCLSRYPDWQAR  352



>emb|CDP15979.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   399 bits (1026),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 187/344 (54%), Positives = 248/344 (72%), Gaps = 0/344 (0%)
 Frame = +3

Query  72    LIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAK  251
             +   S AI  +   W++  W W  P+KL+K+LRQQG +G  Y  + GD+  +S  ++ A 
Sbjct  15    VTALSSAIFLVALAWKLFKWVWLNPKKLEKLLRQQGFRGNSYIPVLGDVIAMSTLLKQAH  74

Query  252   SKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKP  431
             SKPINLSDDI PR +P ++D ++K+G+N+++W GP+P V I+DPEL++       +F KP
Sbjct  75    SKPINLSDDIVPRIIPEYLDLVKKHGKNTYIWYGPEPSVCIQDPELIREASQNINLFHKP  134

Query  432   PSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVG  611
               N L++LLA G+I +  DKW KHRK+INP F  EKLK M+P+F  S + ML +WE+ + 
Sbjct  135   VVNQLTRLLAPGLISYNGDKWAKHRKLINPAFHGEKLKLMLPSFCTSATAMLRKWEEIIS  194

Query  612   DQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWR  791
               G  ELDVWP L+ L+SD ISRTAFGS+YEEG  IFELQ EQ    ++   S+ IPGWR
Sbjct  195   PTGFCELDVWPSLRSLSSDAISRTAFGSNYEEGRVIFELQGEQCELCIKALWSMLIPGWR  254

Query  792   FLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNK  971
             FLPTKRNRRM QI K V  SI +II+ R+  +R GE   DD LG+LL+SN +EI+++GNK
Sbjct  255   FLPTKRNRRMGQIFKDVTDSIREIINSRLNEIRAGEFGDDDFLGLLLQSNSQEIDRHGNK  314

Query  972   NFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +FGMT  EVIEEC+LFY+AGQETTS LLVWT++LLS+HQEWQTR
Sbjct  315   DFGMTIEEVIEECRLFYVAGQETTSVLLVWTLILLSVHQEWQTR  358



>ref|XP_008226215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Prunus 
mume]
Length=518

 Score =   399 bits (1026),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 189/333 (57%), Positives = 240/333 (72%), Gaps = 3/333 (1%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLS--DDISP  287
             WR+LNW W RP+KL+K LR+QGL G  Y+ +FGD K +SK +E  +SKPI LS   DI+P
Sbjct  21    WRVLNWVWLRPKKLEKCLREQGLAGNSYRLLFGDTKDLSKMLEQTQSKPIKLSTSHDIAP  80

Query  288   RALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQG  467
                PFF   +   G+NSFVW+GP P V I +PE +K+ F +H  F K   NP+ K L QG
Sbjct  81    HVTPFFHQTVNSYGKNSFVWMGPIPRVHIMNPEDLKDTFNRHDDFHKVVKNPIMKSLPQG  140

Query  468   VIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPY  647
             ++  E ++W KHRKIINP F +EKLK M+P FY SCSEM+++WE  V  +   ELDVWPY
Sbjct  141   IVGIEGEQWAKHRKIINPAFHLEKLKGMVPIFYRSCSEMINKWESLVSKESSCELDVWPY  200

Query  648   LQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQ  827
             L+   SDVISR AFGSSYEEG KIF+L RE+         S+YIPGWRFLPTK+N++ K+
Sbjct  201   LENFTSDVISRAAFGSSYEEGRKIFQLLREEAKIYTVAMRSVYIPGWRFLPTKQNKKAKE  260

Query  828   IEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTTREVIE  1004
             I  ++   +  II+KR +AM+ GEA+ DDLLGIL+ESNF EI+++G NKN GM+  +VI 
Sbjct  261   IHNEIKGLLKGIINKREEAMKAGEATKDDLLGILMESNFREIQEHGNNKNAGMSIEDVIG  320

Query  1005  ECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ECKLFY AGQETTS LLVWTMVLLS +Q+WQ R
Sbjct  321   ECKLFYFAGQETTSVLLVWTMVLLSQNQDWQAR  353



>gb|AIA82924.1| SLS1 [Gentiana rigescens]
Length=519

 Score =   399 bits (1025),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 187/341 (55%), Positives = 246/341 (72%), Gaps = 1/341 (0%)
 Frame = +3

Query  81    FSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKP  260
             F      L   + +LNW WF+P+K++K L++QGLKG  Y+ ++GDLK++ K+++ A S+P
Sbjct  13    FVTGAAALYVAYEVLNWVWFKPKKIEKQLQEQGLKGNPYRLLYGDLKEMQKTLKKACSQP  72

Query  261   I-NLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPS  437
             +   S    PR +P + D + K G+N + W GP+  V + DPE +K V  K+ +F KP S
Sbjct  73    VKGFSHAFEPRVIPLYQDVVHKYGKNGYAWFGPEASVIVMDPESIKEVTLKYDVFNKPHS  132

Query  438   NPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQ  617
             NPLSKLL +GV+ +E DKWVKHRKIINP F  +KLKHM+P+F+ S  E +S W+  V ++
Sbjct  133   NPLSKLLLRGVVSYEGDKWVKHRKIINPAFHQDKLKHMLPSFHTSAMETVSIWDAMVAEK  192

Query  618   GLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFL  797
             G  E+DV PYLQ L SD ISRTAFGS+YEEG +IFELQREQ   V+    S+YIPGWRFL
Sbjct  193   GSTEVDVLPYLQTLTSDAISRTAFGSNYEEGKRIFELQREQAELVVIALRSLYIPGWRFL  252

Query  798   PTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNF  977
             PTK NRRMK I K V+ SI  I+ +R+KAM  G A  DDLLG LLESNF+E++++G K  
Sbjct  253   PTKMNRRMKSISKVVNNSIGIIVSERIKAMEAGVACEDDLLGTLLESNFKEMDEHGKKEV  312

Query  978   GMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQT  1100
             G++ ++VIEECKLFY AGQETTS+LLVWTMVLLS +  WQT
Sbjct  313   GLSIQDVIEECKLFYFAGQETTSTLLVWTMVLLSKYSHWQT  353



>ref|XP_004166890.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=524

 Score =   399 bits (1025),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 191/331 (58%), Positives = 246/331 (74%), Gaps = 1/331 (0%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             W++++W WFRP+KL+K+LR+QG  G  Y+ + GDLK+ +   ++A SKP+N S+ I+PR 
Sbjct  29    WKIVDWIWFRPKKLEKLLRRQGFTGNSYRILHGDLKESAAMRKEAMSKPMNFSNHIAPRV  88

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGVI  473
             +P     IQ  G+NSF+WLGP P V I DPE +K VF+    FQKP  NPL++LL QG+ 
Sbjct  89    IPSVYHTIQIYGKNSFMWLGPMPRVHIMDPEQIKTVFSFINDFQKPTMNPLTRLLVQGIA  148

Query  474   FHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQ  653
               E +KW KHRKIINP F +EKLK M+PAFY SC+EM+S+WE  V  +G  ELDV P L+
Sbjct  149   NLEGEKWAKHRKIINPAFHLEKLKDMVPAFYHSCNEMVSKWESMVSREGSCELDVMPCLK  208

Query  654   QLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQIE  833
              +ASDVISRTAFGSSYE+G KIF+LQ E    V+Q S  IYIPGW FLPTK NR+MK+I 
Sbjct  209   NMASDVISRTAFGSSYEKGXKIFKLQTELGNLVIQASLGIYIPGWSFLPTKSNRKMKEIS  268

Query  834   KQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTTREVIEEC  1010
             K++   I+ I+++R K+M  GEA   DLL IL+ESN  EI+Q+G NK+ GM+  EVIEEC
Sbjct  269   KEITTLILGIMNEREKSMNAGEAIQTDLLSILMESNMNEIKQHGNNKDIGMSIEEVIEEC  328

Query  1011  KLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             KLFY+AGQETT++LLVWTMVLLS + EWQ R
Sbjct  329   KLFYIAGQETTATLLVWTMVLLSSYSEWQER  359



>ref|XP_008452438.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=521

 Score =   399 bits (1024),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/332 (58%), Positives = 247/332 (74%), Gaps = 2/332 (1%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             W++++W WFRP+KL+KILR+QG  G  Y+ + GDLK+ +   E+A SKP+N S+ I+PR 
Sbjct  25    WKLVDWIWFRPKKLEKILRRQGFAGNSYRILHGDLKESAAMREEAMSKPMNFSNHIAPRV  84

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGVI  473
             +P     IQ  G+ S +WLGP P V I DPE +K VF+    FQKP  NPL++LL QG+ 
Sbjct  85    IPSVYHTIQLYGKKSMMWLGPMPRVHIMDPEQLKIVFSSINDFQKPTMNPLTRLLVQGLA  144

Query  474   FHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSC-SEMLSEWEKNVGDQGLAELDVWPYL  650
               E  KWVKHRKIINP F +EKLK M+PAFY SC +EM+S+WE  V  +G  ELDV PYL
Sbjct  145   SLEGQKWVKHRKIINPAFHVEKLKDMVPAFYHSCYNEMVSKWEGMVSREGSCELDVMPYL  204

Query  651   QQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQI  830
             Q +ASDVISRTAFGSSYE+G KIFELQ E    V+Q +  IYIPGWRFLPTK NR+MK+I
Sbjct  205   QNMASDVISRTAFGSSYEKGKKIFELQTELANLVIQANLGIYIPGWRFLPTKSNRKMKEI  264

Query  831   EKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTTREVIEE  1007
              K++   I+ I++++ K+++ GEA   DLL IL+ESN  EI+Q+G NKN GM+  +VIEE
Sbjct  265   SKEITTLILGIMNEKEKSIKAGEAIQTDLLSILMESNMNEIKQHGNNKNIGMSIEDVIEE  324

Query  1008  CKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             CKLFY+AGQETT++LLVWTMVLLS + EWQ R
Sbjct  325   CKLFYIAGQETTATLLVWTMVLLSSYSEWQER  356



>ref|XP_003546751.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like isoform X1 [Glycine 
max]
Length=520

 Score =   398 bits (1022),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 189/335 (56%), Positives = 252/335 (75%), Gaps = 3/335 (1%)
 Frame = +3

Query  108   CLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISP  287
             C W++L W W RP++L+K+LR+QGL+G  Y    GD K+  K  ++A SKP+NLSDDI P
Sbjct  19    CAWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNLSDDIIP  78

Query  288   RALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQG  467
             R   +   ++ K+G+NSF+WLGP P V I DPE +K+VF K   F KP  NPL KLLA G
Sbjct  79    RVSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLATG  138

Query  468   VIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPY  647
             +  +E +KW KHR+IINP F +EKLK M+P F+ SC++++S+WE  +  +G  E+D WP+
Sbjct  139   LAGYEGEKWSKHRRIINPAFNLEKLKIMLPLFFKSCNDLVSKWEGMLSSEGSCEMDAWPF  198

Query  648   LQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQ  827
             LQ LASDVI+R+AFGSSYEEG +IF+LQREQ   ++++   I IPGWRFLPT  +RRMK+
Sbjct  199   LQNLASDVIARSAFGSSYEEGRRIFQLQREQAELLIKVLLKIQIPGWRFLPTNTHRRMKE  258

Query  828   IEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG---NKNFGMTTREV  998
             I++ + AS+ D+I+KR KA++ GEA+ +DLLGILLESN +EI+++G   NKN GM+  EV
Sbjct  259   IDRDIKASLKDMINKREKALKAGEATKNDLLGILLESNHKEIQEHGNRNNKNVGMSLEEV  318

Query  999   IEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IEECKLFY AGQETTS LLVWTMVLLS + +WQ R
Sbjct  319   IEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQAR  353



>gb|AJD25172.1| cytochrome P450 CYP72A331 [Salvia miltiorrhiza]
Length=516

 Score =   398 bits (1022),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 191/351 (54%), Positives = 254/351 (72%), Gaps = 4/351 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             MEI++ ++    A       W+ L   WF PRKL+K LRQ+G  G  Y+F+ GD K+I+ 
Sbjct  3     MEILYSILALFCAAFLSHNAWKFLTRVWFEPRKLEKRLRQEGFSGNSYRFMIGDSKQIA-  61

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
             + + A SKPI  S+DI+PR +PF   ++ K GEN F+W G KP + I D E+ K + +K+
Sbjct  62    AAKQANSKPIAFSNDIAPRVIPFIHHSLLKYGENCFIWYGSKPTIVILDQEMTKEILSKN  121

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
              +FQK  S PL KLLAQGV  +E DKW KHR+++NP F +EKLK M+P FYLSC EMLS+
Sbjct  122   YVFQKT-STPLDKLLAQGVATYEADKWAKHRRLLNPAFHLEKLKLMLPLFYLSCGEMLSK  180

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
              EK +  +G+ E+DVWP+LQ L SDVISRTAFGS+YEEG KIFEL +EQ   + +    +
Sbjct  181   LEKIIPSEGVCEVDVWPHLQALTSDVISRTAFGSNYEEGGKIFELLKEQGALLFKAFQML  240

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEAS-PDDLLGILLESNFEE  950
             YIPGWRFLPT+ N+RMK+I  +V + ++ II+KR++ +  GE +   DLLGILLESNF+E
Sbjct  241   YIPGWRFLPTRTNKRMKEIAMEVDSLVLGIINKRMQMIEAGEVTESSDLLGILLESNFKE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             I++NG +  GM+ REVI+ECKLFYLAGQETTS+LLVWTM+LLS H +WQ R
Sbjct  301   IQKNG-EYLGMSLREVIDECKLFYLAGQETTSALLVWTMILLSKHPDWQAR  350



>ref|XP_007213922.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
 gb|EMJ15121.1| hypothetical protein PRUPE_ppa004271mg [Prunus persica]
Length=519

 Score =   398 bits (1022),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 193/331 (58%), Positives = 252/331 (76%), Gaps = 1/331 (0%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             WR+LNW W RP+KL++ LRQQGL G  Y+ + GD K+ S  +++AKSKP++L  D++PR 
Sbjct  24    WRVLNWVWLRPKKLERCLRQQGLAGNSYRLLIGDTKESSMMLKEAKSKPMDLFHDLAPRV  83

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGVI  473
             LPF   ++   G+NSF+W+GP P V I +PE +K++F K+  FQKP  NPL KLLA G+ 
Sbjct  84    LPFVHQSMNTYGKNSFIWIGPTPRVNISNPEDMKDIFAKYEDFQKPVKNPLVKLLATGLA  143

Query  474   FHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQ  653
              +E +KW KHRKIINP F  EKLK M+PAF+ SCSE++ EWE     +G  ELDVWPYLQ
Sbjct  144   NYEGEKWAKHRKIINPAFHSEKLKRMLPAFHQSCSELIEEWESLASKEGSCELDVWPYLQ  203

Query  654   QLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQIE  833
              L +DVISRTAFGSSYEEG KIF+L ++Q    ++   S+YIPGWRFLPT+ N+RMK+I+
Sbjct  204   NLTADVISRTAFGSSYEEGRKIFQLLKDQAQLTIKAIQSVYIPGWRFLPTRMNKRMKEID  263

Query  834   KQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN-KNFGMTTREVIEEC  1010
             K++  S+M II+KR +A+R  EA+ DDLLGIL++SN +EI +NGN KN GM+  +VIEEC
Sbjct  264   KEIKGSLMGIINKREEAIRVREATRDDLLGILMDSNLKEIRENGNTKNVGMSIEDVIEEC  323

Query  1011  KLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             KLFY AGQETTS LLVWT+VLLS +Q+WQ R
Sbjct  324   KLFYFAGQETTSVLLVWTLVLLSQNQDWQAR  354



>ref|XP_004146005.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=530

 Score =   398 bits (1022),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 246/333 (74%), Gaps = 3/333 (1%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             W++++W WFRP+KL+K+LRQQG  G  Y+ + GDLK+ +   + A SKP+N S+ I+PR 
Sbjct  29    WKLVDWIWFRPKKLEKLLRQQGFTGNSYRILHGDLKESAAMRDQAISKPMNFSNYIAPRV  88

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPS--NPLSKLLAQG  467
             +P     IQ  G+NSF+W+GP P V I DPE +K VF+    +QKP +  NPL+KLLA G
Sbjct  89    IPSVHHTIQHYGKNSFMWIGPMPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLADG  148

Query  468   VIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPY  647
             ++ HE  KWVKHRKIINP F +EKLK M+PAFY SC EM+S+WE  V  +G  ELDV PY
Sbjct  149   LLNHEGQKWVKHRKIINPAFHLEKLKDMVPAFYHSCDEMISKWESMVSVEGFCELDVMPY  208

Query  648   LQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQ  827
             LQ + +DVISRTAFGSSYE+G KIF+LQ E    V+Q +  IYIPGWRFLPTK N +MK 
Sbjct  209   LQNMTADVISRTAFGSSYEKGKKIFKLQTELGEMVMQSTLGIYIPGWRFLPTKSNNKMKV  268

Query  828   IEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTTREVIE  1004
             I K++   IMDII++R  +M+ GEA   DLL IL+ESN  EI+Q+G NK+ GM+  +VI+
Sbjct  269   ISKEISTLIMDIINERETSMKSGEAIQTDLLSILMESNLNEIKQHGNNKDIGMSIEDVID  328

Query  1005  ECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ECKLFY+AGQETT++LL WTMVLLS + +WQ R
Sbjct  329   ECKLFYIAGQETTATLLTWTMVLLSSYSDWQER  361



>gb|KHN47456.1| Secologanin synthase [Glycine soja]
Length=537

 Score =   398 bits (1022),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 185/331 (56%), Positives = 242/331 (73%), Gaps = 1/331 (0%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINL-SDDISPR  290
             W+MLNW W RP++L+++LR+QGL+G  Y    GDLK+  K   +A SKP+NL S DI+PR
Sbjct  40    WKMLNWLWLRPKRLERLLREQGLQGNSYTLFVGDLKEFGKMRNEALSKPMNLFSHDIAPR  99

Query  291   ALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGV  470
              L F    + K+G+NSF+W GP P V + DPE +K+V  K   F KP  NP  +LLA G+
Sbjct  100   VLSFIQHTVNKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFGKPDMNPHVRLLAPGL  159

Query  471   IFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYL  650
             + HE +KW KHRKIINP F +EKLK+M+P F   C +++S+WE  +   G +E D+WP+ 
Sbjct  160   VSHEGEKWSKHRKIINPAFNLEKLKNMLPLFIKCCDDLISKWEGMLSSDGTSETDIWPFF  219

Query  651   QQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQI  830
             Q LASDVISRTAFGSSYEEG +IF+L +EQ    +Q    + IPGWRF+PT  +RRMK+I
Sbjct  220   QNLASDVISRTAFGSSYEEGRRIFQLLKEQTELTIQTFLKVNIPGWRFVPTTTHRRMKEI  279

Query  831   EKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFGMTTREVIEEC  1010
              K + AS+MD+I+KR  A++ GEA+ ++LL ILLESN +EI++ GNKN GM   EVIEEC
Sbjct  280   NKDIEASLMDMINKRETALKAGEATKNNLLDILLESNHKEIQEQGNKNVGMNLEEVIEEC  339

Query  1011  KLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             KLFY AGQETTS LLVWTM+LLSM+ +WQTR
Sbjct  340   KLFYFAGQETTSVLLVWTMILLSMYPDWQTR  370



>ref|XP_003543171.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Glycine max]
Length=537

 Score =   398 bits (1022),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 185/331 (56%), Positives = 242/331 (73%), Gaps = 1/331 (0%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINL-SDDISPR  290
             W+MLNW W RP++L+++LR+QGL+G  Y    GDLK+  K   +A SKP+NL S DI+PR
Sbjct  40    WKMLNWLWLRPKRLERLLREQGLQGNSYTLFVGDLKEFGKMRNEALSKPMNLFSHDIAPR  99

Query  291   ALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGV  470
              L F    + K+G+NSF+W GP P V + DPE +K+V  K   F KP  NP  +LLA G+
Sbjct  100   VLSFIQHTVNKHGKNSFIWFGPIPRVTLTDPEQIKDVLNKIYDFGKPDMNPHVRLLAPGL  159

Query  471   IFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYL  650
             + HE +KW KHRKIINP F +EKLK+M+P F   C +++S+WE  +   G +E D+WP+ 
Sbjct  160   VSHEGEKWSKHRKIINPAFNLEKLKNMLPLFIKCCDDLISKWEGMLSSDGTSETDIWPFF  219

Query  651   QQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQI  830
             Q LASDVISRTAFGSSYEEG +IF+L +EQ    +Q    + IPGWRF+PT  +RRMK+I
Sbjct  220   QNLASDVISRTAFGSSYEEGRRIFQLLKEQTELTIQTFLKVNIPGWRFVPTTTHRRMKEI  279

Query  831   EKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFGMTTREVIEEC  1010
              K + AS+MD+I+KR  A++ GEA+ ++LL ILLESN +EI++ GNKN GM   EVIEEC
Sbjct  280   NKDIEASLMDMINKRETALKAGEATKNNLLDILLESNHKEIQEQGNKNVGMNLEEVIEEC  339

Query  1011  KLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             KLFY AGQETTS LLVWTM+LLSM+ +WQTR
Sbjct  340   KLFYFAGQETTSVLLVWTMILLSMYPDWQTR  370



>ref|XP_009790240.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Nicotiana 
sylvestris]
Length=512

 Score =   397 bits (1019),  Expect = 6e-131, Method: Compositional matrix adjust.
 Identities = 188/344 (55%), Positives = 250/344 (73%), Gaps = 5/344 (1%)
 Frame = +3

Query  75    IGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKS  254
             I F I I+     WR +NW W +P+ L+K LR+ G +G  YK ++GD+K++    E+AKS
Sbjct  8     ISFVIIIILYRWGWRFMNWLWLQPKCLEKCLRELGFRGNSYKLLYGDMKEVVMMDEEAKS  67

Query  255   KPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP  434
             KPI  S DI PR +PF    I   G+ SF+WLGP P + I DPEL++ + +K  IFQKPP
Sbjct  68    KPIKFSHDIVPRIMPFIQKTIIDYGKKSFIWLGPTPALLIMDPELIREILSKSNIFQKPP  127

Query  435   SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD  614
                 +KLLA+G++ +E DKW KHR+IIN  F ++KLKHM+P+F+L   EMLS+WEK V  
Sbjct  128   PTAQTKLLAEGILSYEADKWAKHRRIINHAFHLDKLKHMVPSFHLCTCEMLSKWEKIVSA  187

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRF  794
             +G +E+DVWPYLQ L SD ISRTAFG+SYEEG K+FELQ+E    +L+++ S YI   +F
Sbjct  188   EG-SEVDVWPYLQSLTSDAISRTAFGNSYEEGRKMFELQQELAKIILKVTESSYI---KF  243

Query  795   LPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEAS-PDDLLGILLESNFEEIEQNGNK  971
             LP K +RRMKQI ++V + ++ II+KR+ A+  GEAS  DDLLGILLESN +EI+++ NK
Sbjct  244   LPNKEDRRMKQIYQEVRSLVLGIINKRMNAIEAGEASNNDDLLGILLESNLKEIQEHRNK  303

Query  972   NFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              FGM+  EVIEECKLFY AGQETTS+LL W+M++LS H EWQ R
Sbjct  304   KFGMSMDEVIEECKLFYFAGQETTSALLTWSMIVLSKHSEWQAR  347



>ref|XP_008226214.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Prunus 
mume]
Length=518

 Score =   397 bits (1019),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 190/333 (57%), Positives = 247/333 (74%), Gaps = 3/333 (1%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLS--DDISP  287
             WR+LNW W RP+KL++ LR+QGL G  YK +FGD K+ S  ++ A+SKPI LS   DI+P
Sbjct  21    WRVLNWVWLRPKKLERSLREQGLTGNSYKLLFGDTKESSMMLDQAQSKPIKLSTSHDIAP  80

Query  288   RALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQG  467
             R +PF    +   G+NSFVW+GP P V I +PE +K +F K   F++P +NP+  LLAQG
Sbjct  81    RVMPFVHQTVNTYGKNSFVWMGPIPKVNIMNPEDLKEIFNKDQNFRRPSANPMIDLLAQG  140

Query  468   VIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPY  647
             ++  E+ KW KHRKII+P F +EKLK M+P FY SCSEM++EWE+ V  +G  ELDVWP 
Sbjct  141   LLAFEDGKWAKHRKIIHPAFHLEKLKGMLPTFYQSCSEMINEWERLVSKEGSCELDVWPC  200

Query  648   LQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQ  827
             LQ L++D+ISR AFGSSY+EG KIF+L REQ  +      S+YIPG RFLPTK+N+RMK+
Sbjct  201   LQTLSADMISRAAFGSSYQEGRKIFQLLREQEKFYATAIQSVYIPGSRFLPTKQNKRMKK  260

Query  828   IEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN-KNFGMTTREVIE  1004
             I +++   +  II+KR +AM+ GEAS  DLLGIL+ESN +EI ++GN +N GM+  +VIE
Sbjct  261   IYEEISVLLKGIINKREEAMKLGEASKHDLLGILMESNLKEIREHGNHRNTGMSLEDVIE  320

Query  1005  ECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ECKLFYLAGQETTS LLVW MVLLS +Q WQ R
Sbjct  321   ECKLFYLAGQETTSVLLVWAMVLLSQNQNWQAR  353



>ref|XP_004244382.2| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=511

 Score =   396 bits (1018),  Expect = 9e-131, Method: Compositional matrix adjust.
 Identities = 187/345 (54%), Positives = 253/345 (73%), Gaps = 3/345 (1%)
 Frame = +3

Query  72    LIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAK  251
             LI FS  +V ++ +WRM+NW W RPRK++K  R+QGL G  Y+ ++GD K+++K  + AK
Sbjct  4     LICFSALLVTMIWMWRMVNWVWIRPRKIEKCFRKQGLNGHPYRTLYGDTKEMAKLTKQAK  63

Query  252   SKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKP  431
              KP+ L+DDI  R LPF+   + K G N F+W+GP+P +FI +PEL++++   + IF+KP
Sbjct  64    LKPMKLTDDILTRVLPFYHYTLNKYGNNCFIWIGPEPRIFIMEPELIRDIVMNNNIFKKP  123

Query  432   PSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVG  611
                PL +LL  G+  +E+ KW KHRKI+N  F  EKLK+M+PA + SC +M+++WE  + 
Sbjct  124   KPTPLVQLLVSGISSYEDQKWAKHRKILNTAFYTEKLKYMVPAMHKSCEDMMNKWEILIC  183

Query  612   DQGLA-ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGW  788
             ++  + ELDV PY + L SDVISRTAFGSSY+EG KIF LQ+E      Q   S+YIPGW
Sbjct  184   NKNKSCELDVHPYFEDLTSDVISRTAFGSSYQEGMKIFHLQKELAELTRQAFQSVYIPGW  243

Query  789   RFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN  968
             RFLPT+RNRRMK I+ ++  ++  I++KR ++M  GE   +DLLGILL+SN  EI+QNG 
Sbjct  244   RFLPTRRNRRMKGIDNELKDTLRKIVNKRERSMNLGETQ-EDLLGILLKSNVNEIQQNGT  302

Query  969   KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             K FGMTT EVIEECKLFY AGQET+S+LLVWTMVLLS+HQ WQTR
Sbjct  303   K-FGMTTDEVIEECKLFYFAGQETSSNLLVWTMVLLSVHQNWQTR  346



>ref|XP_006364091.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=510

 Score =   396 bits (1018),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 190/351 (54%), Positives = 256/351 (73%), Gaps = 7/351 (2%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             M+ +   I F+I +V  +  WR+LNW W +PR L+K LR+ G +G  Y+ + GD+ ++ K
Sbjct  1     MQYISLTIAFAIILVIFL-RWRLLNWLWLQPRPLEKCLRELGFRGNSYRLLVGDMNEVVK  59

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
               E+AKSKPI  S DI PR +PF    I   G+NSF+WLGP P + I +PE ++ + +K 
Sbjct  60    MDEEAKSKPIKFSHDIVPRLMPFIHKTIIDYGKNSFIWLGPNPAMLIMEPEHIREILSKS  119

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
              IFQKPP   L+KLLA+G++ +E DKW KHR+IINP F ++KLKHM+P+F+L+  EMLS+
Sbjct  120   NIFQKPPP-ALTKLLAEGILSYEADKWAKHRRIINPAFHLDKLKHMVPSFHLTTCEMLSK  178

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WEK V  +G +E+DVWPYLQ L SD ISRTAFGSSYEEG KI ELQ+E    +++ + + 
Sbjct  179   WEKIVSTEG-SEVDVWPYLQTLTSDAISRTAFGSSYEEGRKIHELQQELAKIIVKETEAS  237

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEAS-PDDLLGILLESNFEE  950
             YI   RFLPTK  RRM ++ ++V + ++ II+KR+  +  GE S  DDLLGILLESN +E
Sbjct  238   YI---RFLPTKEKRRMNRLHQEVRSLVLRIINKRMNEIEAGETSNSDDLLGILLESNLKE  294

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             I+++GNK FGM+  EVIEECKLFYLAGQETTS+LLVW+M+LLS H +WQ R
Sbjct  295   IQEHGNKKFGMSIDEVIEECKLFYLAGQETTSALLVWSMILLSKHSDWQAR  345



>dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta]
Length=518

 Score =   396 bits (1018),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 194/350 (55%), Positives = 252/350 (72%), Gaps = 3/350 (1%)
 Frame = +3

Query  60    IVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSV  239
             I+F L+     I      W+   W W  PRKL+K LR+QG+KG  YKF+ G+LK I  + 
Sbjct  5     ILFTLLVTCAVIYISSWAWKAFVWVWLNPRKLEKCLREQGIKGPSYKFLSGNLKDIVSAT  64

Query  240   EDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT-KHT  416
             ++A++KP+ LS  I PR +PF    ++K G+ SF+W GP   V I DP++++++ + K  
Sbjct  65    QEARAKPMELSHKIVPRVMPFVHQTVEKYGKLSFIWYGPYCRVNIMDPDMIRDILSNKFG  124

Query  417   IFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEW  596
              F+K  +NPL KLL  GV+ +E +KWVKHR+I+NP F +EKLK M+PA Y SCSEM+++W
Sbjct  125   HFEKIRTNPLGKLLISGVVSYEGEKWVKHRRILNPAFHLEKLKMMLPAIYTSCSEMVNKW  184

Query  597   EKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIY  776
             E  V  Q   ELDVWP+LQ L +DVISRTAFGSSYEEG +IF+LQ EQ G V++   SIY
Sbjct  185   EMMV-SQDSCELDVWPHLQNLTADVISRTAFGSSYEEGRRIFQLQSEQAGLVIKALQSIY  243

Query  777   IPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIE  956
             IPG RFLPTKRN RMK+I  +    + DI++KR KAM+ GEA  DDLLG+L+ESNF+EI 
Sbjct  244   IPGLRFLPTKRNNRMKEIYGEARVLLRDIVNKREKAMKIGEAHNDDLLGLLMESNFKEIT  303

Query  957   QNGN-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              N N KNFGMT  EVI+ECKLFY AGQETTS+LLVWTMV+LSMH +WQ +
Sbjct  304   DNVNSKNFGMTIDEVIDECKLFYFAGQETTSTLLVWTMVVLSMHPDWQEK  353



>ref|XP_008226210.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   396 bits (1018),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 193/339 (57%), Positives = 253/339 (75%), Gaps = 1/339 (0%)
 Frame = +3

Query  90    AIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINL  269
             A V +   WR+LNW W RP+KL++ LRQQGL G  Y+ + GD K+ S  V++ KSKP++L
Sbjct  16    ASVIITWAWRVLNWVWLRPKKLERCLRQQGLAGNSYRLLIGDTKESSMMVKETKSKPMDL  75

Query  270   SDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLS  449
               D++PR LPF   ++   G+N F+W+GP P V I +P+ +K++F K+  FQKP +NPL 
Sbjct  76    CHDLAPRVLPFVHQSMNTYGKNFFIWIGPTPRVNISNPDDMKDIFAKYEDFQKPATNPLV  135

Query  450   KLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAE  629
              LLA G+  +E +KW KHRKIINP F  EKLK M+PAF+ SCSEM+ +WE     +G  E
Sbjct  136   NLLATGLSSYEGEKWAKHRKIINPAFHSEKLKRMLPAFHQSCSEMIEKWESLASKEGSCE  195

Query  630   LDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKR  809
             LDVWPYLQ L +DVISRTAFGSSYEEG KIF+L ++Q    ++   S+YIPGW FLPT+ 
Sbjct  196   LDVWPYLQNLTADVISRTAFGSSYEEGRKIFQLLKDQGQLTMKTIQSVYIPGWWFLPTRM  255

Query  810   NRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN-KNFGMT  986
             N+RMK+I+K++  S+M II+KR +A+R GEA+ DDLLGIL+ SN +EI +NGN KNFGM+
Sbjct  256   NKRMKEIDKEIKGSLMGIINKREEAIRVGEATKDDLLGILMASNLKEIRENGNTKNFGMS  315

Query  987   TREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
               +VIEECKLFY AGQETTS LLVWT+VLLS +Q+WQ R
Sbjct  316   IEDVIEECKLFYFAGQETTSVLLVWTLVLLSQNQDWQAR  354



>ref|XP_006495013.1| PREDICTED: secologanin synthase-like [Citrus sinensis]
Length=536

 Score =   397 bits (1019),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/331 (55%), Positives = 247/331 (75%), Gaps = 1/331 (0%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             W++LNWAW +P++++K LR+QG KG  Y+F+FGD+++ +   + AKSKPI+  DDI+PR 
Sbjct  41    WKILNWAWLKPKRVEKQLRKQGFKGNSYRFLFGDVREHAVLSKQAKSKPISFEDDIAPRV  100

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGVI  473
             +P +   ++  G+  + W+GP P++ I DP+ +K VFTK   FQKP SNPL K+L  G+ 
Sbjct  101   VPLYDQLVKLYGKICYWWVGPIPMINIMDPDQLKEVFTKINDFQKPKSNPLGKILTTGLA  160

Query  474   FHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQ  653
              HE +KW KHRKIINP F  EKLK M+PAF  SCSE++S+WE  +  +G  ELDVWPY+ 
Sbjct  161   SHEGEKWAKHRKIINPAFHQEKLKLMLPAFNQSCSEIISKWENLMSTEGSCELDVWPYIV  220

Query  654   QLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQIE  833
              L SDVISRTAFGS+YEEG +IF+LQ E     LQ   S+YIPGWR++PTKRNRRMK+++
Sbjct  221   NLTSDVISRTAFGSNYEEGIRIFQLQTELADLALQALQSVYIPGWRYVPTKRNRRMKELD  280

Query  834   KQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNF-GMTTREVIEEC  1010
             K++   + DII KR  AM+ GEA+ DDLLG+L+ESN +EI+++GN    G++  +VI+EC
Sbjct  281   KEIRVRLADIIRKREIAMKTGEAAKDDLLGLLMESNLKEIKEHGNNKLKGISRDDVIDEC  340

Query  1011  KLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             KLFY AGQETTS LL+WTMVLLS HQ+WQ  
Sbjct  341   KLFYFAGQETTSVLLLWTMVLLSKHQDWQAH  371



>gb|KHN44057.1| Secologanin synthase [Glycine soja]
Length=520

 Score =   396 bits (1017),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/335 (56%), Positives = 251/335 (75%), Gaps = 3/335 (1%)
 Frame = +3

Query  108   CLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISP  287
             C W++L W W RP++L+K+LR+QGL+G  Y    GD K+  K  ++A SKP+NLSDDI P
Sbjct  19    CAWKVLIWLWLRPKRLEKLLREQGLQGNPYTLFVGDSKEFLKMRKEALSKPMNLSDDIIP  78

Query  288   RALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQG  467
             R   +   ++ K+G+NSF+WLGP P V I DPE +K+VF K   F KP  NPL KLLA G
Sbjct  79    RVSSYEQHSVNKHGKNSFIWLGPIPRVTILDPEQIKDVFNKIYDFPKPNMNPLVKLLATG  138

Query  468   VIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPY  647
             +  +E +KW KHR+IINP F +EKLK M+P F+ SC++++S+WE  +  +G  E+D WP+
Sbjct  139   LAGYEGEKWSKHRRIINPAFNLEKLKIMLPLFFKSCNDLVSKWEGMLSSEGSCEMDAWPF  198

Query  648   LQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQ  827
             LQ LASDVI+R+AFGSSYEEG +IF+LQREQ   ++++   I IPGWRFLPT  +RRMK+
Sbjct  199   LQNLASDVIARSAFGSSYEEGRRIFQLQREQAELLIKVLLKIQIPGWRFLPTNTHRRMKE  258

Query  828   IEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG---NKNFGMTTREV  998
             I++ + AS+ D+I+KR KA++ GEA+ +DLLGILL SN +EI+++G   NKN GM+  EV
Sbjct  259   IDRDIKASLKDMINKREKALKAGEATKNDLLGILLASNHKEIQEHGNRNNKNVGMSLEEV  318

Query  999   IEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IEECKLFY AGQETTS LLVWTMVLLS + +WQ R
Sbjct  319   IEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQAR  353



>ref|XP_009394212.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=527

 Score =   396 bits (1018),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 181/339 (53%), Positives = 250/339 (74%), Gaps = 1/339 (0%)
 Frame = +3

Query  90    AIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINL  269
              ++FL    R+LNWAW+RPR+L++ LR QGL GT Y+F +GD+K+I +  ++A++KP+ L
Sbjct  19    GLLFLAWALRVLNWAWWRPRRLERALRAQGLNGTPYRFPYGDVKEILRLRKEARAKPMPL  78

Query  270   SDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT-KHTIFQKPPSNPL  446
             + +I PR LPFF  A+ + G+ SF W GP P V I DPELV+ V + K  IF KP  NPL
Sbjct  79    AHNIIPRLLPFFHRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKFGIFGKPTQNPL  138

Query  447   SKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLA  626
             S+  ++G+  +E +KWVKHR+I+NP F  EKLK M+PAF   CS+++  WE   G +   
Sbjct  139   SRFFSKGLFVYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCSDLMDRWENMAGSEACY  198

Query  627   ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTK  806
             ELDVWP LQ  + DVISRTAFGSSYEEG +IF+LQ EQ   V+Q+  ++Y+PG+RFLPT 
Sbjct  199   ELDVWPELQSFSGDVISRTAFGSSYEEGRQIFQLQSEQAELVIQVVQNLYVPGYRFLPTP  258

Query  807   RNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFGMT  986
             +N+R+K I++++ + +  II KR + ++ G+AS DDLLG+L+ESN + ++++GNKN GMT
Sbjct  259   KNKRIKAIDREIRSILRGIIKKREQDIKTGKASTDDLLGLLMESNMKHLQEDGNKNAGMT  318

Query  987   TREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             T +VIEECKLFY AGQETTS+LL WTM+ LSMH  WQ R
Sbjct  319   TEDVIEECKLFYFAGQETTSALLTWTMICLSMHPTWQVR  357



>ref|XP_010092744.1| Secologanin synthase [Morus notabilis]
 gb|EXB52089.1| Secologanin synthase [Morus notabilis]
Length=558

 Score =   397 bits (1019),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/363 (53%), Positives = 251/363 (69%), Gaps = 41/363 (11%)
 Frame = +3

Query  138   FRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRALPFFIDAI  317
              RP++L+K LR+QGLKG  Y+F+FGDLK+     ++A+SKPINLSDDI+ R  PF +  +
Sbjct  31    LRPKRLEKCLRKQGLKGNSYRFLFGDLKESISMYKEARSKPINLSDDITTRVFPFVLQTV  90

Query  318   QK----------------------------------------NGENSFVWLGPKPLVFIK  377
             QK                                        +G++SF+W+GP P V I 
Sbjct  91    QKYGMYLYSTQSGGQTVIFGTQGSQIDHKTLFNKRKAFSFPVSGKDSFMWIGPNPRVNIT  150

Query  378   DPELVKNVFTKHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIP  557
             +PE +K++F K   F KP +NPL +LLA G+  +E +KW KHRKIINP F +EKLKHM+P
Sbjct  151   NPEHLKDIFNKIGDFPKPHNNPLVELLATGLASYEGEKWAKHRKIINPAFHVEKLKHMLP  210

Query  558   AFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQRE  737
             AFYLSC+EML +WE  + ++G  E+DVWPYLQ +  DVISRTAFGSSYEEG +IF+LQRE
Sbjct  211   AFYLSCNEMLKKWESFLNNEGSCEIDVWPYLQNMTGDVISRTAFGSSYEEGRRIFQLQRE  270

Query  738   QVGYVLQISSSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDL  917
             Q    ++   ++Y+PGWRF PT  N+RMK+++ +V   + DII KR KAMR GEA  DDL
Sbjct  271   QAELAIKAIQTVYVPGWRFAPTTLNKRMKEVDHEVQGLLKDIIHKREKAMRAGEAPNDDL  330

Query  918   LGILLESNFEEIEQNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEW  1094
             LGIL+ESNF+EI+++G NKN G++ R+VIEECKLFY AGQETTS LLVWTMVLLS + +W
Sbjct  331   LGILMESNFKEIQEHGNNKNMGISIRDVIEECKLFYFAGQETTSVLLVWTMVLLSRYPDW  390

Query  1095  QTR  1103
             Q R
Sbjct  391   QAR  393



>ref|XP_006364093.1| PREDICTED: secologanin synthase-like [Solanum tuberosum]
Length=536

 Score =   396 bits (1017),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/343 (56%), Positives = 253/343 (74%), Gaps = 4/343 (1%)
 Frame = +3

Query  81    FSIAIVFLV-CLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSK  257
             FS AI+F++   WR+LN+ WF+P+KL+K LRQQG KG  YK ++GD+K++ K +E+A SK
Sbjct  32    FSFAIIFVLRWTWRILNYVWFKPKKLEKQLRQQGFKGNSYKLLYGDMKEMKKMIEEATSK  91

Query  258   PINLSDD-ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPP  434
             PI+ S D I PR  PF    I   G+N FVW+GPKP V I +P+L++ V TK+ ++ K  
Sbjct  92    PIDFSHDLIWPRINPFIHKTITNYGKNCFVWIGPKPAVLITEPKLIREVLTKNYVYHKAR  151

Query  435   SNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD  614
              +PLSKL+  G+  HE+DKW  HR+I+NP F ++KLKHM+PAF L+ +EML+ W+K V  
Sbjct  152   GSPLSKLVISGLAGHEKDKWATHRRILNPAFHLDKLKHMLPAFKLTVNEMLNTWKKVVSK  211

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRF  794
              G  E+DVWPYLQ L SD ISRTAFGS+YEEG K FELQ+EQ+  +L I + I I  +RF
Sbjct  212   DG-TEIDVWPYLQTLTSDAISRTAFGSNYEEGKKNFELQKEQIELILTIINVIMIMNYRF  270

Query  795   LPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKN  974
             +PTK+N+RM QI  +V A I+ II+KR++ +  GE S DDLL ILL SN +EI+Q+GNK 
Sbjct  271   VPTKKNKRMMQIFYEVKALILGIINKRMRMIEAGE-SHDDLLSILLTSNLKEIQQHGNKK  329

Query  975   FGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             FGM+  EVIEECKLFY AGQETTS+LLVWTM+LL  +  WQ R
Sbjct  330   FGMSIDEVIEECKLFYFAGQETTSTLLVWTMILLCKYPIWQER  372



>ref|XP_002263652.1| PREDICTED: cytochrome P450 CYP72A219-like [Vitis vinifera]
Length=516

 Score =   395 bits (1015),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 187/350 (53%), Positives = 254/350 (73%), Gaps = 1/350 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             MEI +  +    A   L   WR     W RPR+L++ LR+QGL G  Y+ + GD KK+S 
Sbjct  1     MEIAYDSVLIFCAFALLSLAWRAFYLVWLRPRRLERCLRRQGLMGNSYRPLHGDAKKVSI  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
              +++A S+PINLSDDI PR +PF    IQ+ G+NSF W+GP P V I  PEL++ VF + 
Sbjct  61    MLKEANSRPINLSDDIVPRVIPFLYKTIQQYGKNSFTWVGPIPRVNIMKPELIREVFLEA  120

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
               FQK   NPL+  L  G++ +E +KW KHRK++NP F +EKLK M PAF+LSC +M+S+
Sbjct  121   GRFQKQKPNPLANFLLTGLVSYEGEKWAKHRKLLNPAFHVEKLKLMSPAFHLSCRQMISK  180

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
              E+ V  +G  ELDVWP+L+ L +D +SRTAFGSSYEEG ++F+L +EQ    +++  S+
Sbjct  181   MEEMVSPEGSCELDVWPFLKNLTADALSRTAFGSSYEEGRRLFQLLQEQTYLTMEVFQSV  240

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI  953
             YIPGW +LPTKRN+RMK+I+K+++  + DII KR KAM+ G+ + +DLLGIL+ESN +EI
Sbjct  241   YIPGWWYLPTKRNKRMKKIDKEMNTLLNDIITKRDKAMKDGKTANEDLLGILMESNSKEI  300

Query  954   EQNGN-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQT  1100
             ++ GN KN G++ +EVIEECKLFYLAGQETTS+LL+WTMVLLS H  WQT
Sbjct  301   QEGGNSKNAGISMQEVIEECKLFYLAGQETTSNLLLWTMVLLSKHPNWQT  350



>ref|XP_009394213.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394214.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394215.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=522

 Score =   395 bits (1016),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 181/339 (53%), Positives = 250/339 (74%), Gaps = 1/339 (0%)
 Frame = +3

Query  90    AIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINL  269
              ++FL    R+LNWAW+RPR+L++ LR QGL GT Y+F +GD+K+I +  ++A++KP+ L
Sbjct  19    GLLFLAWALRVLNWAWWRPRRLERALRAQGLNGTPYRFPYGDVKEILRLRKEARAKPMPL  78

Query  270   SDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT-KHTIFQKPPSNPL  446
             + +I PR LPFF  A+ + G+ SF W GP P V I DPELV+ V + K  IF KP  NPL
Sbjct  79    AHNIIPRLLPFFHRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKFGIFGKPTQNPL  138

Query  447   SKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLA  626
             S+  ++G+  +E +KWVKHR+I+NP F  EKLK M+PAF   CS+++  WE   G +   
Sbjct  139   SRFFSKGLFVYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCSDLMDRWENMAGSEACY  198

Query  627   ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTK  806
             ELDVWP LQ  + DVISRTAFGSSYEEG +IF+LQ EQ   V+Q+  ++Y+PG+RFLPT 
Sbjct  199   ELDVWPELQSFSGDVISRTAFGSSYEEGRQIFQLQSEQAELVIQVVQNLYVPGYRFLPTP  258

Query  807   RNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFGMT  986
             +N+R+K I++++ + +  II KR + ++ G+AS DDLLG+L+ESN + ++++GNKN GMT
Sbjct  259   KNKRIKAIDREIRSILRGIIKKREQDIKTGKASTDDLLGLLMESNMKHLQEDGNKNAGMT  318

Query  987   TREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             T +VIEECKLFY AGQETTS+LL WTM+ LSMH  WQ R
Sbjct  319   TEDVIEECKLFYFAGQETTSALLTWTMICLSMHPTWQVR  357



>ref|XP_004169020.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=530

 Score =   396 bits (1017),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 189/333 (57%), Positives = 245/333 (74%), Gaps = 3/333 (1%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             W++++W WFRP+KL+K+LRQQG  G  Y+ + GDLK+ +   + A SKP+N S+ I+PR 
Sbjct  29    WKLVDWIWFRPKKLEKLLRQQGFTGNSYRILHGDLKERAAMRDQAISKPMNFSNYIAPRV  88

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPS--NPLSKLLAQG  467
             +P     IQ  G+NSF+W+GP P V I DPE +K VF+    +QKP +  NPL+KLLA G
Sbjct  89    IPSVHHTIQHYGKNSFMWIGPMPRVHIMDPEQLKTVFSLINDYQKPTASLNPLAKLLADG  148

Query  468   VIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPY  647
             ++ HE  KWVKHRKIINP F +EKLK M+PAFY SC EM+S+WE  V  +G  ELDV PY
Sbjct  149   LLNHEGQKWVKHRKIINPAFHLEKLKDMVPAFYHSCDEMISKWESMVSVEGFCELDVMPY  208

Query  648   LQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQ  827
             LQ + +DVISRTAFGSSYE+G + F+LQ E    V+Q +  IYIPGWRFLPTK N +MK 
Sbjct  209   LQNMTADVISRTAFGSSYEKGKRXFKLQTELGEMVMQSTLGIYIPGWRFLPTKSNNKMKV  268

Query  828   IEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTTREVIE  1004
             I K++   IMDII++R  +M+ GEA   DLL IL+ESN  EI+Q+G NK+ GM+  +VI+
Sbjct  269   ISKEISTLIMDIINERETSMKSGEAIQTDLLSILMESNLNEIKQHGNNKDIGMSIEDVID  328

Query  1005  ECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ECKLFY+AGQETT++LL WTMVLLS + EWQ R
Sbjct  329   ECKLFYIAGQETTATLLTWTMVLLSSYSEWQER  361



>ref|XP_004295683.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   395 bits (1015),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 189/347 (54%), Positives = 256/347 (74%), Gaps = 9/347 (3%)
 Frame = +3

Query  84    SIAIVFLVCL----WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAK  251
             ++++VF+  +    W +L+W WF+P+KL++ LRQQG +G  Y+  +GD+K+ +  V++AK
Sbjct  10    ALSLVFVSIIVRWAWSLLDWVWFKPKKLERCLRQQGFQGNAYRLFYGDMKENAIMVKEAK  69

Query  252   SKPINLSD--DISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQ  425
             SKP+NLS   DISPR +P     ++  G+NSFVW+GP P V I +PE +K+VF K + F 
Sbjct  70    SKPMNLSTSHDISPRVIPLLDQTVKTYGKNSFVWVGPLPRVNIMNPEDLKDVFAKPSDFP  129

Query  426   KPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKN  605
             KP SNPL KLL+ G+  +E +KW KHR+IINP F  EK+K M+PAFY SC++M+ EWE  
Sbjct  130   KPVSNPLIKLLSTGLANYEGEKWAKHRRIINPTFHSEKVKRMLPAFYQSCNDMIKEWETV  189

Query  606   VGDQGLA-ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
             V  +G + E+DVWP LQ L +DVISRTAFGSSY+EG KIFEL +EQ  Y ++    +YIP
Sbjct  190   VSKEGSSCEIDVWPSLQNLTADVISRTAFGSSYQEGQKIFELLKEQAVYAMKTVQRVYIP  249

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQN  962
             GWRF+PTK N+RMKQI +++   +  II+KR +A++ GEA+ DDLLG LLESN ++I+ +
Sbjct  250   GWRFVPTKMNKRMKQIHEEIRGLVEGIINKREQAIKAGEATKDDLLGALLESNMKDIQDH  309

Query  963   G--NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQ  1097
             G  NKN GM+  +VIEECKLFY AGQETTS LLVWTMVLL  +Q WQ
Sbjct  310   GKNNKNVGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLCQNQNWQ  356



>ref|XP_004135800.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=521

 Score =   394 bits (1012),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 188/333 (56%), Positives = 236/333 (71%), Gaps = 1/333 (0%)
 Frame = +3

Query  108   CLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISP  287
             C WR LNW W  P+KL+K LR+QG  G  Y+   GDLK +    E+AKSKP+N S DI+P
Sbjct  23    CGWRFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPMNFSHDIAP  82

Query  288   RALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQG  467
             R +P     I+K G+NSFVWLGP P VFI DPE +K   + +  FQKP  NPL KLL  G
Sbjct  83    RVIPSIHHTIEKYGKNSFVWLGPIPRVFIMDPEQLKAALSLYNDFQKPTINPLVKLLFDG  142

Query  468   VIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPY  647
             +I HE +KWVKHRKI+N  F  EKLK M+P  + SC+EM++ WEK V   G  ELDV PY
Sbjct  143   LINHEGEKWVKHRKIVNHAFHFEKLKDMVPTMFESCNEMINTWEKMVSKDGSCELDVMPY  202

Query  648   LQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQ  827
             LQ LA+DVISRTAFGS+YEEG  IF   +E +   +Q S+ +YIPG RFLPTK N RMK+
Sbjct  203   LQNLAADVISRTAFGSTYEEGKVIFNHFKELICLTIQASNIVYIPGRRFLPTKSNNRMKK  262

Query  828   IEKQVHASIMDIIDKRVKAMRGGEA-SPDDLLGILLESNFEEIEQNGNKNFGMTTREVIE  1004
             I K++   +M++IDKR + M+ GE    DDLLGILLESNF EI+++GN N GM+  ++IE
Sbjct  263   ITKEIKTMLMNVIDKRQRTMKEGETMQSDDLLGILLESNFNEIKEHGNVNLGMSINDLIE  322

Query  1005  ECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ECK+FY AGQETT+ LLVWTM+LL  + +WQ R
Sbjct  323   ECKIFYFAGQETTAVLLVWTMILLGSYTKWQDR  355



>ref|XP_004307203.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=543

 Score =   395 bits (1014),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 192/354 (54%), Positives = 255/354 (72%), Gaps = 5/354 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLV--CLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKI  227
             ME+ F +I  SI ++ +   C WR+LNW W +P+KL+K LRQQGL G  Y+ + GD+K+ 
Sbjct  26    MELSF-IIALSIVLLSIASSCAWRVLNWVWLKPKKLEKCLRQQGLAGNSYRVLIGDVKES  84

Query  228   SKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
              + +++A SKP+NLSDD +PR LPF    I K+G+NSF W G  P V I +P+ +  + T
Sbjct  85    FRVMKEACSKPMNLSDDAAPRVLPFLHQTITKHGKNSFTWFGTTPRVTIMNPDYLNEILT  144

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             K+  F++P + P+ KLL+ G+   E +KWVK RKIINP F +EKLK+M+PA Y SC++M+
Sbjct  145   KYDDFRRPHTAPVVKLLSYGLANLEGEKWVKQRKIINPAFHIEKLKNMLPAIYQSCTDMI  204

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             ++WE  V  +G  ELD+WP+LQ L+ DVISRTAFGSSYEEG  IFELQ+EQ   +++   
Sbjct  205   TKWEIMVSKEGSCELDIWPFLQNLSGDVISRTAFGSSYEEGRTIFELQKEQTELLIKALF  264

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGG-EASPDDLLGILLESNF  944
             S YIPG+RFLPTK NRRMK I K+V A++  II  +V+A+R G E + +DLLGILLESN+
Sbjct  265   SAYIPGFRFLPTKLNRRMKAISKEVEATMKRIISNKVEAIRAGDEDAKNDLLGILLESNW  324

Query  945   EEIEQ-NGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +EI Q  GNKN GM+  EVI ECKLFYLAG ETTS LL WTM+LL  +  WQ R
Sbjct  325   KEIRQYGGNKNLGMSIEEVIGECKLFYLAGAETTSILLTWTMILLCRYPNWQAR  378



>ref|XP_008450754.1| PREDICTED: cytochrome P450 CYP72A219-like [Cucumis melo]
Length=517

 Score =   393 bits (1010),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/351 (54%), Positives = 241/351 (69%), Gaps = 1/351 (0%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             M+    +I F   +  L C WR LNW W  P+KL+K LR+QG  G  Y+   GDL  +  
Sbjct  1     MDFRNSMIWFVFMVCLLRCGWRFLNWIWLTPKKLEKCLREQGFAGNPYRLYSGDLNDVVA  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
               E+AKSKP+N S DI PR +P     I+K G+NSF+WLGP P V I DPE +K   + +
Sbjct  61    MEEEAKSKPMNFSHDIVPRVIPSMHHTIKKYGKNSFMWLGPNPRVLIMDPEQLKAALSLY  120

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
               FQKP +NPL +LL  G+I HE +KWVKHRKIIN  F  EKLK M+P  + SC+EM+S+
Sbjct  121   NDFQKPTTNPLVRLLFDGLINHEGEKWVKHRKIINHAFHFEKLKDMVPTMFESCNEMISK  180

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WEK     G  ELDV PYLQ L +DVISRTAFGS+YEEG  IF   +E +  VLQ S+++
Sbjct  181   WEKMTSKDGSCELDVVPYLQSLTADVISRTAFGSTYEEGKIIFNHFKELIRLVLQASNTV  240

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEA-SPDDLLGILLESNFEE  950
             Y+PGWRFLPTK N RMK+I K++   +M+IIDKR + M+  E    DDLLGILLESN  E
Sbjct  241   YLPGWRFLPTKSNNRMKKITKEIKTILMNIIDKRQRTMKEDETMHSDDLLGILLESNSNE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             I+++GN N GM+  ++IEECK+FY AGQETT+ LLVWTMVLL  + +WQ R
Sbjct  301   IKEHGNVNIGMSINDLIEECKIFYFAGQETTAVLLVWTMVLLGSYTKWQDR  351



>emb|CDP15980.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   393 bits (1010),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/341 (56%), Positives = 250/341 (73%), Gaps = 0/341 (0%)
 Frame = +3

Query  81    FSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKP  260
              S   V L   W++ NW W +P+KL+K+L+QQG KG  Y+ +FGDLK IS S  +A+SKP
Sbjct  12    LSSCFVLLTLAWKLFNWIWLKPKKLEKLLKQQGFKGNPYRLLFGDLKDISNSAREARSKP  71

Query  261   INLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSN  440
             I+LSDDI PR +P F   +QK G  +++W GP+P +FI+DPEL++      T+F KP + 
Sbjct  72    ISLSDDIIPRIIPEFHKLVQKYGTKTYIWYGPEPAIFIQDPELLREAAQAITVFHKPDAG  131

Query  441   PLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQG  620
               ++LL  G+  +  DKW KHRK+INP F  EKLK M+PAF  S SEM+ +WE+ V  +G
Sbjct  132   QFTRLLTPGLASYNGDKWAKHRKLINPVFNGEKLKTMLPAFQTSASEMMRKWEEIVLPKG  191

Query  621   LAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLP  800
               ELD+WPYLQ++  D ISRTAFGS+YEE  KIFELQ EQ+ + ++   S++IPGWRFLP
Sbjct  192   SCELDIWPYLQRVTCDAISRTAFGSNYEEARKIFELQGEQLEHCVKAVWSMFIPGWRFLP  251

Query  801   TKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFG  980
             TKRNRRM+QIEK+V  SI  I++ R+KAMR GE+  DD LG LLESN +EI ++G+K  G
Sbjct  252   TKRNRRMRQIEKEVDDSIRRIVNSRLKAMRAGESCDDDFLGRLLESNSQEIHKHGSKGVG  311

Query  981   MTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             M+T+EV+EECKLFY AGQETTS LL+WTM+LLS +Q WQ R
Sbjct  312   MSTQEVVEECKLFYFAGQETTSVLLLWTMILLSRYQNWQKR  352



>ref|XP_007149362.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
 gb|ESW21356.1| hypothetical protein PHAVU_005G063900g [Phaseolus vulgaris]
Length=523

 Score =   392 bits (1008),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/332 (56%), Positives = 243/332 (73%), Gaps = 2/332 (1%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINL-SDDISPR  290
             W MLNW WF P++L+++LR+QGL+G  Y  + GD K  +K  ++A SKP+NL S DI PR
Sbjct  25    WMMLNWVWFTPKRLERLLREQGLQGNPYTLLVGDTKDFAKMRKEAFSKPMNLFSHDIVPR  84

Query  291   ALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGV  470
                FF  +I  +G+ SF+W GP P V I DPEL+K+V  K   F+K   NP  +LLA G+
Sbjct  85    VFSFFHHSINTHGKKSFMWFGPAPRVTITDPELIKDVLNKTYDFEKINMNPQVRLLAPGL  144

Query  471   IFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYL  650
             + HE +KW KHRKIINP F +EKLK M+P F   C +++  WEK     G +E+DVWP+L
Sbjct  145   VSHEGEKWSKHRKIINPAFNLEKLKDMLPLFVKCCDDLIGNWEKMSSSDGSSEMDVWPFL  204

Query  651   QQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQI  830
             Q LA D ISRTAFGSS+EEG +IF+L +EQ    +Q+   +YIPGWRF+PT  +RRMK I
Sbjct  205   QNLARDAISRTAFGSSFEEGRRIFQLLKEQTELTVQLMLKVYIPGWRFVPTPTHRRMKAI  264

Query  831   EKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTTREVIEE  1007
             +K++ AS+MDII+ + KA++ GEA+ +DLLGILLESN +EI+++G NKN GM   +VI E
Sbjct  265   DKEIKASLMDIINNKEKALKAGEATKNDLLGILLESNHKEIQEHGNNKNVGMNIEDVIGE  324

Query  1008  CKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             CKLFY AGQETTSSLLVWTM+LLSM+ +WQTR
Sbjct  325   CKLFYFAGQETTSSLLVWTMILLSMYPDWQTR  356



>ref|XP_004248201.1| PREDICTED: cytochrome P450 CYP72A219-like [Solanum lycopersicum]
Length=510

 Score =   392 bits (1007),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 189/347 (54%), Positives = 253/347 (73%), Gaps = 9/347 (3%)
 Frame = +3

Query  75    IGFSIAIVFLVCL---WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVED  245
             I  +I I+ ++     WR++NW W +PR L+K LR+ G +G  YKF+ GD+ ++ K  E+
Sbjct  4     ILVAICIILVIIFRWSWRLMNWLWLQPRCLEKCLRELGFRGNSYKFLVGDMNEVVKMDEE  63

Query  246   AKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQ  425
             AKSKPI  S DI  R +PF    I   G+NSF+WLGP P + I DPE ++ + +K  IFQ
Sbjct  64    AKSKPIKFSHDIVKRLMPFIHKTIIDYGKNSFIWLGPNPAMLIMDPEHIREILSKSNIFQ  123

Query  426   KPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKN  605
             KPP   L+KLLA+G++ +E DKW KHR+IINP F ++KLKHM+P+F+L+  EMLS+WEK 
Sbjct  124   KPPP-ALTKLLAEGILSYEGDKWAKHRRIINPAFHLDKLKHMVPSFHLTTCEMLSKWEKI  182

Query  606   VGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPG  785
             V  +G +E+DVWPYLQ L SD ISRTAFGSSYEEG +I ELQ+E    +L+ + + YI  
Sbjct  183   VSTEG-SEVDVWPYLQTLTSDAISRTAFGSSYEEGRQIHELQQELAKIILKETEASYI--  239

Query  786   WRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEAS-PDDLLGILLESNFEEIEQN  962
              RFLPTK  RRM +I ++V + ++ II+KR+  +  G+ S  DDLLGILLESN +EI+++
Sbjct  240   -RFLPTKEKRRMNRIHQEVRSLVLRIINKRMNKIEAGDTSNSDDLLGILLESNMKEIQEH  298

Query  963   GNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             GNK FGM+  EVIEECKLFYLAGQETTS+LLVW+M+LLS H +WQ R
Sbjct  299   GNKKFGMSIDEVIEECKLFYLAGQETTSALLVWSMILLSKHSDWQAR  345



>ref|XP_004171842.1| PREDICTED: LOW QUALITY PROTEIN: secologanin synthase-like [Cucumis 
sativus]
Length=587

 Score =   394 bits (1013),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 188/333 (56%), Positives = 236/333 (71%), Gaps = 1/333 (0%)
 Frame = +3

Query  108   CLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISP  287
             C WR LNW W  P+KL+K LR+QG  G  Y+   GDLK +    E+AKSKP+N S DI+P
Sbjct  89    CGWRFLNWIWLTPKKLEKCLREQGFAGNSYRLYSGDLKDLVAMSEEAKSKPMNFSHDIAP  148

Query  288   RALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQG  467
             R +P     I+K G+NSFVWLGP P VFI DPE +K   + +  FQKP  NPL KLL  G
Sbjct  149   RVIPSIHHTIEKYGKNSFVWLGPIPRVFIMDPEQLKAALSLYNDFQKPTINPLVKLLFDG  208

Query  468   VIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPY  647
             +I HE +KWVKHRKI+N  F  EKLK M+P  + SC+EM++ WEK V   G  ELDV PY
Sbjct  209   LINHEGEKWVKHRKIVNHAFHFEKLKDMVPTMFESCNEMINTWEKMVSKDGSCELDVMPY  268

Query  648   LQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQ  827
             LQ LA+DVISRTAFGS+YEEG  IF   +E +   +Q S+ +YIPG RFLPTK N RMK+
Sbjct  269   LQNLAADVISRTAFGSTYEEGKVIFNHFKELICLTIQASNIVYIPGRRFLPTKSNNRMKK  328

Query  828   IEKQVHASIMDIIDKRVKAMRGGEA-SPDDLLGILLESNFEEIEQNGNKNFGMTTREVIE  1004
             I K++   +M++IDKR + M+ GE    DDLLGILLESNF EI+++GN N GM+  ++IE
Sbjct  329   ITKEIKTMLMNVIDKRQRTMKEGETMQSDDLLGILLESNFNEIKEHGNVNLGMSINDLIE  388

Query  1005  ECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ECK+FY AGQETT+ LLVWTM+LL  + +WQ R
Sbjct  389   ECKIFYFAGQETTAVLLVWTMILLGSYTKWQDR  421



>ref|XP_004294187.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   391 bits (1004),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 190/348 (55%), Positives = 248/348 (71%), Gaps = 7/348 (2%)
 Frame = +3

Query  75    IGFSIAIVFLVC--LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDA  248
             +  S+  V +V    W +L+W W +P+KL++ LR+QG KG  Y+ ++GD K+    ++ A
Sbjct  9     VALSLVFVSIVVRLAWSVLDWVWLKPKKLERCLRKQGFKGNSYRILYGDTKENVIMLKKA  68

Query  249   KSKPINLS--DDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
             KSKP+NLS   DI+PR  P     ++  G+NS VW+GP P V I +PE +K+VFT+ + F
Sbjct  69    KSKPMNLSTSHDIAPRVTPLLHQTVKTYGKNSLVWMGPIPQVNIMNPEDLKDVFTELSDF  128

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
             QKP SNPL K LA G++ HE +KW KHR+IINP F  EKLK M+PAFY SC EM+ EWE 
Sbjct  129   QKPHSNPLVKFLATGLVIHEGEKWAKHRRIINPTFHFEKLKRMLPAFYQSCDEMIKEWET  188

Query  603   NVGDQGLA-ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYI  779
              V  +  + E+DVWP LQ + +DVISRTAFGSSY+EG KIFEL +EQ  Y ++   S+YI
Sbjct  189   VVSKESSSHEIDVWPSLQNVTADVISRTAFGSSYQEGRKIFELLKEQAVYAMKSIQSVYI  248

Query  780   PGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQ  959
             PGWRF+PTK N+RMKQI+K++   +M II KR +A+  GEA  DDLLG L+ESN +EI  
Sbjct  249   PGWRFVPTKMNKRMKQIDKEIRNVLMGIISKREQAIEVGEAIKDDLLGALMESNLKEIRD  308

Query  960   NG--NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQ  1097
             +G  NK+ GM+  +VIEECKLFY AGQETTS LLVWTMVLL  +Q WQ
Sbjct  309   HGKNNKDVGMSIEDVIEECKLFYFAGQETTSVLLVWTMVLLCQNQNWQ  356



>ref|XP_009394216.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=527

 Score =   391 bits (1004),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 181/345 (52%), Positives = 252/345 (73%), Gaps = 2/345 (1%)
 Frame = +3

Query  75    IGFSIA-IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAK  251
             +G+ +A ++FL    R+LNWAW+RPR L++ LR  GL GT Y+F +GDLK+ ++  ++A+
Sbjct  13    LGWGVAGLLFLAWALRVLNWAWWRPRWLERALRAHGLNGTAYRFPYGDLKENARFSKEAR  72

Query  252   SKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT-KHTIFQK  428
             +KP+ L+ +I PR LPF   A+ + G+ SF W GP P V I DPELV+ V + K  IF K
Sbjct  73    AKPMPLAHNIIPRLLPFLNRAMDEYGKISFTWFGPVPQVTITDPELVREVLSNKFGIFGK  132

Query  429   PPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNV  608
             P  NPLS+  ++G+  +E +KWVKHR+I+NP F  EKLK M+PAF   CS+++  WE   
Sbjct  133   PTQNPLSRFFSKGLFVYEGEKWVKHRRIMNPAFHAEKLKRMLPAFSACCSDLMDRWENMA  192

Query  609   GDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGW  788
             G +   ELDVWP LQ  + DVISRTAFGSSYEEG +IF+LQ EQ   V+Q+  ++Y+PG+
Sbjct  193   GSEACYELDVWPELQSFSGDVISRTAFGSSYEEGRQIFQLQSEQAELVIQVVQNLYVPGY  252

Query  789   RFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN  968
             RFLPT +N+R+K I++++ + +  II KR + ++ G+AS DDLLG+L+ESN + ++++GN
Sbjct  253   RFLPTPKNKRIKAIDREIRSILRGIIKKREQDIKTGKASTDDLLGLLMESNMKHLQEDGN  312

Query  969   KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             KN GMTT +VIEECKLFY AGQETTS+LL WTM+ LSMH  WQ R
Sbjct  313   KNAGMTTEDVIEECKLFYFAGQETTSALLTWTMICLSMHPTWQVR  357



>ref|XP_008386384.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=511

 Score =   390 bits (1002),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 186/342 (54%), Positives = 242/342 (71%), Gaps = 2/342 (1%)
 Frame = +3

Query  84    SIAIVFLVCL-WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKP  260
             SI  V L+ L W+++NW W +P+K ++ LRQQGL G  Y+ + GDL   SK  + A SKP
Sbjct  4     SIVCVGLIALGWKVVNWIWLKPKKFERHLRQQGLSGNSYRLLIGDLNDNSKMTKAALSKP  63

Query  261   INLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSN  440
             + LS DI P  LP   D   K G  SFVWLGP P V + D EL++  FTK+ +++KP SN
Sbjct  64    MELSHDIVPYVLPLLHDIFNKYGRKSFVWLGPMPSVILFDAELMREAFTKYRVYEKPHSN  123

Query  441   PLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQG  620
             PL  LLA G++ HE DKWVKHR+IINP F +EK+K M+PAF+ +   MLS+WE     +G
Sbjct  124   PLISLLATGLVGHEGDKWVKHRRIINPAFHVEKMKDMLPAFHAASENMLSKWEMLFSSKG  183

Query  621   LAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLP  800
               E+DVWPYL   A DVISR AFG ++EEG + F+LQ+EQ  ++  +  S+YIP +RFLP
Sbjct  184   TCEVDVWPYLCAFAGDVISRAAFGCNFEEGQRFFQLQKEQAAFIRIVLDSVYIPFFRFLP  243

Query  801   TKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN-KNF  977
             TK NRRMKQI K++   +  II+KR KAMR GEA+ DDLLGILL+SNF EI+++ N K+ 
Sbjct  244   TKMNRRMKQIAKEMDTLLRGIINKREKAMRAGEATEDDLLGILLKSNFNEIQEHANDKDV  303

Query  978   GMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             GM+  EVIEECKLFYLAG+ETT  L+ WT+VLL  +Q+WQ R
Sbjct  304   GMSIEEVIEECKLFYLAGEETTRDLINWTLVLLGKYQDWQMR  345



>ref|XP_009343590.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   390 bits (1002),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 190/352 (54%), Positives = 253/352 (72%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFS-IAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME+    IG   + I+     WR++NW W RP+KL++ LRQQGL G  Y+F+ GDLK+ +
Sbjct  1     MEVSVSNIGVVLVGIIVTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLKERT  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               ++ A SKP+NLS DI+PR LPF   ++   G+NSF+W GP P V I +PE +K++ TK
Sbjct  61    MMLKQAYSKPMNLSHDIAPRVLPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILTK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                F K  SNP  KLL  G   ++ +KW +HR+IINP F ++KLK M+PAFYLS +EM+ 
Sbjct  121   IEDFPKLKSNPYVKLLVTGTAHYQGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSNEMIK  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             EWE  V   G  ELDV P L+ L +D+ISR+AFGSSY+EG KIF+L REQV  V ++  +
Sbjct  181   EWESLVLKAGSCELDVQPCLENLTADMISRSAFGSSYKEGRKIFQLLREQVQLVSKVIQN  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRF+PTK N++MK I+K++   +M II+KR + +R GEA+ DDLLGIL+ESN +E
Sbjct  241   VYIPGWRFVPTKMNKKMKGIDKEIGGLLMGIINKREEGIRAGEATKDDLLGILMESNLKE  300

Query  951   IEQNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             I+++G NK  GM+T +VIEECKLFY AGQETTS LLVWTMVLL  +Q WQ R
Sbjct  301   IKEHGNNKRVGMSTDDVIEECKLFYFAGQETTSLLLVWTMVLLGQNQIWQDR  352



>gb|EPS70870.1| hypothetical protein M569_03891 [Genlisea aurea]
Length=535

 Score =   391 bits (1004),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 189/364 (52%), Positives = 259/364 (71%), Gaps = 13/364 (4%)
 Frame = +3

Query  51    MMEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             M EIV  ++ +S+A+  L  LW  LNWA+FRP++L+  LRQQGL+G  Y  I GDLK++ 
Sbjct  1     MEEIVLQILTYSLALSALYALWASLNWAYFRPKRLEAFLRQQGLRGNKYSSIHGDLKELK  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
                E AK+KPI L DDI PR L   +  I   G  S+ W+GPKP V + DPE+VK V  K
Sbjct  61    LITESAKAKPIRLDDDIKPRVLGLIVKTIAAYGNESYFWIGPKPSVILTDPEMVKEVLRK  120

Query  411   HTIFQKPPS-NPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             + +F KP + NPL+++L++G+I +E +KW KHRK++NP F MEKLK M+PAF LS +E+L
Sbjct  121   NDVFTKPVNPNPLTRILSKGLIGYEGEKWAKHRKLLNPAFHMEKLKLMVPAFGLSSAEVL  180

Query  588   SEWEKNV-------GDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVG  746
             +EWEK         G     E+DVWPYLQ + SD ISRTAFGS YE+G KIF+LQ EQV 
Sbjct  181   NEWEKKTMSSSSENGGSEEIEIDVWPYLQTITSDAISRTAFGSRYEDGRKIFQLQNEQVK  240

Query  747   YVLQISSSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGE----ASPDD  914
               ++  +  YIPG R+LPT++N+R+ +I++ +   + ++ID+R+KAM+ GE    A+ +D
Sbjct  241   LAVESRTLPYIPGSRYLPTRKNKRLTEIKRDLQLLVRELIDRRMKAMKSGEEADAAAAND  300

Query  915   LLGILLESNFEEIEQNGNK-NFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQE  1091
             LLG++LESNF E+E +GN  ++GM+  E+I+EC LFYLAGQETTSSL++WTMVLLS H E
Sbjct  301   LLGLMLESNFREVEHHGNNSSYGMSIEEIIDECTLFYLAGQETTSSLILWTMVLLSRHPE  360

Query  1092  WQTR  1103
             WQ R
Sbjct  361   WQER  364



>ref|XP_007149352.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
 gb|ESW21346.1| hypothetical protein PHAVU_005G063200g [Phaseolus vulgaris]
Length=520

 Score =   389 bits (1000),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 183/333 (55%), Positives = 249/333 (75%), Gaps = 3/333 (1%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             W++LNW WF P++L+K+LR+QG +G  YK + GD K+  K  ++A SKP++LSDDI PR 
Sbjct  21    WKILNWLWFNPKRLEKLLREQGFQGNPYKLLVGDSKEFLKMRKEALSKPMDLSDDIVPRV  80

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGVI  473
               +   +++ +G+NSF+WLGP P V I DPE +K++F K   F KP  NPL KLLA G+ 
Sbjct  81    SSYINHSVKSHGKNSFIWLGPTPRVTILDPEQIKDIFNKIYDFPKPDINPLLKLLATGLA  140

Query  474   FHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQ  653
              +E +KW KHR++INP F +EKLK M+P F+ SC++++++WE+ +   G  E+D WP+LQ
Sbjct  141   DYEGEKWSKHRRLINPAFNLEKLKAMLPLFFESCNDLVNKWERMLSSDGSCEIDAWPFLQ  200

Query  654   QLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQIE  833
              + SDVI+R+AFGSS+EEG +IF+LQREQ    LQ+   I IPGWRFLPTK +RRMK+I+
Sbjct  201   NMTSDVIARSAFGSSFEEGRRIFQLQREQAKLALQVILKIQIPGWRFLPTKSHRRMKEID  260

Query  834   KQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG---NKNFGMTTREVIE  1004
             + + AS+ D+I KR KA++ GEA  DDLLGILLESN +EI+++    NKN GM+  +VIE
Sbjct  261   RDIKASLKDMIYKREKALKKGEAINDDLLGILLESNHKEIQEHAKGDNKNVGMSLEDVIE  320

Query  1005  ECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ECKLFY AGQETTS LLVWTMVLLS + +WQ R
Sbjct  321   ECKLFYFAGQETTSVLLVWTMVLLSRYPDWQER  353



>ref|XP_008366858.1| PREDICTED: cytochrome P450 CYP72A219-like [Malus domestica]
Length=516

 Score =   389 bits (1000),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 190/352 (54%), Positives = 252/352 (72%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFS-IAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME+    IG   + I+     WR++NW W RP+KL++ LRQQGL G  Y+F+ GDLK+ +
Sbjct  1     MEVSVSNIGVVLVGIIVTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLKERT  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               ++ A SKP+NLS DI+PR LPF   ++   G+NSF+W GP P V I +PE +K++ TK
Sbjct  61    MMLKQAYSKPMNLSHDIAPRVLPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILTK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                F K  SNP  KLL  G   +E +KW +HR+IINP F ++KLK M+PAFYLS SEM+ 
Sbjct  121   IEDFPKLKSNPYVKLLVTGTAHYEGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSSEMIK  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             EWE  V  +G  ELDV P L+ L +D+ISR+AFGSSY+EG KIF+L REQ+  V ++  +
Sbjct  181   EWESLVLKEGSCELDVRPCLENLTADMISRSAFGSSYKEGRKIFQLLREQLQLVTKVIQN  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRF+PTK N++MK I+K++   +M II+KR + +R GEA+ DDLLGIL+ESN +E
Sbjct  241   VYIPGWRFVPTKMNKKMKGIDKEIGGLLMGIINKREEGIRAGEATKDDLLGILMESNLKE  300

Query  951   IEQNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             I+++G NK  GM   +VIEECKLFY AGQETTS LLVWTMVLL  +Q WQ R
Sbjct  301   IKEHGNNKGVGMXMYDVIEECKLFYFAGQETTSLLLVWTMVLLGQNQIWQDR  352



>ref|XP_007149353.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
 gb|ESW21347.1| hypothetical protein PHAVU_005G063300g [Phaseolus vulgaris]
Length=520

 Score =   389 bits (998),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 182/333 (55%), Positives = 249/333 (75%), Gaps = 3/333 (1%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             W++LNW WF P++L+K+LR+QG +G  YK + GD K+  K  ++A SKP++LSDDI PR 
Sbjct  21    WKILNWLWFNPKRLEKLLREQGFQGNPYKLLVGDSKEFLKMRKEALSKPMDLSDDIVPRV  80

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGVI  473
               +   +++ +G+NSF+WLGP P V I DPE +K++F K   F KP  NPL KLLA G+ 
Sbjct  81    SSYINHSVKSHGKNSFIWLGPTPRVTILDPEQIKDIFNKIYDFPKPDINPLFKLLATGLA  140

Query  474   FHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQ  653
              +E +KW KHR++INP F +EKLK M+P F+ SC++++++WE+ +   G  E+D WP+LQ
Sbjct  141   GYEGEKWSKHRRLINPAFNLEKLKAMLPLFFESCNDLVNKWERMLSSDGSCEIDAWPFLQ  200

Query  654   QLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQIE  833
              + SDVI+R+AFGSS+EEG +IF+LQREQ    LQ+   + IPGWRFLPTK +RRMK+I+
Sbjct  201   NMTSDVIARSAFGSSFEEGRRIFQLQREQTKLALQVILKVQIPGWRFLPTKSHRRMKEID  260

Query  834   KQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG---NKNFGMTTREVIE  1004
             + + AS+ D+I KR KA++ GEA  DDLLGILLESN +EI+++    NKN GM+  +VIE
Sbjct  261   RDIKASLKDMIYKREKALKKGEAINDDLLGILLESNHKEIQEHAKGDNKNVGMSLEDVIE  320

Query  1005  ECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ECKLFY AGQETTS LLVWTMVLLS + +WQ R
Sbjct  321   ECKLFYFAGQETTSVLLVWTMVLLSRYPDWQER  353



>ref|XP_009339350.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=519

 Score =   389 bits (998),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 189/334 (57%), Positives = 249/334 (75%), Gaps = 1/334 (0%)
 Frame = +3

Query  105   VCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDIS  284
              C WR+LNW W RP+ L+K LRQQGL G  Y+   GDL++ S  +++A SKP+NLS D +
Sbjct  21    ACAWRVLNWVWLRPKDLEKCLRQQGLAGNSYRLWSGDLRESSIMLKEAMSKPMNLSHDTA  80

Query  285   PRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQ  464
             PR LPF   ++   G+NSF+W+GP P V I +PE +K++FTKH  F KP  NPL KLLA 
Sbjct  81    PRVLPFVHQSVSTYGKNSFMWIGPTPRVNITNPEDLKDIFTKHEDFPKPALNPLVKLLAT  140

Query  465   GVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWP  644
             G+  +E DKW KHR+I+NP F  EKLK M+P+FY SCSEM+ EWE  V      ELDVWP
Sbjct  141   GLANYEGDKWAKHRRIVNPAFHSEKLKRMLPSFYQSCSEMIEEWESLVSKDSSCELDVWP  200

Query  645   YLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMK  824
             YLQ + +DVISRT+FGSSY+EG +IF+L + Q    ++   S+YIPGWRFLPTK N+ MK
Sbjct  201   YLQNVTADVISRTSFGSSYKEGREIFQLLKVQTELAIKTIQSVYIPGWRFLPTKMNKSMK  260

Query  825   QIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNK-NFGMTTREVI  1001
              ++K++   +M II+KR +A++ G+A+ DDLLG+LL+SNF+EI+++GNK   GM+T++V+
Sbjct  261   GVDKKIRELLMGIINKREEAIKAGKATKDDLLGLLLDSNFKEIKEHGNKRKVGMSTQDVL  320

Query  1002  EECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EECKLFY AGQETTS LLVWTMVLLS +Q WQ R
Sbjct  321   EECKLFYFAGQETTSVLLVWTMVLLSENQNWQDR  354



>ref|XP_004166891.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=523

 Score =   389 bits (998),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 181/331 (55%), Positives = 243/331 (73%), Gaps = 1/331 (0%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             W++ +W WFRP+KL+K+LRQQG  G  Y+ + GDLK+ +   E+A SKP+N S+ I+PR 
Sbjct  28    WKLADWIWFRPKKLEKLLRQQGFAGNSYRILHGDLKESAAMREEAMSKPMNFSNHIAPRV  87

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGVI  473
             +P     IQ  G+NSF+W+G  P V I DPE +K VF+    FQ+P  NPL KL   G+ 
Sbjct  88    IPSVHQTIQHYGKNSFMWIGTVPRVHIMDPEQLKTVFSFINDFQRPTMNPLLKLFTNGLF  147

Query  474   FHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQ  653
              HE  KWVKHRKII+P F ++KLK MIP FY SC+EM+S+WE  V ++G  ELDV PYLQ
Sbjct  148   SHEGQKWVKHRKIISPAFHLKKLKDMIPEFYHSCNEMVSKWESMVSEEGSCELDVMPYLQ  207

Query  654   QLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQIE  833
              +ASDVISRTAFGSSYE+G KIFELQ +   + +Q S  IYIPGWRFLPTK N +MK+I 
Sbjct  208   NMASDVISRTAFGSSYEKGKKIFELQSKLGAFAIQSSLGIYIPGWRFLPTKSNNKMKEIS  267

Query  834   KQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTTREVIEEC  1010
             K++   I+ +++++ K+M+ GEA   DLL IL+ESN  EI+++G NK  G++ ++VI+EC
Sbjct  268   KEISTLILGVMNEKEKSMKAGEAIQTDLLSILIESNLNEIKEHGNNKGMGLSIQDVIDEC  327

Query  1011  KLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             KLFY+ GQETT++LL+WTMV+LS + EWQ R
Sbjct  328   KLFYITGQETTATLLIWTMVMLSSYSEWQER  358



>ref|XP_009339373.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=511

 Score =   388 bits (997),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 185/342 (54%), Positives = 242/342 (71%), Gaps = 2/342 (1%)
 Frame = +3

Query  84    SIAIVFLVCL-WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKP  260
             SI  V L+ L W+++NW W +P+KL++ LRQQGL G  Y+ + GDL   SK  + A SKP
Sbjct  4     SIVCVGLITLGWKVVNWIWLKPKKLERHLRQQGLSGNSYRLLIGDLNDNSKMTKAALSKP  63

Query  261   INLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSN  440
             +  S DI P  LP   D   K G  SF+WLGP P V + D EL++  FTK+ +++KP SN
Sbjct  64    MEFSHDIVPYVLPLLHDIFNKYGRKSFIWLGPIPSVILFDAELMREAFTKYRVYEKPHSN  123

Query  441   PLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQG  620
             PL  LL  G++ HE DKWVKHR+IINP F +EK+K M+PAF+ +   MLS+WE     +G
Sbjct  124   PLISLLVTGLVGHEGDKWVKHRRIINPAFHVEKMKDMLPAFHAASENMLSKWETLFSSRG  183

Query  621   LAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLP  800
               E+DVWPYL   A DVISR AFGS++EEG + F+LQ+EQ  +V  +  S+YIP +RFLP
Sbjct  184   TCEVDVWPYLCAFAGDVISRAAFGSNFEEGQRFFQLQKEQAAFVRIVLDSVYIPFFRFLP  243

Query  801   TKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN-KNF  977
             TK NRRMKQI K++   +  II++R KAMR GEA+ DDLLGILL+SNF EI+++ N K+ 
Sbjct  244   TKMNRRMKQIAKEMDTLLRGIINQREKAMRAGEATEDDLLGILLKSNFNEIQEHANDKDV  303

Query  978   GMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             GM+  EVIEECKLFYLAG+ETT  L+ WT+VLL  +Q+WQ R
Sbjct  304   GMSIEEVIEECKLFYLAGEETTRDLINWTLVLLGKYQDWQMR  345



>ref|XP_011098148.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=519

 Score =   388 bits (997),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 182/342 (53%), Positives = 247/342 (72%), Gaps = 3/342 (1%)
 Frame = +3

Query  87    IAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPIN  266
             I +V    + ++LNW WFRP+KL+K+LR+QGL G  Y+   GD++     ++  + K + 
Sbjct  13    ITLVSTTLVVKLLNWVWFRPKKLEKLLRKQGLSGNPYRLFLGDMQDFGNVMKTEQPKTLK  72

Query  267   LSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPL  446
             LSDD+ P  LP++ + I K G+ SFVW GP P V + DPEL+K + +K  +F KP  +P+
Sbjct  73    LSDDLPPHILPYYHNIIHKYGKLSFVWFGPSPRVNVADPELIKEILSKPGLFHKPLPDPI  132

Query  447   SKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLA  626
              + +  G++F E DKW KHRKIIN  F MEKLK+MIPA +LSCS+M+ +WE ++   G +
Sbjct  133   GETIVGGLLFLEGDKWAKHRKIINQAFHMEKLKNMIPAMFLSCSKMIEKWEASISSCGSS  192

Query  627   -ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPT  803
              E+DVWP L+ L+ DVISRTAFGSSYEEG +IFELQ+EQV  VL +    +IPGWR+ PT
Sbjct  193   QEIDVWPSLEDLSGDVISRTAFGSSYEEGRRIFELQKEQVKLVLHLLQFSFIPGWRYFPT  252

Query  804   KRNRRMKQIEKQVHASIMDIIDKRVKAMR--GGEASPDDLLGILLESNFEEIEQNGNKNF  977
               NRR+++I KQ+ + +  II++R KAM    GE   +DLLGIL+ESNF EI+Q+GNKN 
Sbjct  253   NANRRLREITKQIESLLRGIINQRGKAMERADGEIIRNDLLGILMESNFREIQQHGNKNV  312

Query  978   GMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             G++  +VIEECKLFY AG+ETTS+LLVWTMVLLS HQ+WQ R
Sbjct  313   GLSIEDVIEECKLFYFAGKETTSNLLVWTMVLLSKHQDWQAR  354



>ref|XP_009602242.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana tomentosiformis]
Length=513

 Score =   388 bits (996),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 180/350 (51%), Positives = 248/350 (71%), Gaps = 2/350 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             M+IV  ++  +I I  ++ +WRM+NW W RPRKL+K  R+QG+ G  Y+ ++GD K++++
Sbjct  1     MKIV-AILFSAIVIALVIWVWRMVNWVWLRPRKLEKCFRKQGMNGHPYRTLYGDTKEMAE  59

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
               ++AK KPI L+DDI PR  PF+     K G + F W+GP+P +F+  PEL+K + T +
Sbjct  60    MTKEAKFKPIKLTDDILPRIFPFYHHTFNKYGNHCFAWIGPEPRIFVMKPELIKEIVTNN  119

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
             TIF+KP   PL +LL  G+  +E+DKW KHRKI+N  F  EKLK M+PA + SC +M+++
Sbjct  120   TIFKKPKPAPLVQLLVSGISSYEDDKWAKHRKILNTAFYAEKLKCMLPAMHTSCEDMINK  179

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WE  + +    ELDV PY +   SDVISRTAFGSSY EG +IF LQ+E      Q   S+
Sbjct  180   WEILLSENKSCELDVHPYFEDFTSDVISRTAFGSSYAEGTRIFHLQKELAELTRQAFQSV  239

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI  953
             YIPGWR+LPT+ NRRMK I+ ++   +  I+ KR +AM G  +  +DLLGILL+SN +EI
Sbjct  240   YIPGWRYLPTRTNRRMKAIDNELRDILRKIVSKRERAMVGEASDQEDLLGILLKSNLKEI  299

Query  954   EQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ++ G+K FGMTT EVIEECK+FY AGQE++S+LLVWTMVLLS+HQ WQ R
Sbjct  300   QERGSK-FGMTTDEVIEECKVFYFAGQESSSNLLVWTMVLLSVHQTWQAR  348



>ref|XP_009356829.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=516

 Score =   387 bits (995),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 189/352 (54%), Positives = 252/352 (72%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIA-IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME+    IG  +  I+     WR++NW W RP+KL++ LRQQGL G  Y+F+ GDL + +
Sbjct  1     MEVSVSNIGVVLVRIIVTAWAWRVVNWLWLRPKKLERYLRQQGLAGNSYRFLVGDLTERT  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               ++ A SKP+NLS DI+PR LPF   ++   G+NSF+W GP P V I +PE +K++ TK
Sbjct  61    MMLKQAYSKPMNLSHDIAPRVLPFEYHSVNTYGKNSFIWAGPVPRVNIANPEDLKDILTK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                F K  SNP  KLL  G   ++ +KW +HR+IINP F ++KLK M+PAFYLS +EM+ 
Sbjct  121   IEDFPKLKSNPYVKLLVTGTAHYQGEKWRRHRRIINPAFHLDKLKGMLPAFYLSSNEMIK  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             EWE  V   G  ELDV P L+ L +D+ISR+AFGSSY+EG KIF+L REQV  V ++  +
Sbjct  181   EWESLVLKAGSCELDVQPCLENLTADMISRSAFGSSYKEGRKIFQLLREQVQLVSKVIQN  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRF+PTK N++MK I+K++   +M II+KR + +R GEA+ DDLLGIL+ESN +E
Sbjct  241   VYIPGWRFVPTKMNKKMKGIDKEIGGLLMGIINKREEGIRAGEATKDDLLGILMESNLKE  300

Query  951   IEQNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             I+++G NK  GM+T +VIEECKLFY AGQETTS LLVWTMVLL  +Q WQ R
Sbjct  301   IKEHGNNKRVGMSTDDVIEECKLFYFAGQETTSLLLVWTMVLLGQNQIWQDR  352



>ref|XP_010060775.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67640.1| hypothetical protein EUGRSUZ_F01386 [Eucalyptus grandis]
Length=510

 Score =   387 bits (994),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 196/340 (58%), Positives = 248/340 (73%), Gaps = 7/340 (2%)
 Frame = +3

Query  84    SIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPI  263
             ++  V     WR +NW W RP++L+++LRQQGL G  Y F+ GDLK+  + +++AKSKPI
Sbjct  12    TVLAVLTTWAWRAVNWVWLRPKRLERLLRQQGLSGKSYTFLVGDLKENLRMLKEAKSKPI  71

Query  264   NLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNP  443
              +SDDI PR LPF   + Q  G++SF W+GP P V I +PE +K VF+K   + KP SNP
Sbjct  72    AVSDDIKPRLLPFLHQSFQTYGKDSFTWMGPTPRVNITNPEQIKEVFSKIYDYPKPASNP  131

Query  444   LSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGL  623
             L KLLA G+  HE +KW +HRKIINP F MEKLK M+PAFYLSC+EM+  WEK+V ++  
Sbjct  132   LVKLLADGLANHEGEKWARHRKIINPAFHMEKLKLMLPAFYLSCTEMVDRWEKSVLEERS  191

Query  624   AELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPT  803
              E+D W  LQ L  DVISRTAFGSS+EEG +IFELQ EQ    ++   S+YIPGWRF+PT
Sbjct  192   CEVDAWVDLQNLTRDVISRTAFGSSFEEGKRIFELQEEQALLAIKALQSVYIPGWRFVPT  251

Query  804   KRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFGM  983
             K NRRMK I K+V A +MDII +RVKA+R G+A+ DDLLG+LLESN +E       + GM
Sbjct  252   KMNRRMKNINKEVQAVLMDIIRRRVKAIRAGDAAGDDLLGLLLESNMKE-------DVGM  304

Query  984   TTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +  +VIEECKLFY AGQETTS LLVWTMVLLS+H +WQ R
Sbjct  305   SLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHPDWQAR  344



>dbj|BAL45198.1| cytochrome P450 monooxygenase [Medicago truncatula]
Length=518

 Score =   387 bits (995),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 189/335 (56%), Positives = 251/335 (75%), Gaps = 1/335 (0%)
 Frame = +3

Query  102   LVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDI  281
             L+  WR+LNW W +P+KL+K+LR+QGLKG  Y+ + GD+K + K  ++A +KP+NLSDDI
Sbjct  17    LIWAWRILNWLWLKPKKLEKLLREQGLKGNSYRLLVGDIKDLLKIRKEATTKPMNLSDDI  76

Query  282   SPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLA  461
              PR   F   ++ K+G+NSF+W GP P V I DP+ +K+V  K   FQKP +NPL +LLA
Sbjct  77    VPRVYSFVHQSVTKHGKNSFIWFGPTPRVNITDPDQIKDVLNKIYDFQKPNANPLVRLLA  136

Query  462   QGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVW  641
              G++  E ++W KHRKIINP F +EKLK M+P F+ SC +M+S+WEK +   G  E+DVW
Sbjct  137   NGLVSLEGEQWSKHRKIINPAFHLEKLKIMLPIFHKSCDDMISKWEKMLSSDGSCEMDVW  196

Query  642   PYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRM  821
             P+LQ  ASDVISR AFGSSYEEG +IF+LQ EQ     +I   +YIPGWRFLPT   RRM
Sbjct  197   PFLQNFASDVISRAAFGSSYEEGKRIFQLQTEQAELTTKIMMKVYIPGWRFLPTATPRRM  256

Query  822   KQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTTREV  998
             K+I++ + AS+ D+I+ R +A++ GEA+ DDLLGILLESN +E+E++G NK+ GM+  +V
Sbjct  257   KEIDRDIKASLTDMINNRERALKAGEATKDDLLGILLESNHKEMEEHGNNKDVGMSLDDV  316

Query  999   IEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IEECKLFY AGQETTS LLVWTMVLLS + +WQ R
Sbjct  317   IEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQAR  351



>ref|XP_009339365.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=526

 Score =   387 bits (994),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 190/358 (53%), Positives = 257/358 (72%), Gaps = 8/358 (2%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVC-LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME   G +  ++ +V +V   W +LNW WFRP+KL++ LRQQGL G  Y+ +FGDLK+ S
Sbjct  1     MEASPGSVALTVVLVSIVAWAWSLLNWVWFRPKKLERYLRQQGLGGNSYRLLFGDLKESS  60

Query  231   KSVEDAKSKPIN-LSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
                + A+SKP+N LS DI P  LPF    +   G+NSF+W+GP   V I +PE +++V  
Sbjct  61    MMHKQARSKPMNHLSHDIVPHILPFLHQTVITYGKNSFIWMGPTLRVNILNPEDLRDVLN  120

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             ++  F+KP SNP++++L QG++  + +KW KH++IINP F +EKLK M+P FY  CSEM+
Sbjct  121   RYDDFRKPLSNPITRVLPQGLVNIDGEKWTKHKRIINPAFHLEKLKVMVPTFYQCCSEMI  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQRE--QVGYVLQI  761
               WE  V ++GL ELDVWP+LQ LA DV+SR AFGSSYEEG KIF+L +E  ++G  L  
Sbjct  181   DTWENLVANEGLYELDVWPWLQSLAGDVLSRAAFGSSYEEGKKIFQLLKEHARIGATLLR  240

Query  762   SS--SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGE-ASPDDLLGILL  932
              S  S+YIPGWRFLP+K N+RMK+I K++   IMDII+KR   ++ G+  + DDLLG+LL
Sbjct  241   RSLTSVYIPGWRFLPSKMNKRMKEINKEIRVLIMDIINKREGTIKAGDNINKDDLLGVLL  300

Query  933   ESNFEEIEQNGN-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ESN +EI+++GN KN GM+  EVIEECKLFY  GQETT++ LVW MVLLS +Q WQ R
Sbjct  301   ESNSKEIKEHGNHKNVGMSIEEVIEECKLFYFVGQETTAAFLVWAMVLLSHNQNWQNR  358



>ref|XP_004146075.1| PREDICTED: secologanin synthase-like [Cucumis sativus]
Length=551

 Score =   388 bits (996),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 181/331 (55%), Positives = 242/331 (73%), Gaps = 1/331 (0%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             W++ +W WFRP+KL+K+LRQQG  G  Y+ + GDLK+ +   E+A SKP+N S+ I+PR 
Sbjct  37    WKLADWIWFRPKKLEKLLRQQGFAGNSYRILHGDLKESAAMREEAMSKPMNFSNHIAPRV  96

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGVI  473
             +P     IQ  G+NSF+W+G  P V I DPE +K VF+    FQ+P  NPL KL   G+ 
Sbjct  97    IPSVHQTIQHYGKNSFMWIGTVPRVHIMDPEQLKTVFSFINDFQRPTMNPLLKLFTNGLF  156

Query  474   FHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQ  653
              HE  KWVKHRKII+P F ++KLK MIP FY SC+EM+S+WE  V  +G  ELDV PYL+
Sbjct  157   SHEGQKWVKHRKIISPAFHLKKLKDMIPEFYHSCNEMVSKWESMVSREGSCELDVMPYLK  216

Query  654   QLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQIE  833
              +ASDVISRTAFGSSYE+G KIFELQ +   + +Q S  IYIPGWRFLPTK N +MK+I 
Sbjct  217   NMASDVISRTAFGSSYEKGKKIFELQSKLGAFAIQSSLGIYIPGWRFLPTKSNNKMKEIS  276

Query  834   KQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTTREVIEEC  1010
             K++   I+ +++++ K+M+ GEA   DLL IL+ESN  EI+++G NK  G++ ++VI+EC
Sbjct  277   KEISTLILGVMNEKEKSMKAGEAIQTDLLSILIESNLNEIKEHGNNKGMGLSIQDVIDEC  336

Query  1011  KLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             KLFY+ GQETT++LL+WTMVLLS + EWQ R
Sbjct  337   KLFYITGQETTATLLIWTMVLLSSYSEWQER  367



>ref|XP_009394217.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=538

 Score =   387 bits (995),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 182/345 (53%), Positives = 249/345 (72%), Gaps = 2/345 (1%)
 Frame = +3

Query  75    IGFSIA-IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAK  251
             +G+ +A ++FL    R+LNWAW+RPR L++ LR QGL GT Y+F +GDLK+ ++  ++A+
Sbjct  29    LGWGVAGLLFLAWALRVLNWAWWRPRWLERALRAQGLNGTAYRFPYGDLKENARFSKEAR  88

Query  252   SKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT-KHTIFQK  428
             +KP+ LS +I PR LPF   A+ + G+ SF WLGP P V I DPELV+ V + K   F K
Sbjct  89    AKPMPLSHNIIPRLLPFLNRAMDEYGKISFTWLGPVPQVTITDPELVREVLSNKFGHFGK  148

Query  429   PPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNV  608
             P  NPL +  A+G+  +E +KWVKHR+I+NP F  EKLK M+PAF   CS+++  WE   
Sbjct  149   PNQNPLVRFFARGLFVYEGEKWVKHRRILNPAFHAEKLKRMLPAFSACCSDLMDRWENMA  208

Query  609   GDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGW  788
             G +   ELDVWP LQ    DVISRTAFGSSYEEG  IF LQ EQ   ++Q+  ++Y+PG+
Sbjct  209   GSEACYELDVWPELQSFTGDVISRTAFGSSYEEGRPIFHLQAEQAELLIQVVQNLYVPGY  268

Query  789   RFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN  968
             RFLPT +N+R+K I++++ + +  II KR + ++ G+AS DDLLG+L+ESN + ++++GN
Sbjct  269   RFLPTPKNKRIKAIDREIRSILRGIIKKREQDIKTGKASTDDLLGLLMESNMKRLQEDGN  328

Query  969   KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             KN GMTT +VIEECKLFY AGQETTS+LL WTM+ LSMH  WQ R
Sbjct  329   KNAGMTTEDVIEECKLFYFAGQETTSALLTWTMICLSMHPTWQVR  373



>ref|XP_008798317.1| PREDICTED: LOW QUALITY PROTEIN: cytochrome P450 CYP72A219-like 
[Phoenix dactylifera]
Length=527

 Score =   387 bits (993),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 187/357 (52%), Positives = 254/357 (71%), Gaps = 6/357 (2%)
 Frame = +3

Query  39    THTEMMEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDL  218
             T   +  I +G++G    ++F++  WR L W W+RP++L++ LR QGL+G+ Y+F+ GDL
Sbjct  10    TAETLWRIGWGVVG----LLFVLRAWRGLEWVWWRPKRLERALRGQGLRGSRYRFLHGDL  65

Query  219   KKISKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKN  398
             K+ ++  ++A+SKP+  S DI PR  P F  AI++NG+ S  WLGP P V I +PELV+ 
Sbjct  66    KETARLNKEARSKPMPFSHDIIPRVSPIFHRAIKENGKISITWLGPVPRVTIMNPELVRE  125

Query  399   VFT-KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSC  575
             V + K   F KP  NPL +LLA+G+  +E ++W KHR+I+NP F +EKLK M+PAF   C
Sbjct  126   VLSNKFGHFTKPKLNPLGQLLARGLADYEGEQWAKHRRILNPAFHLEKLKRMLPAFSACC  185

Query  576   SEMLSEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVL  755
              E++S WEK++G  G  ELDVWP LQ    DVISRTAFGSSY EG +IF+LQ EQ   V+
Sbjct  186   GELVSRWEKSIGSLGYYELDVWPELQTFTGDVISRTAFGSSYAEGRRIFQLQAEQAELVI  245

Query  756   QISSSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLE  935
             +   ++YIPG+RFLPT  N R K+I ++V A +  II+KR KA++ GEAS DDLLG+++E
Sbjct  246   KAVQTVYIPGYRFLPTPINNRRKEIYREVRALLRGIIEKREKAIKLGEASNDDLLGVMIE  305

Query  936   SNFEEIEQNGN-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              N +  +++GN KN GMTT EVIEECKLFY AGQETTS LL WTM++LSMH  WQ R
Sbjct  306   YNLKHFQEHGNSKNTGMTTEEVIEECKLFYFAGQETTSVLLTWTMIVLSMHPSWQVR  362



>gb|ABC59078.1| cytochrome P450 monooxygenase CYP72A59 [Medicago truncatula]
Length=518

 Score =   386 bits (991),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 188/335 (56%), Positives = 250/335 (75%), Gaps = 1/335 (0%)
 Frame = +3

Query  102   LVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDI  281
             L+  WR+LNW W +P+KL+K+LR+QGLKG  Y+ + GD+  + K  ++A SKP+NLSDDI
Sbjct  17    LIWAWRILNWLWLKPKKLEKLLREQGLKGNSYRLLVGDMNDLLKMRKEATSKPMNLSDDI  76

Query  282   SPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLA  461
              PR   F   ++ K+G+NSF+W GP P V I DP+ +K+V  K   FQKP +NPL +LLA
Sbjct  77    VPRVYSFVHQSVTKHGKNSFIWFGPTPRVNITDPDQIKDVLNKIYDFQKPNANPLVRLLA  136

Query  462   QGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVW  641
              G++  E ++W KHRKIINP F +EKLK M+P F+ SC +++S+WEK +   G  E+DVW
Sbjct  137   NGLVSLEGEQWSKHRKIINPAFHLEKLKIMLPIFHKSCDDLISKWEKMLSSDGSCEMDVW  196

Query  642   PYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRM  821
             P+LQ  ASDVISR AFGSSYEEG +IF+LQ EQ     +I   +YIPGWRFLPT   RRM
Sbjct  197   PFLQNFASDVISRAAFGSSYEEGKRIFQLQTEQAELTTKIMMKVYIPGWRFLPTATPRRM  256

Query  822   KQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTTREV  998
             K+I++ + AS+ D+I+ R +A++ GEA+ DDLLGILLESN +E+E++G NK+ GM+  +V
Sbjct  257   KEIDRDIKASLTDMINNRERALKAGEATKDDLLGILLESNHKEMEEHGNNKDVGMSLDDV  316

Query  999   IEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IEECKLFY AGQETTS LLVWTMVLLS + +WQ R
Sbjct  317   IEECKLFYFAGQETTSVLLVWTMVLLSRYPDWQAR  351



>ref|XP_010926800.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Elaeis guineensis]
Length=519

 Score =   385 bits (990),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 184/348 (53%), Positives = 246/348 (71%), Gaps = 5/348 (1%)
 Frame = +3

Query  72    LIGFSIAIVFLVCLW--RMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVED  245
             ++G  + ++FL+ +W  R L W W+RPR+L+ +LR QGL GT Y+F++GDLK   +  + 
Sbjct  8     MVGAVVGVLFLL-VWAVRALEWVWWRPRRLEGLLRAQGLSGTRYRFLYGDLKDNVRLQKA  66

Query  246   AKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT-KHTIF  422
             A+SKP+ LS  I PR LPFF  AI+ +G+ SF W GP P V +KDPELV+ V + K   F
Sbjct  67    ARSKPMPLSHCIGPRVLPFFHQAIEDHGKISFTWFGPYPRVILKDPELVREVLSNKFGHF  126

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
             +KP  NPL KLLA+GV  +E +KW KHR+IINP F +EKLKHM+P     C E+++ W+ 
Sbjct  127   EKPNINPLGKLLARGVADYEGEKWAKHRRIINPAFHLEKLKHMLPTLATCCDELINRWDN  186

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
             ++G QG  ELDVWP  Q    DVISR AFGSS++EG +IF+LQ+EQ   V+Q +  IYIP
Sbjct  187   HLGSQGYCELDVWPAFQNFTGDVISRAAFGSSFKEGQRIFQLQQEQTELVVQAAQKIYIP  246

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE-EIEQ  959
             G+RFLPTK+N RM +I++++ A +  +I++R +AMR    S DDLLG+L+ESN     EQ
Sbjct  247   GYRFLPTKKNNRMYEIDREIRALLSRMIEQRERAMRKAGVSNDDLLGLLIESNLRYSQEQ  306

Query  960   NGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              G+KN GMT  +VIEECKLFY AG ETTS LL WT+V+L MH  WQ R
Sbjct  307   GGSKNTGMTKDDVIEECKLFYFAGHETTSVLLTWTVVVLGMHPSWQAR  354



>gb|EPS69403.1| hypothetical protein M569_05363, partial [Genlisea aurea]
Length=504

 Score =   384 bits (987),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 180/329 (55%), Positives = 242/329 (74%), Gaps = 2/329 (1%)
 Frame = +3

Query  123   LNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRALPF  302
             L+WA F+PR+L++ LR+QGLKG+ YKF+ GD K+  + + +AKSKPI + DDI PR + F
Sbjct  1     LDWAVFKPRRLERFLRKQGLKGSSYKFLHGDNKESLEILRNAKSKPIAVDDDIKPRVVGF  60

Query  303   FIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKP-PSNPLSKLLAQGVIFH  479
             F+  I   G+N F W G +P+V + DPE VK VF K   FQKP   NPL+K L+ G++  
Sbjct  61    FVKTIDTYGKNCFFWRGTRPVVILTDPETVKEVFKKTEAFQKPVDPNPLAKFLSTGLVAI  120

Query  480   EEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQQL  659
             E +KW KHRKI+NP F MEKLK M+ AF +SC E L +W+  +      E+DVWPYLQ +
Sbjct  121   EGEKWAKHRKIMNPAFHMEKLKRMVSAFGVSCEEALGKWDVLLSSSSSGEIDVWPYLQTI  180

Query  660   ASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQIEKQ  839
              SD ISRTAFGSSYE+G ++FELQ EQ  ++     SIYIPG RFLPTKRNRRMK+IE++
Sbjct  181   TSDAISRTAFGSSYEKGRRVFELQIEQSEHIFTAGQSIYIPGSRFLPTKRNRRMKEIERE  240

Query  840   VHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQN-GNKNFGMTTREVIEECKL  1016
             + + I  +I++R+++M+ G+A  +DLLG++LESN +EIEQ+ G++  GM+  +++EECKL
Sbjct  241   IQSLIRGLINERIESMKAGKACENDLLGLMLESNNQEIEQSGGDRRSGMSMADIVEECKL  300

Query  1017  FYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             FY AGQETTS LL WT+VLLS H EWQTR
Sbjct  301   FYFAGQETTSVLLCWTLVLLSRHPEWQTR  329



>ref|XP_010060773.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67635.1| hypothetical protein EUGRSUZ_F01380 [Eucalyptus grandis]
Length=510

 Score =   385 bits (988),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 249/351 (71%), Gaps = 8/351 (2%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCL-WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME+    I  ++ + FL  L WR++NW W RP++L+  LRQQGL G  Y F+FGDLK+ S
Sbjct  1     MEVTIQSIALAMVLAFLTTLAWRVVNWTWLRPKRLEGFLRQQGLSGKPYTFLFGDLKEDS  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
             + +  A SKPI +SDDI PR LPF   + Q  G++SF+W+GP P V + +PE +K +F+K
Sbjct  61    RLLRIANSKPIAISDDIKPRLLPFVHQSFQTYGKDSFMWIGPTPRVNLTNPEQLKEIFSK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                + KP  +PLSKLL  G+ FHE +KW +HRKIINP F MEKLK M+PAF  SC+EM+ 
Sbjct  121   MYDYHKPTRSPLSKLLLGGLPFHEGEKWARHRKIINPAFHMEKLKLMLPAFCSSCTEMVH  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
              WEK V ++   E+DVW  LQ L  DVISRTAFGS YEEG +IFELQ E     ++   S
Sbjct  181   RWEKLVSEERSCEVDVWVDLQNLTRDVISRTAFGSRYEEGKRIFELQEELGVLTIKALRS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRFLPTK NRRMK I K+V A + DII +R KA+RGGEA+ DDLLG+LLESN ++
Sbjct  241   VYIPGWRFLPTKMNRRMKNIGKEVQALLTDIIRRREKAIRGGEATGDDLLGLLLESNMKD  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
                    N  M+  +VIEEC LFY+AGQETTS+LLVWTMVLLS+H +WQ R
Sbjct  301   -------NVRMSLHDVIEECNLFYVAGQETTSALLVWTMVLLSVHPDWQAR  344



>emb|CBI39937.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   383 bits (983),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/290 (61%), Positives = 226/290 (78%), Gaps = 1/290 (0%)
 Frame = +3

Query  237   VEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHT  416
             + +A S+PI+ SDDI  R LPF   +IQK G+NSF W GPKP+V+I +PEL+++V  KH 
Sbjct  2     INEANSRPISFSDDIVQRVLPFHDHSIQKYGKNSFTWFGPKPVVYIMEPELIRDVLLKHN  61

Query  417   IFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEW  596
             +FQKPP +PLSKLLA GV+  E ++W K RKIINP F +EKLKHM+ AF LSCS+M+++W
Sbjct  62    VFQKPPPHPLSKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKW  121

Query  597   EKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIY  776
             EK +   G  ELDVWPYL+ LA DVISRTAFGSSYEEG +IF+LQREQ    +Q++ SIY
Sbjct  122   EKKLSLDGSCELDVWPYLENLAGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSIY  181

Query  777   IPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIE  956
             +PGWRF PTK NRRM+QI  +V+A +  II+KR KAM+ GE +  DLLG+L+ESN+ +++
Sbjct  182   VPGWRFFPTKTNRRMRQISNEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNYRDMQ  241

Query  957   QNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +N   KN GM+ ++VIEECKLFYLAGQETTS LL+WTMVLLS H  WQT 
Sbjct  242   ENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQTH  291



>gb|AEI59772.1| cytochrome P450 [Helianthus annuus]
Length=519

 Score =   385 bits (988),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 189/354 (53%), Positives = 251/354 (71%), Gaps = 4/354 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             M+ V   +  S AIV ++  W+++N  W RP+KL+K+LR QG KG  YKF+FGD+K+   
Sbjct  1     MDAVTNTVAISCAIVVVLYAWKIINILWVRPKKLEKLLRNQGFKGNKYKFLFGDMKEFEM  60

Query  234   SVEDAKSKPINLSDD--ISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
             S + +K+K I+L D+  + P  +PF    +QK G + F W+G  P + + DPE++K+V  
Sbjct  61    SFQQSKTKHIDLDDEDGVLPYIVPFNHQHLQKFGRSYFKWIGWNPRLTVMDPEIIKDVLV  120

Query  408   KH-TIFQKPPSNPL-SKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSE  581
             +    FQK   NPL  K +A G++ HE D+W KHRK+INPGF  EKLK+M PAF+LSCSE
Sbjct  121   RKINDFQKLTFNPLFVKYIATGLVSHEGDQWAKHRKLINPGFHAEKLKNMAPAFHLSCSE  180

Query  582   MLSEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQI  761
             M+ +W+K +   G  ELDVWP+LQ L SDVISRT FGSSYEEG +I EL REQ   V++ 
Sbjct  181   MIGKWDKLISSNGSCELDVWPHLQALTSDVISRTTFGSSYEEGVRICELLREQSELVMET  240

Query  762   SSSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESN  941
               S+YIPG +FLPTKRN RM  I  +V +SI  II+ R+KAM+ GE + DDLLG+LLESN
Sbjct  241   LKSLYIPGSKFLPTKRNMRMNAINNEVQSSIGSIIENRLKAMKAGEGNYDDLLGVLLESN  300

Query  942   FEEIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              + +EQ+ NK+ GMT  EVI+ECK F+ AGQ TTSSL+VWTM+LLS HQEWQ+R
Sbjct  301   KKAVEQHQNKSHGMTINEVIQECKAFHFAGQGTTSSLIVWTMILLSKHQEWQSR  354



>ref|XP_010694547.1| PREDICTED: cytochrome P450 72A15-like [Beta vulgaris subsp. vulgaris]
Length=521

 Score =   385 bits (988),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 181/351 (52%), Positives = 248/351 (71%), Gaps = 7/351 (2%)
 Frame = +3

Query  72    LIGFSIAIVFLVCL-----WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKS  236
             +IG  IAI   +C+     W++LNW WFRP+KL+K LR+QGLKG  YK++ GD+K+  + 
Sbjct  1     MIGLFIAIGIALCVILTWVWKILNWVWFRPKKLEKQLRKQGLKGNSYKWLVGDMKETFRM  60

Query  237   VEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHT  416
               +A+ KPI  ++D   R LPF    + K GEN + W GP P + I +PEL++  FT+  
Sbjct  61    RAEARGKPIPFTNDYYSRVLPFLDQHVNKYGENCWTWFGPVPAINIAEPELIREAFTRMN  120

Query  417   IFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEW  596
              FQK   NPL  LL  G++ +E +KW KHRK++NP F MEKLK MIPAF  S +E++++W
Sbjct  121   EFQKTRLNPLIGLLVPGLVGYEGEKWAKHRKLVNPAFHMEKLKLMIPAFGASVTEIINKW  180

Query  597   EKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIY  776
             EK V + G +E+DVWPYL  L++DVISR AFGSSYEEG +IFEL +EQ    L++  S+Y
Sbjct  181   EKIVPESGSSEIDVWPYLMSLSADVISRAAFGSSYEEGKRIFELLKEQTQITLRLFQSVY  240

Query  777   IPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIE  956
             IPGWR++PTK NR+MK+I  Q+   +  +I+KR KAM  GE + DDLLGIL++SNF+  +
Sbjct  241   IPGWRYVPTKTNRKMKEINSQIQNLLTGLINKRKKAMEAGEVAKDDLLGILMDSNFKASQ  300

Query  957   QNGNKN--FGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
               G+      M+ +++I+ECKLFY AGQETTS+LLVWTM+LL  HQ+WQTR
Sbjct  301   NVGSHKQLLAMSFQDMIDECKLFYFAGQETTSTLLVWTMILLGKHQDWQTR  351



>gb|KHG14489.1| Secologanin synthase [Gossypium arboreum]
Length=521

 Score =   385 bits (988),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 172/337 (51%), Positives = 245/337 (73%), Gaps = 1/337 (0%)
 Frame = +3

Query  96    VFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSD  275
             V ++C W++LNWAW  P+KL+K LRQQG  G  Y+ +FG++K++      A+S+P++L+D
Sbjct  19    VLILCGWKILNWAWLTPKKLEKCLRQQGFNGNSYRLLFGEIKEMFTMTRQARSRPMSLTD  78

Query  276   DISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKL  455
             DI+P  +P++   +   G+NS  W GP P V I DPEL++ +F K   FQKP  NPL  L
Sbjct  79    DIAPYVIPYYHQTVTNYGKNSIRWFGPSPRVTIMDPELIREIFNKFNEFQKPRINPLITL  138

Query  456   LAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELD  635
             L  G++  E ++W KHRKII P F ++KLK+M+PAFY  C+EM+ +WE+ V   G +E+D
Sbjct  139   LFSGILTLEGERWAKHRKIITPSFHLDKLKNMLPAFYECCTEMIEKWEEAVSVNGSSEVD  198

Query  636   VWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNR  815
             VWP L  L  DVISR AFGSSYEEG +IF L  EQ   + +   S+Y+PGWRFLPTK N+
Sbjct  199   VWPCLVNLTRDVISRAAFGSSYEEGRRIFLLLDEQTNLLTETVQSLYVPGWRFLPTKTNK  258

Query  816   RMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN-KNFGMTTR  992
             ++K ++K++  S+ +++  R KA++ GE   DDLLGIL+ESNF+EIE++G+ KN GM+ +
Sbjct  259   KLKLMDKEIKDSLRELVKNREKAVKAGEVKNDDLLGILVESNFKEIEEHGDRKNMGMSIQ  318

Query  993   EVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +V++ECKLFY+AGQETTS LLVWTMVLL+ + +WQT+
Sbjct  319   DVVDECKLFYIAGQETTSVLLVWTMVLLARNPDWQTK  355



>ref|XP_010275181.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=517

 Score =   385 bits (988),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 186/332 (56%), Positives = 243/332 (73%), Gaps = 2/332 (1%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             W +L   W+RP KL+K  R+QG++G    ++ G+LK   +   +A SKP+NLS DI+PR 
Sbjct  21    WSVLYSIWWRPMKLEKCFREQGIEGPPRIWLHGNLKDEVRMRNEALSKPMNLSHDIAPRV  80

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT-KHTIFQKPPSNPLSKLLAQGV  470
             +PF    I+K G  S  W G  P + + DP+L+K++ + K   F+KP SNPL +L   G+
Sbjct  81    VPFVHQTIEKYGNMSVTWFGRTPRINVMDPDLIKDILSNKFGQFEKPKSNPLIRLFVDGL  140

Query  471   IFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYL  650
             + HE +KW KHR+IINP F +EKLK M+PAFY SC EM+++WEK V  +G  ELD+WP L
Sbjct  141   VSHEGEKWAKHRRIINPAFHIEKLKRMLPAFYTSCFEMITKWEKLVALEGSCELDIWPEL  200

Query  651   QQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQI  830
             Q L  DVISRTAFGSSY+EG +IF+LQ EQ   V+ ++ SIYIPG+R LPTKRN RMK+I
Sbjct  201   QNLTGDVISRTAFGSSYDEGRRIFQLQNEQAKIVMDVALSIYIPGYRLLPTKRNNRMKEI  260

Query  831   EKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN-KNFGMTTREVIEE  1007
             +++V   +  I++KR KA++ GEAS DDLLG+LLESNF+EI ++GN KN GM   EVIEE
Sbjct  261   DREVRGLLRRIVNKREKAIKLGEASKDDLLGLLLESNFKEIREHGNEKNIGMNVDEVIEE  320

Query  1008  CKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             CKLFY AGQETTS+LLVWTMV+LSMH EWQ R
Sbjct  321   CKLFYFAGQETTSNLLVWTMVVLSMHPEWQMR  352



>ref|XP_010060783.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=510

 Score =   384 bits (987),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 198/351 (56%), Positives = 249/351 (71%), Gaps = 8/351 (2%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVC-LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME     I  +  +  L    WR++NW W RP++L+++LRQQGL G  Y F+FGDLK+ S
Sbjct  1     MEASIQSIALATVLAVLTTWAWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENS  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
             + + +A SKPI++SDDI PR LPF   + Q  G++SF+W+GP P V I +PE +K +F+K
Sbjct  61    RLLTEANSKPISVSDDIKPRLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                + +P SNPL KLLA G+  HE +KW +HRKIINP F MEKLK M+PAFY SC+EM+ 
Sbjct  121   INDYPRPGSNPLVKLLADGLASHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMVG  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
              WEK V      E+D W  LQ L  +VISRTAFGSS+EEG +IFELQ EQ    L    S
Sbjct  181   RWEKLVSVDRSCEIDAWVDLQNLTREVISRTAFGSSFEEGKRIFELQGEQAQLTLIALQS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRF+PTK NRRMK I+K+V A +MDII +R KA+R GEA+ DDLLG+LLESN +E
Sbjct  241   VYIPGWRFVPTKMNRRMKSIDKEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMKE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
                    N GM+  +VIEECKLFY AGQETTS LLVWTMVLLS+H +WQ R
Sbjct  301   -------NVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQAR  344



>ref|XP_010060778.1| PREDICTED: cytochrome P450 72A15-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW67643.1| hypothetical protein EUGRSUZ_F01390 [Eucalyptus grandis]
Length=510

 Score =   384 bits (986),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 249/351 (71%), Gaps = 8/351 (2%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVC-LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME     I  +  +  L    WR++NW W RP++L+++LRQQGL G  Y F+FGDLK+ S
Sbjct  1     MEASIQSIALATVLAILTTWAWRVVNWVWLRPQRLERLLRQQGLSGKPYTFLFGDLKENS  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
             + + +A SKPI +SDDI PR LPF   + Q  G++SF+W+GP P V I +PE +K +F+K
Sbjct  61    RLLTEANSKPIAVSDDIKPRLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                + +P SNPL KLLA G+  HE +KW +HRKIINP F MEKLK M+PAFY SC+EM+ 
Sbjct  121   INDYPRPGSNPLVKLLADGLTSHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMVG  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
              WEK V  +   E+D W  LQ L  +VISRTAFGSS+EEG +IFELQ EQ    L    S
Sbjct  181   RWEKLVSVERSCEIDAWVDLQNLTGEVISRTAFGSSFEEGKRIFELQGEQAQLTLIALQS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRF+PTK NRRMK I+K+V A +MDI+ +R KA+R GEA+ DDLLG+LLESN +E
Sbjct  241   VYIPGWRFVPTKMNRRMKSIDKEVRALLMDIVRRREKAIREGEAAGDDLLGLLLESNMKE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
                    N GM+  +VIEECKLFY AGQETTS LLVWTMVLLS+H +WQ R
Sbjct  301   -------NVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQAR  344



>ref|XP_007022097.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
 gb|EOY13622.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
1 [Theobroma cacao]
Length=518

 Score =   384 bits (986),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 185/348 (53%), Positives = 247/348 (71%), Gaps = 4/348 (1%)
 Frame = +3

Query  72    LIGFSIAIV---FLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVE  242
             +IG S++ +    LV  WR+L+W W RP++L++ LR+QGL G  Y+F+ GD+K+      
Sbjct  6     VIGISLSFLVVGILVWGWRILDWVWMRPKRLERCLRKQGLTGNSYRFLSGDIKESFAMSR  65

Query  243   DAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
              A+SKP+ LSDDI+    PF    ++ +G++SF W+GP P V I +PE ++ +FTK   F
Sbjct  66    QARSKPMPLSDDITQYVGPFLHQTVKNSGKSSFSWVGPIPRVTIMEPEEIREIFTKFNDF  125

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
             QKP SNPL  LL  G++  + ++W KHRKIINP F  +KLK+M+PAFY SC EM+S+WEK
Sbjct  126   QKPHSNPLVSLLVSGLVNLDGEEWAKHRKIINPAFHQDKLKNMLPAFYQSCIEMISKWEK  185

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
              V  +G +ELDVWPYL +L  DVISR AFGSSYEEG +IF+L  +Q    +Q+  S YIP
Sbjct  186   LVFLEGSSELDVWPYLVKLTRDVISRAAFGSSYEEGRRIFQLLEDQTSLTMQVVQSAYIP  245

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQN  962
             GWR+LPTK NR+MK I K +  S+  +I KR +A +  E S DDLLGIL+ESN  EI++ 
Sbjct  246   GWRYLPTKTNRKMKVIAKDIKDSLKGMIKKREEATKASEVSNDDLLGILVESNIREIQEQ  305

Query  963   GN-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             G+ KN GM+  +VIEECKLFY AGQETTS LLVWTM+LL+ H  WQT+
Sbjct  306   GDHKNMGMSIEDVIEECKLFYFAGQETTSVLLVWTMILLARHPHWQTK  353



>ref|XP_008226217.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Prunus 
mume]
Length=522

 Score =   384 bits (986),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 196/355 (55%), Positives = 255/355 (72%), Gaps = 5/355 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLW--RMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKI  227
             + I+   +  S+ +V +V  W  R+LNW W RP KL++ LR+QGL G  Y+ +FGD K+I
Sbjct  3     ISIIQVCVALSVVLVSIVIAWAWRVLNWVWLRPNKLERCLREQGLTGNSYRLLFGDTKEI  62

Query  228   SKSVEDAKSKPINLS--DDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNV  401
             S  VE A+SKPI LS   DI+PR +PF    +   G NSFVW+GP P V I +PE +K+ 
Sbjct  63    SMMVEQAQSKPIKLSTTHDIAPRVIPFSHQIVYTYGRNSFVWMGPTPRVTIMNPEDLKDA  122

Query  402   FTKHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSE  581
             F K   FQ+  SNP+ K ++QG+   E +KW KHRKIINP F +EKLK M+P FY SCSE
Sbjct  123   FNKSDEFQRAISNPIVKSISQGLSSLEGEKWAKHRKIINPAFHLEKLKGMLPTFYQSCSE  182

Query  582   MLSEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQI  761
             M+++WE  V  +G  E+DVWPYL+ L SDVISR AFGSSYEEG KIF+L RE+  +    
Sbjct  183   MINKWESLVFKEGSREMDVWPYLENLTSDVISRAAFGSSYEEGRKIFQLLREEAKFYTIA  242

Query  762   SSSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESN  941
             + S+YIPGWRFLPTK+N+RMK+I K+V   +  II+KR  A++ GEA+  +LLGIL+ESN
Sbjct  243   ARSVYIPGWRFLPTKQNKRMKEIHKEVRGLLKGIINKREDAIKAGEAAKGNLLGILMESN  302

Query  942   FEEIEQNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             F EI+++G NKN GM+  +VI ECKLFY AGQETTS LLVWT+VLLS +Q+WQ R
Sbjct  303   FREIQEHGNNKNAGMSIEDVIGECKLFYFAGQETTSVLLVWTLVLLSQNQDWQAR  357



>ref|XP_009797437.1| PREDICTED: cytochrome P450 CYP72A219-like [Nicotiana sylvestris]
Length=515

 Score =   384 bits (985),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 248/351 (71%), Gaps = 2/351 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             M+IV  L    +    ++  W+M+NW W RPRKL+K  R+QG+ G  Y+ ++GD K++++
Sbjct  1     MKIVAILFSAIVINALVIWGWKMVNWVWLRPRKLEKCFRKQGMNGHPYRTLYGDTKEMAE  60

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
               ++A  KPI L+DDI PR  PF+   + K G + + W+GP+P +F+ +PEL+K + T +
Sbjct  61    LTKEAMLKPIKLTDDILPRIFPFYHHTLNKYGNHCYAWIGPEPRIFVMEPELIKEIVTNN  120

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
             TIF+KP   PL +LL  G+  +E++KW KHRKIIN  F  EKLK M+PA + SC +M+++
Sbjct  121   TIFKKPKPAPLVQLLVSGISSYEDEKWAKHRKIINTAFYAEKLKCMLPAMHTSCEDMINK  180

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WE  + +    ELDV PY + L SDVISRTAFGSSY EG +IF LQ+E      Q   S+
Sbjct  181   WEILLSENKSYELDVHPYFEDLTSDVISRTAFGSSYAEGTRIFHLQKELAELTRQAFQSV  240

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEAS-PDDLLGILLESNFEE  950
             YIPGWR+LPT+ NRRMK I+ ++   +  I+ KR +AM+ GEAS  +DLLGILL+SN +E
Sbjct  241   YIPGWRYLPTRTNRRMKAIDNELRDILRKIVSKRERAMKVGEASDEEDLLGILLKSNLKE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             I++ G K FGMTT EVIEECK+FY AGQE++S+LL+WTMVLLSMHQ WQ R
Sbjct  301   IQEGGRK-FGMTTDEVIEECKIFYFAGQESSSNLLIWTMVLLSMHQNWQAR  350



>ref|XP_007022098.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
 gb|EOY13623.1| Cytochrome P450, family 72, subfamily A, polypeptide 15 isoform 
2 [Theobroma cacao]
Length=518

 Score =   384 bits (985),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 185/348 (53%), Positives = 247/348 (71%), Gaps = 4/348 (1%)
 Frame = +3

Query  72    LIGFSIAIV---FLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVE  242
             +IG S++ +    LV  WR+L+W W RP++L++ LR+QGL G  Y+F+ GD+K+      
Sbjct  6     VIGISLSFLVVGILVWGWRILDWVWMRPKRLERCLRKQGLTGNSYRFLSGDIKESFAMSR  65

Query  243   DAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
              A+SKP+ LSDDI+    PF    ++ +G++SF W+GP P V I +PE ++ +FTK   F
Sbjct  66    QARSKPMPLSDDITQYVGPFLHQTVKNSGKSSFSWVGPIPRVTIMEPEEIREIFTKFNDF  125

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
             QKP SNPL  LL  G++  + ++W KHRKIINP F  +KLK+M+PAFY SC EM+S+WEK
Sbjct  126   QKPHSNPLVSLLVSGLVNLDGEEWAKHRKIINPAFHQDKLKNMLPAFYQSCIEMISKWEK  185

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
              V  +G +ELDVWPYL +L  DVISR AFGSSYEEG +IF+L  +Q    +Q+  S YIP
Sbjct  186   LVFLEGSSELDVWPYLVKLTRDVISRAAFGSSYEEGRRIFQLLEDQTSLTMQVVQSAYIP  245

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQN  962
             GWR+LPTK NR+MK I K +  S+  +I KR +A +  E S DDLLGIL+ESN  EI++ 
Sbjct  246   GWRYLPTKTNRKMKVIAKDIKDSLKGMIKKREEATKASEVSNDDLLGILVESNIREIQEQ  305

Query  963   GN-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             G+ KN GM+  +VIEECKLFY AGQETTS LLVWTM+LL+ H  WQT+
Sbjct  306   GDHKNMGMSIEDVIEECKLFYFAGQETTSVLLVWTMILLARHPHWQTK  353



>ref|XP_008226216.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X1 [Prunus 
mume]
Length=521

 Score =   384 bits (985),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 195/348 (56%), Positives = 252/348 (72%), Gaps = 5/348 (1%)
 Frame = +3

Query  75    IGFSIAIVFLVCLW--RMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDA  248
             +  S+ +V +V  W  R+LNW W RP KL++ LR+QGL G  Y+ +FGD K+IS  VE A
Sbjct  9     VALSVVLVSIVIAWAWRVLNWVWLRPNKLERCLREQGLTGNSYRLLFGDTKEISMMVEQA  68

Query  249   KSKPINLS--DDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
             +SKPI LS   DI+PR +PF    +   G NSFVW+GP P V I +PE +K+ F K   F
Sbjct  69    QSKPIKLSTTHDIAPRVIPFSHQIVYTYGRNSFVWMGPTPRVTIMNPEDLKDAFNKSDEF  128

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
             Q+  SNP+ K ++QG+   E +KW KHRKIINP F +EKLK M+P FY SCSEM+++WE 
Sbjct  129   QRAISNPIVKSISQGLSSLEGEKWAKHRKIINPAFHLEKLKGMLPTFYQSCSEMINKWES  188

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
              V  +G  E+DVWPYL+ L SDVISR AFGSSYEEG KIF+L RE+  +    + S+YIP
Sbjct  189   LVFKEGSREMDVWPYLENLTSDVISRAAFGSSYEEGRKIFQLLREEAKFYTIAARSVYIP  248

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQN  962
             GWRFLPTK+N+RMK+I K+V   +  II+KR  A++ GEA+  +LLGIL+ESNF EI+++
Sbjct  249   GWRFLPTKQNKRMKEIHKEVRGLLKGIINKREDAIKAGEAAKGNLLGILMESNFREIQEH  308

Query  963   G-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             G NKN GM+  +VI ECKLFY AGQETTS LLVWT+VLLS +Q+WQ R
Sbjct  309   GNNKNAGMSIEDVIGECKLFYFAGQETTSVLLVWTLVLLSQNQDWQAR  356



>gb|KCW67646.1| hypothetical protein EUGRSUZ_F01394 [Eucalyptus grandis]
Length=510

 Score =   383 bits (983),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 249/351 (71%), Gaps = 8/351 (2%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVC-LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME     I  +  +  L    WR++NW W RP++L+++LRQQGL G  Y F+FGDLK+ S
Sbjct  1     MEASIQSIALATVLAVLTTWAWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENS  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
             + + +A SKPI++SDDI PR LPF   + Q  G++SF+W+GP P V I +PE +K +F+K
Sbjct  61    RLLTEANSKPISVSDDIKPRLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                + +P SNPL KLLA G+  HE +KW +HRKIINP F MEKLK M+PAFY SC+EM+ 
Sbjct  121   INDYPRPGSNPLVKLLADGLASHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMVG  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
              WEK V      E+D W  LQ L  +VISRTAFGSS+EEG +IFELQ EQ    L    S
Sbjct  181   RWEKLVSVDRSCEIDAWVDLQNLTREVISRTAFGSSFEEGKRIFELQGEQAQLTLIALQS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRF+PTK NRRMK I+K+V A +MDII +R KA+R GEA+ DDLLG+LLESN +E
Sbjct  241   VYIPGWRFVPTKMNRRMKSIDKEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMKE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
                    N GM+  +V+EEC+LFY AGQETTS LLVWTMVLLS+H +WQ R
Sbjct  301   -------NVGMSLHDVMEECRLFYFAGQETTSVLLVWTMVLLSVHSDWQAR  344



>ref|XP_008226302.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=518

 Score =   382 bits (982),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 181/352 (51%), Positives = 244/352 (69%), Gaps = 2/352 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCL-WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEI    +  +I  V L+ L W+++NW W +P+KL++ LRQQGL G  Y+ + GDL   S
Sbjct  1     MEISVSSMVVAILCVGLITLGWKVVNWVWLKPKKLERYLRQQGLSGNSYRLLIGDLTDNS  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
             K  ++A SKP+  S DI P  LP   +   K G+ SF+WLGP P V I D EL++   TK
Sbjct  61    KMTKEALSKPMEFSHDIVPYVLPLLQETFNKYGKKSFIWLGPVPSVVIFDAELMRETLTK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
             H +F+KP SNPL   L  G++ +E DKWVKH++IINP F ++K+K M+PAF+ +C  MLS
Sbjct  121   HRVFEKPHSNPLLSFLVTGLLSYEGDKWVKHKRIINPAFHIDKMKDMLPAFHAACENMLS  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
             +WE +   +   ELDVWPYL   + D ISR AFGS++EEG + FELQ+EQ     ++ +S
Sbjct  181   KWETHFSSKETCELDVWPYLCAFSGDAISRAAFGSNFEEGERFFELQKEQGALTREVLNS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIP  RFLPTK NR MKQI  ++   +  II+KR KAMR GEA+ DDLLGILL+SNF E
Sbjct  241   VYIPLLRFLPTKMNRSMKQISDEMAICLRGIINKREKAMRAGEATEDDLLGILLKSNFSE  300

Query  951   IEQNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             I+++G +K+ GM+  EVIEECK+FYLAG++TT  L+ WT+VLL  HQ+WQ R
Sbjct  301   IQEHGDDKDVGMSIEEVIEECKVFYLAGEDTTKDLINWTLVLLGKHQDWQRR  352



>ref|XP_010060776.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67641.1| hypothetical protein EUGRSUZ_F01387 [Eucalyptus grandis]
Length=510

 Score =   382 bits (981),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 195/351 (56%), Positives = 251/351 (72%), Gaps = 8/351 (2%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVC-LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME+    I  +  +  L    WR +NW W RP++L+++LRQQGL G  Y F+FGDLK+  
Sbjct  1     MEVSMQSIALATVLAVLTTWAWRAVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENL  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
             + +++AKSKPI +SDDI PR LPF   + Q  G++ F W+GP P V I +PE +K +F+K
Sbjct  61    RMLKEAKSKPIAVSDDIKPRLLPFLHRSFQTYGKDWFTWMGPIPRVNITNPEQIKEIFSK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                + KP SN L KLLA G+  HE +KW +HRKIINP F MEKLKHM+PAFY SC+EM+ 
Sbjct  121   IYDYPKPASNALVKLLADGLANHEGEKWARHRKIINPAFHMEKLKHMLPAFYSSCTEMVD  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
              WEK+V ++   E+D W  LQ L  DVISRTAFGSS+EEG +IFELQ EQ    ++   S
Sbjct  181   RWEKSVLEERSCEVDAWVDLQNLTRDVISRTAFGSSFEEGKRIFELQEEQALLAIKALQS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRF+PTK NRRM+ I+K+V A +MDI+ +R KA+R G A+ DDLLG+LLESN +E
Sbjct  241   VYIPGWRFVPTKMNRRMQNIDKEVQALLMDIVRRREKAIRAGGAAGDDLLGLLLESNMKE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
                    N GM+  +VIEECKLFY+AGQETTS LLVWTMVLLS+H +WQ R
Sbjct  301   -------NAGMSLHDVIEECKLFYIAGQETTSVLLVWTMVLLSVHPDWQAR  344



>ref|XP_011082818.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=521

 Score =   382 bits (982),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 184/355 (52%), Positives = 251/355 (71%), Gaps = 6/355 (2%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLW--RMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKI  227
             ME+    I  S+ IV L+  W  R+LNW WFRP+KL+K+LR+QGL+G  Y+F+ GD+K +
Sbjct  3     MELKLSSIFISVLIVGLIT-WAVRILNWVWFRPKKLEKLLRKQGLQGNPYRFLLGDMKTL  61

Query  228   SKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
                 ++ ++K I LSD ++P  LP++   I + G+NSF+W GP P + I DP+L+K + T
Sbjct  62    ISVTKEEQTKSIQLSDHLAPHILPYYHQIINEYGQNSFIWFGPSPRLNITDPQLMKEILT  121

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             K  +F KP  +P+ + +A G++F E++KW +HRKIINP F MEKLK+M+ A  LSCS M+
Sbjct  122   KPEVFHKPLPDPIGETIAGGLLFLEDEKWAQHRKIINPAFHMEKLKNMVSAIRLSCSNMV  181

Query  588   SEWEKNVG-DQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQIS  764
              +WE      +   E+DVWP+L+ L+ DVISRTAFGSS+EEG +IFEL REQV  VL++ 
Sbjct  182   EKWESMFSRSERSLEIDVWPHLESLSGDVISRTAFGSSHEEGRRIFELHREQVKLVLELL  241

Query  765   SSIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNF  944
                +IPGWRF+PTK NRRM+ I K++ + +  II++R KAM  GE   DDLL  L+ESN 
Sbjct  242   KFFFIPGWRFVPTKANRRMRAISKEIQSLLRGIINQREKAMERGETVGDDLLSTLMESNL  301

Query  945   EEIEQNGN--KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +EIE++G   K+ GM   +VI ECKLFY AG ETTS LLVWTMV+LS HQEWQ R
Sbjct  302   KEIEEHGGKKKDVGMDIEDVINECKLFYFAGSETTSLLLVWTMVMLSKHQEWQVR  356



>ref|XP_010064522.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67638.1| hypothetical protein EUGRSUZ_F01383 [Eucalyptus grandis]
Length=510

 Score =   382 bits (980),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 195/351 (56%), Positives = 249/351 (71%), Gaps = 8/351 (2%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCL-WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEI    I  +  +  L  L W ++NWAW RP++++ +LRQQGL G  + F+FGDLK+IS
Sbjct  1     MEISIQSIALATVLAVLTTLAWMVVNWAWLRPKRIEGLLRQQGLSGRPHTFLFGDLKEIS  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
             + + +AKSKP  LSDDI PR LP    + Q  G+NSF+W+GP P V I +PEL+K +F+K
Sbjct  61    RLMREAKSKPFGLSDDIKPRLLPLVHQSFQTYGKNSFMWIGPTPTVNITNPELLKEIFSK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                ++KPP +PL KLL  G+ FHE  KWV+HRKIINP F +EKLK  +PAFY SC+EM+ 
Sbjct  121   MYDYRKPPRSPLLKLLFGGLAFHEGKKWVQHRKIINPAFHVEKLKLTLPAFYSSCTEMVG  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
              WE  V +    E+D W  LQ L+ D+ISRTAFGS Y EG +IFELQ E     ++   S
Sbjct  181   RWEYLVSEVRSCEVDAWVDLQNLSRDLISRTAFGSRYAEGKRIFELQEELALLTMKALQS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRFLPT+ NRRMK I+K+V A +MDII +R KA+RGGEA+ DDLLG+LLESN +E
Sbjct  241   VYIPGWRFLPTRMNRRMKNIDKEVQALLMDIIRRREKAIRGGEAAGDDLLGLLLESNMKE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
                    N GM+  +V EECK FY+AGQETTS LLVWTMVLLS+H +WQ R
Sbjct  301   -------NAGMSFHDVTEECKFFYVAGQETTSVLLVWTMVLLSVHPDWQAR  344



>ref|XP_010324391.1| PREDICTED: cytochrome P450 CYP72A219-like isoform X2 [Solanum 
lycopersicum]
Length=472

 Score =   380 bits (976),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 196/351 (56%), Positives = 248/351 (71%), Gaps = 45/351 (13%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             ME+V      +I I   VCLW++LNW WFRP+KL+K+LR+QGL G  Y+ ++GD+K  SK
Sbjct  1     MELVTACCC-AITITLFVCLWKVLNWVWFRPKKLEKLLRKQGLNGNSYRLLYGDMKDFSK  59

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
              +++A SKP+NLS+DI+PR +PFF++ I+K                              
Sbjct  60    MIKEANSKPMNLSNDITPRLVPFFLETIKKYA----------------------------  91

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
                          LL QG+  +EEDKW KHRKIINP F +EKLKHM+PAF+LSCSEMLS+
Sbjct  92    -------------LLVQGLAAYEEDKWAKHRKIINPAFHLEKLKHMLPAFHLSCSEMLSK  138

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WE  V  +G  E+DVWP+LQQL  DVISRTAFGSSYEEG KIFELQREQ  + +    S+
Sbjct  139   WEDAV--EGSCEIDVWPHLQQLTCDVISRTAFGSSYEEGRKIFELQREQAQHFIDTVRSV  196

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGG-EASPDDLLGILLESNFEE  950
              IP WRFLPTKRNRRMK+I+ +V  S+  IIDKR+KAM+ G +A  +DLLG+LLESNF+E
Sbjct  197   NIPRWRFLPTKRNRRMKEIKNEVRTSMKGIIDKRMKAMKAGHDADNEDLLGVLLESNFKE  256

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             IEQ+GNK+FGM+  EVIEECKLFY AGQET + LLVWT+VLLS +Q+WQT+
Sbjct  257   IEQHGNKDFGMSIEEVIEECKLFYFAGQETIAVLLVWTLVLLSRYQDWQTQ  307



>ref|XP_007149376.1| hypothetical protein PHAVU_005G065000g [Phaseolus vulgaris]
 gb|ESW21370.1| hypothetical protein PHAVU_005G065000g [Phaseolus vulgaris]
Length=523

 Score =   382 bits (981),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 179/332 (54%), Positives = 245/332 (74%), Gaps = 2/332 (1%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINL-SDDISPR  290
             W MLNW WF P++L+++LR+QGL+G  Y  + GD  + +K  ++A SKP++L S+DI  R
Sbjct  25    WMMLNWLWFTPKRLERLLREQGLQGNPYTLLVGDTNEFAKMRKEAFSKPMDLFSNDIVQR  84

Query  291   ALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGV  470
               PFF  +I  +G+NSF+W GP P V + DPEL+K+VF K   FQK   NP  +LL  G+
Sbjct  85    VYPFFRHSINTHGKNSFIWFGPAPRVILTDPELIKDVFNKTFDFQKIYLNPQVRLLTPGL  144

Query  471   IFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYL  650
             + HE +KW KHRKII P F +EKLK M+P     C +++S+WE+ +   G +E+DVWP+L
Sbjct  145   VSHEGEKWRKHRKIITPVFNLEKLKDMLPVLIKCCDDLISKWEEMLSLDGSSEMDVWPFL  204

Query  651   QQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQI  830
             Q L S+ ISRTAFGSSYEEG +IF+L +EQ     Q+   +YIPGWRF+PT  +RRMK+I
Sbjct  205   QNLTSEAISRTAFGSSYEEGRRIFQLLKEQSELTAQLVYKVYIPGWRFVPTTTHRRMKEI  264

Query  831   EKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTTREVIEE  1007
             +K+  AS+MDII+ + KA++ GEA+ +DLL ILLESN +EI+++G NKN G+   +VIEE
Sbjct  265   DKETKASLMDIINNKEKALKAGEATKNDLLDILLESNHKEIQEHGNNKNVGLNIEDVIEE  324

Query  1008  CKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             CKLFY AGQ++TSSLLVWTM+LLSM+ +WQTR
Sbjct  325   CKLFYFAGQDSTSSLLVWTMILLSMYPDWQTR  356



>ref|XP_009343589.1| PREDICTED: cytochrome P450 CYP72A219-like [Pyrus x bretschneideri]
Length=515

 Score =   381 bits (979),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 184/331 (56%), Positives = 242/331 (73%), Gaps = 1/331 (0%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             WR++NW W RP+KL++ LRQQGL G  Y+F  GD+K+IS + E A SKP++LS  I+PR 
Sbjct  21    WRVVNWLWLRPKKLERYLRQQGLAGNLYRFKSGDMKEISMTTEQAYSKPMSLSHYIAPRV  80

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGVI  473
             +PF    +    +NSFVW+G  P V I +PE +K + TK   F +P  NPL KLLA G+ 
Sbjct  81    IPFHHRLVNTYRKNSFVWMGTIPRVIITNPEDLKYILTKMEEFPQPEPNPLVKLLATGIA  140

Query  474   FHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYLQ  653
              +E +KW KH++IINP F +EKLK M+PAFY SCSEM+ EWE  V  +G  ELDV P L+
Sbjct  141   LYEGEKWAKHQRIINPVFHLEKLKRMLPAFYESCSEMIVEWESLVLKEGSCELDVRPCLE  200

Query  654   QLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQIE  833
              L +D+ISR+AFGSSY+EG KIF+L REQ   V ++  ++YIPGWRF+PTK N++MK I+
Sbjct  201   NLTADMISRSAFGSSYKEGRKIFQLLREQAQLVTKVIQNVYIPGWRFVPTKMNKKMKGID  260

Query  834   KQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN-KNFGMTTREVIEEC  1010
             K++   +M II+KR + +R GEA+ DDLLG L+ESN +EI+++GN K  GM+  +VIEEC
Sbjct  261   KEIRGLLMGIINKREEGIRAGEATKDDLLGNLMESNLKEIKEHGNDKTVGMSMDDVIEEC  320

Query  1011  KLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             KLFY AGQETTS LLVWTMVLL  +Q WQ R
Sbjct  321   KLFYFAGQETTSLLLVWTMVLLGQNQIWQDR  351



>emb|CBI39923.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   379 bits (974),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 178/290 (61%), Positives = 225/290 (78%), Gaps = 1/290 (0%)
 Frame = +3

Query  237   VEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHT  416
             + +A S+PI+ SDDI  R LPF   +IQK G+NSF WLGPKP+V I +PEL+++VF KH 
Sbjct  2     INEANSRPISFSDDIVQRVLPFHDHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVFLKHN  61

Query  417   IFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEW  596
              FQK P +PL KLLA GV+  E ++W K RKIINP F +EKLKHM+ AF LSCS+M+++W
Sbjct  62    AFQKVPPHPLGKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKW  121

Query  597   EKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIY  776
             EK +   G  ELDVWPYL+ LA DVISRTAFGSSYEEG +IF+LQREQ    +Q++ SIY
Sbjct  122   EKKLSLDGSCELDVWPYLENLAGDVISRTAFGSSYEEGRRIFQLQREQAHLAIQVTRSIY  181

Query  777   IPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIE  956
             +PGWRF PTK NRRM+QI  +V+A +  II+KR KAM+ GE +  DLLG+L+ESN+ +++
Sbjct  182   VPGWRFFPTKTNRRMRQISNEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNYRDMQ  241

Query  957   QNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +N   KN GM+ ++VIEECKLFYLAGQETTS LL+WTMVLLS H  WQTR
Sbjct  242   ENDERKNVGMSIKDVIEECKLFYLAGQETTSVLLLWTMVLLSKHSNWQTR  291



>ref|XP_011098146.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=517

 Score =   381 bits (979),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 171/340 (50%), Positives = 247/340 (73%), Gaps = 1/340 (0%)
 Frame = +3

Query  87    IAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPIN  266
             + +V    + ++LNW WFRP+KL+K+LR+QGL G  Y+   GD++ +S  ++  + K + 
Sbjct  13    LILVSTALIVKLLNWVWFRPKKLEKLLRKQGLNGNPYRLFRGDMQDLSNVMKTKQPKTLK  72

Query  267   LSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPL  446
             LSDD+ P  LP++ + I K G++SF+W+GP P + + DPE +K + +K  +F KP  +P+
Sbjct  73    LSDDLPPHILPYYHNIIDKYGKHSFIWVGPSPRLNVADPEHIKEILSKPGLFHKPLPDPI  132

Query  447   SKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLA  626
              + +  G+ + E+D+W KHR+I+NP F MEKLK+MIPA +LSCS+++ +WE ++   G +
Sbjct  133   GETIVGGLAYLEDDRWAKHRRIMNPAFHMEKLKNMIPAMFLSCSKLIEKWEASISGSGSS  192

Query  627   -ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPT  803
              E+DVWPYLQ L  DVISRTAFG SYEEG +IFELQREQV  VL +    ++PGWR+ PT
Sbjct  193   QEIDVWPYLQDLTGDVISRTAFGRSYEEGRRIFELQREQVKLVLHLFPFSFLPGWRYFPT  252

Query  804   KRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFGM  983
             K NR+++ I K++ + +  II++R +AM  GE    DLLGIL+ESN  EI+Q+GNKN G+
Sbjct  253   KANRKLRAITKEIQSLVRGIINQREQAMARGEIIHMDLLGILMESNSREIQQHGNKNAGL  312

Query  984   TTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +  +VIEECKLFY AG ++TS+LLVWTMVLLS HQ+WQ R
Sbjct  313   SIEDVIEECKLFYFAGSDSTSTLLVWTMVLLSNHQDWQAR  352



>ref|XP_011098149.1| PREDICTED: cytochrome P450 CYP72A219-like [Sesamum indicum]
Length=515

 Score =   381 bits (978),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 176/345 (51%), Positives = 248/345 (72%), Gaps = 6/345 (2%)
 Frame = +3

Query  72    LIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAK  251
             LI  S A+V      ++LNW WFRP+KL+K+LR+QGL G  Y+   GD++ ++  ++  +
Sbjct  11    LILVSTALVV-----KVLNWVWFRPKKLEKLLRKQGLNGNPYRLFLGDMQDLTNVLKTQQ  65

Query  252   SKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKP  431
              K +NLSDD+ P  LP++ + I   G++SFVW GP P + + DPEL+K + +K  +F K 
Sbjct  66    PKTLNLSDDLRPHILPYYQNIIDNFGKHSFVWFGPSPRLNVADPELIKEILSKPRLFHKA  125

Query  432   PSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVG  611
               +P+ + +  G+ + E++KW KHRKI+N  F MEKLK+MIPA +LSCS+M+ +WE  + 
Sbjct  126   LPDPIGETIVGGLSYLEDEKWAKHRKIVNEAFHMEKLKNMIPAMFLSCSKMIEKWEALIS  185

Query  612   DQGLA-ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGW  788
               G + E+DVWP+L+ L  DVISRTAFGSSYEEG +IF+LQ+EQV  +L +    +IPGW
Sbjct  186   RSGSSQEIDVWPFLEDLTGDVISRTAFGSSYEEGRRIFQLQKEQVKLLLHLLQFSFIPGW  245

Query  789   RFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN  968
             R+ PTK NRR++ I KQ+ + +  +I++R KAM  GE    DLL IL+ESNF+EI+++GN
Sbjct  246   RYFPTKANRRLRAITKQIQSLLRGMINQREKAMERGEIIHSDLLSILMESNFKEIQEHGN  305

Query  969   KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             KN G++  +VIEECKLFY AG ETTS+LLVWTMVLLS HQ+WQ R
Sbjct  306   KNVGLSIEDVIEECKLFYFAGSETTSTLLVWTMVLLSKHQDWQAR  350



>ref|XP_007022099.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
 gb|EOY13624.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
Length=518

 Score =   380 bits (977),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/353 (52%), Positives = 253/353 (72%), Gaps = 2/353 (1%)
 Frame = +3

Query  48    EMMEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKI  227
             E   ++  L+ F + +  L+  WR+L+W W +P++L++ LR+QGL+G  Y+F+ GD+K+ 
Sbjct  2     EFSPVIGTLLSF-LVVGILIGGWRILDWVWLKPKRLERCLRKQGLRGNSYRFLSGDIKES  60

Query  228   SKSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT  407
             S   + A+SKP+ LSDDI+    PF    ++  G+NSFVW+GP+P V I +PE ++ +FT
Sbjct  61    SDMSKQARSKPMPLSDDIAQYVSPFLHQTVKNYGKNSFVWIGPRPRVTIMEPEQIREIFT  120

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             K   FQKP S P+  LL  G+   + ++W KHR IINP F  +KLK+M+PAFY SC EM+
Sbjct  121   KFNDFQKPRSYPVGNLLVCGLANLQGEEWAKHRNIINPAFHQDKLKNMLPAFYQSCIEMI  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             S+WEK V  +G +ELDVWPYL  L  DVISR AFGSSYEEG +IF+L  +Q+   +Q+  
Sbjct  181   SKWEKMVFVEGSSELDVWPYLINLTRDVISRAAFGSSYEEGRRIFQLLDDQINLTMQVIQ  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             S+YIPG  FLPTK NR++K I K +   + ++I KR KA++ GEAS DDLLGIL+ESN +
Sbjct  241   SVYIPGSWFLPTKTNRKLKVIVKDIKDLLKEMIKKREKAIKAGEASKDDLLGILVESNIK  300

Query  948   EIEQNGN-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EI+++G+ KN GM+  +VIE+CKLFY AGQETTS LLVWTM+LL+ H  WQT+
Sbjct  301   EIQEHGDHKNMGMSIEDVIEDCKLFYFAGQETTSILLVWTMILLARHPHWQTK  353



>emb|CDP15974.1| unnamed protein product [Coffea canephora]
Length=455

 Score =   378 bits (971),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 184/286 (64%), Positives = 228/286 (80%), Gaps = 0/286 (0%)
 Frame = +3

Query  243   DAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
             +AKSKPI+LSDDI PR +PF +  I K G NSF+WLGPKP V I+DPEL++ +F KH +F
Sbjct  4     EAKSKPISLSDDIVPRVIPFHVKTINKYGSNSFLWLGPKPSVIIRDPELLREIFLKHNLF  63

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
              K  SNPL KLLA+G++  E DKW K RKIINP F +EK+K M+PAF+ S SEML  WE+
Sbjct  64    PKQHSNPLGKLLAKGLLDSEGDKWAKDRKIINPAFNLEKIKLMLPAFHSSASEMLRNWEE  123

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
              +  +G  ELDVWPYLQ L  DVISRTAFGS+YEEG KI ELQ+EQV +V+    S+YIP
Sbjct  124   KLSPEGSCELDVWPYLQTLTGDVISRTAFGSNYEEGRKILELQQEQVDHVVTAERSLYIP  183

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQN  962
             G RFLPTKRNRRMK+IEK V A+I DIID++VKAM+ GE   DDLLGILLESNF+EI+Q 
Sbjct  184   GMRFLPTKRNRRMKEIEKVVQATIRDIIDRKVKAMKAGEGRRDDLLGILLESNFKEIDQY  243

Query  963   GNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQT  1100
             G+K+FGM+ +++IEECKLFY  GQ+TTS+LLVW ++LLS HQ+WQ+
Sbjct  244   GSKDFGMSIKDIIEECKLFYFGGQDTTSTLLVWALILLSKHQDWQS  289



>ref|XP_010926817.1| PREDICTED: cytochrome P450 72A15-like isoform X3 [Elaeis guineensis]
Length=519

 Score =   380 bits (976),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 245/348 (70%), Gaps = 5/348 (1%)
 Frame = +3

Query  72    LIGFSIAIVFLVCLW--RMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVED  245
             ++G  + ++FL+ +W  R L W W+RPR+L+ +LR QGL GT Y+F++GDLK   +  + 
Sbjct  8     MVGAVVGVLFLL-VWAVRALEWVWWRPRRLEGLLRAQGLSGTRYRFLYGDLKDNVRLQKA  66

Query  246   AKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT-KHTIF  422
             A+SKP+ LS  I PR LPFF  AI+ +G+ SF W GP P V +KDPELV+ V + K   F
Sbjct  67    ARSKPMPLSHCIGPRVLPFFHQAIEDHGKISFTWFGPYPTVILKDPELVREVLSNKFGHF  126

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
             +KP  NPL KLLA+GV  +E +KW KHR+IINP F +EKLKHM P F   C E+++ W+ 
Sbjct  127   EKPNINPLGKLLARGVADYEGEKWAKHRRIINPAFHLEKLKHMFPTFATCCDELINRWDN  186

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
             +VG Q   ELDVWP  Q    DVISR AFGSS++EG +IF+LQ EQ+  ++Q + +IYIP
Sbjct  187   HVGSQAYCELDVWPEFQNFTGDVISRVAFGSSFKEGQRIFQLQEEQMELLVQAAQNIYIP  246

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE-EIEQ  959
             G+RFLPTK+N RM +I +++ A +  +I++R +AMR   A+ DDLLG+L+ESN     EQ
Sbjct  247   GYRFLPTKKNNRMYEIYREIRALLSRMIEQRERAMRKSGATNDDLLGLLIESNLRYSQEQ  306

Query  960   NGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              G+KN GMT  +VIEECKLFY AG +TT  LL WT+V+L MH  WQ R
Sbjct  307   GGSKNTGMTKDDVIEECKLFYFAGHKTTLVLLTWTVVILGMHPSWQAR  354



>ref|XP_007149361.1| hypothetical protein PHAVU_005G063800g [Phaseolus vulgaris]
 gb|ESW21355.1| hypothetical protein PHAVU_005G063800g [Phaseolus vulgaris]
Length=516

 Score =   380 bits (976),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 178/332 (54%), Positives = 239/332 (72%), Gaps = 2/332 (1%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINL-SDDISPR  290
             WRM+NW W  P++L+++LR+QGL+G  YKF  GD K+I K  ++  SKP++L S DI PR
Sbjct  18    WRMVNWLWLTPKRLERLLREQGLEGKPYKFFVGDTKEIEKMKKEGLSKPMDLFSHDIVPR  77

Query  291   ALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGV  470
                FF  +I  +G+  F W GP P V + DP+L+K+V  K   F +   +P  K L  G+
Sbjct  78    VFSFFHHSINTHGKICFTWFGPIPRVILTDPDLIKDVLNKMNEFGRINMHPQLKFLVPGL  137

Query  471   IFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYL  650
             + HE ++W KHRKIINP F +EKLK+M P F   C +++S+WE+ +G  G +E+DVWP+L
Sbjct  138   VSHEGERWSKHRKIINPAFNLEKLKNMFPPFIKCCDDLISKWEEMLGSDGSSEIDVWPFL  197

Query  651   QQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQI  830
               +ASD ISRTAFGSS+EEG +IF+L +EQ+   ++I S +YIPGWRF+PT + RRMK I
Sbjct  198   HNMASDAISRTAFGSSFEEGRRIFQLLKEQIELTVEIISKVYIPGWRFVPTTKQRRMKAI  257

Query  831   EKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNG-NKNFGMTTREVIEE  1007
             +K++  S+ DII+ RVKA+  GEA+  DLLGILLESN +EIE+ G NKN GM   +VI E
Sbjct  258   DKEIKCSLTDIINNRVKALETGEATKMDLLGILLESNQKEIEEQGNNKNIGMNNEDVIAE  317

Query  1008  CKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             CKLFY AG ET SSLLVWTM+LLSM+ +WQTR
Sbjct  318   CKLFYFAGHETVSSLLVWTMILLSMYPDWQTR  349



>emb|CBI39929.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   378 bits (970),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 175/290 (60%), Positives = 223/290 (77%), Gaps = 1/290 (0%)
 Frame = +3

Query  237   VEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHT  416
             + +A S+PI+ SDDI  R LPF   +IQK G+N+F+WLGPKP+V I  PEL+++V  KH 
Sbjct  2     INEANSRPISFSDDIVQRVLPFHDHSIQKYGKNNFIWLGPKPVVNIMQPELIRDVLLKHN  61

Query  417   IFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEW  596
              FQKPP +PL KLLA GV   E ++W K RKIINP F +EKLKHM+ AF LSCS+M+++W
Sbjct  62    AFQKPPRHPLGKLLASGVASLEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKW  121

Query  597   EKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIY  776
             EK +   G  ELD+WPYLQ L  DVISRTAFGSSYEEG +IF+LQ+EQ    +Q++ S+Y
Sbjct  122   EKQLSLDGSCELDIWPYLQNLTGDVISRTAFGSSYEEGRRIFQLQKEQALLTVQVTRSVY  181

Query  777   IPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIE  956
             +PGWRF PTK NRRM+QI  +V A +  II+KR KAM+ GE + DDLLG+L+ESN+ E++
Sbjct  182   VPGWRFFPTKTNRRMRQISSEVDALLKGIIEKREKAMQAGETANDDLLGLLMESNYREMQ  241

Query  957   QNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             +N   KN GM+ ++VIEECKLFYLAGQETTS+LL+WTMVLLS H  WQ R
Sbjct  242   ENDERKNVGMSIKDVIEECKLFYLAGQETTSALLLWTMVLLSKHSNWQAR  291



>ref|XP_009394210.1| PREDICTED: cytochrome P450 CYP72A219-like [Musa acuminata subsp. 
malaccensis]
Length=526

 Score =   380 bits (977),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 251/345 (73%), Gaps = 2/345 (1%)
 Frame = +3

Query  75    IGFSIA-IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAK  251
             +G+ +A ++FL    R+LNWAW+RPR+L++ LR QGLKGT Y+F +GDLK+ ++  ++A+
Sbjct  13    LGWGVAGLLFLAWASRVLNWAWWRPRRLERALRAQGLKGTAYRFPYGDLKENARFSKEAR  72

Query  252   SKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT-KHTIFQK  428
             +K + L+ +I PR LPF+  A+ + G+ SF W GP P V I DPELV+ V + K   F K
Sbjct  73    AKSMPLAHNIIPRLLPFYHRAMDEYGKISFTWSGPVPQVAITDPELVREVLSNKFGHFGK  132

Query  429   PPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNV  608
             P  NPL++  A+G+  +E +KWVKHR+I+NP F  EKLK M+PAF   CS+++  WE   
Sbjct  133   PNQNPLARFFARGLAVYEGEKWVKHRRILNPAFHAEKLKRMLPAFSACCSDLMDRWENMA  192

Query  609   GDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGW  788
             G +   ELDVWP LQ    DVISRTAFGSS++EG  IF+LQ EQ   ++Q+  ++Y+PG+
Sbjct  193   GSEACYELDVWPELQSFTGDVISRTAFGSSHKEGRPIFQLQAEQAELLIQVVQNLYVPGY  252

Query  789   RFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN  968
             RFLPT +N+R++ I++++ + +  II KR + ++ G+AS DDLLG+L+ESN + ++++GN
Sbjct  253   RFLPTPKNKRIRAIDREIRSILRGIIKKREQDIKTGKASNDDLLGLLMESNMKHLQEDGN  312

Query  969   KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             KN GMTT +VIEECKLFY AGQETTS LL WTM+ LSMH  WQ R
Sbjct  313   KNAGMTTEDVIEECKLFYFAGQETTSVLLTWTMICLSMHPTWQIR  357



>emb|CAN72865.1| hypothetical protein VITISV_029731 [Vitis vinifera]
Length=502

 Score =   379 bits (974),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 187/349 (54%), Positives = 246/349 (70%), Gaps = 20/349 (6%)
 Frame = +3

Query  66    FGLIGFSIA-IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVE  242
               L+  S A I  L+  WR+LNW W RP++L++ L+QQGL G  Y+ + GD K++   ++
Sbjct  6     LNLVALSFAFITILIYAWRILNWMWLRPKRLERCLKQQGLAGNSYRLLHGDFKEMFMMIK  65

Query  243   DAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
             +A S+PI++SDDI  R  PF   +I+K G++SF+W+GPKP V I +PEL+++V + HT+F
Sbjct  66    EATSRPISISDDIVQRIAPFHYHSIKKYGKSSFIWMGPKPRVNIMEPELIRDVLSMHTVF  125

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLK-HMIPAFYLSCSEMLSEWE  599
             +KP  + L KLL  G++F + +KW KHRKIINP F++EK+K H      +SC        
Sbjct  126   RKPRVHALVKLLVSGLLFLDGEKWAKHRKIINPAFRLEKVKRHDKQMGLVSC--------  177

Query  600   KNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYI  779
                      ELDVWPYLQ L  D ISRTAFGS+YE+G  IFELQREQ   ++Q S S +I
Sbjct  178   ---------ELDVWPYLQNLTGDAISRTAFGSNYEKGRMIFELQREQAQLLVQFSESAFI  228

Query  780   PGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQ  959
             PGWRF PTK N+RMKQI K+V+A +  IIDKR KAM+ GE   DDLLGILLESNF+EI++
Sbjct  229   PGWRFXPTKSNKRMKQIRKEVNALLWGIIDKRGKAMKAGETLNDDLLGILLESNFKEIQE  288

Query  960   NGN-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             + N KN GM+ ++VIEECKLFY AG ETTS+LL+WTMVLLS H  WQ R
Sbjct  289   HENDKNVGMSIKDVIEECKLFYFAGXETTSALLLWTMVLLSKHPNWQAR  337



>ref|XP_010926808.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Elaeis guineensis]
Length=519

 Score =   380 bits (975),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 182/348 (52%), Positives = 245/348 (70%), Gaps = 5/348 (1%)
 Frame = +3

Query  72    LIGFSIAIVFLVCLW--RMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVED  245
             ++G  + ++FL+ +W  R L W W+RPR+L+ +LR QGL GT Y+F++GDLK   +  + 
Sbjct  8     MVGAVVGVLFLL-VWAVRALEWVWWRPRRLEGLLRAQGLSGTRYRFLYGDLKDNVRLQKA  66

Query  246   AKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT-KHTIF  422
             A+SKP+ LS  I PR LPFF  AI+ +G+ SF W GP P V +KDPELV+ V + K   F
Sbjct  67    ARSKPMPLSHCIGPRVLPFFHQAIEDHGKISFTWFGPYPTVILKDPELVREVLSNKFGHF  126

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
             +KP  NPL KLLA+GV  +E +KW KHR+IINP F +EKLKHM P F   C E+++ W+ 
Sbjct  127   EKPNINPLGKLLARGVADYEGEKWAKHRRIINPAFHLEKLKHMFPTFATCCDELINRWDN  186

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
             +VG Q   ELDVWP  Q    DVISR AFGSS++EG +IF+LQ EQ+  ++Q + +IYIP
Sbjct  187   HVGSQAYCELDVWPEFQNFTGDVISRVAFGSSFKEGQRIFQLQEEQMELLVQAAQNIYIP  246

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE-EIEQ  959
             G+RFLPTK+N RM +I +++ A +  +I++R +AMR   A+ DDLLG+L+ESN     EQ
Sbjct  247   GYRFLPTKKNNRMYEIYREIRALLSRMIEQRERAMRKSGATNDDLLGLLIESNLRYSQEQ  306

Query  960   NGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              G+KN GMT  +VIEECKLFY AG +TT  LL WT+V+L MH  WQ R
Sbjct  307   GGSKNTGMTKDDVIEECKLFYFAGHKTTLVLLTWTVVILGMHPSWQAR  354



>ref|XP_007022096.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
 gb|EOY13621.1| Cytochrome P450, family 72, subfamily A, polypeptide 15, putative 
[Theobroma cacao]
Length=482

 Score =   378 bits (971),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 181/348 (52%), Positives = 245/348 (70%), Gaps = 4/348 (1%)
 Frame = +3

Query  72    LIGFSIAIVFLVCL---WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVE  242
             +IG S++ + +  L   WR+++W W +P++L++ LRQQGL G  Y+F+ GD+K+      
Sbjct  6     VIGISLSFLVVGILIWGWRIVDWVWVKPKRLERCLRQQGLTGNSYRFLSGDIKESFAMSR  65

Query  243   DAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
              A+S+P+ L DDI+    PF    ++  G+NSF W+GP P V I +PE ++ +FTK   F
Sbjct  66    QARSQPMPLGDDITQYVGPFLHQTVKNYGKNSFSWVGPIPRVTIMEPEDIREIFTKFNDF  125

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
             QKP +NPL  LL  G++  + ++W KHRKIINP F  +KLK+M+PAFY SC EM+S+WEK
Sbjct  126   QKPHTNPLVSLLVSGLVNLDGEEWAKHRKIINPAFHQDKLKNMLPAFYQSCIEMISKWEK  185

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
              V  +G  ELDVWPYL +L  DVISR AFGSSYEEG +IF+L  +Q    +Q+  S YIP
Sbjct  186   LVFLEGSRELDVWPYLVKLTRDVISRAAFGSSYEEGRRIFQLLEDQTNLTMQVVQSAYIP  245

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQN  962
             GWR+LPTK NR+MK I K +  S+  +I KR +A +  E S DDLLGIL+ESN  EI+++
Sbjct  246   GWRYLPTKTNRKMKVIAKDIKDSLKGMIKKREEATKASEVSNDDLLGILVESNIREIQEH  305

Query  963   GN-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             G+ KN GM+  +VIEECKLFY AGQETTS LLVWTM+LL+ H  WQT+
Sbjct  306   GDHKNMGMSIEDVIEECKLFYFAGQETTSVLLVWTMILLARHPHWQTK  353



>ref|XP_010060779.1| PREDICTED: cytochrome P450 72A15-like isoform X2 [Eucalyptus 
grandis]
Length=510

 Score =   379 bits (972),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 195/345 (57%), Positives = 250/345 (72%), Gaps = 12/345 (3%)
 Frame = +3

Query  84    SIAIVFLVCL-----WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDA  248
             SIA+V ++ +     WR++N  W RP++L+++LRQQGL G  Y F+FGDLK+ S+ +++A
Sbjct  7     SIAVVTILAVLTTWAWRVVNSVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENSRLLKEA  66

Query  249   KSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQK  428
              SKPI + DDI PR LPF   + Q  G++SF+W+GP P V I +PE +K +F+K   + +
Sbjct  67    YSKPITIFDDIKPRLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSKINDYPR  126

Query  429   PPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNV  608
             P SNPL KLLA G+  HE +KW +HRKIINP F MEKLK M+PAFY SC+EM+  WEK V
Sbjct  127   PGSNPLVKLLADGLTSHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMVGRWEKLV  186

Query  609   GDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGW  788
               +   E+D W  LQ L  +VISRTAFGSS+EEG +IFELQ EQ    L    S+YIPGW
Sbjct  187   SVERSCEIDAWVDLQNLTGEVISRTAFGSSFEEGKRIFELQGEQAQLTLIALQSVYIPGW  246

Query  789   RFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN  968
             RF+PTK NRRMK I+K+V A +MDI+ +R KA+R GEA+ DDLLG+LLESN +E      
Sbjct  247   RFVPTKMNRRMKSIDKEVRALLMDIVRRREKAIREGEAAGDDLLGLLLESNMKE------  300

Query  969   KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
              N GM+  +VIEECKLFY AGQETTS LLVWTMVLLS+H +WQ R
Sbjct  301   -NVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQAR  344



>ref|XP_008219216.1| PREDICTED: cytochrome P450 CYP72A219-like [Prunus mume]
Length=519

 Score =   378 bits (971),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/350 (52%), Positives = 247/350 (71%), Gaps = 6/350 (2%)
 Frame = +3

Query  63    VFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVE  242
             V  ++  SI I +    WR+LNW W RP+KL++ LR+QG  G  Y+ +FGD K  S  + 
Sbjct  7     VLSVVWVSIVIAWA---WRVLNWMWLRPKKLERCLREQGFTGNSYRLLFGDTKDSSMMLR  63

Query  243   DAKSKPINLS--DDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHT  416
              A+SKP+ LS   DI+PR +PF    ++  G NSFVW+GP P + I +PE +K +F K  
Sbjct  64    QAQSKPMKLSTSHDIAPRVMPFVHQIVKTYGRNSFVWMGPMPKLNIMNPEDLKEIFNKRQ  123

Query  417   IFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEW  596
              FQ+P +NPL KLL QG++  E+ KW KHRKII P F +EKLK M+P FY SCS+M++EW
Sbjct  124   NFQRPSANPLIKLLVQGLLHIEDVKWAKHRKIIKPAFHLEKLKGMLPTFYQSCSDMINEW  183

Query  597   EKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIY  776
             +  V   G  E DVWP L+ L++DVI+R AFGSSY+EG KIF+L ++Q      +  S+Y
Sbjct  184   KGLVSKDGSCEFDVWPCLKNLSADVIARAAFGSSYQEGRKIFQLLQQQDKNFSLVVRSVY  243

Query  777   IPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIE  956
             IPGWRFLPTK NRRMK+I K+++  +  II+KR + ++ GE + DDLLGIL+ESN +EI 
Sbjct  244   IPGWRFLPTKHNRRMKEINKEINVLLRGIINKREEEIKLGEDNKDDLLGILMESNLKEIR  303

Query  957   QNGNK-NFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ++GNK + GM+ ++VIEEC+LFYLAG E+TS+LLVW M+LL  +Q WQ R
Sbjct  304   EHGNKTDTGMSIQDVIEECRLFYLAGSESTSTLLVWAMILLGQNQNWQAR  353



>ref|XP_010502007.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=512

 Score =   377 bits (969),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/352 (52%), Positives = 245/352 (70%), Gaps = 7/352 (2%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCL-WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEI    +  S+A+V    L WR L W WF+P+ L+  LR+QGL GT Y  + GD+K+  
Sbjct  1     MEISVASVTISVAVVVTSWLVWRALQWVWFKPKMLESYLRRQGLPGTSYTPLVGDVKRNF  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               + +A+SKPINL+DDI+PR +P  +  ++ +G   F W GP P++ I DPE +K VF K
Sbjct  61    SMLTEARSKPINLTDDITPRVMPHPLQMLKTHGRTYFSWFGPVPIITIMDPEQIKEVFNK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                FQKP + PL+ L+A+G+  ++ DKW KHR+IINP F +EK+K+M+PAFY SCSE+L 
Sbjct  121   VYDFQKPHTFPLATLIAKGLANYDGDKWAKHRRIINPAFHLEKIKNMVPAFYQSCSEVLG  180

Query  591   EWEKNVGDQGLA-ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             EWEK V D+G + E+DVWP L  + +DVISRTAFGSSY+EG +IFELQ E    ++Q   
Sbjct  181   EWEKLVSDKGSSCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFR  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
                IPG+ +LPTK NRRMK   +++   +  I++KR++A   GEA  DDLLGILLESN  
Sbjct  241   KAIIPGFSYLPTKGNRRMKATAREIQVILRGIVNKRLRAREAGEAPSDDLLGILLESNLG  300

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             + + N     GM+T +++EECKLFY AGQETTS LLVWTMVLLS H++WQ R
Sbjct  301   QTKGN-----GMSTEDLMEECKLFYFAGQETTSVLLVWTMVLLSQHKDWQAR  347



>ref|XP_006377672.1| hypothetical protein POPTR_0011s101202g, partial [Populus trichocarpa]
 gb|ERP55469.1| hypothetical protein POPTR_0011s101202g, partial [Populus trichocarpa]
Length=396

 Score =   373 bits (957),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 184/345 (53%), Positives = 249/345 (72%), Gaps = 7/345 (2%)
 Frame = +3

Query  87    IAIVFLVCL---WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSK  257
             ++IV++  L   WR+LNW WFRP+K+++ LRQQG  G  Y+ +FGD K+ S  +++A++K
Sbjct  10    VSIVYVAVLRWAWRVLNWVWFRPKKVERCLRQQGFAGKPYRLLFGDWKENSDMLKEARTK  69

Query  258   PINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPS  437
             PI LSD + PR +PF    ++  G+NSF+W+GPKP V I +P+ +++VF K   +QK PS
Sbjct  70    PIGLSDALLPRVMPFLHQLVKDYGKNSFMWIGPKPRVNIMNPDQIRDVFMKINEYQK-PS  128

Query  438   NPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVG-D  614
             +PL K LA G+  HE +KW KHRKIINP F  EKLK MIPAFY SCS M+++WEK V  D
Sbjct  129   HPLLKPLACGLASHEGEKWAKHRKIINPAFHQEKLKLMIPAFYESCSGMINKWEKLVSVD  188

Query  615   QGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQ-ISSSIYIPGWR  791
             +G  ELDVWP LQ L  D ISRT+FGS+YEEG +IF+L +E     +  I  +  IPG+R
Sbjct  189   EGSCELDVWPDLQGLTCDAISRTSFGSNYEEGKRIFDLLKELTDLTVHVIIKAFVIPGYR  248

Query  792   FLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN-  968
             FLP   NRR+K I+K++ AS+  +I+KR KAM  GE + +DLLG+LLESNF EI+++GN 
Sbjct  249   FLPIPTNRRLKAIDKEIKASLNALINKREKAMSAGEDAKNDLLGLLLESNFREIQEHGNT  308

Query  969   KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             K+  M+  +VI+ECK+FY AGQETTS LL WTMVLL+ +  WQ R
Sbjct  309   KSVRMSIEDVIDECKIFYFAGQETTSVLLTWTMVLLAQYPNWQAR  353



>ref|XP_010060780.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 ref|XP_010060781.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
 gb|KCW67645.1| hypothetical protein EUGRSUZ_F01392 [Eucalyptus grandis]
Length=510

 Score =   377 bits (967),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 193/351 (55%), Positives = 246/351 (70%), Gaps = 8/351 (2%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVC-LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME     I  +  +  L    WR++NW W RP++L+++LRQQGL G  Y F+FGDLK+ S
Sbjct  1     MEASIQSIALATVLAVLTTWAWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENS  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
             + + +A SKPI +SDDI PR  PF   + Q  G++SF+W+GP P V I +PE +K +F+ 
Sbjct  61    RLLTEANSKPIAISDDIKPRLFPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSN  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                + KP SNPL KLL  G+  HE +KWV+HRKIINP F MEKLK M+PAFY SC+EM+ 
Sbjct  121   INDYPKPASNPLVKLLVDGLANHEGEKWVRHRKIINPAFHMEKLKLMLPAFYSSCAEMVG  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
              WEK V  +   E+D W  LQ L  +V+SRTAFGSS+EEG +I ELQ EQ    +    S
Sbjct  181   RWEKLVSVERSCEIDAWVDLQNLTREVLSRTAFGSSFEEGKRICELQGEQAQLTIIAFQS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRF+PTK NRRMK I+K+V A +MDI+ +R KA+R GEA+ DDLLG+LLESN +E
Sbjct  241   VYIPGWRFVPTKMNRRMKNIDKEVRALLMDIVRRREKAIREGEAAGDDLLGLLLESNMKE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
                    N GM+  +VIEECKLFY AGQETTS LLVWTMVLLS+H +WQ R
Sbjct  301   -------NVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQAR  344



>ref|XP_010041835.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=398

 Score =   372 bits (956),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 193/351 (55%), Positives = 244/351 (70%), Gaps = 8/351 (2%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVC-LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME     I  +  +  L    WR++N  W RP++L+++LRQQGL G  Y F+FGDLK+ S
Sbjct  1     MEASIQSIALATVLAVLTTWAWRVVNLVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENS  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
             + + +A SKPI +SDDI PR  PF   + Q  G++SF+W+GP P V I +PE +K +F+ 
Sbjct  61    RLLTEANSKPIAISDDIKPRLFPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSN  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                + KP SNPL KLL  G+  HE +KWV+HRKIINP F MEKLK M+PAFY SC+EM+ 
Sbjct  121   INDYPKPASNPLVKLLVDGLANHEGEKWVRHRKIINPAFHMEKLKLMLPAFYSSCAEMVG  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
              WEK V  +   E+D W  LQ L  +V+SRTAFGSS EEG +I ELQ EQ    +    S
Sbjct  181   RWEKLVSVERSCEIDAWVDLQNLTREVLSRTAFGSSLEEGKRICELQGEQAQLTIIAFQS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRF+PTK NRRMK I+K+V A +MDII +R KA+R GEA+ DDLLG+LLESN +E
Sbjct  241   VYIPGWRFVPTKMNRRMKSIDKEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMKE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
                    N GM+  +VIEECKLFY AGQETTS LLVWTMVLLS+H +WQ R
Sbjct  301   -------NVGMSLHDVIEECKLFYFAGQETTSVLLVWTMVLLSVHSDWQAR  344



>ref|XP_010060782.1| PREDICTED: cytochrome P450 72A15-like [Eucalyptus grandis]
Length=510

 Score =   376 bits (966),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 193/351 (55%), Positives = 247/351 (70%), Gaps = 8/351 (2%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVC-LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             ME     I  +  +  L    WR++NW W RP++L+++LRQQGL G  Y F+FGDLK+ S
Sbjct  1     MEASIQSIALATVLAVLTTWAWRVVNWVWLRPKRLERLLRQQGLSGKPYTFLFGDLKENS  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
             + + +A SKPI +SDDI PR LPF   + Q  G++SF+W+GP P V I +PE +K +F+K
Sbjct  61    RLLTEANSKPIAVSDDIKPRLLPFLHQSSQTYGKDSFMWIGPTPRVRITNPEQLKEIFSK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                + +P SNPL KLL  G+  HE +KW +HRKIINP F MEKLK M+PAFY SC+EM+ 
Sbjct  121   INDYPRPGSNPLVKLLTNGLFDHEGEKWARHRKIINPAFHMEKLKLMLPAFYSSCTEMVG  180

Query  591   EWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSS  770
              WEK V  +   E+D W  LQ L  +VISRTAFGSS+EEG +I ELQ EQ    +    S
Sbjct  181   RWEKLVSVERSCEIDAWVDLQNLTREVISRTAFGSSFEEGKRISELQGEQAQLTIIALQS  240

Query  771   IYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEE  950
             +YIPGWRF+PTK NRRMK I+K+V A +MDII +R KA+R GEA+ DDLLG+LLESN +E
Sbjct  241   VYIPGWRFVPTKMNRRMKSIDKEVRALLMDIIRRREKAIREGEAAGDDLLGLLLESNMKE  300

Query  951   IEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
                    N GM+  +V+EEC+LFY AGQETTS LLVWTMVLLS+H +WQ R
Sbjct  301   -------NVGMSLHDVMEECRLFYFAGQETTSVLLVWTMVLLSVHSDWQAR  344



>ref|XP_010241316.1| PREDICTED: cytochrome P450 CYP72A219-like [Nelumbo nucifera]
Length=518

 Score =   377 bits (967),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 182/353 (52%), Positives = 252/353 (71%), Gaps = 2/353 (1%)
 Frame = +3

Query  51    MMEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             M E VF      + I+ L  +WRML   W+RP KL++ L++QG+KG  YK + G+LK  S
Sbjct  1     MGEFVFISATVILCILILSWVWRMLYLIWWRPMKLERYLKEQGIKGPPYKLLVGNLKDES  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT-  407
             +  ++A SKP+NLS +I+PR  PF +  IQ  G+ S  W G  P ++I DPEL+K++   
Sbjct  61    RLRKEALSKPMNLSHNIAPRVAPFVLQTIQNYGKMSVSWSGRTPRIYITDPELIKDILLY  120

Query  408   KHTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEML  587
             K   F++   NP ++ LA G++ +E +KWVKHR+IINP F ++KLK ++P F +SC +++
Sbjct  121   KFGHFERSKPNPFARSLASGLVSYEGEKWVKHRRIINPAFHLDKLKRLLPVFSISCCDLI  180

Query  588   SEWEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             + WEK V  +G  E+DVWP L+ L+ D+ISR AFGSSYEEG +IF++Q EQ   ++Q + 
Sbjct  181   TRWEKLVPSEGSYEMDVWPELKNLSGDIISRAAFGSSYEEGRRIFQIQEEQASLIMQDAM  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
             SI+IPG RFLPTKRN RMK++E++V A +  II KR KAMR GEA  +DLLG+L+E NF+
Sbjct  241   SIHIPGLRFLPTKRNNRMKEMEREVRALLEGIISKREKAMRMGEACTNDLLGLLMEFNFK  300

Query  948   EIEQNGN-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             EI+++GN KN GM+  EVI ECKLFY AG+ETTS LL WTM++LSMH EWQ R
Sbjct  301   EIQEHGNLKNVGMSIDEVIGECKLFYFAGRETTSILLTWTMLVLSMHSEWQLR  353



>emb|CBI39938.3| unnamed protein product [Vitis vinifera]
Length=455

 Score =   374 bits (959),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 175/288 (61%), Positives = 221/288 (77%), Gaps = 1/288 (0%)
 Frame = +3

Query  243   DAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
             +A S PI+ SDDI  R LPFF  +IQK G+NSF WLGPKP+V I +PEL+++V  KH +F
Sbjct  4     EANSGPISFSDDIVKRVLPFFNHSIQKYGKNSFTWLGPKPVVNIMEPELIRDVLLKHNVF  63

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
             QKPP +PL KLLA GV+  E ++W K RKIINP F +EKLKHM+ AF LSCS+M+++WEK
Sbjct  64    QKPPPHPLGKLLATGVVALEGEQWTKRRKIINPAFHLEKLKHMVSAFQLSCSDMVNKWEK  123

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
              +      ELD+WPYLQ L  DVISRTAFGSSYEEG +IF+LQ+EQ   V Q++ S+Y+P
Sbjct  124   KLSMDDSCELDIWPYLQILTGDVISRTAFGSSYEEGRRIFQLQKEQAHLVAQVTQSVYVP  183

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQN  962
             GWRF PTK NRRM+QI  +V+A +  II+KR KAM+ GE +  DLLG+L+ESN+ E+++N
Sbjct  184   GWRFFPTKINRRMRQIRNEVNALLKGIIEKREKAMKVGETANHDLLGLLMESNYREMQEN  243

Query  963   G-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
                KN GM+ ++VIEECKLFY AGQETTS LL+WTMVLLS H  WQ R
Sbjct  244   DERKNVGMSIKDVIEECKLFYFAGQETTSVLLLWTMVLLSKHSNWQAR  291



>ref|XP_010911572.1| PREDICTED: cytochrome P450 CYP72A219-like [Elaeis guineensis]
Length=522

 Score =   376 bits (965),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/332 (55%), Positives = 239/332 (72%), Gaps = 2/332 (1%)
 Frame = +3

Query  114   WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPRA  293
             WR L W W+ PR+L++ LR QGL+GT Y+F+ GDLK+ ++  ++A+SKP+  S DI PR 
Sbjct  26    WRGLEWLWWTPRRLERALRCQGLRGTRYRFLHGDLKETARLNKEARSKPMPFSHDIVPRV  85

Query  294   LPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFT-KHTIFQKPPSNPLSKLLAQGV  470
              PFF  AI++NG+ SF W GP P V I +PE V+ V + K   F KP  NPL +LLA G+
Sbjct  86    APFFHRAIKENGKISFTWFGPVPRVTIMNPEWVREVLSNKFGHFAKPQINPLGRLLATGL  145

Query  471   IFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLAELDVWPYL  650
               +E +KW KHR+I+NP F +EKLK M+PAF     E+++ WEK++G  G  ELDVW  L
Sbjct  146   ANYEGEKWAKHRRILNPAFHLEKLKRMLPAFSACSGELVNRWEKSIGSLGYYELDVWHEL  205

Query  651   QQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQI  830
             Q    DVISRTAFGSSYEEG +IF+LQ EQ G ++Q + ++YIPG+RFLPT  N R K+I
Sbjct  206   QNFTGDVISRTAFGSSYEEGRRIFQLQTEQAGLLIQAAQTVYIPGYRFLPTPINNRRKKI  265

Query  831   EKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGN-KNFGMTTREVIEE  1007
             +++V A +  II+KR KA+  GEAS DDLL ++++SN +  +++GN KN  MTT EVIEE
Sbjct  266   DREVRALLRGIIEKREKAINLGEASNDDLLDLMIKSNLKHFQEHGNSKNTRMTTEEVIEE  325

Query  1008  CKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             CKLFY AGQETTS LL WTMV+LSMH  WQ R
Sbjct  326   CKLFYFAGQETTSVLLTWTMVVLSMHPSWQVR  357



>ref|XP_010465353.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=512

 Score =   375 bits (964),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 177/332 (53%), Positives = 237/332 (71%), Gaps = 6/332 (2%)
 Frame = +3

Query  111   LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPR  290
             +WR L W WF+P+ L+  LR+QGL GT Y  + GDLK+    + +AKSKPI L+DDI+PR
Sbjct  21    VWRTLQWVWFKPKMLESYLRRQGLAGTSYTPLVGDLKRHFSMLTEAKSKPIKLTDDITPR  80

Query  291   ALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGV  470
              +P+ +  ++ +G   F WLGP P + I DPEL+K VF K   FQK  + PL +L+A G+
Sbjct  81    IVPYPLQMLKTHGRTHFTWLGPIPTITIMDPELIKEVFNKVYDFQKAHTFPLGRLIAAGL  140

Query  471   IFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGDQGLA-ELDVWPY  647
             + ++ DKW KHR+IINP F +EK+K+M+PAF+ SCSE + EW+K V ++G + ELDVWP+
Sbjct  141   LSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSETVGEWDKLVSNKGSSCELDVWPW  200

Query  648   LQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMKQ  827
             L  + +DVISRTAFGSSY+EG +IFELQ E    ++Q     +IPG+R+LPTK NRRM  
Sbjct  201   LVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFQKTFIPGYRYLPTKGNRRMNA  260

Query  828   IEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFGMTTREVIEE  1007
               +++   +  I+DKR++A  GGE   DDLLGILLESN  + E N     GM+T E++EE
Sbjct  261   TARKIKVILRGIVDKRLRAREGGEVPSDDLLGILLESNSGQTEGN-----GMSTEELMEE  315

Query  1008  CKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             CKLFY AGQETTS LLVWTMVLLS H++WQ R
Sbjct  316   CKLFYFAGQETTSVLLVWTMVLLSQHKDWQAR  347



>gb|KEH36886.1| cytochrome P450 family monooxygenase [Medicago truncatula]
Length=383

 Score =   370 bits (951),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 177/351 (50%), Positives = 245/351 (70%), Gaps = 3/351 (1%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISK  233
             + I +G+I  ++ +  LV  WR+LNW W +P++L+K+LR+QG  G  Y+ + GDLK   K
Sbjct  5     LAIYYGIILITVTL-GLVYTWRVLNWIWLKPKRLEKLLREQGCNGNSYRLVLGDLKDSYK  63

Query  234   SVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKH  413
               + AKSKP+ LSDDI PR +P+    +Q  G+N F+W G  P + + +PEL+K+V  + 
Sbjct  64    MGKKAKSKPMELSDDIIPRVIPYIQQLVQIYGKNPFIWSGTTPRLILTEPELIKDVLNRT  123

Query  414   TIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE  593
             +  QKP    + K L  G+I HE +KW KHR+++N  FQ+EKLK M P+F  SC +M+S+
Sbjct  124   SELQKPKYE-IFKFLFSGLIIHEGEKWRKHRRLMNAAFQLEKLKIMAPSFLTSCIDMISK  182

Query  594   WEKNVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSI  773
             WE  +   G  E+D+WP LQ L SDVISR AFGSSYEEG +IF+LQREQ   V++     
Sbjct  183   WESTLSSDGSGEIDIWPSLQNLTSDVISRNAFGSSYEEGKRIFDLQREQGELVMKNLVKS  242

Query  774   YIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEI  953
              IP WRF+PT   RRM +IEK + +S+  II+KR KAM+ GEA+ +DLLG+LLESN +EI
Sbjct  243   LIPLWRFIPTATQRRMHEIEKDIDSSLRYIINKREKAMKAGEATENDLLGLLLESNHQEI  302

Query  954   EQNG-NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
               +G NKN GM+  +V+ ECKLFYLAGQE+TS++LVWTM+LLS + +WQ R
Sbjct  303   RDHGNNKNMGMSLEDVVGECKLFYLAGQESTSTMLVWTMILLSRYPDWQER  353



>ref|XP_004295684.1| PREDICTED: secologanin synthase-like [Fragaria vesca subsp. vesca]
Length=523

 Score =   375 bits (964),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 183/348 (53%), Positives = 246/348 (71%), Gaps = 7/348 (2%)
 Frame = +3

Query  75    IGFSIAIVFLVC--LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDA  248
             +  S+  V +V    W +L+W W +P+KL++ LR+QG KG  Y+ ++GD K  S    +A
Sbjct  9     VALSLVFVSIVVRLAWSVLDWVWLKPKKLERCLREQGFKGNSYRILYGDTKDESIMRAEA  68

Query  249   KSKPINLS--DDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIF  422
             KSKP+N+S   DI P+   F    ++  G+NSFVW+GP P V + +PE +K VFT+H  F
Sbjct  69    KSKPMNISTSHDIGPQLDAFVDKTVKSYGKNSFVWIGPIPRVNVMNPEELKEVFTRHEEF  128

Query  423   QKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEK  602
             ++P +NPL  LL  G+ F E +KW KHR+IINP F  EKLK MIPAF+ S  EM+ EWE 
Sbjct  129   RRPITNPLILLLTSGLNFCEGEKWAKHRRIINPAFHFEKLKLMIPAFHQSFDEMIKEWES  188

Query  603   NVGDQGL-AELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYI  779
              V  +G  AELDVWP LQ + +DVISRTAFG++Y+EG ++FEL REQ  +V +   SIYI
Sbjct  189   AVSKEGSSAELDVWPSLQSMTADVISRTAFGTNYQEGRQMFELLREQTIHVTKALHSIYI  248

Query  780   PGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQ  959
             PGWRFLPTKRN R+ +I K+++  +  II+ R +A R GEAS DDLLG L+ESN + I++
Sbjct  249   PGWRFLPTKRNMRINKINKEINGIVRGIIENREQATRAGEASGDDLLGALMESNLKHIQE  308

Query  960   NG--NKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQ  1097
             NG  NKN GM+ ++V++ECKLFY AGQETTS +LVWTM+LLS +Q WQ
Sbjct  309   NGKNNKNVGMSIQDVMQECKLFYFAGQETTSVMLVWTMILLSQNQNWQ  356



>ref|XP_006477887.1| PREDICTED: 11-oxo-beta-amyrin 30-oxidase-like [Citrus sinensis]
Length=512

 Score =   375 bits (963),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/347 (51%), Positives = 248/347 (71%), Gaps = 7/347 (2%)
 Frame = +3

Query  75    IGFSIA---IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVED  245
             + FS A   I+   C W++LNWAW +P+KL+  LRQQG  G  YK   GD+K +S  +++
Sbjct  3     LAFSSALATIILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDMKDMSLMLKE  62

Query  246   AKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQ  425
             AK++PI++SDDI PR LP+    I K G+ SF W+GP+P + ++DP+L++ +  KH IFQ
Sbjct  63    AKARPISVSDDIVPRILPYHHHIISKYGKKSFKWMGPRPSINVQDPKLIREILLKHDIFQ  122

Query  426   KPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE-WEK  602
             KP  N LSKL+  G++ +E ++W K RKI NP F  +KLK M+P  YLSC+ M+ + +E 
Sbjct  123   KPRGNSLSKLVVNGMVMYEGEQWSKVRKIANPAFHQDKLKDMLPKMYLSCNHMIRKLFEI  182

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
                D+   ELD+WP++Q LA+DVISRTAFGS+Y++G KIFEL REQ   ++++S   YIP
Sbjct  183   AASDEESFELDIWPHIQALAADVISRTAFGSNYDDGRKIFELIREQSHLLIEVSQFDYIP  242

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQN  962
             GWRFLPTK NR++K    ++   +  II KR +A+R G+AS DDLLG+L+ESN++EI++ 
Sbjct  243   GWRFLPTKPNRKLKANHHEMRRLMKGIIKKREEALRIGKASNDDLLGLLMESNYKEIQE-  301

Query  963   GNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
               K  GM+  EVIEECKLFYLAGQETT+SLLVW +++L MH  WQ R
Sbjct  302   --KEAGMSIEEVIEECKLFYLAGQETTASLLVWVLIMLCMHPIWQER  346



>gb|EYU38228.1| hypothetical protein MIMGU_mgv1a004669mg [Erythranthe guttata]
Length=516

 Score =   375 bits (963),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 178/348 (51%), Positives = 246/348 (71%), Gaps = 3/348 (1%)
 Frame = +3

Query  69    GLIGFSIAIVFLVCL-WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVED  245
             G I  SI +V L+ L  + +NW W +P+KL+K+LR++GL G  YK + GD+K++   +++
Sbjct  4     GSILLSILVVGLITLSAKFVNWVWIKPKKLEKLLRKEGLNGNPYKLLLGDMKQLISVMKE  63

Query  246   AKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQ  425
              + K I  SD + P  LP +     K GENSF+W+GP P + I DP+L+K +  K  +FQ
Sbjct  64    EQPKSIQFSDHLLPHILPHYHHNRTKFGENSFMWVGPSPKLIIADPQLMKEILEKPNVFQ  123

Query  426   KPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKN  605
             KP  +P+ + +A G++  E++KW KHR+IINP F MEKLK M+PA  LSCS ML +WE +
Sbjct  124   KPHPDPIGETIAGGLVVLEDEKWTKHRRIINPAFHMEKLKKMVPAIRLSCSNMLDQWEAS  183

Query  606   -VGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
               G     E+DVWPYLQ L+ DVISR AFGSS+E+G +IFELQ++QV   L++   +++P
Sbjct  184   FAGSDESKEIDVWPYLQNLSGDVISRVAFGSSHEQGVRIFELQKDQVKLALELLKFMFVP  243

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQN  962
             GWRF+PTK NRRMK I K++ + + DII++R KA+  GE   +DLLG L+ESN  EI++N
Sbjct  244   GWRFVPTKANRRMKAISKEIQSLLRDIINQREKAIEDGEVIGEDLLGTLMESNLREIDEN  303

Query  963   GN-KNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             G+ KN GMT  EVI ECKLFY AG E+TS LL+WTMV+LS +QEWQ R
Sbjct  304   GSKKNMGMTIEEVINECKLFYFAGSESTSGLLMWTMVMLSKNQEWQAR  351



>ref|XP_006442316.1| hypothetical protein CICLE_v10024206mg [Citrus clementina]
 gb|ESR55556.1| hypothetical protein CICLE_v10024206mg [Citrus clementina]
Length=512

 Score =   375 bits (962),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 178/347 (51%), Positives = 247/347 (71%), Gaps = 7/347 (2%)
 Frame = +3

Query  75    IGFSIA---IVFLVCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVED  245
             + FS A   I+   C W++LNWAW +P+KL+  LRQQG  G  YK   GD+K +S  +++
Sbjct  3     LAFSSALATIILAYCAWKILNWAWLKPKKLENFLRQQGFSGNSYKIFHGDMKDMSLMLKE  62

Query  246   AKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQ  425
              K++PI+LSDDI PR LP+    I K G+ SF W+GP+P + ++DP+L++ +  KH IFQ
Sbjct  63    TKARPISLSDDIVPRILPYHHHIISKYGKKSFKWMGPRPSINVQDPKLIREILLKHDIFQ  122

Query  426   KPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSE-WEK  602
             KP  N LSKL+  G++ +E ++W K RKI NP F  +KLK M+P  YLSC+ M+ + +E 
Sbjct  123   KPKGNSLSKLVVNGMVMYEGEQWSKVRKIANPAFHQDKLKDMLPKMYLSCNHMIRKLFEI  182

Query  603   NVGDQGLAELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIP  782
                D+   ELD+WP++Q LA+DVISRTAFGS+Y++G KIFEL REQ   ++++S   YIP
Sbjct  183   AASDEESFELDIWPHIQALAADVISRTAFGSNYDDGRKIFELIREQSHLLIEVSQFDYIP  242

Query  783   GWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQN  962
             GWRFLPTK NR++K    ++   +  II KR +A+R G+AS DDLLG+L+ESN++EI++ 
Sbjct  243   GWRFLPTKPNRKLKANHHEMRRLMKGIIKKREEALRIGKASNDDLLGLLMESNYKEIQE-  301

Query  963   GNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
               K  GM+  EVIEECKLFYLAGQETT+SLLVW +++L MH  WQ R
Sbjct  302   --KESGMSIEEVIEECKLFYLAGQETTASLLVWVLIMLCMHPIWQER  346



>ref|XP_010465357.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=512

 Score =   374 bits (961),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 180/352 (51%), Positives = 244/352 (69%), Gaps = 7/352 (2%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFL-VCLWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEI    +  S+AIV + + +WR L W WF+P+ L+  LR+QGL GT Y  + GDLK+ +
Sbjct  1     MEISVASVTISVAIVVVSLWVWRTLQWVWFKPKMLESYLRRQGLAGTRYTPLVGDLKRNA  60

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               + +A+SKPI L+DD  PR +PF +  ++ +G   F WLGP P + I DPEL+K VF K
Sbjct  61    NMLAEARSKPIKLTDDTRPRIVPFPLHMLKTHGRTFFTWLGPIPTITIMDPELIKEVFNK  120

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                FQK  + PL +L+  G++ ++ DKW KHR+IINP F +EK+K+M+PAF+ SCSE + 
Sbjct  121   VYDFQKAHTFPLGRLIVPGLVSYDGDKWTKHRRIINPAFHLEKIKNMVPAFHQSCSETVG  180

Query  591   EWEKNVGDQGLA-ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             EW+K V ++G + E+DVWP+L  + +DVISRTAFGSSY+EG +IFELQ E    ++Q   
Sbjct  181   EWDKLVSNKGSSCEVDVWPWLLSMTADVISRTAFGSSYKEGQRIFELQAELSQLIIQAVQ  240

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
               +IPG+ +LPTK NRRM    +++   +  IIDKR++   GGE   DDLLGILLESN  
Sbjct  241   KAFIPGYSYLPTKGNRRMNATAREMKVILRGIIDKRLRGREGGEVPSDDLLGILLESNLG  300

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             + + N     GM+T E++EECKLFY AGQETTS LLVWTMVLLS HQ+WQ R
Sbjct  301   QTKGN-----GMSTEELMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQAR  347



>ref|XP_010487267.1| PREDICTED: cytochrome P450 72A15-like [Camelina sativa]
Length=547

 Score =   375 bits (964),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 182/352 (52%), Positives = 245/352 (70%), Gaps = 7/352 (2%)
 Frame = +3

Query  54    MEIVFGLIGFSIAIVFLVCL-WRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKIS  230
             MEI    +  S+A+V    L WR L W WF+P+ L+  LR+QGL GT Y  + GD+K+  
Sbjct  36    MEISVASVTISVAVVVTSWLVWRALQWVWFKPKMLESYLRRQGLPGTSYTPLVGDVKRNF  95

Query  231   KSVEDAKSKPINLSDDISPRALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTK  410
               + +A+SKPINL+DDI+PR +P  +  ++ +G   F W GP P++ I DPE +K VF K
Sbjct  96    SMLTEARSKPINLTDDITPRVMPHPLQMLKTHGRTYFSWFGPVPIITIMDPEQIKEVFNK  155

Query  411   HTIFQKPPSNPLSKLLAQGVIFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLS  590
                FQKP + PL+ L+A+G+  ++ DKW KHR+IINP F +EK+K+M+PAF+ SCSE+L 
Sbjct  156   VYDFQKPHTFPLATLIAKGLANYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVLG  215

Query  591   EWEKNVGDQGLA-ELDVWPYLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISS  767
             EWEK V D+G + E+DVWP L  + +DVISRTAFGSSY+EG +IFELQ E    ++Q   
Sbjct  216   EWEKLVSDKGSSCEVDVWPGLVSMTADVISRTAFGSSYKEGQRIFELQAELAQLIIQAFR  275

Query  768   SIYIPGWRFLPTKRNRRMKQIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFE  947
                IPG+ +LPTK NRRMK   +++   +  I++KR++A   GEA  DDLLGILLESN  
Sbjct  276   KAIIPGFSYLPTKGNRRMKAKAREIQVILRGIVNKRLRAREAGEAPSDDLLGILLESNLG  335

Query  948   EIEQNGNKNFGMTTREVIEECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             + + N     GM+T +++EECKLFY AGQETTS LLVWTMVLLS HQ+WQ R
Sbjct  336   QTKGN-----GMSTEDLMEECKLFYFAGQETTSVLLVWTMVLLSQHQDWQAR  382



>ref|XP_010465361.1| PREDICTED: cytochrome P450 72A13-like [Camelina sativa]
Length=513

 Score =   374 bits (961),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 178/333 (53%), Positives = 242/333 (73%), Gaps = 7/333 (2%)
 Frame = +3

Query  111   LWRMLNWAWFRPRKLQKILRQQGLKGTDYKFIFGDLKKISKSVEDAKSKPINLSDDISPR  290
             +WR LNW WF+P+ L+  LR+QGL GT Y  + GD+K+ S  + +A+SKPI L+DDI+PR
Sbjct  21    VWRTLNWVWFKPKMLESYLRRQGLAGTPYTPLVGDVKRNSSMLAEARSKPIQLTDDITPR  80

Query  291   ALPFFIDAIQKNGENSFVWLGPKPLVFIKDPELVKNVFTKHTIFQKPPSNPLSKLLAQGV  470
              +PF +  ++ +G   F WLGP P V I DPEL+K VF     FQK  SNPL +L+A G+
Sbjct  81    VVPFHLHMLKTHGRTFFTWLGPIPTVTIMDPELIKEVFNNVNDFQKAHSNPLGRLIATGL  140

Query  471   IFHEEDKWVKHRKIINPGFQMEKLKHMIPAFYLSCSEMLSEWEKNVGD-QGLA-ELDVWP  644
             + ++ DKW KHR+IINP F +EK+K+M+PAF+ SCSE++ +W+K V D +GL+ E+DVWP
Sbjct  141   VSYDGDKWAKHRRIINPAFHLEKIKNMVPAFHQSCSEVVGQWDKLVLDKEGLSCEMDVWP  200

Query  645   YLQQLASDVISRTAFGSSYEEGNKIFELQREQVGYVLQISSSIYIPGWRFLPTKRNRRMK  824
             +L  L +DVISRTAFGSSY+EG +IFELQ E    ++Q     +IPG+ +LPTK NRRMK
Sbjct  201   WLVSLTADVISRTAFGSSYKEGQRIFELQAELARLLIQNFRKAFIPGYNYLPTKGNRRMK  260

Query  825   QIEKQVHASIMDIIDKRVKAMRGGEASPDDLLGILLESNFEEIEQNGNKNFGMTTREVIE  1004
                +++   +  I+++R++A   G+A  DDLLGILLESN    ++ GN   GM+T E++E
Sbjct  261   AAAREIKVIMGGIVNRRLRAREAGDAPSDDLLGILLESNLG--QEKGN---GMSTEELME  315

Query  1005  ECKLFYLAGQETTSSLLVWTMVLLSMHQEWQTR  1103
             ECKLFY AGQETT+ LLVWTMVLLS HQ+WQ R
Sbjct  316   ECKLFYFAGQETTTVLLVWTMVLLSQHQDWQAR  348



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2691533780576