BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16529_g1_i1 len=1300 path=[1278:0-354 1633:355-396 1675:397-518
1797:519-1299]

Length=1300
                                                                      Score     E

ref|XP_009619335.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    380   7e-126   
ref|XP_009593308.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    378   3e-125   
emb|CDO99026.1|  unnamed protein product                                377   6e-125   
ref|XP_009778186.1|  PREDICTED: LOW QUALITY PROTEIN: 2-hydroxyiso...    373   2e-123   
ref|XP_011071672.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    367   5e-121   
ref|XP_011073864.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    362   3e-119   
emb|CDO99023.1|  unnamed protein product                                361   1e-118   
emb|CDO99024.1|  unnamed protein product                                361   2e-118   
ref|XP_011071561.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    359   8e-118   
emb|CDO99025.1|  unnamed protein product                                358   2e-117   
ref|XP_004247378.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    357   3e-117   
ref|XP_006359893.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    356   8e-117   
ref|XP_007222644.1|  hypothetical protein PRUPE_ppa008552mg             352   6e-115   
ref|XP_008390858.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    351   1e-114   
ref|XP_008222954.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    349   8e-114   
ref|XP_007034684.1|  Alpha/beta-Hydrolases superfamily protein          354   1e-113   
ref|XP_006489347.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    348   4e-113   
ref|XP_009364211.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    346   2e-112   
gb|ABB89023.1|  CXE carboxylesterase                                    345   2e-112   Actinidia eriantha
ref|XP_011075707.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    345   3e-112   
gb|EYU23693.1|  hypothetical protein MIMGU_mgv1a027087mg                343   2e-111   
sp|Q5NUF4.1|HIDM_GLYEC  RecName: Full=2-hydroxyisoflavanone dehyd...    342   4e-111   Glycyrrhiza echinata [hedgehog licorice]
ref|XP_006489341.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    339   1e-109   
ref|XP_010099277.1|  putative carboxylesterase 2                        338   1e-109   
ref|XP_002517206.1|  catalytic, putative                                337   5e-109   Ricinus communis
gb|KDO74721.1|  hypothetical protein CISIN_1g018914mg                   337   9e-109   
gb|KDP40144.1|  hypothetical protein JCGZ_02142                         334   3e-108   
ref|XP_007222670.1|  hypothetical protein PRUPE_ppa008575mg             334   6e-108   
ref|XP_008222955.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    333   7e-108   
gb|AFK39504.1|  unknown                                                 332   5e-107   
gb|AES62697.2|  2-hydroxyisoflavanone dehydratase                       330   9e-107   
ref|XP_002277866.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    330   2e-106   Vitis vinifera
ref|XP_007143222.1|  hypothetical protein PHAVU_007G054300g             330   2e-106   
ref|XP_010666246.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    328   7e-106   
ref|XP_009338446.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    328   1e-105   
ref|XP_004511347.1|  PREDICTED: probable carboxylesterase 2-like        328   2e-105   
ref|XP_003610679.1|  Gibberellin receptor GID1                          327   3e-105   
gb|ACJ84311.1|  unknown                                                 325   2e-104   Medicago truncatula
ref|XP_008358548.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    325   2e-104   
ref|XP_006355549.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    324   4e-104   
gb|ACJ84653.1|  unknown                                                 323   8e-104   Medicago truncatula
ref|XP_007034685.1|  CXE carboxylesterase                               323   1e-103   
ref|XP_003592446.1|  Hormone-sensitive lipase                           323   2e-103   
ref|XP_004290227.1|  PREDICTED: probable carboxylesterase 2-like        322   2e-103   
ref|XP_010024368.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    321   4e-103   
ref|XP_009624702.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    321   5e-103   
ref|XP_007143221.1|  hypothetical protein PHAVU_007G054200g             321   5e-103   
gb|AFK64684.1|  2-hydroxyisoflavanone dehydratase                       321   6e-103   
ref|NP_001237228.1|  2-hydroxyisoflavanone dehydratase                  320   9e-103   
ref|XP_004296910.1|  PREDICTED: uncharacterized protein LOC101305932    331   1e-102   
gb|ADV71376.1|  2-hydroxyisoflavanone dehydratase                       320   1e-102   
gb|KCW60819.1|  hypothetical protein EUGRSUZ_H03555                     322   1e-102   
gb|AHZ08760.1|  2-hydroxyisoflavanone dehydratase                       319   2e-102   
ref|XP_008390857.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    319   3e-102   
ref|XP_010024367.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    319   3e-102   
ref|XP_010024366.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    319   3e-102   
ref|XP_010649883.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    318   5e-102   
ref|XP_004298163.1|  PREDICTED: uncharacterized protein LOC101304570    336   6e-102   
ref|XP_003556031.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    318   1e-101   
gb|KCW60818.1|  hypothetical protein EUGRSUZ_H03554                     319   1e-101   
ref|XP_008358549.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    318   1e-101   
gb|ABB89008.1|  CXE carboxylesterase                                    318   1e-101   Malus pumila [paradise apple]
ref|XP_006489582.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    318   3e-101   
ref|NP_001239627.1|  uncharacterized protein LOC100785409               317   3e-101   
ref|XP_004496762.1|  PREDICTED: probable carboxylesterase 12-like       317   4e-101   
gb|ACU19949.1|  unknown                                                 316   4e-101   Glycine max [soybeans]
gb|KDO74707.1|  hypothetical protein CISIN_1g020576mg                   316   5e-101   
ref|XP_004240012.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    315   1e-100   
ref|XP_008222956.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    315   1e-100   
ref|XP_007157159.1|  hypothetical protein PHAVU_002G047500g             317   1e-100   
ref|NP_001276288.1|  uncharacterized protein LOC100813532               315   1e-100   
gb|KHN30461.1|  Putative carboxylesterase 2                             315   2e-100   
ref|XP_010277778.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    315   2e-100   
ref|XP_004516320.1|  PREDICTED: probable carboxylesterase 1-like        315   2e-100   
ref|XP_010688718.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    314   3e-100   
gb|KEH33676.1|  2-hydroxyisoflavanone dehydratase                       310   1e-98    
ref|XP_010099276.1|  putative carboxylesterase 2                        310   2e-98    
ref|XP_006359900.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    307   1e-97    
ref|XP_008390965.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    306   3e-97    
ref|XP_004247376.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    305   8e-97    
ref|XP_006588437.1|  PREDICTED: uncharacterized protein LOC100785...    316   9e-97    
ref|XP_006359901.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    305   1e-96    
gb|KHN02697.1|  Putative carboxylesterase 1                             305   1e-96    
ref|XP_007143223.1|  hypothetical protein PHAVU_007G054400g             303   2e-95    
ref|XP_006359931.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    301   2e-95    
ref|XP_003610685.1|  Neutral cholesterol ester hydrolase                301   4e-95    
ref|XP_009619342.1|  PREDICTED: uncharacterized protein LOC104111364    310   5e-95    
ref|XP_009616956.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    299   2e-94    
ref|XP_004511449.1|  PREDICTED: probable carboxylesterase 4-like        297   2e-93    
ref|XP_009627861.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    295   4e-93    
ref|XP_004511348.1|  PREDICTED: probable carboxylesterase 12-like       293   3e-92    
ref|XP_004496760.1|  PREDICTED: probable carboxylesterase 4-like        293   4e-92    
ref|XP_003516761.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    291   2e-91    
gb|AES62689.2|  2-hydroxyisoflavanone dehydratase                       291   3e-91    
ref|XP_006359899.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    291   3e-91    
ref|XP_007017298.1|  Alpha/beta-Hydrolases superfamily protein          290   6e-91    
gb|KHN30463.1|  Putative carboxylesterase 2                             290   6e-91    
gb|AFK46020.1|  unknown                                                 289   1e-90    
ref|XP_003627985.1|  Hormone-sensitive lipase                           289   3e-90    
ref|XP_008805243.1|  PREDICTED: probable carboxylesterase 2             286   1e-89    
ref|XP_003610683.1|  Arylacetamide deacetylase                          286   1e-89    
gb|KHN35189.1|  Putative carboxylesterase 2                             285   3e-89    
ref|XP_004241152.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    286   3e-89    
ref|XP_004247529.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    282   8e-88    
ref|XP_006355613.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    281   9e-88    
ref|XP_010107991.1|  putative carboxylesterase 12                       285   1e-87    
ref|XP_003622702.1|  Hormone-sensitive lipase                           281   2e-87    
ref|XP_006359894.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    281   2e-87    
ref|XP_009400390.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    281   2e-87    
ref|XP_010943016.1|  PREDICTED: tuliposide A-converting enzyme 2,...    280   6e-87    
ref|XP_003592438.1|  Paired amphipathic helix protein Sin3              293   7e-87    
ref|XP_008805244.1|  PREDICTED: probable carboxylesterase 2             280   9e-87    
ref|XP_002284587.1|  PREDICTED: probable carboxylesterase 2             279   1e-86    Vitis vinifera
ref|XP_006359895.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    279   1e-86    
ref|XP_010916645.1|  PREDICTED: probable carboxylesterase 2             278   3e-86    
ref|XP_010275601.1|  PREDICTED: probable carboxylesterase 2             278   3e-86    
ref|XP_008795140.1|  PREDICTED: probable carboxylesterase 2             278   3e-86    
ref|XP_010916828.1|  PREDICTED: probable carboxylesterase 2             277   4e-86    
gb|ABW74473.1|  CXE carboxylesterase                                    277   7e-86    Paeonia suffruticosa [moutan peony]
ref|XP_006359897.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    277   8e-86    
ref|XP_008803544.1|  PREDICTED: tuliposide A-converting enzyme 2,...    276   1e-85    
ref|XP_010066035.1|  PREDICTED: probable carboxylesterase 12            276   2e-85    
ref|XP_009418893.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    274   7e-85    
gb|AFK39787.1|  unknown                                                 273   2e-84    
ref|XP_010066040.1|  PREDICTED: probable carboxylesterase 12            273   2e-84    
ref|XP_004247377.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    272   8e-84    
ref|XP_004957047.1|  PREDICTED: probable carboxylesterase 12-like       271   1e-83    
ref|XP_004237066.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    271   1e-83    
ref|XP_007200925.1|  hypothetical protein PRUPE_ppb022581mg             270   2e-83    
ref|XP_004247530.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    271   3e-83    
ref|XP_010269100.1|  PREDICTED: probable carboxylesterase 2             270   4e-83    
ref|XP_004294833.1|  PREDICTED: probable carboxylesterase 12-like       269   6e-83    
ref|XP_006379208.1|  hypothetical protein POPTR_0009s10720g             268   1e-82    
ref|XP_008670244.1|  PREDICTED: tuliposide A-converting enzyme 1,...    268   2e-82    
emb|CAN61111.1|  hypothetical protein VITISV_006466                     268   3e-82    Vitis vinifera
ref|XP_008375948.1|  PREDICTED: probable carboxylesterase 12            267   3e-82    
ref|XP_011088283.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase       269   3e-82    
ref|XP_011015827.1|  PREDICTED: probable carboxylesterase 5 isofo...    267   3e-82    
ref|XP_008236607.1|  PREDICTED: probable carboxylesterase 12            267   3e-82    
ref|XP_011016435.1|  PREDICTED: probable carboxylesterase 2             267   4e-82    
ref|XP_011030271.1|  PREDICTED: probable carboxylesterase 2             267   5e-82    
gb|ACU15060.1|  unknown                                                 265   7e-82    Glycine max [soybeans]
ref|XP_009350610.1|  PREDICTED: probable carboxylesterase 12            266   9e-82    
ref|XP_010943012.1|  PREDICTED: tuliposide A-converting enzyme 2,...    266   1e-81    
ref|XP_010066037.1|  PREDICTED: probable carboxylesterase 7             265   2e-81    
ref|XP_008805888.1|  PREDICTED: tuliposide A-converting enzyme 2,...    265   2e-81    
ref|XP_010677107.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    266   3e-81    
ref|XP_002285067.1|  PREDICTED: probable carboxylesterase 2             265   4e-81    Vitis vinifera
ref|XP_007042380.1|  Alpha/beta-Hydrolases superfamily protein, p...    264   4e-81    
ref|XP_006660708.1|  PREDICTED: tuliposide A-converting enzyme 1,...    265   5e-81    
ref|XP_006374969.1|  hypothetical protein POPTR_0014s03220g             265   5e-81    
ref|XP_010066042.1|  PREDICTED: probable carboxylesterase 12            264   6e-81    
ref|XP_010066041.1|  PREDICTED: probable carboxylesterase 12            264   6e-81    
ref|XP_008775309.1|  PREDICTED: probable carboxylesterase 12            264   7e-81    
ref|XP_002285064.2|  PREDICTED: probable carboxylesterase 2             266   8e-81    Vitis vinifera
emb|CDP07665.1|  unnamed protein product                                263   1e-80    
gb|AFV95085.1|  carboxylesterase 1                                      264   1e-80    
ref|XP_009346270.1|  PREDICTED: probable carboxylesterase 12            263   1e-80    
ref|XP_004505200.1|  PREDICTED: probable carboxylesterase 12-like       263   1e-80    
ref|NP_001063400.1|  Os09g0462200                                       263   1e-80    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011000096.1|  PREDICTED: probable carboxylesterase 12            263   2e-80    
emb|CDP15645.1|  unnamed protein product                                263   2e-80    
ref|XP_002462498.1|  hypothetical protein SORBIDRAFT_02g026816          263   2e-80    Sorghum bicolor [broomcorn]
gb|EEC84711.1|  hypothetical protein OsI_31671                          263   2e-80    Oryza sativa Indica Group [Indian rice]
ref|XP_006487078.1|  PREDICTED: probable carboxylesterase 12-like       263   2e-80    
ref|XP_008236532.1|  PREDICTED: probable carboxylesterase 12            263   2e-80    
ref|XP_010033689.1|  PREDICTED: probable carboxylesterase 12            263   2e-80    
ref|XP_009773904.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    263   2e-80    
ref|XP_010064185.1|  PREDICTED: probable carboxylesterase 2             263   2e-80    
ref|XP_004230816.2|  PREDICTED: LOW QUALITY PROTEIN: probable car...    264   2e-80    
ref|XP_010943009.1|  PREDICTED: probable carboxylesterase 12            263   3e-80    
ref|XP_004230815.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    262   4e-80    
ref|XP_007199215.1|  hypothetical protein PRUPE_ppa021861mg             262   4e-80    
ref|XP_008372377.1|  PREDICTED: LOW QUALITY PROTEIN: probable car...    262   4e-80    
gb|AFV95090.1|  carboxylesterase 1                                      262   5e-80    
ref|XP_004230814.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    261   6e-80    
gb|AFV95086.1|  carboxylesterase 1                                      262   6e-80    
ref|XP_010275604.1|  PREDICTED: probable carboxylesterase 2             261   7e-80    
ref|XP_007200443.1|  hypothetical protein PRUPE_ppa008902mg             261   7e-80    
gb|KDP25935.1|  hypothetical protein JCGZ_22840                         261   8e-80    
gb|ABB89006.1|  CXE carboxylesterase                                    261   8e-80    Malus pumila [paradise apple]
ref|XP_007199222.1|  hypothetical protein PRUPE_ppa021907mg             261   1e-79    
ref|XP_002518792.1|  catalytic, putative                                261   1e-79    Ricinus communis
ref|XP_008444640.1|  PREDICTED: probable carboxylesterase 2             261   1e-79    
ref|XP_008236609.1|  PREDICTED: probable carboxylesterase 13            261   1e-79    
ref|XP_011088284.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase       260   1e-79    
ref|XP_008346180.1|  PREDICTED: probable carboxylesterase 12            260   2e-79    
gb|KGN62538.1|  hypothetical protein Csa_2G360060                       260   2e-79    
ref|XP_006384426.1|  hypothetical protein POPTR_0004s14970g             260   2e-79    
gb|KCW63808.1|  hypothetical protein EUGRSUZ_G01474                     260   3e-79    
ref|XP_002510250.1|  Gibberellin receptor GID1, putative                260   3e-79    Ricinus communis
ref|XP_010943013.1|  PREDICTED: probable carboxylesterase 12            260   3e-79    
ref|XP_004152796.1|  PREDICTED: probable carboxylesterase 2-like        261   3e-79    
ref|XP_010066036.1|  PREDICTED: probable carboxylesterase 12            259   3e-79    
gb|EMS55581.1|  putative carboxylesterase 2                             259   3e-79    
ref|XP_008236535.1|  PREDICTED: probable carboxylesterase 12            259   4e-79    
ref|XP_008805889.1|  PREDICTED: tuliposide A-converting enzyme 2,...    259   4e-79    
gb|KCW63810.1|  hypothetical protein EUGRSUZ_G01481                     259   5e-79    
ref|XP_011000158.1|  PREDICTED: probable carboxylesterase 12            259   5e-79    
gb|KCW63809.1|  hypothetical protein EUGRSUZ_G01478                     259   5e-79    
ref|XP_007156545.1|  hypothetical protein PHAVU_003G295100g             259   5e-79    
ref|XP_006387587.1|  hypothetical protein POPTR_0807s00200g             259   6e-79    
emb|CDP21662.1|  unnamed protein product                                259   6e-79    
gb|AFV95088.1|  carboxylesterase 1                                      260   8e-79    
ref|XP_004294832.1|  PREDICTED: probable carboxylesterase 12-like       258   1e-78    
emb|CDP21304.1|  unnamed protein product                                258   1e-78    
ref|XP_008236533.1|  PREDICTED: probable carboxylesterase 12            258   1e-78    
gb|KCW53399.1|  hypothetical protein EUGRSUZ_J02629                     258   1e-78    
ref|XP_004230812.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    258   1e-78    
ref|XP_006487080.1|  PREDICTED: probable carboxylesterase 12-like       258   1e-78    
ref|XP_004976420.1|  PREDICTED: probable carboxylesterase 1-like ...    258   2e-78    
ref|XP_011000106.1|  PREDICTED: probable carboxylesterase 7             259   2e-78    
ref|XP_004294831.1|  PREDICTED: probable carboxylesterase 12-like       257   2e-78    
ref|XP_007224951.1|  hypothetical protein PRUPE_ppa021391mg             256   3e-78    
ref|XP_006346460.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    258   3e-78    
emb|CDP01339.1|  unnamed protein product                                257   3e-78    
ref|XP_008803545.1|  PREDICTED: tuliposide A-converting enzyme 2,...    257   4e-78    
ref|XP_004230813.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    256   4e-78    
dbj|BAJ90314.1|  predicted protein                                      256   5e-78    
ref|XP_007042381.1|  Alpha/beta-Hydrolases superfamily protein, p...    260   6e-78    
ref|XP_006346463.1|  PREDICTED: probable carboxylesterase 7-like        256   6e-78    
ref|XP_004976421.1|  PREDICTED: probable carboxylesterase 1-like ...    256   6e-78    
ref|XP_009789749.1|  PREDICTED: probable carboxylesterase 2             256   7e-78    
ref|XP_010028485.1|  PREDICTED: probable carboxylesterase 12            256   7e-78    
ref|XP_008356214.1|  PREDICTED: probable carboxylesterase 12            256   7e-78    
gb|AFW62365.1|  gibberellin receptor GID1L2                             256   7e-78    
ref|XP_010943015.1|  PREDICTED: tuliposide A-converting enzyme 2,...    256   8e-78    
ref|XP_007017300.1|  Catalytic, putative                                256   8e-78    
gb|KCW66448.1|  hypothetical protein EUGRSUZ_F00245                     256   9e-78    
ref|XP_009403370.1|  PREDICTED: probable carboxylesterase 12            256   9e-78    
ref|XP_011000170.1|  PREDICTED: probable carboxylesterase 12            256   1e-77    
ref|XP_004973681.1|  PREDICTED: probable carboxylesterase 12-like       256   1e-77    
gb|AFV95084.1|  carboxylesterase 1                                      256   2e-77    
ref|XP_006346461.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    254   2e-77    
ref|XP_003550344.1|  PREDICTED: probable carboxylesterase 13-like       255   3e-77    
ref|XP_007156546.1|  hypothetical protein PHAVU_003G295200g             254   3e-77    
ref|NP_001062036.1|  Os08g0475400                                       255   3e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011006470.1|  PREDICTED: probable carboxylesterase 12            254   3e-77    
ref|XP_002285071.1|  PREDICTED: probable carboxylesterase 12            254   3e-77    Vitis vinifera
ref|XP_009623230.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    254   3e-77    
ref|XP_007201337.1|  hypothetical protein PRUPE_ppa007658mg             256   3e-77    
ref|XP_009418894.1|  PREDICTED: probable carboxylesterase 12            254   3e-77    
ref|XP_010671193.1|  PREDICTED: probable carboxylesterase 12            255   4e-77    
ref|XP_003574615.1|  PREDICTED: tuliposide A-converting enzyme 1,...    254   4e-77    
gb|EEC83733.1|  hypothetical protein OsI_29586                          254   4e-77    Oryza sativa Indica Group [Indian rice]
ref|XP_002313105.1|  hypothetical protein POPTR_0009s10700g             254   4e-77    Populus trichocarpa [western balsam poplar]
gb|EYU42665.1|  hypothetical protein MIMGU_mgv1a025384mg                254   6e-77    
ref|XP_011000218.1|  PREDICTED: probable carboxylesterase 12            254   6e-77    
ref|XP_004973680.1|  PREDICTED: probable carboxylesterase 12-like       254   8e-77    
ref|XP_003518853.1|  PREDICTED: probable carboxylesterase 12-like...    254   1e-76    
ref|XP_010251281.1|  PREDICTED: probable carboxylesterase 2             253   1e-76    
ref|XP_011083826.1|  PREDICTED: probable carboxylesterase 7             254   1e-76    
ref|NP_001150584.1|  gibberellin receptor GID1L2                        253   1e-76    Zea mays [maize]
emb|CDP18391.1|  unnamed protein product                                253   1e-76    
ref|XP_010943010.1|  PREDICTED: tuliposide A-converting enzyme 2,...    253   1e-76    
ref|XP_006346462.1|  PREDICTED: probable carboxylesterase 7-like        253   1e-76    
ref|XP_008373167.1|  PREDICTED: probable carboxylesterase 12            253   2e-76    
ref|XP_003608006.1|  Gibberellin receptor GID1                          253   2e-76    
ref|XP_009612646.1|  PREDICTED: probable carboxylesterase 2             253   2e-76    
gb|KCW63811.1|  hypothetical protein EUGRSUZ_G01482                     253   2e-76    
gb|ACJ84504.1|  unknown                                                 252   3e-76    Medicago truncatula
ref|XP_010066043.1|  PREDICTED: probable carboxylesterase 12            253   3e-76    
ref|XP_008375949.1|  PREDICTED: LOW QUALITY PROTEIN: probable car...    251   3e-76    
ref|XP_006354905.1|  PREDICTED: probable carboxylesterase 2-like        252   3e-76    
gb|KDP25937.1|  hypothetical protein JCGZ_22842                         252   3e-76    
ref|XP_004505199.1|  PREDICTED: probable carboxylesterase 2-like        251   4e-76    
gb|KDP38376.1|  hypothetical protein JCGZ_04301                         252   4e-76    
ref|XP_006480144.1|  PREDICTED: probable carboxylesterase 13-like       252   4e-76    
ref|XP_010943011.1|  PREDICTED: tuliposide A-converting enzyme 2,...    251   4e-76    
ref|XP_006379206.1|  hypothetical protein POPTR_0009s10680g             251   5e-76    
ref|XP_008811334.1|  PREDICTED: probable carboxylesterase 2             251   5e-76    
gb|KDO49165.1|  hypothetical protein CISIN_1g042745mg                   251   6e-76    
gb|EYU37700.1|  hypothetical protein MIMGU_mgv1a018666mg                251   9e-76    
ref|XP_008459209.1|  PREDICTED: probable carboxylesterase 7             253   1e-75    
ref|XP_009391348.1|  PREDICTED: tuliposide A-converting enzyme 2,...    250   1e-75    
ref|XP_008346181.1|  PREDICTED: probable carboxylesterase 12            250   1e-75    
ref|XP_009793834.1|  PREDICTED: probable carboxylesterase 2             250   2e-75    
ref|XP_011083827.1|  PREDICTED: probable carboxylesterase 7             250   2e-75    
ref|XP_007042383.1|  Catalytic, putative                                249   2e-75    
ref|XP_010059959.1|  PREDICTED: probable carboxylesterase 2             250   2e-75    
ref|NP_001149234.1|  gibberellin receptor GID1L2                        250   2e-75    
ref|XP_002282006.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase       249   2e-75    
ref|XP_011030283.1|  PREDICTED: probable carboxylesterase 2             249   2e-75    
ref|XP_010503510.1|  PREDICTED: probable carboxylesterase 12            250   2e-75    
ref|XP_004238173.1|  PREDICTED: probable carboxylesterase 2             249   3e-75    
ref|XP_010238241.1|  PREDICTED: probable carboxylesterase 12            250   3e-75    
ref|XP_006379210.1|  hypothetical protein POPTR_0009s10780g             251   3e-75    
tpg|DAA48454.1|  TPA: hypothetical protein ZEAMMB73_761771              249   3e-75    
ref|XP_006404226.1|  hypothetical protein EUTSA_v10010541mg             249   3e-75    
ref|XP_002313842.2|  hypothetical protein POPTR_0009s10800g             249   4e-75    
ref|NP_001148405.1|  gibberellin receptor GID1L2                        249   4e-75    
ref|XP_010647769.1|  PREDICTED: probable carboxylesterase 2             249   5e-75    
gb|KDP25940.1|  hypothetical protein JCGZ_22845                         248   6e-75    
ref|XP_007199906.1|  hypothetical protein PRUPE_ppa007279mg             250   8e-75    
gb|EAY94325.1|  hypothetical protein OsI_16093                          248   9e-75    
ref|NP_001052933.1|  Os04g0449800                                       248   9e-75    
ref|XP_009150180.1|  PREDICTED: probable carboxylesterase 12            248   1e-74    
ref|XP_006292986.1|  hypothetical protein CARUB_v10019264mg             248   1e-74    
ref|XP_009351128.1|  PREDICTED: probable carboxylesterase 12            248   1e-74    
ref|XP_009401278.1|  PREDICTED: probable carboxylesterase 2             248   1e-74    
ref|XP_007136667.1|  hypothetical protein PHAVU_009G063600g             248   1e-74    
emb|CDY37916.1|  BnaA06g19010D                                          248   1e-74    
emb|CAN61113.1|  hypothetical protein VITISV_006468                     247   2e-74    
ref|XP_002284585.2|  PREDICTED: probable carboxylesterase 2             249   2e-74    
emb|CDO97159.1|  unnamed protein product                                247   2e-74    
ref|XP_002285054.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase       246   2e-74    
ref|XP_002285042.1|  PREDICTED: probable carboxylesterase 5             247   2e-74    
ref|XP_011088286.1|  PREDICTED: probable carboxylesterase 12            247   2e-74    
ref|XP_003603016.1|  Gibberellin receptor GID1                          247   3e-74    
ref|XP_006342613.1|  PREDICTED: probable carboxylesterase 2-like        247   3e-74    
ref|XP_009358071.1|  PREDICTED: probable carboxylesterase 12            246   4e-74    
emb|CAH67096.1|  H0818E04.13                                            246   4e-74    
ref|XP_009403354.1|  PREDICTED: tuliposide A-converting enzyme 1,...    246   4e-74    
dbj|BAK00050.1|  predicted protein                                      246   4e-74    
ref|XP_004294838.1|  PREDICTED: probable carboxylesterase 1-like        246   4e-74    
ref|XP_003578247.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    246   5e-74    
emb|CBI26216.3|  unnamed protein product                                247   6e-74    
gb|KHN12768.1|  Putative carboxylesterase 13                            246   6e-74    
ref|XP_004505201.1|  PREDICTED: probable carboxylesterase 12-like       247   6e-74    
ref|XP_009401277.1|  PREDICTED: tuliposide A-converting enzyme 1,...    246   7e-74    
ref|XP_011074454.1|  PREDICTED: probable carboxylesterase 2             246   7e-74    
ref|XP_007201831.1|  hypothetical protein PRUPE_ppa009150mg             245   8e-74    
ref|XP_006374970.1|  hypothetical protein POPTR_0014s03230g             246   8e-74    
ref|XP_008236606.1|  PREDICTED: probable carboxylesterase 5             247   8e-74    
emb|CAN61114.1|  hypothetical protein VITISV_006469                     245   9e-74    
gb|EMT18899.1|  Putative gibberellin receptor GID1L3                    245   9e-74    
ref|XP_003608007.1|  Gibberellin receptor GID1                          245   1e-73    
ref|XP_009805070.1|  PREDICTED: probable carboxylesterase 12            244   1e-73    
dbj|BAJ84785.1|  predicted protein                                      245   2e-73    
gb|KEH22636.1|  CXE carboxylesterase                                    246   2e-73    
ref|XP_002285076.1|  PREDICTED: probable carboxylesterase 2             244   2e-73    
ref|NP_001063401.1|  Os09g0462300                                       245   2e-73    
dbj|BAJ95882.1|  predicted protein                                      245   2e-73    
ref|XP_003608010.1|  Hormone-sensitive lipase                           244   3e-73    
gb|ABB89018.1|  CXE carboxylesterase                                    243   3e-73    
ref|XP_010426364.1|  PREDICTED: probable carboxylesterase 12            244   3e-73    
gb|EPS68028.1|  hypothetical protein M569_06746                         244   3e-73    
ref|XP_010107961.1|  putative carboxylesterase 13                       244   4e-73    
ref|XP_010059963.1|  PREDICTED: probable carboxylesterase 2             244   4e-73    
ref|XP_004145359.1|  PREDICTED: probable carboxylesterase 13-like       244   4e-73    
ref|XP_004294840.1|  PREDICTED: probable carboxylesterase 7-like        243   4e-73    
ref|XP_011083926.1|  PREDICTED: LOW QUALITY PROTEIN: probable car...    243   5e-73    
ref|XP_010028488.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    243   5e-73    
ref|XP_004957048.1|  PREDICTED: probable carboxylesterase 1-like        244   5e-73    
gb|EEC84712.1|  hypothetical protein OsI_31672                          244   5e-73    
ref|XP_002285045.1|  PREDICTED: probable carboxylesterase 12            243   6e-73    
ref|XP_008346179.1|  PREDICTED: probable carboxylesterase 12            243   6e-73    
ref|XP_010503505.1|  PREDICTED: probable carboxylesterase 12 isof...    243   8e-73    
ref|XP_010227862.1|  PREDICTED: probable carboxylesterase 12            244   8e-73    
ref|XP_008372376.1|  PREDICTED: probable carboxylesterase 12            243   9e-73    
ref|NP_190438.1|  probable carboxylesterase 12                          243   9e-73    
ref|XP_008236603.1|  PREDICTED: probable carboxylesterase 12            242   1e-72    
ref|XP_010503506.1|  PREDICTED: probable carboxylesterase 12 isof...    243   1e-72    
gb|KDP25945.1|  hypothetical protein JCGZ_22850                         243   2e-72    
ref|XP_008392310.1|  PREDICTED: probable carboxylesterase 12            244   2e-72    
ref|XP_006487077.1|  PREDICTED: probable carboxylesterase 12-like       243   2e-72    
ref|XP_006292579.1|  hypothetical protein CARUB_v10018816mg             242   2e-72    
ref|XP_009367375.1|  PREDICTED: probable carboxylesterase 2             242   2e-72    
ref|NP_001063395.1|  Os09g0461700                                       242   2e-72    
ref|XP_010515187.1|  PREDICTED: probable carboxylesterase 12            242   2e-72    
ref|XP_004291126.1|  PREDICTED: probable carboxylesterase 2-like        241   3e-72    
emb|CDP15143.1|  unnamed protein product                                241   3e-72    
ref|XP_006487128.1|  PREDICTED: probable carboxylesterase 13-like       241   3e-72    
ref|XP_002285060.1|  PREDICTED: probable carboxylesterase 7 isofo...    244   3e-72    
gb|AAL57633.1|  AT3g48690/T8P19_200                                     241   3e-72    
emb|CDX77920.1|  BnaC03g52990D                                          241   3e-72    
emb|CDO97158.1|  unnamed protein product                                242   3e-72    
ref|XP_006487081.1|  PREDICTED: probable carboxylesterase 5-like        241   3e-72    
gb|EAZ03815.1|  hypothetical protein OsI_25944                          241   3e-72    
ref|XP_011092716.1|  PREDICTED: probable carboxylesterase 12            243   3e-72    
ref|XP_009623231.1|  PREDICTED: probable carboxylesterase 12            241   3e-72    
dbj|BAE98942.1|  hypothetical protein                                   241   3e-72    
ref|XP_010647771.1|  PREDICTED: probable carboxylesterase 7 isofo...    244   3e-72    
ref|XP_003574616.1|  PREDICTED: probable carboxylesterase 12            242   3e-72    
ref|XP_007222829.1|  hypothetical protein PRUPE_ppa008795mg             241   4e-72    
gb|ABB89005.1|  CXE carboxylesterase                                    241   4e-72    
ref|XP_007200860.1|  hypothetical protein PRUPE_ppa027099mg             241   4e-72    
ref|XP_010059962.1|  PREDICTED: probable carboxylesterase 2             241   4e-72    
gb|AEP68102.1|  CXE protein                                             241   5e-72    
ref|XP_009349526.1|  PREDICTED: probable carboxylesterase 2             241   7e-72    
ref|XP_008452527.1|  PREDICTED: probable carboxylesterase 2             241   7e-72    
ref|XP_008392308.1|  PREDICTED: probable carboxylesterase 7             242   8e-72    
ref|XP_009350720.1|  PREDICTED: probable carboxylesterase 12            240   8e-72    
ref|XP_004505198.1|  PREDICTED: probable carboxylesterase 2-like        240   9e-72    
ref|XP_002532718.1|  catalytic, putative                                240   1e-71    
ref|XP_007201832.1|  hypothetical protein PRUPE_ppa009160mg             239   1e-71    
ref|XP_004957035.1|  PREDICTED: probable carboxylesterase 12-like       240   1e-71    
ref|XP_003529387.1|  PREDICTED: probable carboxylesterase 12-like       240   1e-71    
ref|XP_010265680.1|  PREDICTED: probable carboxylesterase 2             242   1e-71    
gb|KHN31061.1|  Putative carboxylesterase 2                             240   1e-71    
ref|XP_004248737.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    239   1e-71    
gb|KHN30460.1|  Putative carboxylesterase 2                             244   2e-71    
ref|NP_001063391.1|  Os09g0460700                                       239   2e-71    
gb|ACU20935.1|  unknown                                                 239   2e-71    
ref|NP_001057132.1|  Os06g0214800                                       240   2e-71    
emb|CDX68486.1|  BnaC01g25640D                                          239   2e-71    
ref|XP_010515186.1|  PREDICTED: probable carboxylesterase 12            239   2e-71    
ref|XP_008236608.1|  PREDICTED: probable carboxylesterase 12            240   2e-71    
ref|XP_003528252.1|  PREDICTED: probable carboxylesterase 2-like        239   3e-71    
ref|XP_006346459.1|  PREDICTED: probable carboxylesterase 12-like       238   3e-71    
ref|XP_008220200.1|  PREDICTED: probable carboxylesterase 2             239   3e-71    
ref|XP_002518790.1|  Gibberellin receptor GID1, putative                239   4e-71    
ref|XP_004160624.1|  PREDICTED: probable carboxylesterase 2-like        239   4e-71    
gb|KDP20170.1|  hypothetical protein JCGZ_00017                         238   4e-71    
gb|KDP25933.1|  hypothetical protein JCGZ_22838                         240   5e-71    
ref|XP_008367674.1|  PREDICTED: probable carboxylesterase 2             238   5e-71    
ref|XP_002877622.1|  hypothetical protein ARALYDRAFT_485224             238   5e-71    
ref|XP_010028489.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    238   5e-71    
ref|XP_002518791.1|  catalytic, putative                                239   6e-71    
ref|XP_006384431.1|  hypothetical protein POPTR_0004s15020g             238   6e-71    
gb|EAZ09394.1|  hypothetical protein OsI_31668                          238   7e-71    
ref|XP_010059961.1|  PREDICTED: probable carboxylesterase 2             238   7e-71    
ref|XP_010426363.1|  PREDICTED: probable carboxylesterase 12            238   8e-71    
ref|NP_190439.1|  carboxyesterase 13                                    238   8e-71    
ref|XP_002442315.1|  hypothetical protein SORBIDRAFT_08g017820          238   9e-71    
ref|XP_006480146.1|  PREDICTED: probable carboxylesterase 12-like       238   1e-70    
ref|XP_002510251.1|  Gibberellin receptor GID1, putative                237   1e-70    
ref|NP_001063388.1|  Os09g0460300                                       239   1e-70    
ref|XP_011004992.1|  PREDICTED: probable carboxylesterase 1             237   2e-70    
ref|XP_009151501.1|  PREDICTED: probable carboxylesterase 12            237   2e-70    
gb|ACG31461.1|  gibberellin receptor GID1L2                             236   2e-70    
gb|EYU37698.1|  hypothetical protein MIMGU_mgv1a026137mg                237   2e-70    
ref|XP_009359212.1|  PREDICTED: probable carboxylesterase 2             236   3e-70    
ref|XP_010943127.1|  PREDICTED: tuliposide A-converting enzyme 2,...    236   3e-70    
ref|XP_002518789.1|  catalytic, putative                                237   3e-70    
ref|XP_010059960.1|  PREDICTED: probable carboxylesterase 2             236   4e-70    
ref|XP_006291432.1|  hypothetical protein CARUB_v10017570mg             236   5e-70    
ref|XP_006480129.1|  PREDICTED: probable carboxylesterase 2-like        235   5e-70    
ref|XP_008236604.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    235   6e-70    
gb|EAZ03818.1|  hypothetical protein OsI_25947                          238   6e-70    
ref|XP_010028490.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    235   7e-70    
ref|XP_006494929.1|  PREDICTED: probable carboxylesterase 12-like       235   7e-70    
gb|EYU37699.1|  hypothetical protein MIMGU_mgv1a026120mg                234   1e-69    
ref|NP_001140832.1|  uncharacterized LOC100272907                       236   1e-69    
ref|XP_004230811.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    234   1e-69    
ref|XP_004294834.1|  PREDICTED: probable carboxylesterase 13-like       236   2e-69    
gb|KHN37496.1|  Putative carboxylesterase 2                             234   2e-69    
ref|XP_003608013.1|  CXE carboxylesterase                               234   2e-69    
emb|CDP15654.1|  unnamed protein product                                234   2e-69    
ref|XP_002285040.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase       234   2e-69    
ref|XP_010515188.1|  PREDICTED: LOW QUALITY PROTEIN: probable car...    234   2e-69    
ref|NP_001142317.1|  uncharacterized protein LOC100274486               234   2e-69    
emb|CDY20870.1|  BnaC05g26220D                                          234   2e-69    
ref|XP_004294836.1|  PREDICTED: probable carboxylesterase 1-like        233   2e-69    
emb|CDX83045.1|  BnaA01g20450D                                          234   3e-69    
gb|ABB89003.1|  CXE carboxylesterase                                    234   3e-69    
gb|KDO57857.1|  hypothetical protein CISIN_1g043192mg                   234   3e-69    
ref|XP_009410114.1|  PREDICTED: tuliposide A-converting enzyme 1,...    234   3e-69    
gb|KFK34170.1|  hypothetical protein AALP_AA5G109700                    234   3e-69    
gb|EYU37697.1|  hypothetical protein MIMGU_mgv1a027056mg                234   4e-69    
gb|KDO36706.1|  hypothetical protein CISIN_1g021927mg                   233   4e-69    
gb|EYU36292.1|  hypothetical protein MIMGU_mgv1a009954mg                233   5e-69    
ref|XP_010425157.1|  PREDICTED: probable carboxylesterase 7             233   5e-69    
gb|EAZ00143.1|  hypothetical protein OsI_22147                          233   6e-69    
ref|XP_010274181.1|  PREDICTED: probable carboxylesterase 2             233   6e-69    
gb|KDO35883.1|  hypothetical protein CISIN_1g022120mg                   232   6e-69    
gb|KDP38377.1|  hypothetical protein JCGZ_04302                         233   7e-69    
ref|NP_001057131.1|  Os06g0214300                                       233   7e-69    
dbj|BAJ94344.1|  predicted protein                                      233   8e-69    
gb|EAZ36262.1|  hypothetical protein OsJ_20583                          233   9e-69    
ref|XP_009152167.1|  PREDICTED: probable carboxylesterase 7 isofo...    232   1e-68    
ref|XP_010275602.1|  PREDICTED: probable carboxylesterase 2             232   1e-68    
ref|XP_003518851.1|  PREDICTED: probable carboxylesterase 12-like       234   1e-68    
ref|XP_008459207.1|  PREDICTED: probable carboxylesterase 12            232   1e-68    
emb|CBI32437.3|  unnamed protein product                                231   1e-68    
ref|NP_001168393.1|  uncharacterized protein LOC100382162               232   1e-68    
ref|XP_007200491.1|  hypothetical protein PRUPE_ppa009174mg             231   1e-68    
ref|XP_010107964.1|  putative carboxylesterase 7                        231   2e-68    
ref|XP_003523912.1|  PREDICTED: probable carboxylesterase 2-like        231   2e-68    
gb|KDP25934.1|  hypothetical protein JCGZ_22839                         231   2e-68    
dbj|BAK06088.1|  predicted protein                                      232   2e-68    
ref|XP_002518752.1|  Gibberellin receptor GID1, putative                231   2e-68    
emb|CAN61112.1|  hypothetical protein VITISV_006467                     234   2e-68    
ref|XP_010033690.1|  PREDICTED: probable carboxylesterase 12            233   3e-68    
emb|CDY29339.1|  BnaA05g16060D                                          231   3e-68    
ref|XP_011000147.1|  PREDICTED: probable carboxylesterase 7             231   3e-68    
ref|XP_010066050.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    230   4e-68    
ref|XP_002531392.1|  Arylacetamide deacetylase, putative                230   5e-68    
ref|XP_006395695.1|  hypothetical protein EUTSA_v10004622mg             231   5e-68    
ref|XP_009772464.1|  PREDICTED: probable carboxylesterase 2             230   6e-68    
ref|XP_004957041.1|  PREDICTED: probable carboxylesterase 12-like       230   8e-68    
ref|XP_002436702.1|  hypothetical protein SORBIDRAFT_10g007228          230   8e-68    
ref|XP_011006469.1|  PREDICTED: probable carboxylesterase 12            229   8e-68    
tpg|DAA61799.1|  TPA: gibberellin receptor GID1L2                       230   9e-68    
ref|XP_002526230.1|  catalytic, putative                                229   2e-67    
ref|XP_007200745.1|  hypothetical protein PRUPE_ppa026088mg             228   2e-67    
ref|XP_006473355.1|  PREDICTED: probable carboxylesterase 2-like        229   2e-67    
ref|XP_006480127.1|  PREDICTED: probable carboxylesterase 5-like        228   2e-67    
ref|XP_006487076.1|  PREDICTED: probable carboxylesterase 12-like       228   3e-67    
gb|KFK44058.1|  hypothetical protein AALP_AA1G210500                    228   3e-67    
ref|NP_001148840.1|  gibberellin receptor GID1L2                        229   3e-67    
tpg|DAA61750.1|  TPA: hypothetical protein ZEAMMB73_506846              231   3e-67    
ref|XP_008236605.1|  PREDICTED: 2-hydroxyisoflavanone dehydratase...    228   4e-67    
ref|XP_002313103.2|  hypothetical protein POPTR_0009s10730g             228   4e-67    
ref|XP_007156547.1|  hypothetical protein PHAVU_003G295300g             229   4e-67    
ref|XP_004230810.1|  PREDICTED: probable carboxylesterase 13            228   4e-67    
ref|XP_002875213.1|  hypothetical protein ARALYDRAFT_484264             228   4e-67    
ref|XP_011004866.1|  PREDICTED: probable carboxylesterase 12            228   4e-67    
ref|XP_004964881.1|  PREDICTED: probable carboxylesterase 2-like        229   4e-67    
ref|XP_006384430.1|  hypothetical protein POPTR_0004s15010g             228   5e-67    



>ref|XP_009619335.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Nicotiana 
tomentosiformis]
Length=343

 Score =   380 bits (977),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 194/306 (63%), Positives = 241/306 (79%), Gaps = 5/306 (2%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLAS--ATQK  985
             S LIRVYK+GRVER+   P VPP+PED ATGV+SKDI +SP I  R+Y PKL +    QK
Sbjct  37    SQLIRVYKNGRVERMFGSPIVPPTPEDPATGVASKDIDISPEIRARIYHPKLTTKNTDQK  96

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LPIL+YYHGGGFC++SAFS +   YLN++VS++NV+A+SVEYRLAPEHPLP GYED W A
Sbjct  97    LPILLYYHGGGFCLESAFSFLDQRYLNLIVSKSNVVAISVEYRLAPEHPLPVGYEDSWTA  156

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             LQW+ASH  +  +    KEPWLVNHGDFEK+ +GGDSAGGNIVHN+++R+G E LN   K
Sbjct  157   LQWIASHVLD--KPGFGKEPWLVNHGDFEKVLIGGDSAGGNIVHNISLRSGLESLNGGVK  214

Query  624   LLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCS  445
             +LG IL FPYF SS+E   E S+  ++W FV P+A+ G+D+P I P  E APSL+GL CS
Sbjct  215   ILGSILCFPYFLSSSE-FKEDSLASRIWAFVNPSAEDGVDDPRINPFVEKAPSLSGLGCS  273

Query  444   KLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFKR  265
             K+ VCVAEKDELR I ++YVEAVKKSGWKGEI+++DV+GE+HCF I +P TEKAKD  K 
Sbjct  274   KILVCVAEKDELRNIGIQYVEAVKKSGWKGEIKLIDVQGEDHCFQIFDPETEKAKDLIKG  333

Query  264   IASFIQ  247
             IA F++
Sbjct  334   IADFVK  339



>ref|XP_009593308.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Nicotiana 
tomentosiformis]
Length=317

 Score =   378 bits (970),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 199/308 (65%), Positives = 234/308 (76%), Gaps = 8/308 (3%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASAT---Q  988
             SP+IRVYKDG VER+   PYVPPSPEDS TGVSSKD+T+S ++  R+Y PKL+  T   Q
Sbjct  13    SPVIRVYKDGHVERLFGSPYVPPSPEDSVTGVSSKDLTISSDLKARIYHPKLSITTSNNQ  72

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLPILVYYHGGGFCV S FS +   YLN+LVS+AN++ VSV+Y LAPEHPL   Y+D W 
Sbjct  73    KLPILVYYHGGGFCVGSTFSFLSQRYLNLLVSEANIVTVSVQYSLAPEHPLSVIYDDSWT  132

Query  807   ALQWVASHA-SNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
             ALQWV +H   N G +   KEPWL++HGDF+KIFVGGDSAGGNI HNV +RAG E LN  
Sbjct  133   ALQWVTAHVLENPGIK---KEPWLIDHGDFKKIFVGGDSAGGNIAHNVVLRAGVEGLNGG  189

Query  630   SKLLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLR  451
              K+LGGILSFPYF SS E  G+ S+L K+W FV P+A+ GID+P I P  E APSL  L 
Sbjct  190   VKILGGILSFPYFLSSTENRGD-SLLSKIWVFVNPSAENGIDDPKINPFVEKAPSLTELG  248

Query  450   CSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTF  271
             CS+L VCVAEKDELR + +RY E VKK GWKGE+EVV+VEGE HCF I+NP  EKAK   
Sbjct  249   CSRLLVCVAEKDELRNLGIRYAEVVKKCGWKGEVEVVEVEGEGHCFQILNPDGEKAKHLI  308

Query  270   KRIASFIQ  247
             KRIA FI+
Sbjct  309   KRIAEFIK  316



>emb|CDO99026.1| unnamed protein product [Coffea canephora]
Length=318

 Score =   377 bits (968),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 193/307 (63%), Positives = 237/307 (77%), Gaps = 4/307 (1%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLP  979
             SP I+VY+DG VER+   P+VPPS +D  TGVSSKDIT+SP+IS R+YLPK++    KLP
Sbjct  14    SPAIKVYRDGTVERLSGSPFVPPSLDDPTTGVSSKDITISPSISARMYLPKISDPNHKLP  73

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             ILV++HGG F V+SAFS ++H Y+N+LVS+A  +AVSVEYRLAPEHPLPA  ED W ALQ
Sbjct  74    ILVFFHGGRFVVESAFSFLHHRYVNLLVSEARAVAVSVEYRLAPEHPLPAALEDGWAALQ  133

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WVASH   +G  +  KEPWLV HGDF KI++GG SAGGNIVHN+AIRAG E L    K+L
Sbjct  134   WVASHVV-EGSGIE-KEPWLVKHGDFNKIYLGGSSAGGNIVHNMAIRAGVESLVGDVKIL  191

Query  618   GGILSFPYFWSSNEK--GGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCS  445
             GG LS PYFW S  K    E+S+  KV+ F YP A GGIDNPMI P+A+ AP L+GL CS
Sbjct  192   GGFLSHPYFWDSTTKKENNEESMPYKVFMFAYPLAPGGIDNPMINPLADGAPKLSGLACS  251

Query  444   KLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFKR  265
             +L VC ++KD+ REI+L YVEA+KKSGWKGE+E VDV+GE+HCF + NP TEK+K    R
Sbjct  252   RLFVCTSQKDQFREINLLYVEALKKSGWKGELEFVDVDGEDHCFEVFNPETEKSKSLITR  311

Query  264   IASFIQD  244
             +ASFI+D
Sbjct  312   LASFIRD  318



>ref|XP_009778186.1| PREDICTED: LOW QUALITY PROTEIN: 2-hydroxyisoflavanone dehydratase-like 
[Nicotiana sylvestris]
Length=319

 Score =   373 bits (958),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 192/307 (63%), Positives = 238/307 (78%), Gaps = 7/307 (2%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLAS--ATQK  985
             SPL+RVYK+GRVERI   P VPP PED ATGV+SKDI +SP I  R+YLPKL +    Q+
Sbjct  13    SPLLRVYKNGRVERIFGSPIVPPIPEDPATGVASKDIEISPEIRARIYLPKLRTKNTDQR  72

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
              PILVYYHGGGFC++SAFS +   YLN++VS++NV+A+SVEYRLAPEHPLP GYED W A
Sbjct  73    FPILVYYHGGGFCLESAFSFLDQRYLNLIVSESNVVAISVEYRLAPEHPLPVGYEDSWTA  132

Query  804   LQWVASHASND-GQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             LQWVASH  +  G +   KEPWLVNHGDFEK+ +GGDSAGGNIVHN+++R G E LN   
Sbjct  133   LQWVASHVLDKPGFE---KEPWLVNHGDFEKVLIGGDSAGGNIVHNISLRPGLESLNGGV  189

Query  627   KLLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRC  448
             K+LG IL FPYF SS+E   E S+  ++W FV P+A+ G+D+P I P  E A SL+GL C
Sbjct  190   KILGSILCFPYFLSSSEF-KEDSLPGRIWAFVNPSAEDGVDDPRINPFVEKAHSLSGLGC  248

Query  447   SKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFK  268
               + VCVAEKDE+R I ++YVEAVKKSGWKGEI+++DV+GE+HCF + +P TEKAKD  K
Sbjct  249   XNILVCVAEKDEMRNIGIQYVEAVKKSGWKGEIKLIDVQGEDHCFQVFDPETEKAKDLIK  308

Query  267   RIASFIQ  247
              IA F++
Sbjct  309   GIADFVK  315



>ref|XP_011071672.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Sesamum indicum]
Length=321

 Score =   367 bits (942),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 185/309 (60%), Positives = 233/309 (75%), Gaps = 8/309 (3%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLP  979
             SP+I+VY DG VER+   P+VPPSPED  TGVSSKD  +SP +S R+YLPKL   TQKLP
Sbjct  13    SPIIKVYTDGTVERLFGSPHVPPSPEDPTTGVSSKDTIISPTVSARLYLPKLTHPTQKLP  72

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             ILVYYHGGGFCV+SAFS   H ++N+L +++  + VSVEYRLAPEHPLPA YED W+AL+
Sbjct  73    ILVYYHGGGFCVESAFSFFDHRFMNLLSAESVALVVSVEYRLAPEHPLPAAYEDSWDALK  132

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WV SH  +  Q    K+ W+ NH DF ++F+GGDSAGGNIVHN+A+RAG+E L    K+L
Sbjct  133   WVCSHVLD--QTHFEKDQWITNHADFNRVFIGGDSAGGNIVHNIAMRAGSESLPGNVKIL  190

Query  618   GGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
             G ILS PYFW SN  G       EQ  + ++W FVYP+A GGID+P+I P+A+ APSLAG
Sbjct  191   GAILSHPYFWGSNPIGNEPKEDIEQHTVYRLWLFVYPSAPGGIDSPLINPLADGAPSLAG  250

Query  456   LRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             L CSK+ VC++EKD L    L Y E VKKSGWKGE++VV+++GE+HCF + +P TEKAK+
Sbjct  251   LGCSKIIVCLSEKDLLTARGLVYAEKVKKSGWKGEVQVVEIDGEDHCFHLFDPQTEKAKN  310

Query  276   TFKRIASFI  250
               KR+ASFI
Sbjct  311   LIKRLASFI  319



>ref|XP_011073864.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Sesamum indicum]
Length=323

 Score =   362 bits (930),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/311 (59%), Positives = 234/311 (75%), Gaps = 10/311 (3%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLP  979
             SP+I+VY DG VER+   P+VPPSPED  TGVSSKD+++SP +S R+YLPKL   TQKLP
Sbjct  13    SPVIKVYTDGTVERLFGSPHVPPSPEDPTTGVSSKDVSISPAVSARLYLPKLTHPTQKLP  72

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             ILVYYH G FC++SAFS  +H Y+N+L ++A  + VSVEYR APEHPLPA YED W+ALQ
Sbjct  73    ILVYYHSGAFCLESAFSFFHHRYINLLSAEAEALVVSVEYRQAPEHPLPAAYEDSWDALQ  132

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WV SH  +  Q +  K+ W+ +HGDF ++F+GGDSAGGNI HN+A+RAG+E L    K++
Sbjct  133   WVCSHVLD--QTLLEKDQWITDHGDFTRVFIGGDSAGGNIAHNIALRAGSESLPGNVKII  190

Query  618   GGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
             GGILS PYFW SN  G       E++ + ++W FVYP + GGIDNP+I P+A+ APSL+G
Sbjct  191   GGILSHPYFWGSNPIGNEPKVDIEENFMYRLWLFVYPFSPGGIDNPLINPLAKGAPSLSG  250

Query  456   LRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE--KA  283
             L CSK+ VC+AEKD+L    L YVE VKKSGWKGE+EV  VEGE+HCF I +P T+   A
Sbjct  251   LGCSKILVCLAEKDQLTARGLVYVEEVKKSGWKGEVEVTVVEGEDHCFHIYDPETQTPSA  310

Query  282   KDTFKRIASFI  250
             K+  +R+ASFI
Sbjct  311   KNLIRRLASFI  321



>emb|CDO99023.1| unnamed protein product [Coffea canephora]
Length=326

 Score =   361 bits (927),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 228/310 (74%), Gaps = 10/310 (3%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLPI  976
             P +RVYKDG VER  + PYVPP+ ED ATGVSSKDIT+SP IS R+YLPKL + TQKLPI
Sbjct  14    PFLRVYKDGSVERFLDSPYVPPALEDPATGVSSKDITISPGISARIYLPKLPTTTQKLPI  73

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             L Y+HGG FC++SAFS +   Y++ L SQA V+ VSVEYRLAPE+P+P  YED W ALQW
Sbjct  74    LAYFHGGAFCIESAFSFLSQRYISTLASQAKVLVVSVEYRLAPENPIPTAYEDSWAALQW  133

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
             +ASH+SND  Q   KEPWL+NH DF ++FVGGDS+G NI HN+++RAG E L     + G
Sbjct  134   IASHSSND--QNYKKEPWLLNHADFNRVFVGGDSSGANIAHNLSLRAGRESLQGGMSIHG  191

Query  615   GILSFPYFWS--------SNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              +LS PYF S        S++   ++++L K W+F YP A GG DNP+I P +  APSL+
Sbjct  192   VLLSHPYFLSSKPISLEPSSDDDVDKNLLYKAWEFAYPNAPGGFDNPLINPFSNEAPSLS  251

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
              L+CS+L VCVAEKDELRE  +RY  A+KKSGWKG++E+ +VEGE+HCF I +     AK
Sbjct  252   SLQCSRLLVCVAEKDELRERGVRYFNAIKKSGWKGKVELFEVEGEDHCFQIFDIERGNAK  311

Query  279   DTFKRIASFI  250
               FKR+ASF+
Sbjct  312   IMFKRLASFL  321



>emb|CDO99024.1| unnamed protein product [Coffea canephora]
Length=320

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/309 (61%), Positives = 233/309 (75%), Gaps = 9/309 (3%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLPI  976
             P+IRVYKDG+VER+    YVPPSPED  TGVSSKDIT+SP +S R+YLPK+    Q+LPI
Sbjct  14    PVIRVYKDGKVERLFGSQYVPPSPEDPITGVSSKDITISPEVSARLYLPKITDPNQRLPI  73

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LVY HGGGFC++SAFS  +  ++N+LVSQA V+AVSVEYRLAPEHPLPA YEDCW ALQW
Sbjct  74    LVYIHGGGFCIESAFSFDHQRHINLLVSQAKVVAVSVEYRLAPEHPLPAAYEDCWAALQW  133

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
             VASH  N   +   +EPWLV+HG+F K++VGGDSAG NIVHNV +RAG E L    K+LG
Sbjct  134   VASHIDNSSME---REPWLVSHGNFNKLYVGGDSAGANIVHNVVLRAGAESLYGDVKILG  190

Query  615   GILSFPYFWSSN--EKG----GEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGL  454
               L+ PYFWSSN   KG      +++  ++W F YP+A+ GIDNPMI P+A+ APSLA L
Sbjct  191   AFLTQPYFWSSNLASKGCGNPRVETLATEIWMFAYPSAERGIDNPMINPLADGAPSLARL  250

Query  453   RCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDT  274
              CS+L V VAEKD LR   + YV+AVK+SGWKGEIE+ +VEG++H F I NP  ++AK  
Sbjct  251   GCSRLLVNVAEKDILRNGGILYVDAVKESGWKGEIELFEVEGKDHSFHIFNPEDKEAKIQ  310

Query  273   FKRIASFIQ  247
              + +ASF+ 
Sbjct  311   MQVLASFLM  319



>ref|XP_011071561.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Sesamum indicum]
Length=321

 Score =   359 bits (921),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 181/309 (59%), Positives = 229/309 (74%), Gaps = 8/309 (3%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLP  979
             +P I+VY DG VERI ++P VPPSPED  TGVSSKD T+SP +S R+YLPKL   TQKLP
Sbjct  13    TPFIKVYTDGTVERIFSFPDVPPSPEDPTTGVSSKDTTISPTLSARLYLPKLTDPTQKLP  72

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             ILVYYHGGGFCVDSAFS + H Y+N L +++  + VSV+YRLAPEHPLPA YED WEAL+
Sbjct  73    ILVYYHGGGFCVDSAFSLLTHRYMNFLSAESGALVVSVQYRLAPEHPLPAAYEDSWEALK  132

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WV SH  +  Q    K+ W+ +H DF ++F+GGDSAGGNI HN+A+RAG+E L    K+L
Sbjct  133   WVCSHVLD--QTHLEKDEWITSHADFNRLFIGGDSAGGNITHNIAMRAGSESLPGNLKVL  190

Query  618   GGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
             G I+S P+FW S+  G       EQS   ++W   YP+A GGID+P+I P+A+ APSL+G
Sbjct  191   GAIISNPFFWGSHPIGNEPREDIEQSAAYRLWFLAYPSAPGGIDSPLINPLADGAPSLSG  250

Query  456   LRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             L CSK+ VC++EKD L    L Y E VKKSGWKG++EVV++EGE+HCF + +P TEKAK 
Sbjct  251   LGCSKIIVCLSEKDVLTARGLVYAEEVKKSGWKGQVEVVEIEGEDHCFQLFDPQTEKAKY  310

Query  276   TFKRIASFI  250
                R+ASFI
Sbjct  311   LISRLASFI  319



>emb|CDO99025.1| unnamed protein product [Coffea canephora]
Length=318

 Score =   358 bits (919),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 236/307 (77%), Gaps = 4/307 (1%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLP  979
             SPL++VY+DGRVER    PYVPPSPED +T VSSKDIT+S + S R+YLP +  +++K P
Sbjct  13    SPLLKVYEDGRVERFFGSPYVPPSPEDPSTSVSSKDITISADFSARLYLPNVQDSSKKFP  72

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             ILVY+H GGFC +SAFS ++H YLN+LVS+AN +AVSVEYRLAPE PLPA YEDCW ALQ
Sbjct  73    ILVYFHCGGFCTESAFSILHHRYLNLLVSEANALAVSVEYRLAPECPLPAAYEDCWAALQ  132

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             W++SH   +      KE WL++HG+F+++++GGDS+G NIVHN+A+RAG E L+   K+L
Sbjct  133   WISSHVVVNSNTD--KEHWLLSHGNFDEVYIGGDSSGANIVHNIAMRAGVESLDGDVKIL  190

Query  618   GGILSFPYFWSS--NEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCS  445
             GG LS P+FW    N +  E+++L +VW  VYP   GG+DNPMI P+A++APSL+ L CS
Sbjct  191   GGFLSHPFFWDPEINAENVEETMLYRVWKLVYPAPPGGLDNPMINPLADDAPSLSQLGCS  250

Query  444   KLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFKR  265
             +L VC +E+DELRE +  YV+ + +SGWKGE+E+V++EGE+HCF I +  +EKAK   KR
Sbjct  251   RLFVCTSERDELRERTGLYVQTLTESGWKGEVELVEIEGEDHCFHIFHLESEKAKSLVKR  310

Query  264   IASFIQD  244
             +A FI +
Sbjct  311   LAFFINN  317



>ref|XP_004247378.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum lycopersicum]
Length=316

 Score =   357 bits (916),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 188/303 (62%), Positives = 233/303 (77%), Gaps = 6/303 (2%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLPIL  973
             LIRVYK+GRVER+   P VP SPED  TGVSSKDI +SP I  R+YLPKL +  QKLPIL
Sbjct  15    LIRVYKNGRVERLFGSPIVPASPEDPDTGVSSKDIDISPEIKARIYLPKLTN-DQKLPIL  73

Query  972   VYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQWV  793
             VYYHGG FC++SAFS + H YLN +V+++NVIAVSVEYRLAPEHPLP  YED W ALQWV
Sbjct  74    VYYHGGAFCLESAFSFLDHRYLNRIVAESNVIAVSVEYRLAPEHPLPVAYEDSWAALQWV  133

Query  792   ASHA-SNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
              SH  S  G +   KEPWLVNHGDFEK+ +GGDSAGGNI HN+ +R+G+E LN   K+LG
Sbjct  134   GSHVESKPGFE---KEPWLVNHGDFEKVLIGGDSAGGNIAHNITLRSGSETLNGGIKILG  190

Query  615   GILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCSKLH  436
              +L FP+F +S++   E S+  K+W+FV P+A+ G+D+P I P  E + SL+ L CSK+ 
Sbjct  191   SLLCFPFFLTSHD-FKEDSLPSKIWEFVNPSAEKGVDDPNINPFVEKSQSLSTLGCSKII  249

Query  435   VCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFKRIAS  256
             VCVAEKDELR I ++YVEAVK S WKGEIE++DVEGE+HCF I +  TEKAK+  K +A+
Sbjct  250   VCVAEKDELRNIGIKYVEAVKNSEWKGEIELIDVEGEDHCFQIFDTETEKAKNLMKGMAN  309

Query  255   FIQ  247
             FI+
Sbjct  310   FIK  312



>ref|XP_006359893.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum tuberosum]
Length=319

 Score =   356 bits (914),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 187/304 (62%), Positives = 229/304 (75%), Gaps = 5/304 (2%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASAT--QKLP  979
              IRVYK+GRVER+   P VPPSPED ATGVSSKDI +SP    R+YLPKL ++   QKLP
Sbjct  15    FIRVYKNGRVERLFGSPIVPPSPEDPATGVSSKDIDISPEFKARIYLPKLTNSITDQKLP  74

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             ILVYYHGG FC++SAFS + H YLN +V+++NVIAVSVEYRL PE+P P  YED W ALQ
Sbjct  75    ILVYYHGGAFCLESAFSVLDHRYLNRIVAESNVIAVSVEYRLVPENPFPVAYEDSWAALQ  134

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WV SH   + +    KEPWLVNHGDFEK+ +GGDSAGGNIVHN+++R+G+E LN   K+L
Sbjct  135   WVGSHV--EAKPGFEKEPWLVNHGDFEKVLIGGDSAGGNIVHNLSLRSGSESLNGGIKIL  192

Query  618   GGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCSKL  439
             G +L FPYF +S +   E S+  K+W FV P+ K G+D+P I P  E A SL+ L CSK+
Sbjct  193   GSLLCFPYFLTSID-FKEDSLPSKLWRFVNPSTKDGVDDPNINPFVEKAQSLSTLGCSKI  251

Query  438   HVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFKRIA  259
              VCVAEKDELR I ++Y EAVK S WKGEIE++DVEGE+HCF I +  TEKAK+  K IA
Sbjct  252   LVCVAEKDELRNIGIKYAEAVKNSEWKGEIELIDVEGEDHCFQIFDTETEKAKNLIKEIA  311

Query  258   SFIQ  247
             SFI+
Sbjct  312   SFIK  315



>ref|XP_007222644.1| hypothetical protein PRUPE_ppa008552mg [Prunus persica]
 gb|EMJ23843.1| hypothetical protein PRUPE_ppa008552mg [Prunus persica]
Length=327

 Score =   352 bits (903),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 186/313 (59%), Positives = 232/313 (74%), Gaps = 12/313 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKL-ASATQK  985
             P IR+YKDG VER+   PYVPPSP D  T VSSKD+T S  PNIS R+YLP +  + TQK
Sbjct  15    PRIRIYKDGTVERLLGSPYVPPSPHDPQTRVSSKDLTFSHNPNISARLYLPNVPQNQTQK  74

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LPILVY+HGG FC++SAFS + H YLN LVS+A VIAVSVEYRLAPE+PLP  YEDCW A
Sbjct  75    LPILVYFHGGAFCIESAFSFLDHRYLNRLVSEAQVIAVSVEYRLAPENPLPIAYEDCWAA  134

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             LQWV SHA+N+ +    KEPWL+N+GDF+++++GGDSAGGNI HN+A++ G E ++   K
Sbjct  135   LQWVTSHANNE-ELDDNKEPWLLNYGDFDRLYIGGDSAGGNIAHNLAMKVGAESISGAVK  193

Query  624   LLGGILSFPYFWSSNEKGG-------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             +LG  LS  YFW S   G        E+++  KVWDFVYP+A GGIDNPM+ P  E APS
Sbjct  194   ILGAFLSHSYFWGSKPIGSEPKGEDFEKTMEYKVWDFVYPSAPGGIDNPMVNPAGEGAPS  253

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPG-TE  289
             LAGL CSKL VCVA KD+LR+  + Y + V++SGWKGE+E+ +VEGE+HCF I +   TE
Sbjct  254   LAGLGCSKLLVCVAGKDQLRDRGVWYCDLVRESGWKGEVELFEVEGEDHCFHIFSETETE  313

Query  288   KAKDTFKRIASFI  250
               K   KR+ASF+
Sbjct  314   NVKKMIKRLASFL  326



>ref|XP_008390858.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Malus domestica]
Length=327

 Score =   351 bits (900),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 186/314 (59%), Positives = 236/314 (75%), Gaps = 13/314 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSP-EDSATGVSSKDITVS--PNISVRVYLPKLA-SATQ  988
             P IR YKDG VER+ +YPYVPPSP ++  TGVSSKDIT+S  PNIS R+YLP L+ + +Q
Sbjct  14    PFIRFYKDGSVERLLDYPYVPPSPNQNPETGVSSKDITISDNPNISARLYLPNLSQNQSQ  73

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLPILVY+HGGGFC++SAFS +  HYLN LVS+A V+A+SV+YRLAPE+PLP  YEDCW+
Sbjct  74    KLPILVYFHGGGFCIESAFSFLDTHYLNRLVSEARVLAISVDYRLAPENPLPIAYEDCWD  133

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
              L+WVASH+SN+      KEPWLV +GDF+++++GGDSAGGNI HN+AI+AG E L    
Sbjct  134   GLRWVASHSSNNDSGGD-KEPWLVRYGDFDRLYIGGDSAGGNIAHNMAIKAGVESLCGGV  192

Query  627   KLLGGILSFPYFWSSNEKGG-------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
             K+LG  LS PYFWSS   G        E+++   +WDFVYP+A GG+DNPM+ P  E  P
Sbjct  193   KILGAFLSHPYFWSSKPIGSEPKGEDFEKAVPYLIWDFVYPSAPGGVDNPMLNPAGEGKP  252

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIM-NPGT  292
             SLAGL CS+L VCVA KDELR+  + Y + VK+SGWKGE+E+ +VEGE+HC+ I     T
Sbjct  253   SLAGLACSRLLVCVAGKDELRDRGVWYYDLVKESGWKGEVELFEVEGEDHCYHIFCESET  312

Query  291   EKAKDTFKRIASFI  250
             E  K   KR+ASF+
Sbjct  313   ENVKKMIKRLASFL  326



>ref|XP_008222954.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Prunus mume]
Length=332

 Score =   349 bits (895),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 186/313 (59%), Positives = 230/313 (73%), Gaps = 12/313 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKL-ASATQK  985
             P IR+YKDG VER+   PYVPPSP D  T VSSKD T S  PNIS R+YLP +  + TQK
Sbjct  20    PRIRIYKDGTVERLMGSPYVPPSPHDPQTRVSSKDFTFSHNPNISARLYLPNVPQNQTQK  79

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LPILVY+HGG FC++SAFS + H YLN LVS+A VIAVSVEYRLAPE+PLP  YEDCW A
Sbjct  80    LPILVYFHGGAFCIESAFSFLDHRYLNRLVSEAQVIAVSVEYRLAPENPLPIAYEDCWVA  139

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             LQWV SHA+N+ +    KEPWL+N+GDF+++++GGDSAGGNI HN+A++ G E L+   K
Sbjct  140   LQWVTSHANNE-ELDDNKEPWLLNYGDFDRLYIGGDSAGGNIAHNLAMKVGAESLSGAVK  198

Query  624   LLGGILSFPYFWSSNEKGG-------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             +LG  LS  YFW S   G        E++   K+WDFVYP+A GGIDNPM+ P  E APS
Sbjct  199   ILGAFLSHSYFWGSKPIGSEPKGEDFEKTTEYKLWDFVYPSAPGGIDNPMVNPAGEGAPS  258

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPG-TE  289
             LAGL CSKL VCVA KD+LR+  + Y + V++SGWKGE+E+ +VEGE+HCF I +   TE
Sbjct  259   LAGLGCSKLLVCVAGKDQLRDRGVWYCDLVRESGWKGEVELFEVEGEDHCFHIFSETETE  318

Query  288   KAKDTFKRIASFI  250
               K   KR+ASF+
Sbjct  319   NVKKMIKRLASFL  331



>ref|XP_007034684.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY05610.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=481

 Score =   354 bits (908),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 186/305 (61%), Positives = 233/305 (76%), Gaps = 7/305 (2%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPE-DSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             LI++YKDG VER+   PYVPPSPE D  TGVSSKDIT+S N  IS R+YLPKL    +KL
Sbjct  177   LIKLYKDGSVERLFGSPYVPPSPEPDPETGVSSKDITISDNPLISARLYLPKLTQPHEKL  236

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             PILVY+H GGFC++SAFS     YLN LVS+A V+AVSVEYRLAPEHPLPA YEDCW AL
Sbjct  237   PILVYFHAGGFCLESAFSFFDLRYLNALVSEARVVAVSVEYRLAPEHPLPAAYEDCWAAL  296

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             QWVASH+ ++  +   K+ WL+NHGDF++IF+GGDSAGGNIVHN+A++AG E L  + KL
Sbjct  297   QWVASHSLDNEIK---KDSWLLNHGDFDRIFIGGDSAGGNIVHNIALQAGAEGLKGRVKL  353

Query  621   LGGILSFPYFWSSNEKGG-EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCS  445
             LG  LS PYFW S      ++S+   VW+FVYP+A GGIDN +I P+    PSLAGL CS
Sbjct  354   LGAFLSHPYFWGSESSTDHDKSMPTLVWEFVYPSAPGGIDNALINPLGPGKPSLAGLGCS  413

Query  444   KLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFKR  265
             +L VCVAEKD+LR+  + Y +AVK+SGW+GEIE+ +V+GE+H F I++ G E +K   KR
Sbjct  414   RLLVCVAEKDQLRDFGVLYYDAVKESGWQGEIELFEVKGEDHAFHILDFGKENSKIMIKR  473

Query  264   IASFI  250
             +ASF+
Sbjct  474   LASFL  478


 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 37/53 (70%), Gaps = 1/53 (2%)
 Frame = -2

Query  513  GIDNPMIYPMAENAPSLAGLRCSKLHVCVAEKDELREI-SLRYVEAVKKSGWK  358
            GIDN MI P+    PSLAG  CSKL VCVAEKD LR I  + Y EA+K+ GW+
Sbjct  17   GIDNVMINPVGPGEPSLAGFGCSKLLVCVAEKDLLRIIRGIWYCEAIKERGWE  69



>ref|XP_006489347.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Citrus sinensis]
 gb|KDO74706.1| hypothetical protein CISIN_1g019090mg [Citrus sinensis]
Length=346

 Score =   348 bits (892),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 189/331 (57%), Positives = 234/331 (71%), Gaps = 27/331 (8%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDS--ATGVSSKDIT-VSPN----ISVRVYLPKLAS  997
             PL+RVYKDG VER+   PYVPPS  D+   TGVSSKDIT +S N    +S R+YLPKL  
Sbjct  16    PLVRVYKDGSVERLLGSPYVPPSSPDADPTTGVSSKDITSISQNPAISLSARLYLPKLTD  75

Query  996   ATQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYED  817
               QKLPI VY+HGGGFC++SAFS + H YLNILVS+A V+AVSVEYRLAPEHPLPA YED
Sbjct  76    HHQKLPIFVYFHGGGFCIESAFSFLNHRYLNILVSEARVLAVSVEYRLAPEHPLPAAYED  135

Query  816   CWEALQWVASHAS----NDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGN  649
             CW ALQWVASH +    ++      KE WL+NHGDFE++F+GGDSAGGNIVHN+A+RAG 
Sbjct  136   CWAALQWVASHRNKIDDHENYSSNNKEAWLLNHGDFERVFIGGDSAGGNIVHNIAMRAGE  195

Query  648   -EPLNQKS--------KLLGGILSFPYFWSSNEKGG-------EQSILQKVWDFVYPTAK  517
              +  N +S        K+LG  L  PYFW SN  G        E + L   W+FVYPTA 
Sbjct  196   GDHDNHESSLKESTGVKILGAFLGHPYFWGSNPIGSEPVGDNRENNFLHLSWEFVYPTAP  255

Query  516   GGIDNPMIYPMAENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvd  337
             GGIDNPM+ P+ E  P+LA L CS+L VCVAEKD+LR+  + Y  AVK+SG++GE E+ +
Sbjct  256   GGIDNPMVNPVGEGKPNLAKLGCSRLLVCVAEKDQLRDRGIWYFNAVKESGFQGEAELFE  315

Query  336   vegeEHCFPIMNPGTEKAKDTFKRIASFIQD  244
             V+GE+H F   NP TE AK  F+ ++SF+ +
Sbjct  316   VKGEDHAFHFFNPKTEIAKIMFQTLSSFLNN  346



>ref|XP_009364211.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Pyrus x bretschneideri]
Length=332

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 185/319 (58%), Positives = 235/319 (74%), Gaps = 18/319 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSP-EDSATGVSSKDITVS--PNISVRVYLPKL-ASATQ  988
             P IR YKDG VER+ + PYVPPSP ++  TGVSSKDIT+S  PNIS R+YLP L  + +Q
Sbjct  14    PFIRFYKDGSVERLLDSPYVPPSPNQNPETGVSSKDITISDNPNISARLYLPNLPQNQSQ  73

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLPILVY+HGGGFC++SAFS +   YLN LVS+A V+A+SV+YRLAPE+PLP  YEDCW+
Sbjct  74    KLPILVYFHGGGFCIESAFSFLDTRYLNSLVSEARVLAISVDYRLAPENPLPIAYEDCWD  133

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             AL+WVASH+SN+      KEPWLV +GDF+++++GGDSAGGNI HN+A++AG E L    
Sbjct  134   ALRWVASHSSNNDSGGD-KEPWLVRYGDFDRLYIGGDSAGGNIAHNMAMKAGVESLCGGV  192

Query  627   KLLGGILSFPYFWSSNEKGG-------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
             K+LG  LS PYFWSS   G        E+++   +WDFVYP+A GG+DNPM+ P  E  P
Sbjct  193   KILGAFLSHPYFWSSKPIGSEPKGEDFEKAVPYLIWDFVYPSAPGGVDNPMLNPAGEGKP  252

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIM-----  304
             SLAGL CS+L VCVA KD LR+  + Y + VK+SGWKGE+E+ +VEGE+HC+ I      
Sbjct  253   SLAGLACSRLLVCVAGKDALRDRGVWYYDLVKESGWKGEVELFEVEGEDHCYHIFCVSET  312

Query  303   -NPGTEKAKDTFKRIASFI  250
              N  TE  K  FKR+ASF+
Sbjct  313   ENTETENIKKMFKRLASFL  331



>gb|ABB89023.1| CXE carboxylesterase [Actinidia eriantha]
Length=332

 Score =   345 bits (886),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 174/312 (56%), Positives = 229/312 (73%), Gaps = 12/312 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLPI  976
             PL+R YKDG VER    PY+PPSP D ATGVSSKD+T+SP +S R+YLP  ASATQKLP+
Sbjct  15    PLLRHYKDGTVERFIASPYIPPSPLDPATGVSSKDVTISPLVSARLYLP--ASATQKLPV  72

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LVY+HGGGFC++SAFS   H Y+N L S++N +AVSVEYRLAPE+PLPA Y+D W ALQW
Sbjct  73    LVYFHGGGFCIESAFSLFNHRYVNALASESNAVAVSVEYRLAPENPLPAAYDDSWAALQW  132

Query  795   VASHASNDG--QQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             VA H+ + G   +   ++ WL  H DF+++F+GGDSAG NIVH++AIRAG+EPL    K+
Sbjct  133   VAYHSVDRGTDDKSQQRDSWLAEHADFDRLFIGGDSAGANIVHHLAIRAGSEPLPGDLKI  192

Query  621   LGGILSFPYFWSSNEKGG-------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             LG  L+ PYFW S+  G        E++++Q++W  VYP+A GGIDNP I P + +APS+
Sbjct  193   LGAFLAQPYFWGSDPVGSESPDLHTEENLIQRIWTCVYPSAPGGIDNPAINPFSPDAPSV  252

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWK-geievvdvegeEHCFPIMNPGTEK  286
             A L C++L VCV+ +DELRE  +RY+E VK+SGW+  +IE+ +VEGE H F     G+E 
Sbjct  253   AALGCARLLVCVSGEDELRERGIRYLEEVKRSGWRGEKIELFEVEGEGHAFHFFGFGSEN  312

Query  285   AKDTFKRIASFI  250
             AK    R+ASF+
Sbjct  313   AKRMITRLASFV  324



>ref|XP_011075707.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Sesamum indicum]
Length=318

 Score =   345 bits (884),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 225/310 (73%), Gaps = 12/310 (4%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLP  979
             SP I+VY     ER+   P+VPPSPED  TGV+SKD T++PN+S R+YLPKL++ TQKLP
Sbjct  14    SPFIKVY----TERLLGTPHVPPSPEDPTTGVASKDTTITPNVSARLYLPKLSNPTQKLP  69

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             ILVYYHGGGFCVDSAFS  YH Y+N+L S++  + VSVEYRLAPE+ LPA YED W+AL+
Sbjct  70    ILVYYHGGGFCVDSAFSCQYHRYMNLLSSKSGALVVSVEYRLAPEYLLPAAYEDSWDALK  129

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WV SH  +       K+ W+ NH DF ++F+GGDSAGGN+ HN+A+ AG+E L    K+L
Sbjct  130   WVCSHVLDHTHFE--KDQWITNHADFNRVFIGGDSAGGNVTHNIAMHAGSESLPGNVKIL  187

Query  618   GGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
             G +LS+P+FW SN  G       EQ I  ++  FVYP+A GGIDNP I P+A+ APSL+ 
Sbjct  188   GAVLSYPHFWGSNPIGDEPTEDMEQHIAYRLSLFVYPSAPGGIDNPSINPLADGAPSLSR  247

Query  456   LRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             L CSK+ V +AEKD+     L Y E VK SGWKG++EVV VEGE HCF I++P TEKAK+
Sbjct  248   LGCSKIIVKLAEKDDFTSRGLAYAEEVKSSGWKGDVEVVVVEGEGHCFHILDPETEKAKN  307

Query  276   TFKRIASFIQ  247
               KR+ASFI 
Sbjct  308   LIKRLASFIS  317



>gb|EYU23693.1| hypothetical protein MIMGU_mgv1a027087mg [Erythranthe guttata]
Length=324

 Score =   343 bits (879),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 220/310 (71%), Gaps = 7/310 (2%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLP  979
             SP+I+VY DG VER+ + P VPPSPED+ TGV SKD T+SP +S R++LPK    TQKLP
Sbjct  15    SPVIKVYTDGTVERLLHSPDVPPSPEDTTTGVYSKDATISPTVSARIHLPKPTHPTQKLP  74

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             +LVYYHGGGFC+ SAFS + H  + +L ++A  + +SVEYRL PEHPLPA YED W+AL+
Sbjct  75    VLVYYHGGGFCIGSAFSHLDHRLMTVLSAEAGALVISVEYRLTPEHPLPAAYEDSWDALK  134

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             W++SH S D Q    KE W+ NH DF +I +GGDSAGGNI HN+A+RAG+EPL    K+ 
Sbjct  135   WISSH-SVDTQTNSEKEKWISNHADFSRISIGGDSAGGNIAHNLALRAGSEPLPGNVKIA  193

Query  618   GGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
             G ILS PYFW SN  G E      QS+L ++W   YP+A GGIDNP+I P  + APSL+G
Sbjct  194   GAILSHPYFWGSNPIGNEPKEDIDQSLLYQLWLLAYPSAPGGIDNPLINPFCDGAPSLSG  253

Query  456   LRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             L CS+L VCV+E D L   +  Y E VK+SGW G +EVV++EGE HCF I     EKAK+
Sbjct  254   LGCSRLMVCVSEMDILTGRAKVYAEKVKESGWNGVVEVVEIEGEGHCFHIFGIENEKAKN  313

Query  276   TFKRIASFIQ  247
               KR A+FI 
Sbjct  314   LIKRWATFIS  323



>sp|Q5NUF4.1|HIDM_GLYEC RecName: Full=2-hydroxyisoflavanone dehydratase; AltName: Full=Carboxylesterase 
HIDM [Glycyrrhiza echinata]
 dbj|BAD80839.1| 2-Hydroxyisoflavanone dehydratase [Glycyrrhiza echinata]
Length=328

 Score =   342 bits (877),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 175/310 (56%), Positives = 224/310 (72%), Gaps = 9/310 (3%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKL  982
             PL+RVYKDG VER     +VPPSPED  TGVS+KDI +S  P IS RVYLPKL + T+KL
Sbjct  19    PLLRVYKDGTVERFLGSSFVPPSPEDPETGVSTKDIVISENPTISARVYLPKLNNTTEKL  78

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             PILVYYHGG FC++SAFS ++  YLNI+ S+ANV+ VS+EYRLAPEHPLPA YED W AL
Sbjct  79    PILVYYHGGAFCLESAFSFLHQRYLNIVASKANVLVVSIEYRLAPEHPLPAAYEDGWYAL  138

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WV SH++N+ +     +PWL+ HGDF + ++GGD++G NI HN A+R G E L    ++
Sbjct  139   KWVTSHSTNNNKPTN-ADPWLIKHGDFNRFYIGGDTSGANIAHNAALRVGAEALPGGLRI  197

Query  621   LGGILSFPYFWSSNE------KGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              G + +FP FW S        +G E+S   +VW+FVYP A GGIDNP+I P+A  AP+LA
Sbjct  198   AGVLSAFPLFWGSKPVLSEPVEGHEKSSPMQVWNFVYPDAPGGIDNPLINPLAPGAPNLA  257

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
              L C K+ V VA KD+LR+  + Y EAVK+SGWKG++E+   EGEEHCF I +P TE +K
Sbjct  258   TLGCPKMLVFVAGKDDLRDRGIWYYEAVKESGWKGDVELAQYEGEEHCFQIYHPETENSK  317

Query  279   DTFKRIASFI  250
             D   RIASF+
Sbjct  318   DLIGRIASFL  327



>ref|XP_006489341.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Citrus sinensis]
Length=349

 Score =   339 bits (870),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 183/335 (55%), Positives = 228/335 (68%), Gaps = 35/335 (10%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPE-DSATGVSSKDITVS--PNISVRVYLPKLASATQK  985
             PLIRVYKDG VER+ + PYVPP+ + D   GVSSKD+T+S  P IS R+YLPKLA   QK
Sbjct  15    PLIRVYKDGSVERMMDSPYVPPTLDPDPQFGVSSKDVTISQNPAISARLYLPKLAQPHQK  74

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVY+HG  FC +SAFS I H YLNILVSQ+ V+AVS+EYRLAPEH LPA YEDCW A
Sbjct  75    LPVLVYFHGSAFCFESAFSFIDHRYLNILVSQSQVLAVSIEYRLAPEHLLPAAYEDCWTA  134

Query  804   LQWVASHASND------------GQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAI  661
              QWVASH + +               +  KEPWL+NHGDFE++F+GGDSAGGNIVHN+A+
Sbjct  135   FQWVASHRNRNSINHHDHDHQNHSNVINNKEPWLLNHGDFERLFIGGDSAGGNIVHNIAM  194

Query  660   RAGNEPLNQKS--------KLLGGILSFPYFWSSNEKGGEQSILQK----------VWDF  535
             +AG +  +Q+S        ++LG  L  P+FW S   G E  +             +W+F
Sbjct  195   KAGED--DQESLLKEGTGVRILGAFLVHPFFWGSGPVGSESDVSDNYDHKKRLEYLIWEF  252

Query  534   VYPTAKGGIDNPMIYPMAENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKg  355
             VYPTA GGIDNPMI P+    PSLA L CS++ VCVA KD LR+  + YV AVK SG+ G
Sbjct  253   VYPTAPGGIDNPMINPVGSGKPSLAKLACSRMLVCVAGKDSLRDRGVLYVNAVKGSGFGG  312

Query  354   eievvdvegeEHCFPIMNPGTEKAKDTFKRIASFI  250
             E+E  +V+GE+H F I NP +E AK  F R+ASF+
Sbjct  313   EVEFFEVKGEDHVFHITNPDSENAKKMFNRLASFL  347



>ref|XP_010099277.1| putative carboxylesterase 2 [Morus notabilis]
 gb|EXC44833.1| putative carboxylesterase 2 [Morus notabilis]
Length=335

 Score =   338 bits (868),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 186/320 (58%), Positives = 222/320 (69%), Gaps = 17/320 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKL  982
             P +RVYKDG V+R+   P VP SP D  TGVSSKDI++S  P IS R++LP L    QKL
Sbjct  14    PFMRVYKDGSVDRLLESPLVPTSPGDPETGVSSKDISISLNPAISARLFLPPLNHNNQKL  73

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+LVY+HGGGFC +SAFSS +H +LN LVSQA V+AVSVEYRLAPE+PLP  YEDCW AL
Sbjct  74    PVLVYFHGGGFCFESAFSSDHHRFLNSLVSQAKVLAVSVEYRLAPEYPLPVAYEDCWYAL  133

Query  801   QWVASHASNDGQQVP-----LKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLN  637
             QWVASH SN   +        KE WL NHGDFEK+F+GGDSAG NIVHN+A+R   E LN
Sbjct  134   QWVASHNSNHDDRDDHDQDITKETWLTNHGDFEKVFLGGDSAGANIVHNMAMRFSKEDLN  193

Query  636   QKSK-LLGGILSFPYFWSSNEKGGE---------QSILQKVWDFVYPTAKGGIDNPMIYP  487
              + K + G  L+ PYFW S    G          +SI + VWDFVYP A GG+DNPMI P
Sbjct  194   NRIKSISGAFLTHPYFWGSEPLVGSSEPCAEELAKSIPRLVWDFVYPCAPGGVDNPMINP  253

Query  486   MAENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPI  307
             +  +APSLAGL C +L V VAEKD LRE   RY EAV++ GWKGE+E+VDVEGE H F I
Sbjct  254   VGPDAPSLAGLGCERLLVSVAEKDVLRERGRRYCEAVRECGWKGEVELVDVEGENHAFQI  313

Query  306   MNPGTEKAKDTFKRIASFIQ  247
             +   +E AK    R+A F+ 
Sbjct  314   LFGESENAKRLITRLAEFLM  333



>ref|XP_002517206.1| catalytic, putative [Ricinus communis]
 gb|EEF45369.1| catalytic, putative [Ricinus communis]
Length=323

 Score =   337 bits (863),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 178/310 (57%), Positives = 220/310 (71%), Gaps = 10/310 (3%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKL  982
             P +RVYKDG VER+   P VP S ED  TGVSSKDIT+S  P IS R+YLPK     QKL
Sbjct  14    PFLRVYKDGSVERLIGSPIVPASIEDPETGVSSKDITISQDPPISARLYLPKFTEPNQKL  73

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
              +L Y HGGGFC++SAFS     Y+N LVS A V+A+SVEYRLAPEHPL   YEDCW AL
Sbjct  74    AVLFYCHGGGFCIESAFSLTETKYMNSLVSLAKVVAISVEYRLAPEHPLSVVYEDCWVAL  133

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             QWVA H+  D  ++  K+PW+ NHGDF ++F+GGDSAG NI HN+ ++ G+E L    KL
Sbjct  134   QWVAMHS--DKNELENKDPWIFNHGDFSRLFIGGDSAGANIAHNMVMKVGSEGLKSDIKL  191

Query  621   LGGILSFPYFWSSNEKGGEQSILQ------KVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
             LG  L+ PYFW S   G E +I +      +VW F+YP+A GGIDN MI P+A  APSLA
Sbjct  192   LGAYLTHPYFWGSKAVGSESTIEREQHLPYRVWSFLYPSAPGGIDNSMINPVAPGAPSLA  251

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
             GL  S+L + VAEKDELRE  + Y   VK+SGWKGEI++++VEGE+H F I+N  TEKAK
Sbjct  252   GLGGSRLLISVAEKDELRERGILYYNVVKESGWKGEIQLIEVEGEDHAFHILNFETEKAK  311

Query  279   DTFKRIASFI  250
             +  KR+ASF+
Sbjct  312   NLIKRLASFL  321



>gb|KDO74721.1| hypothetical protein CISIN_1g018914mg [Citrus sinensis]
Length=349

 Score =   337 bits (864),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 182/335 (54%), Positives = 227/335 (68%), Gaps = 35/335 (10%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPE-DSATGVSSKDITVS--PNISVRVYLPKLASATQK  985
             PLIRVYKDG VER+ + PYVPP+ + D   GVSSKD+T+S  P IS R+YLPKLA   QK
Sbjct  15    PLIRVYKDGSVERMMDSPYVPPTLDPDPQFGVSSKDVTISQNPAISARLYLPKLAQPHQK  74

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             L +LVY+HG  FC +SAFS I H YLNILVSQ+ V+AVS+EYRLAPEH LPA YEDCW A
Sbjct  75    LTVLVYFHGSAFCFESAFSFIDHRYLNILVSQSQVLAVSIEYRLAPEHLLPAAYEDCWTA  134

Query  804   LQWVASHASND------------GQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAI  661
              QWVASH + +               +  KEPWL+NHGDFE++F+GGDSAGGNIVHN+A+
Sbjct  135   FQWVASHRNRNSINHHDHDHQNHSNVINNKEPWLLNHGDFERLFIGGDSAGGNIVHNIAM  194

Query  660   RAGNEPLNQKS--------KLLGGILSFPYFWSSNEKGGEQSILQK----------VWDF  535
             +AG +  +Q+S        ++LG  L  P+FW S   G E  +             +W+F
Sbjct  195   KAGED--DQESLLKEGTGVRILGAFLVHPFFWGSGPVGSESDVSDNYDHKKRLEYLIWEF  252

Query  534   VYPTAKGGIDNPMIYPMAENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKg  355
             VYPTA GGIDNPMI P+    PSLA L CS++ VCVA KD LR+  + YV AVK SG+ G
Sbjct  253   VYPTAPGGIDNPMINPVGSGKPSLAKLACSRMLVCVAGKDSLRDRGVLYVNAVKGSGFGG  312

Query  354   eievvdvegeEHCFPIMNPGTEKAKDTFKRIASFI  250
             E+E  +V+GE+H F I NP +E AK  F R+ASF+
Sbjct  313   EVEFFEVKGEDHVFHITNPDSENAKKMFNRLASFL  347



>gb|KDP40144.1| hypothetical protein JCGZ_02142 [Jatropha curcas]
Length=320

 Score =   334 bits (857),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 181/314 (58%), Positives = 222/314 (71%), Gaps = 19/314 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSP-EDSATGVSSKDITVS--PNISVRVYLPKLASA--T  991
             P +RV+KDG VER+   P VPPSP +D  T VSSKDI++S  P IS R+YLPKL+ +   
Sbjct  14    PFLRVFKDGSVERLMGAPIVPPSPDQDPETEVSSKDISISQHPPISARLYLPKLSQSDDQ  73

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
             +KLPILVY+HGG FC++SAFS     Y+N LVS A VIA+SVEYRLAPEHPLP  YEDCW
Sbjct  74    KKLPILVYFHGGAFCIESAFSLTETKYMNNLVSLAKVIAISVEYRLAPEHPLPTAYEDCW  133

Query  810   EALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
              ALQWV SH +        KEPW+ NHGDF++ F+GGDSAG NI HN+A+R G E LN  
Sbjct  134   FALQWVTSHDN--------KEPWISNHGDFDRFFIGGDSAGANIAHNMAMRIGTEGLNNN  185

Query  630   SKLLGGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
              KLLG  L+ PYFW S   G       EQ +  +VW F+Y +A GGIDNPM+ P+ E  P
Sbjct  186   IKLLGTYLTHPYFWGSKPVGSEPVVDREQLVPYRVWSFLYESAAGGIDNPMMNPVVEGGP  245

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
             SLA L  S+L V VAEKDELRE  + Y   +K+SGWKGE+E ++VEGE+H F I+N  TE
Sbjct  246   SLAKLGGSRLLVSVAEKDELRERGVLYYNLMKESGWKGEVEFIEVEGEDHAFHILNFETE  305

Query  288   KAKDTFKRIASFIQ  247
             KAK+  KR+ASF+Q
Sbjct  306   KAKNLIKRLASFLQ  319



>ref|XP_007222670.1| hypothetical protein PRUPE_ppa008575mg [Prunus persica]
 gb|EMJ23869.1| hypothetical protein PRUPE_ppa008575mg [Prunus persica]
Length=326

 Score =   334 bits (856),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 183/316 (58%), Positives = 232/316 (73%), Gaps = 18/316 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKL-ASATQK  985
             P IR+Y+DG+VER+   P+VPPS +D  TGVSSKDIT+S  P+IS R+YLP L  + TQK
Sbjct  14    PFIRIYQDGKVERLIESPHVPPSDQDPETGVSSKDITISHNPSISARLYLPNLPQNQTQK  73

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LPILVY+HGG FC++SAFS   H +LN LVS+A V AVSVEYRLAPE+PLP  YED W A
Sbjct  74    LPILVYFHGGAFCIESAFSLHAHCFLNRLVSEAQVAAVSVEYRLAPENPLPLAYEDSWAA  133

Query  804   LQWVASHASN---DGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             LQWVASH++N   DG+    K+PWL   GDF+++++GGDSAGGNI HN+A++AG E L  
Sbjct  134   LQWVASHSNNQELDGK----KDPWLAKFGDFDRLYIGGDSAGGNIAHNLAMKAGLERLCG  189

Query  633   KSKLLGGILSFPYFWSS----NEKGG---EQSILQKVWDFVYPTAKGGIDNPMIYPMAEN  475
               K+LG  LS PYFW S    +E  G   E+++  K WD VYP+A GGIDNPM+ P  E 
Sbjct  190   GVKVLGAFLSHPYFWGSKPIRSEPKGEDFEKTLEYKAWDVVYPSAPGGIDNPMVNPAGEG  249

Query  474   APSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPG  295
             APSLAGL CSKL +CVA KD+LR+  + Y + V++SGWKGE+E+ +VEGEEHCF + +  
Sbjct  250   APSLAGLGCSKLLMCVAGKDQLRDRGVWYCDLVRESGWKGEVELFEVEGEEHCFHLGSET  309

Query  294   -TEKAKDTFKRIASFI  250
              TE  K   KR+ASF+
Sbjct  310   ETENVKKLLKRLASFL  325



>ref|XP_008222955.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Prunus mume]
Length=326

 Score =   333 bits (855),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 181/316 (57%), Positives = 232/316 (73%), Gaps = 18/316 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKL-ASATQK  985
             P IR+Y+DG+VER+   P+VPPS +D  TGVSSKDIT+S  P+IS R+YLP L  + TQK
Sbjct  14    PFIRIYQDGKVERLIESPHVPPSNQDPETGVSSKDITISHNPSISARLYLPNLPQNQTQK  73

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LPILVY+HGG FC++SAFS   H +LN LVS+A V AVSVEYRLAPE+PLP  YED W A
Sbjct  74    LPILVYFHGGAFCIESAFSLHAHCFLNRLVSEAQVAAVSVEYRLAPENPLPLAYEDSWAA  133

Query  804   LQWVASHASN---DGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             LQWVASH++N   DG+    K+PWL   GDF+++++GGDSAGGNI HN+A++AG E L  
Sbjct  134   LQWVASHSNNQELDGK----KDPWLAKFGDFDRLYIGGDSAGGNIAHNLAMKAGLESLCG  189

Query  633   KSKLLGGILSFPYFWSS----NEKGG---EQSILQKVWDFVYPTAKGGIDNPMIYPMAEN  475
               ++LG  LS PYFW S    +E  G   E+++  K WD VYP+A GGIDNPM+ P  E 
Sbjct  190   GVRVLGAFLSHPYFWGSKPIRSEPKGEDFEKTLEYKAWDVVYPSAPGGIDNPMVNPAGEG  249

Query  474   APSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPG  295
             APSLAGL CSKL +CVA KD+LR+  + Y + V++SGWKGE+E+ +VE EEHCF +++  
Sbjct  250   APSLAGLGCSKLLMCVAGKDQLRDRGVWYCDLVRESGWKGEVELFEVEEEEHCFHLVSET  309

Query  294   -TEKAKDTFKRIASFI  250
              TE  K   KR+ASF+
Sbjct  310   ETENVKKLLKRLASFL  325



>gb|AFK39504.1| unknown [Medicago truncatula]
Length=323

 Score =   332 bits (850),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 176/312 (56%), Positives = 223/312 (71%), Gaps = 13/312 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             PL+RVYKDG VER      VPP P D  TGVSSKDIT S N  IS R++LPKL + TQKL
Sbjct  14    PLLRVYKDGTVERFLGSKIVPPIPLDPETGVSSKDITFSQNPLISARIHLPKLTNQTQKL  73

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             PILVYYHGG FC++SAFS ++  YLNI+ SQANV+ VSVEYRLAPEHPLPA Y+D W +L
Sbjct  74    PILVYYHGGAFCLESAFSFLHQRYLNIIASQANVLVVSVEYRLAPEHPLPAAYDDGWFSL  133

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGN--EPLNQKS  628
             +W+ SH+ N+       EPWL+ +GDF++ ++GGD++G NI HN  +R GN  E L    
Sbjct  134   KWITSHSINNINNA---EPWLIKYGDFDRFYIGGDTSGANIAHNALLRVGNGVETLPDDV  190

Query  627   KLLGGILSFPYFWSSNE------KGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             K+ G +L+FP FWSS        +G EQS   KVW+FVYP A GGIDNP+I P+A +APS
Sbjct  191   KIRGALLAFPLFWSSKPVLSESVEGHEQSSPMKVWNFVYPDAPGGIDNPLINPLAIDAPS  250

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L  + C K+ + VA  D+LR+  + Y +AVKKSGWKG++E+V VEGEEHCF I +P T+ 
Sbjct  251   LDIIGCPKILIFVAGNDDLRDRGIWYYDAVKKSGWKGDVELVHVEGEEHCFQIYHPETQS  310

Query  285   AKDTFKRIASFI  250
             + D  KRIASF+
Sbjct  311   SIDMVKRIASFL  322



>gb|AES62697.2| 2-hydroxyisoflavanone dehydratase [Medicago truncatula]
Length=323

 Score =   330 bits (847),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 176/312 (56%), Positives = 223/312 (71%), Gaps = 13/312 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             PL+RVYKDG VER      VPP P D  TGVSSKDIT S N  IS R++LPKL + TQKL
Sbjct  14    PLLRVYKDGTVERFLGSKIVPPIPLDPETGVSSKDITFSQNPLISARIHLPKLTNQTQKL  73

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             PILVYYHGG FC++SAFS ++  YLNI+ SQANV+ VSVEYRLAPEHPLPA Y+D W +L
Sbjct  74    PILVYYHGGAFCLESAFSFLHQRYLNIIASQANVLVVSVEYRLAPEHPLPAAYDDGWFSL  133

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGN--EPLNQKS  628
             +W+ SH+ N+       EPWL+ +GDF++ ++GGD++G NI HN  +R GN  E L    
Sbjct  134   KWITSHSINNINNA---EPWLIKYGDFDRFYIGGDTSGANIAHNALLRVGNGVETLPGDV  190

Query  627   KLLGGILSFPYFWSSNE------KGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             K+ G +L+FP FWSS        +G EQS   KVW+FVYP A GGIDNP+I P+A +APS
Sbjct  191   KIRGALLAFPLFWSSKPVLSESVEGHEQSSPMKVWNFVYPDAPGGIDNPLINPLAIDAPS  250

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L  + C K+ + VA  D+LR+  + Y +AVKKSGWKG++E+V VEGEEHCF I +P T+ 
Sbjct  251   LDIIGCPKILIFVAGNDDLRDRGIWYYDAVKKSGWKGDVELVHVEGEEHCFQIYHPETQS  310

Query  285   AKDTFKRIASFI  250
             + D  KRIASF+
Sbjct  311   SIDMVKRIASFL  322



>ref|XP_002277866.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Vitis vinifera]
Length=322

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/313 (52%), Positives = 217/313 (69%), Gaps = 16/313 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             P +RVYKDG ++R+ + P VPPS +D  TGVSSKDI +SP+  +S R+YLPKL +  QKL
Sbjct  14    PFLRVYKDGSIDRLVDPPSVPPSLDDPDTGVSSKDIIISPDTGVSARIYLPKLTNTHQKL  73

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             PILVY+HGGGFCV SAFS+  H Y+N L SQA ++A+S+EYRLAP HPLP  YEDCW AL
Sbjct  74    PILVYFHGGGFCVGSAFSAADHRYINTLSSQATLLAISIEYRLAPTHPLPTAYEDCWAAL  133

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             QWV+SH++         EPWL  HG+F++IF+GGDSAGGNI HN  +RAG E L    ++
Sbjct  134   QWVSSHSTGG------DEPWLTQHGNFDRIFIGGDSAGGNIAHNTVMRAGTESLPNGVRI  187

Query  621   LGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAEN--APS  466
             LG  LS PYFW S   G E      Q +  ++W FV P+++ GID+  + P +     PS
Sbjct  188   LGAFLSQPYFWGSQPIGSESVEDHHQKVSYRIWKFVCPSSEAGIDDSRVNPCSRTPGCPS  247

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L+ L C +L VCVA KDELR+  +RY EAV++SGW+GE+E+ + + E H F I NP +E 
Sbjct  248   LSKLGCRRLLVCVAGKDELRDRDVRYYEAVRESGWEGEVELYEEKEEGHVFHIFNPESEN  307

Query  285   AKDTFKRIASFIQ  247
             AK+   R+ +F+Q
Sbjct  308   AKNMVSRLVAFLQ  320



>ref|XP_007143222.1| hypothetical protein PHAVU_007G054300g [Phaseolus vulgaris]
 gb|ESW15216.1| hypothetical protein PHAVU_007G054300g [Phaseolus vulgaris]
Length=329

 Score =   330 bits (846),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 175/315 (56%), Positives = 221/315 (70%), Gaps = 16/315 (5%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASAT-----  991
             IRV+ DG VER    P+VPPS  D  TGVSSKDI +S  P++S R+YLPKL         
Sbjct  17    IRVFSDGTVERPRESPFVPPSINDPLTGVSSKDIVISQTPSVSARIYLPKLIPTNDQDHP  76

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
             Q  PILVY+HGGGF  +SAFS +YH Y N  VSQ NVI VSVEYR APEHPLPA Y DCW
Sbjct  77    QNFPILVYFHGGGFFFESAFSQLYHRYFNTFVSQTNVIVVSVEYRRAPEHPLPACYHDCW  136

Query  810   EALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
             +AL+WVASH++ +      ++PWL++HG+ +++F+GGDSAGGNIVHNVA+RAG EPL   
Sbjct  137   DALKWVASHSTQNNATN--EDPWLISHGNLQRVFIGGDSAGGNIVHNVAMRAGTEPLPCD  194

Query  630   SKLLGGILSFPYFWSSNE------KGG-EQSILQKVWDFVYPTAKGGIDNPMIYPMAENA  472
              K++G I S PYF SSN       KGG EQS+   VW FVYP+A GGIDNPM+ P+A  A
Sbjct  195   VKIVGAIFSHPYFCSSNPIGSEVVKGGHEQSLAYLVWGFVYPSAPGGIDNPMVNPLAPAA  254

Query  471   PSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
             PSL GL CSK+ VCVA  D+LR+  + Y E V+KSGW GE+E+ + +GE+H + I +P +
Sbjct  255   PSLDGLGCSKILVCVASDDKLRDRGVWYCEGVRKSGWHGELELFEEKGEDHVYHIFHPES  314

Query  291   EKAKDTFKRIASFIQ  247
             E A    +R+  F+Q
Sbjct  315   ENAMKLTQRLRLFLQ  329



>ref|XP_010666246.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Beta vulgaris 
subsp. vulgaris]
Length=308

 Score =   328 bits (840),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 172/307 (56%), Positives = 215/307 (70%), Gaps = 19/307 (6%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKLP  979
              IRVYKDG VER+   P VPP+ ED  TGVSSKD+ +S   N+S R+YLPKL   T+KLP
Sbjct  15    FIRVYKDGSVERLFGSPQVPPTLEDPQTGVSSKDVNISIDTNLSARLYLPKLI--TKKLP  72

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
              LVY+HGGGFCV+SAFS  +  Y+NIL SQA V+ VSVEYRLAPEHPLP  YEDCW AL 
Sbjct  73    TLVYFHGGGFCVESAFSFPHQRYMNILASQAGVLIVSVEYRLAPEHPLPTAYEDCWTALN  132

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WVAS          L +PWL +HGD E +F+GGDS+G NI HN+A+RAG + L     +L
Sbjct  133   WVAS----------LSDPWLASHGDLEALFIGGDSSGANIAHNLAMRAGTQNLENGVNIL  182

Query  618   GGILSFPYFWSSNEKGGEQSILQ---KVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRC  448
             G  +S  +F   +E G   + +Q   +VW+FVYP A GG D+PMI PM   APSLAGL C
Sbjct  183   GAFISSSHFL--DEPGASATGIQMGYRVWNFVYPDAPGGPDSPMINPMCAQAPSLAGLGC  240

Query  447   SKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFK  268
             S+L V VAEK++ R   +RY EAVK SG++G++E+ + +GE HCF I NP TE AK  F+
Sbjct  241   SRLLVLVAEKEDHRNTQVRYYEAVKNSGFQGKVELFETKGEGHCFHIFNPDTENAKLMFQ  300

Query  267   RIASFIQ  247
             R+ASF+Q
Sbjct  301   RLASFLQ  307



>ref|XP_009338446.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Pyrus x bretschneideri]
Length=339

 Score =   328 bits (842),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 181/326 (56%), Positives = 228/326 (70%), Gaps = 25/326 (8%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPY---VPPSPE-DSATGVSSKDITVS--PNISVRVYLPKL-AS  997
             P IR+++DG VERI  +PY   VPPSP+ D+ TGV SKDIT+S  P I  R++LP L  +
Sbjct  14    PFIRIFEDGTVERI-PFPYSSYVPPSPDRDAETGVYSKDITISDNPKILARLFLPNLPQN  72

Query  996   ATQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYED  817
              TQKL ILVY+HGG FC+ S FS ++  YLN LVS+A V+AVSVEYRLAPE+PLP  YED
Sbjct  73    QTQKLSILVYFHGGAFCMASTFSFLHQRYLNRLVSEAKVLAVSVEYRLAPENPLPIAYED  132

Query  816   CWEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLN  637
             CW ALQWVASH++N G     KE  L+N+GDF+++++GGDSAGGNI HN+ ++AG E L 
Sbjct  133   CWAALQWVASHSTNKGSSDGNKETCLLNYGDFDRVYIGGDSAGGNIAHNLVMKAGVEGLC  192

Query  636   QKSKLLGGILSFPYFWSSNEKGG-------EQSILQKVWDFVYPTAKGGIDNPMIYPMAE  478
                K+LG  LS PYFW S   G        E+++   VWDFVYP+A GGIDNPM+ P  E
Sbjct  193   GGVKILGAFLSCPYFWGSKPIGSEPKGENFEKTLHYLVWDFVYPSAPGGIDNPMVNPAGE  252

Query  477   NAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPI---  307
              APSL GL CSKL VCVA KDELR+  ++Y + VK+SGWKGE+E+ +VEGE+HCF +   
Sbjct  253   GAPSLTGLGCSKLLVCVAGKDELRDRGVQYYDLVKESGWKGELELFEVEGEDHCFHVSLG  312

Query  306   -------MNPGTEKAKDTFKRIASFI  250
                        TE  K  FKR+ASF+
Sbjct  313   IEAKTDQTETTTENVKKMFKRLASFL  338



>ref|XP_004511347.1| PREDICTED: probable carboxylesterase 2-like [Cicer arietinum]
Length=331

 Score =   328 bits (840),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 167/313 (53%), Positives = 220/313 (70%), Gaps = 12/313 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS---PNISVRVYLP-KLASATQ  988
             PLIRVYKDG VER+   P VPPS +D  T VSSKDI +S   P++S R++LP       +
Sbjct  19    PLIRVYKDGSVERLIESPIVPPSLQDPQTNVSSKDIIISNNNPSLSARIFLPYSHKHNNK  78

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLPI +Y+HGG FCV+SAFSS+YH+YLNILVS++N+IAVSV+YRL P HPLPA YED W 
Sbjct  79    KLPIFLYFHGGAFCVESAFSSLYHNYLNILVSESNIIAVSVDYRLLPHHPLPAAYEDGWI  138

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             +LQW+ASH SN+      KE WL+++GDF K+++GGD+ G N+ HN+A+RAG E L    
Sbjct  139   SLQWLASHTSNEINNNN-KEQWLLDYGDFNKVYIGGDTNGANLAHNIAMRAGTETLPNNL  197

Query  627   KLLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
             K+ G +L  P+FW S   G E         +  KVW+FVYP AKGGIDN M+ P A++AP
Sbjct  198   KIFGVLLCSPFFWGSKSIGLEALEDNERHGLAIKVWNFVYPNAKGGIDNHMVNPCADDAP  257

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
             +LA L CSK+ V V +KDE R+  L Y ++V+KSGW+G++E+ +   EEH F I N  T 
Sbjct  258   NLATLGCSKMLVTVTDKDEFRDRDLLYYDSVRKSGWQGQLELFEAGDEEHGFQIFNHQTH  317

Query  288   KAKDTFKRIASFI  250
              AK+  KR+ASF+
Sbjct  318   TAKNFIKRLASFL  330



>ref|XP_003610679.1| Gibberellin receptor GID1 [Medicago truncatula]
 gb|AES93637.1| 2-hydroxyisoflavanone dehydratase [Medicago truncatula]
Length=329

 Score =   327 bits (838),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/311 (53%), Positives = 216/311 (69%), Gaps = 10/311 (3%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS---PNISVRVYLPKLASATQK  985
             PLIRVYKDG +ER+ +   VPPS +D  TGVSSKDI +S   P++S R++LPK +    K
Sbjct  19    PLIRVYKDGTIERLMSSSIVPPSLQDPQTGVSSKDIVISNNNPSLSARIFLPK-SHHNHK  77

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
              PIL+Y+H G FCV+S FS   H YLN+LVS++N+IAVS++YRL P+HPLPA YED W +
Sbjct  78    FPILLYFHAGAFCVESPFSFFCHRYLNLLVSESNIIAVSIDYRLLPQHPLPAAYEDGWTS  137

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             LQWVASH SND      KE WL ++GDF K+++GGD  G N+ HN+A+RAG E L    K
Sbjct  138   LQWVASHTSNDPNSSIEKEQWLQDYGDFNKVYIGGDVNGANLAHNLAMRAGTETLPNNLK  197

Query  624   LLGGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             +LG +L  P+FW S   G       E S+  KVW+FVYP AKGGIDNPM+ P A  APSL
Sbjct  198   ILGALLCCPFFWGSKPIGSEPVEEHENSLAIKVWNFVYPNAKGGIDNPMVNPCAIGAPSL  257

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             A L CSK+ + + +KDE R+  + Y E+VK+SGW+G++E+ +   EEH F I  P T+ A
Sbjct  258   ATLGCSKILLTITDKDEFRDRDVLYYESVKESGWQGQLELFEAGDEEHGFQIFKPETDGA  317

Query  282   KDTFKRIASFI  250
             K   KR+ASF+
Sbjct  318   KQFIKRLASFL  328



>gb|ACJ84311.1| unknown [Medicago truncatula]
Length=329

 Score =   325 bits (833),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 164/311 (53%), Positives = 216/311 (69%), Gaps = 10/311 (3%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS---PNISVRVYLPKLASATQK  985
             PLIRVYKDG +ER+ +   VPPS +D  TGVSSKDI +S   P++S R++LPK +    K
Sbjct  19    PLIRVYKDGTIERLMSSSIVPPSLQDPQTGVSSKDIVISNNNPSLSARIFLPK-SHHNHK  77

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
              PIL+Y+H G FCV+S FS   H YLN+LVS++N+IAVS++YRL P+HPLPA YED W +
Sbjct  78    FPILLYFHAGAFCVESPFSFFCHRYLNLLVSESNIIAVSIDYRLLPQHPLPAAYEDGWTS  137

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             LQWVASH SND      KE WL ++GDF K+++GGD  G N+ HN+A+RAG E L    K
Sbjct  138   LQWVASHTSNDPNSSIEKEQWLQDYGDFNKVYIGGDVNGANLAHNLAMRAGTETLPNNLK  197

Query  624   LLGGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             +LG +L  P+FW S   G       E S+  KVW+FVYP AKGGIDNPM+ P A  APSL
Sbjct  198   ILGALLCCPFFWGSKPIGSEPVEEHENSLAIKVWNFVYPNAKGGIDNPMVNPCAIGAPSL  257

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             A L CSK+ + + +KDE R+  + Y E+VK+SGW+G++E+++   EEH F I  P T+  
Sbjct  258   ATLGCSKILLTITDKDEFRDRDVLYYESVKESGWQGQLELLEAGDEEHGFQIFKPETDGV  317

Query  282   KDTFKRIASFI  250
             K   KR+ASF+
Sbjct  318   KQFIKRLASFL  328



>ref|XP_008358548.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Malus domestica]
Length=321

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 179/309 (58%), Positives = 219/309 (71%), Gaps = 10/309 (3%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKL  982
             P  RVYKDG VER+    YVPP  +D  TGVSSKDIT+S  P I  RV+LPKL    QKL
Sbjct  14    PFXRVYKDGYVERLLGSQYVPPLLDDPETGVSSKDITISQDPLIKARVFLPKLDEPHQKL  73

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+LVYYHGGGFCV+SAFSS +H YL+ LVSQA V+AVSVEYR+APEH LPA YED W AL
Sbjct  74    PVLVYYHGGGFCVESAFSSDHHRYLDGLVSQAKVVAVSVEYRMAPEHYLPAAYEDGWAAL  133

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             QW+ASH +   + V   EPWL NHG+ E+ F+GGDSAG NI H +A++ G E L    K+
Sbjct  134   QWIASHFA---ENVIDDEPWLTNHGNSERFFLGGDSAGANIAHXIAMKVGKEGLPGGLKV  190

Query  621   LGGILSFPYFWSSNEKGGE-----QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
             LG  L+ PYF  S E G E     +     VW+FVYP+A GG+D PMI P+A +APSLAG
Sbjct  191   LGVSLTHPYFCGSKEIGSETCEDPEDFGCLVWNFVYPSAPGGVDCPMINPVAPDAPSLAG  250

Query  456   LRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             L CS+L V V+E DELR   + Y EAVK+SGW+GE E+V+VEGE+H F I+   T KAKD
Sbjct  251   LACSRLFVSVSENDELRHRGIAYYEAVKESGWEGEAELVEVEGEDHAFHILKFETPKAKD  310

Query  276   TFKRIASFI  250
               +++A F+
Sbjct  311   LTRKVADFL  319



>ref|XP_006355549.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum tuberosum]
Length=322

 Score =   324 bits (830),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 219/308 (71%), Gaps = 8/308 (3%)
 Frame = -2

Query  1155  PLIRVYKDGRVER---ICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQK  985
             P  R+YKDGRVER   +     VPPS ED ATGVSSKD+++S ++S R+YLPK  +  QK
Sbjct  16    PYYRLYKDGRVERFYELAGIHEVPPSLEDPATGVSSKDVSISAHVSARLYLPKNTAPNQK  75

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVYYHGGG  + SAF    H YLN LVS++N IA+SV YRLAPEH +P  Y+DCW+A
Sbjct  76    LPVLVYYHGGGLVLGSAFFKTEHCYLNYLVSESNCIAISVNYRLAPEHDIPTIYQDCWDA  135

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             LQWVASH+ +D      K+PW+ NHGDF ++FVGGDSAGGNIV+N+ +RAG E L    K
Sbjct  136   LQWVASHSVSDTIN---KDPWIENHGDFNRVFVGGDSAGGNIVYNMIMRAGREKLIGDVK  192

Query  624   LLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCS  445
             LLG IL+FPY    + +  ++ +  K+W+ + P ++ G D+PM+ P+++  PSL+ L CS
Sbjct  193   LLGAILAFPYLMIPSIENYDKGLSYKLWNTICPLSERGNDSPMVNPVSKKCPSLSTLGCS  252

Query  444   KLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTF  271
             +L VC  EKDEL   E++ ++ EAVKKSGWKGEIE +  EGE HCF   NP  EK+KD  
Sbjct  253   RLFVCTGEKDELVPGEVATKFAEAVKKSGWKGEIESILFEGEGHCFQCENPQAEKSKDLI  312

Query  270   KRIASFIQ  247
             KRI SFIQ
Sbjct  313   KRIVSFIQ  320



>gb|ACJ84653.1| unknown [Medicago truncatula]
 gb|AFK47942.1| unknown [Medicago truncatula]
Length=329

 Score =   323 bits (828),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 164/311 (53%), Positives = 215/311 (69%), Gaps = 10/311 (3%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS---PNISVRVYLPKLASATQK  985
             PLIRVYKDG +ER+ +   VPPS +D  TGVSSKDI +S   P++S R++LPK +    K
Sbjct  19    PLIRVYKDGTIERLMSSSIVPPSLQDPQTGVSSKDIVISNNNPSLSARIFLPK-SHHNHK  77

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
              PIL+Y+H G FCV+S FS   H YLN+LVS++N+IAVS++YRL P+HPLPA YED W +
Sbjct  78    FPILLYFHAGAFCVESPFSFFCHRYLNLLVSESNIIAVSIDYRLLPQHPLPAAYEDGWTS  137

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             LQWVASH SND      KE WL ++GDF K+++GGD  G N+ HN+A+RAG E L    K
Sbjct  138   LQWVASHTSNDPNSSIEKEQWLQDYGDFNKVYIGGDVNGANLAHNLAMRAGTETLPNNLK  197

Query  624   LLGGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             +LG +L  P+FW S   G       E S+  KVW+FVYP AKGGIDNPM+ P A  APSL
Sbjct  198   ILGALLCCPFFWGSKPIGSEPVEEHENSLAIKVWNFVYPNAKGGIDNPMVNPCAIGAPSL  257

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             A   CSK+ + + +KDE R+  + Y E+VK+SGW+G++E+ +   EEH F I  P T+ A
Sbjct  258   ATPGCSKILLTITDKDEFRDRDVLYYESVKESGWQGQLELFEAGDEEHGFQIFKPETDGA  317

Query  282   KDTFKRIASFI  250
             K   KR+ASF+
Sbjct  318   KQFIKRLASFL  328



>ref|XP_007034685.1| CXE carboxylesterase [Theobroma cacao]
 gb|EOY05611.1| CXE carboxylesterase [Theobroma cacao]
Length=324

 Score =   323 bits (827),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 168/312 (54%), Positives = 212/312 (68%), Gaps = 12/312 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             P IR+YK G VER+   P VPPS ED  TGVSSKDIT+S N  IS R+YLPK     QK+
Sbjct  14    PFIRIYKGGSVERLAGSPNVPPSTEDPETGVSSKDITISDNPPISARIYLPKQVEQHQKV  73

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+LVY+HGGGFC +SAFS +   Y+N L   A V+ +S+EYRLAPEHPLP  Y+DCW  L
Sbjct  74    PLLVYFHGGGFCFESAFSFVETKYMNSLAYYAKVVVISIEYRLAPEHPLPIAYDDCWAGL  133

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             QWV SH+ + G  V  KEPWL  + DF++++V GDSAG N+ HN+ +RAG+E LN   K+
Sbjct  134   QWVVSHSVDCG--VDNKEPWLSTYVDFDRVYVAGDSAGANLAHNILMRAGSEALNGGVKI  191

Query  621   LGGILSFPYFWSSNEKGGEQSILQK--------VWDFVYPTAKGGIDNPMIYPMAENAPS  466
              G  ++ PYFW S   G E   + K        +W  +YP A GGIDNPMI P++  APS
Sbjct  192   TGAFVTHPYFWGSKPVGSEPKSIDKREKCAMYTIWHLIYPEAPGGIDNPMINPVSPGAPS  251

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             LAGL CS+L V VAEKD LR+  + Y  AVK+SGWKGE+ +V VE E+H F I+N  +E 
Sbjct  252   LAGLGCSRLLVSVAEKDALRDRGIFYYNAVKESGWKGELVLVQVEREDHAFQILNYESEN  311

Query  285   AKDTFKRIASFI  250
             AK   KR+ASF+
Sbjct  312   AKKLIKRLASFL  323



>ref|XP_003592446.1| Hormone-sensitive lipase [Medicago truncatula]
Length=347

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 172/307 (56%), Positives = 218/307 (71%), Gaps = 13/307 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             PL+RVYKDG VER      VPP P D  TGVSSKDIT S N  IS R++LPKL + TQKL
Sbjct  14    PLLRVYKDGTVERFLGSKIVPPIPLDPETGVSSKDITFSQNPLISARIHLPKLTNQTQKL  73

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             PILVYYHGG FC++SAFS ++  YLNI+ SQANV+ VSVEYRLAPEHPLPA Y+D W +L
Sbjct  74    PILVYYHGGAFCLESAFSFLHQRYLNIIASQANVLVVSVEYRLAPEHPLPAAYDDGWFSL  133

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGN--EPLNQKS  628
             +W+ SH+ N+       EPWL+ +GDF++ ++GGD++G NI HN  +R GN  E L    
Sbjct  134   KWITSHSINNINNA---EPWLIKYGDFDRFYIGGDTSGANIAHNALLRVGNGVETLPGDV  190

Query  627   KLLGGILSFPYFWSSNE------KGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             K+ G +L+FP FWSS        +G EQS   KVW+FVYP A GGIDNP+I P+A +APS
Sbjct  191   KIRGALLAFPLFWSSKPVLSESVEGHEQSSPMKVWNFVYPDAPGGIDNPLINPLAIDAPS  250

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L  + C K+ + VA  D+LR+  + Y +AVKKSGWKG++E+V VEGEEHCF I +P T+ 
Sbjct  251   LDIIGCPKILIFVAGNDDLRDRGIWYYDAVKKSGWKGDVELVHVEGEEHCFQIYHPETQS  310

Query  285   AKDTFKR  265
             + D  KR
Sbjct  311   SIDMVKR  317



>ref|XP_004290227.1| PREDICTED: probable carboxylesterase 2-like [Fragaria vesca subsp. 
vesca]
Length=326

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 215/311 (69%), Gaps = 10/311 (3%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKLP  979
             LI+ YKDG VER+   P+VPPS  D  TGVSSKDIT+S  P +S R+YLP    + ++LP
Sbjct  15    LIKHYKDGTVERLIADPHVPPSLNDPQTGVSSKDITISHNPLVSARLYLPAQNQSQKQLP  74

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             I VY+H GGF   SAFS  +H YLN LVS+A VIAVSVEYRLAPE PLPA YED W +LQ
Sbjct  75    IFVYFHAGGFFCSSAFSFYHHRYLNRLVSEAQVIAVSVEYRLAPESPLPAAYEDSWLSLQ  134

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WVASH+ ++      KEPWL + GDF+++++GGDSAGGNI HN+AI+AG E LN   K+L
Sbjct  135   WVASHSLHEDDTCNNKEPWLADFGDFDRVYIGGDSAGGNISHNIAIKAGVESLNGGVKIL  194

Query  618   GGILSFPYFWSSNEKGG-------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
             G ILS   FW S   G        E+S+   V  F +P A GG+DNPMI PMA  APSLA
Sbjct  195   GAILSHSGFWGSTPIGSEPRGEDFEKSLSYLVLKFSFPCADGGLDNPMINPMAPGAPSLA  254

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIM-NPGTEKA  283
             GL CS+L VCVA KDELR+ +L Y  +VK+SGWKGE E+ +VE  EHCF I  +  TE  
Sbjct  255   GLECSRLLVCVAGKDELRDRNLWYYASVKESGWKGEAELFEVEEGEHCFHIASDEVTENV  314

Query  282   KDTFKRIASFI  250
             K   KR+A F+
Sbjct  315   KKMIKRMADFL  325



>ref|XP_010024368.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Eucalyptus 
grandis]
Length=326

 Score =   321 bits (823),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 173/313 (55%), Positives = 218/313 (70%), Gaps = 13/313 (4%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITV--SPNISVRVYLPKLASATQ---  988
              +RVYKDG VER+   PYVPP  ED  TGV+SKDIT+   P I  R++LPKL    +   
Sbjct  13    FLRVYKDGTVERLSGTPYVPPCLEDPKTGVASKDITIREDPLIRARLHLPKLEPVNEQPE  72

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLPILVYYHGGGFC++SAFS + H YL  LV++A ++AVSVEYRLAPE P+PA Y+DCWE
Sbjct  73    KLPILVYYHGGGFCIESAFSLVEHQYLTTLVAEAKILAVSVEYRLAPECPIPAIYDDCWE  132

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             ALQWVASH+ N G  V   EPWL +HGDF ++FVGGDSAG NI HNV +RAG   +    
Sbjct  133   ALQWVASHSVNCGAAV--NEPWLADHGDFHRVFVGGDSAGANIAHNVLMRAGRNTILGGI  190

Query  627   KLLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             K+ G  L+ P+FW S   G E      + +   +W F+YPTA  GID+PMI P A  APS
Sbjct  191   KISGAYLTHPFFWGSEPIGSESKTDRDKGLAHVMWTFLYPTADDGIDSPMINPFAAGAPS  250

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             LAGL C +L V VAEKD LR   L+Y +AVK+SG+KGE+E+V+VEGE+H F I+    + 
Sbjct  251   LAGLGCGRLLVSVAEKDRLRGRGLKYCKAVKESGFKGEVELVEVEGEDHAFHIVTHEKKS  310

Query  285   AKDTFKRIASFIQ  247
             A+   KR+A+F+ 
Sbjct  311   AQVLIKRLAAFLN  323



>ref|XP_009624702.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Nicotiana 
tomentosiformis]
Length=321

 Score =   321 bits (822),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 216/308 (70%), Gaps = 10/308 (3%)
 Frame = -2

Query  1155  PLIRVYKDGRVER---ICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQK  985
             P  R+YK+GRV R   +     VPPS ED  TGVSSKD+T+SP+IS R+YLPK   A QK
Sbjct  17    PYYRLYKNGRVHRFYELYGIVEVPPSLEDPDTGVSSKDVTISPHISARLYLPKNTIADQK  76

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVYYHGGG    SAF    H YLN LVS++  IA+SV YRLAPEH LP  Y+DCW+A
Sbjct  77    LPVLVYYHGGGLVAGSAFFQTEHRYLNHLVSESKCIAISVNYRLAPEHDLPTLYQDCWDA  136

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             LQWVASHA+         EPW+ NHGDF ++F+ GDSAGGNIV N+ +RAG E LN   K
Sbjct  137   LQWVASHAAGKD-----AEPWIANHGDFNRLFIAGDSAGGNIVFNMTMRAGRESLNGGVK  191

Query  624   LLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCS  445
             L+G I +FP+F   + +  E S++ K+W+ + P ++ GI++PM+ P++E  PSL+ L CS
Sbjct  192   LVGAIFAFPFFLIPSVENIEGSLIYKLWNTICPPSEQGINSPMVNPVSEICPSLSELGCS  251

Query  444   KLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTF  271
             +L VC  +KDEL   EI  R+ EAVK SGWKGE+E ++VEGE HCF   NP  EK+KD  
Sbjct  252   RLFVCAGKKDELVPSEIVSRFAEAVKNSGWKGELEFIEVEGEGHCFQAANPEAEKSKDLI  311

Query  270   KRIASFIQ  247
             KR+ASFIQ
Sbjct  312   KRMASFIQ  319



>ref|XP_007143221.1| hypothetical protein PHAVU_007G054200g [Phaseolus vulgaris]
 gb|ESW15215.1| hypothetical protein PHAVU_007G054200g [Phaseolus vulgaris]
Length=323

 Score =   321 bits (823),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 174/313 (56%), Positives = 223/313 (71%), Gaps = 16/313 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASAT-QK  985
             PLIRVY DG VER+   P VPPS +D  T VSSKDI +S  P+IS R+YLPKL S T +K
Sbjct  15    PLIRVYSDGTVERLLGSPQVPPSLQDPQTLVSSKDIVISENPSISARLYLPKLNSHTAEK  74

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             +PILVY+HGG FC++SAFS ++H Y+NI+ S+A V+ VSVEYRLAPE+PLPA YED WEA
Sbjct  75    IPILVYFHGGAFCLESAFSFLHHRYINIVASEAKVVVVSVEYRLAPENPLPAAYEDSWEA  134

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEP--LNQK  631
             L+WV SH++N        EPWL+NHGDF + ++GGD+AG NI HN A+R G E   L   
Sbjct  135   LKWVTSHSNNTN-----VEPWLINHGDFSRFYIGGDTAGANIAHNAALRVGIESGGLLGG  189

Query  630   SKLLGGILSFPYFWSSNE------KGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
              K+ G +L+FP FWSS        +G E+S   +VW FVYP A  GIDNP+I P+   AP
Sbjct  190   VKITGVVLAFPLFWSSEPVLSEPVEGFEESSAMQVWRFVYPDAPHGIDNPLINPLGGGAP  249

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
             SLA L CSK+ + VA KD+LRE  + Y +AV +SGW+G++E+V+VEGEEHCF I +P T 
Sbjct  250   SLASLGCSKMLIFVAGKDDLRERGVWYCDAVMESGWEGDVELVEVEGEEHCFQIYHPQTP  309

Query  288   KAKDTFKRIASFI  250
              +K    R+ASF+
Sbjct  310   NSKTFITRVASFL  322



>gb|AFK64684.1| 2-hydroxyisoflavanone dehydratase [Pueraria candollei var. mirifica]
Length=323

 Score =   321 bits (822),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 166/310 (54%), Positives = 209/310 (67%), Gaps = 11/310 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             PLIRVYKDG V+R+ + P V  SPED  TGVSSKDI ++ N  +S R++LPK  +   KL
Sbjct  16    PLIRVYKDGSVDRLLSSPNVAASPEDPETGVSSKDIVIAQNPYVSARIFLPKSHNNNNKL  75

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             PI VY+HGG FCV+SAFS   H YLNIL S+AN+IAVSV++RL P HPLPA YED W  L
Sbjct  76    PIFVYFHGGAFCVESAFSFFVHRYLNILASEANIIAVSVDFRLLPHHPLPAAYEDGWTTL  135

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             QW+ASHA+N        EPWL+NH DF K++VGG+++G N+ HN+ +RAGNE L    K+
Sbjct  136   QWIASHANNTATN---PEPWLLNHADFSKLYVGGETSGANLAHNLLLRAGNESLPGDLKI  192

Query  621   LGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
             LGG+L   +FW S   G E      QS+  KVW+   P A GGIDNP I P    APSLA
Sbjct  193   LGGLLCCSFFWGSKPIGSEPVDDHQQSLAMKVWNLACPDAPGGIDNPWINPCVAGAPSLA  252

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
              L CSKL V +  +DE R+  + Y + VKKSGW+GE+E+ D   EEH F + +P T  AK
Sbjct  253   TLGCSKLLVTITARDEFRDRDILYHDTVKKSGWQGELELFDAGDEEHAFQLYHPETHTAK  312

Query  279   DTFKRIASFI  250
                KR+ASF+
Sbjct  313   AMIKRLASFL  322



>ref|NP_001237228.1| 2-hydroxyisoflavanone dehydratase [Glycine max]
 sp|Q5NUF3.1|HIDH_SOYBN RecName: Full=2-hydroxyisoflavanone dehydratase; AltName: Full=Carboxylesterase 
HIDH [Glycine max]
 dbj|BAD80840.1| 2-hydroxyisoflavanone dehydratase [Glycine max]
 gb|ACU22699.1| unknown [Glycine max]
Length=319

 Score =   320 bits (821),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 164/310 (53%), Positives = 209/310 (67%), Gaps = 10/310 (3%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             PLIRVYKDG VER+ +   V  SPED  TGVSSKDI ++ N  +S R++LPK      KL
Sbjct  11    PLIRVYKDGSVERLLSSENVAASPEDPQTGVSSKDIVIADNPYVSARIFLPKSHHTNNKL  70

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             PI +Y+HGG FCV+SAFS   H YLNIL S+AN+IA+SV++RL P HP+PA YED W  L
Sbjct  71    PIFLYFHGGAFCVESAFSFFVHRYLNILASEANIIAISVDFRLLPHHPIPAAYEDGWTTL  130

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +W+ASHA+N     P  EPWL+NH DF K++VGG+++G NI HN+ +RAGNE L    K+
Sbjct  131   KWIASHANNTNTTNP--EPWLLNHADFTKVYVGGETSGANIAHNLLLRAGNESLPGDLKI  188

Query  621   LGGILSFPYFWSSNE------KGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
             LGG+L  P+FW S        +G EQS+  KVW+F  P A GGIDNP I P    APSLA
Sbjct  189   LGGLLCCPFFWGSKPIGSEAVEGHEQSLAMKVWNFACPDAPGGIDNPWINPCVPGAPSLA  248

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
              L CSKL V +  KDE R+  + Y   V++SGW+GE+++ D   EEH F +  P T  AK
Sbjct  249   TLACSKLLVTITGKDEFRDRDILYHHTVEQSGWQGELQLFDAGDEEHAFQLFKPETHLAK  308

Query  279   DTFKRIASFI  250
                KR+ASF+
Sbjct  309   AMIKRLASFL  318



>ref|XP_004296910.1| PREDICTED: uncharacterized protein LOC101305932 [Fragaria vesca 
subsp. vesca]
Length=650

 Score =   331 bits (848),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 182/313 (58%), Positives = 219/313 (70%), Gaps = 14/313 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASAT--Q  988
             P +RVYKDG VER+   PYVPP   D  +GVSSKDIT+S N  IS RV+LPKL +    Q
Sbjct  339   PFVRVYKDGSVERLMGTPYVPPMLNDPVSGVSSKDITISQNPLISARVFLPKLDADQPHQ  398

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLPILVY+HGG F ++SAFS  +H YL+ LVSQA V+AVSVEYR+APEHPLPAGYEDCW 
Sbjct  399   KLPILVYFHGGAFMIESAFSFDHHRYLDSLVSQAKVVAVSVEYRMAPEHPLPAGYEDCWA  458

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             ALQWVASH  ++G     +EPWL NHG+ ++ F+GGDSAG NI HNVA+R G E L    
Sbjct  459   ALQWVASHFVDNGIS---EEPWLTNHGNPDRFFLGGDSAGANIAHNVAMRVGKEGLPGGL  515

Query  627   KLLGGILSFPYFWSSNEKGG-------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
             K+ G  L+ PYFW S   G        E+ +   VW+F YP A GGIDNPM+ P    AP
Sbjct  516   KIRGTSLTHPYFWGSKPLGESDPCKEPEKDLGCNVWNFSYPNAPGGIDNPMMNPFGPEAP  575

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
             SLAGL CSKL V V+EKD LR   + Y EAVKKSGWKGE E+V+V GEEH F I+   T 
Sbjct  576   SLAGLGCSKLFVSVSEKDTLRYRGVHYYEAVKKSGWKGEAELVEVVGEEHAFHILKFETP  635

Query  288   KAKDTFKRIASFI  250
             KA+D  +++A F+
Sbjct  636   KAQDLTRKVAEFL  648


 Score =   322 bits (824),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 177/312 (57%), Positives = 217/312 (70%), Gaps = 13/312 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKL--ASATQ  988
             P +RVYKDG VER+   PY  P   D  +GVSSKD+T+S  P IS R++LPKL      Q
Sbjct  14    PFVRVYKDGSVERLLGTPYKAPLLNDPVSGVSSKDVTISKVPLISARIFLPKLDDEQPQQ  73

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLPILVY HGGGFC++SAFS  +H +L+ LVSQA V+AVSVEYR+APEHPLPAGYEDCW 
Sbjct  74    KLPILVYCHGGGFCIESAFSFDHHRFLDGLVSQARVVAVSVEYRMAPEHPLPAGYEDCWA  133

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             AL+WVASH   +G     +EPWL NHG+ E  F+GGDSAG NI HNVA+R G E L    
Sbjct  134   ALEWVASHFVENGIS---EEPWLTNHGNPEYFFLGGDSAGANIAHNVAMRVGKEGLPGGL  190

Query  627   KLLGGILSFPYFWSSNE------KGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             K+LG  L+ PYFW S        K  E+ +   +W+F YP+A GG+DNP I P+A  AP 
Sbjct  191   KILGLSLTHPYFWGSKPIAEDPCKEPEKDLAAMLWNFGYPSAPGGLDNPFINPLAPEAPC  250

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             LAGL CSKL V V+E D L+   +RY +AVKKSGWKGE E+VDVEGE H F I+   T+K
Sbjct  251   LAGLGCSKLFVSVSEHDGLKFRGIRYYDAVKKSGWKGEAELVDVEGEAHAFHILKFETQK  310

Query  285   AKDTFKRIASFI  250
             A+D  K++  F+
Sbjct  311   AQDLIKKLVDFL  322



>gb|ADV71376.1| 2-hydroxyisoflavanone dehydratase [Pueraria montana var. lobata]
Length=325

 Score =   320 bits (820),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/312 (53%), Positives = 210/312 (67%), Gaps = 13/312 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKL  982
             PLIRVYKDG VER+ + P V  SPED  TGVSSKDI ++  P +S R++LP +  +  KL
Sbjct  16    PLIRVYKDGTVERLLSSPNVAASPEDPETGVSSKDIVIAHNPYVSARIFLPNINKSHNKL  75

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             PI VY+HGG FCV+SAFS   H YLNIL SQAN+IAVSV++RL P HPLPA YED W  L
Sbjct  76    PIFVYFHGGAFCVESAFSFFVHRYLNILASQANIIAVSVDFRLLPHHPLPAAYEDGWTTL  135

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRA--GNEPLNQKS  628
             QW+ASHA+N        EPWL+NH DF K++VGG+++G N+ HN+ +RA  GN+ L    
Sbjct  136   QWIASHANNTATN---PEPWLLNHADFNKLYVGGETSGANLAHNLLLRAGNGNQSLPGDL  192

Query  627   KLLGGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             K+LGG+L  P+FW S   G       EQS+  KVW+   P A GGIDNP I P    APS
Sbjct  193   KILGGLLCCPFFWGSKPIGSEPVDEHEQSLAMKVWNLACPDAPGGIDNPWINPCVAGAPS  252

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             LA L CSKL V +  +DE R+  + Y + VKKSGW+G++E+ D   EEH F +  P T+ 
Sbjct  253   LATLGCSKLLVTITGRDEFRDRDILYHDTVKKSGWEGQLELFDAGDEEHAFQLFKPETDT  312

Query  285   AKDTFKRIASFI  250
             AK   KR+ASF+
Sbjct  313   AKAMIKRLASFL  324



>gb|KCW60819.1| hypothetical protein EUGRSUZ_H03555 [Eucalyptus grandis]
Length=379

 Score =   322 bits (825),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 173/313 (55%), Positives = 218/313 (70%), Gaps = 13/313 (4%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITV--SPNISVRVYLPKLASATQ---  988
              +RVYKDG VER+   PYVPP  ED  TGV+SKDIT+   P I  R++LPKL    +   
Sbjct  66    FLRVYKDGTVERLSGTPYVPPCLEDPKTGVASKDITIREDPLIRARLHLPKLEPVNEQPE  125

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLPILVYYHGGGFC++SAFS + H YL  LV++A ++AVSVEYRLAPE P+PA Y+DCWE
Sbjct  126   KLPILVYYHGGGFCIESAFSLVEHQYLTTLVAEAKILAVSVEYRLAPECPIPAIYDDCWE  185

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             ALQWVASH+ N G  V   EPWL +HGDF ++FVGGDSAG NI HNV +RAG   +    
Sbjct  186   ALQWVASHSVNCGAAV--NEPWLADHGDFHRVFVGGDSAGANIAHNVLMRAGRNTILGGI  243

Query  627   KLLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             K+ G  L+ P+FW S   G E      + +   +W F+YPTA  GID+PMI P A  APS
Sbjct  244   KISGAYLTHPFFWGSEPIGSESKTDRDKGLAHVMWTFLYPTADDGIDSPMINPFAAGAPS  303

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             LAGL C +L V VAEKD LR   L+Y +AVK+SG+KGE+E+V+VEGE+H F I+    + 
Sbjct  304   LAGLGCGRLLVSVAEKDRLRGRGLKYCKAVKESGFKGEVELVEVEGEDHAFHIVTHEKKS  363

Query  285   AKDTFKRIASFIQ  247
             A+   KR+A+F+ 
Sbjct  364   AQVLIKRLAAFLN  376



>gb|AHZ08760.1| 2-hydroxyisoflavanone dehydratase [Nicotiana tabacum]
Length=321

 Score =   319 bits (818),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 169/308 (55%), Positives = 215/308 (70%), Gaps = 10/308 (3%)
 Frame = -2

Query  1155  PLIRVYKDGRVER---ICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQK  985
             P  R+YK+GRV R   +     VPPS ED  TGVSSKD+T+SP+IS R+YLPK     QK
Sbjct  17    PYYRLYKNGRVHRFYELYGIVEVPPSLEDPDTGVSSKDVTISPHISARLYLPKNTITDQK  76

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVYYHGGG    SAF    H YLN LVS++  IA+SV YRLAPEH LP  Y+DCW+A
Sbjct  77    LPVLVYYHGGGLVAGSAFFQTEHRYLNHLVSESKCIAISVNYRLAPEHDLPTLYQDCWDA  136

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             LQWVASHA+         EPW+ NHGDF ++F+ GDSAGGNIV N+ +RAG E LN   K
Sbjct  137   LQWVASHAAGKD-----AEPWIANHGDFNRLFIAGDSAGGNIVFNMTMRAGRESLNGGVK  191

Query  624   LLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCS  445
             L+G I +FP+F   + +  E S++ K+W+ + P ++ GI++PM+ P++E  PSL+ L CS
Sbjct  192   LVGAIFAFPFFLIPSVENIEGSLIYKLWNTICPPSEQGINSPMVNPVSEICPSLSELGCS  251

Query  444   KLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTF  271
             +L VC  +KDEL   EI  R+ EAVK SGWKGE+E ++VEGE HCF   NP  EK+KD  
Sbjct  252   RLFVCAGKKDELVPSEIVSRFAEAVKNSGWKGELEFIEVEGEGHCFQAANPEAEKSKDLI  311

Query  270   KRIASFIQ  247
             KR+ASFIQ
Sbjct  312   KRMASFIQ  319



>ref|XP_008390857.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Malus domestica]
Length=333

 Score =   319 bits (818),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 180/320 (56%), Positives = 220/320 (69%), Gaps = 19/320 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERI---CNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKL-ASA  994
             P IR+++DG VER          P   +D  TGVSSKDIT+S  P ISVR +LP L  + 
Sbjct  14    PFIRIFEDGTVERTPLPYPSYVPPSPDQDPETGVSSKDITISENPKISVRAFLPNLPQNH  73

Query  993   TQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDC  814
             TQKLPILVY+HGG FC++SAFS +   YLN+LVS+A VIAVSVEYRLAPE+PLP  YEDC
Sbjct  74    TQKLPILVYFHGGAFCMESAFSFLNQRYLNLLVSEAKVIAVSVEYRLAPENPLPTAYEDC  133

Query  813   WEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             W ALQWVASH+SN       KEPWLV +GDF ++++GGDSAGGNI HN+A++ G E L  
Sbjct  134   WAALQWVASHSSNKDLDSN-KEPWLVRYGDFGRLYIGGDSAGGNITHNLAMKGGVESLCG  192

Query  633   KSKLLGGILSFPYFWSSNEKGGE--QSILQK-----VWDFVYPTAKGGIDNPMIYPMAEN  475
               K+LG  LS PYFW S   G E      +K      WDFVYP+A GGIDNPM+ P  E 
Sbjct  193   GVKILGAFLSCPYFWGSKPIGSEPKGEEFEKYHHSIAWDFVYPSAPGGIDNPMVNPEGEG  252

Query  474   APSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPI----  307
             APSL GL CSK+ VCVA KD+LR+  ++Y + VK+SGWKGE+E+ +VEGE+HCF      
Sbjct  253   APSLTGLGCSKVLVCVAGKDDLRDRGVQYYDLVKESGWKGELELFEVEGEDHCFHFWLMI  312

Query  306   -MNPGTEKAKDTFKRIASFI  250
                  TE  K  FKR+ASF+
Sbjct  313   ESKTETENVKKVFKRLASFL  332



>ref|XP_010024367.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like isoform X2 
[Eucalyptus grandis]
Length=331

 Score =   319 bits (818),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 216/313 (69%), Gaps = 12/313 (4%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITV--SPNISVRVYLPKLASATQ---  988
             L+R YKDG VER+   PYVPP  ED  TGV+SKDIT+   P I  R++LPKL    +   
Sbjct  17    LLRAYKDGTVERLSGTPYVPPCLEDPKTGVASKDITIREDPLIQARLHLPKLEPVNEQPE  76

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLPILVYYHGGGFC++SAFS + H YL  LV++  ++AVS+EYRLAPE P+P  ++DCWE
Sbjct  77    KLPILVYYHGGGFCIESAFSLVEHQYLTTLVAEGKILAVSIEYRLAPECPVPTIFDDCWE  136

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
              LQWVASH+ ++G    +KEPWL +HGDF ++FV GDSAG  I HNV +RAG +P+    
Sbjct  137   GLQWVASHSIDNGGPA-VKEPWLADHGDFHRVFVAGDSAGATIAHNVLMRAGRDPIVGGM  195

Query  627   KLLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             K+ G  L+ PYFW S   G E      + +   VW  +YPTAKGGID+PMI P    APS
Sbjct  196   KISGAYLTHPYFWGSEPIGSEPKTDHDKELPHIVWTSLYPTAKGGIDSPMINPFVTGAPS  255

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             LAGL C +L V VAEKD LR   L+Y EAVK+SG+KGE+E+V+ EGE+H F I+    E 
Sbjct  256   LAGLGCGRLLVSVAEKDLLRNRGLKYCEAVKESGFKGEVELVEAEGEDHAFHIVTYEKES  315

Query  285   AKDTFKRIASFIQ  247
             A+   KR+A+F+ 
Sbjct  316   AQVMIKRLAAFLN  328



>ref|XP_010024366.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like isoform X1 
[Eucalyptus grandis]
Length=331

 Score =   319 bits (818),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 216/313 (69%), Gaps = 12/313 (4%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITV--SPNISVRVYLPKLASATQ---  988
             L+R YKDG VER+   PYVPP  ED  TGV+SKDIT+   P I  R++LPKL    +   
Sbjct  17    LLRAYKDGTVERLSGTPYVPPCLEDPKTGVASKDITIREDPLIQARLHLPKLEPVNEQPE  76

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLPILVYYHGGGFC++SAFS + H YL  LV++  ++AVS+EYRLAPE P+P  ++DCWE
Sbjct  77    KLPILVYYHGGGFCIESAFSLVEHQYLTTLVAEGKILAVSIEYRLAPECPVPTIFDDCWE  136

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
              LQWVASH+ ++G    +KEPWL +HGDF ++FV GDSAG  I HNV +RAG +P+    
Sbjct  137   GLQWVASHSIDNGGPA-VKEPWLADHGDFHRVFVAGDSAGATIAHNVLMRAGRDPIVGGM  195

Query  627   KLLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             K+ G  L+ PYFW S   G E      + +   VW  +YPTAKGGID+PMI P    APS
Sbjct  196   KISGAYLTHPYFWGSEPIGSEPKTDHDKELPHIVWTSLYPTAKGGIDSPMINPFVTGAPS  255

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             LAGL C +L V VAEKD LR   L+Y EAVK+SG+KGE+E+V+ EGE+H F I+    E 
Sbjct  256   LAGLGCGRLLVSVAEKDLLRNRGLKYCEAVKESGFKGEVELVEAEGEDHAFHIVTYEKES  315

Query  285   AKDTFKRIASFIQ  247
             A+   KR+A+F+ 
Sbjct  316   AQVMIKRLAAFLN  328



>ref|XP_010649883.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Vitis vinifera]
Length=318

 Score =   318 bits (816),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 169/315 (54%), Positives = 224/315 (71%), Gaps = 24/315 (8%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPE-DSATGVSSKDITVS----PNISVRVYLPKLASA-  994
             P+IRVYKDG VER+   P VPP PE D  TGV SKDI+ S     +IS R+YLPKL    
Sbjct  15    PIIRVYKDGTVERLMASPIVPPFPEGDPQTGVLSKDISFSITPDSSISARLYLPKLPDQQ  74

Query  993   TQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDC  814
             + KLPILVY+HGGGFC++SA S + H YLNILVSQA V+ VSV+YRLAPEH LP  Y+DC
Sbjct  75    SHKLPILVYFHGGGFCIESASSFLVHRYLNILVSQAKVVVVSVDYRLAPEHLLPIAYDDC  134

Query  813   WEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             W+AL WVASH++        KEPWL+ +GDFE++F+GGDS+GGNIVHN+AIR G      
Sbjct  135   WDALNWVASHSARGATD---KEPWLLEYGDFERLFIGGDSSGGNIVHNMAIRGG------  185

Query  633   KSKLLGGILSFPYFWSSN------EKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENA  472
               ++ G  L  PYFW S       ++G E+S+L ++W  VYP++  G+D+P+I P+   A
Sbjct  186   -VRISGAFLVDPYFWGSKPIGSEPKEGHEESLLSRLWKLVYPSS--GLDDPLINPVGPGA  242

Query  471   PSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
             PSLAGL CS++ VCVAEKD LR+  + Y++AV+ SGW+G++++ + EGE H   I  P T
Sbjct  243   PSLAGLGCSRMLVCVAEKDILRDRGVAYIDAVRTSGWEGDVDLFEAEGENHGHHIFYPET  302

Query  291   EKAKDTFKRIASFIQ  247
             +KAK+ F+R+ASF+ 
Sbjct  303   DKAKEMFQRLASFLN  317



>ref|XP_004298163.1| PREDICTED: uncharacterized protein LOC101304570 [Fragaria vesca 
subsp. vesca]
Length=962

 Score =   336 bits (862),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 182/311 (59%), Positives = 226/311 (73%), Gaps = 13/311 (4%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKLP  979
             LI+ YKDG VER    P+VPPS  D  TGVSSKDIT+S  P IS R+YLP+  + T++LP
Sbjct  17    LIKHYKDGTVERFFGSPHVPPSLNDPVTGVSSKDITISHNPLISARLYLPQ--NQTKRLP  74

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             ILVY+HGGGFC++SAFSS+ H YLN LVS+A VIAVSVEYRLAPE PLPA Y+D W ALQ
Sbjct  75    ILVYFHGGGFCLESAFSSLDHRYLNRLVSEAQVIAVSVEYRLAPESPLPAAYDDAWTALQ  134

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WVASH+ N+      +EPWL ++GDF+++++GGDSAGGN+ HN+A++AG E LN   K+L
Sbjct  135   WVASHSLNE-DDPSQREPWLADYGDFDRVYIGGDSAGGNLAHNLAMKAGVESLNGAVKIL  193

Query  618   GGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
             G ILS PYFW S+  G E       +S+   VW F YP+A GGIDNP+I PM   APSLA
Sbjct  194   GAILSHPYFWGSDPVGSEPKGEDKLKSLPYLVWKFAYPSADGGIDNPLINPMVSGAPSLA  253

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIM-NPGTEKA  283
              L CS++ VCVA KDELR+  + Y + VK SGWKGE E+ +VEGEEHCF I+    TE  
Sbjct  254   RLGCSRVLVCVAGKDELRDRGVLYYDLVKGSGWKGEAELFEVEGEEHCFHILYEKETENV  313

Query  282   KDTFKRIASFI  250
             K   KR+A F+
Sbjct  314   KRMIKRLADFL  324


 Score =   315 bits (807),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 173/309 (56%), Positives = 214/309 (69%), Gaps = 11/309 (4%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKLP  979
             L  +YKDG VER+   PYV P+  D   GVSSKDIT+S  P IS R++LPKL    +K+P
Sbjct  324   LALIYKDGSVERLMGSPYVRPTLNDPDLGVSSKDITISQSPLISARIFLPKLNEPHKKIP  383

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             ILVYYHGG FCV+SAFS  +H +LN LVSQA V+AVSVEYR+APEH LP  YED W AL 
Sbjct  384   ILVYYHGGAFCVESAFSFDHHRFLNSLVSQAEVVAVSVEYRVAPEHSLPIAYEDSWAALN  443

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WVA H +++G     +EPWL+NHGD  ++FVGGDSAG NI HNVA+R G E L     LL
Sbjct  444   WVALHFADNGIN---EEPWLINHGDPNRLFVGGDSAGANIAHNVAMRVGKEGLRNGVNLL  500

Query  618   GGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
             G  L+ P FW S    G      E+ +   VW+  YP+A GGIDNPMI P+A  APSLAG
Sbjct  501   GVFLTHPLFWGSKPIEGDPCEEPEKDLACLVWNMAYPSAPGGIDNPMINPVAPEAPSLAG  560

Query  456   LRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             L CS+L VCV+E DELR   + Y EAVK+SG++GE E+V+VEGE+H F I+     KAK+
Sbjct  561   LGCSRLLVCVSENDELRHRGVGYYEAVKRSGFEGETELVEVEGEDHAFHILKFEFRKAKE  620

Query  276   TFKRIASFI  250
               K++A F+
Sbjct  621   LTKKLADFL  629


 Score =   298 bits (763),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 173/317 (55%), Positives = 217/317 (68%), Gaps = 17/317 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLAS----A  994
             P IRVYKDG VER+   PYVPPSP D  TGVSSKDI +S  P IS R++LP+  +     
Sbjct  647   PFIRVYKDGSVERLMGSPYVPPSPCDPDTGVSSKDIIISDNPKISARLFLPQTLTDQNVQ  706

Query  993   TQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDC  814
              QKLP+LVY+HGGGFC +SAFSS +H +LN LVS+A VIAVSVEYRLAPE  +P  Y+DC
Sbjct  707   NQKLPVLVYFHGGGFCFESAFSSDHHRFLNRLVSKAQVIAVSVEYRLAPEVAIPTCYQDC  766

Query  813   WEALQWVASHASN-DGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLN  637
             W+ALQWVASHA N D      KEPWL+N+GDF K+++GGDSAGGNIVHNVA++AG    +
Sbjct  767   WDALQWVASHAGNEDVMSSANKEPWLLNYGDFGKVYIGGDSAGGNIVHNVAMKAGAG--S  824

Query  636   QKSKLLGGILSFPYFWSS----NEKGGEQ---SILQKVWDFVYPTAKGGIDNPMIYPMAE  478
                KL+G  LS  YF SS    +E  GE+        VW +  P+  GGID+PM+ P   
Sbjct  825   SSVKLVGAFLSHTYFMSSKPLESEPKGEEFKNYAPYVVWGYFNPSTPGGIDSPMVNPAGP  884

Query  477   NAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNP  298
              A SLA L CSKL VCV+ KD+LR+  + Y + VK SG+KGE+E+ +VEGE H F I++ 
Sbjct  885   GARSLAELGCSKLLVCVSSKDQLRDRGVWYYDLVKGSGFKGEVELFEVEGEVHAFHILSE  944

Query  297   G-TEKAKDTFKRIASFI  250
               T   K    ++ASF+
Sbjct  945   AETPNVKKMINKLASFL  961



>ref|XP_003556031.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Glycine max]
 gb|KHN15790.1| Putative carboxylesterase 7 [Glycine soja]
Length=323

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 177/311 (57%), Positives = 224/311 (72%), Gaps = 13/311 (4%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKLPI  976
             IRV+ DG VER    P+VPPS +D  TGVSSKDI +S N  +S R+YLPKL +  Q +PI
Sbjct  17    IRVFSDGTVERPRETPFVPPSIDDPQTGVSSKDIVISQNPLVSARIYLPKLTTINQ-VPI  75

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LV++HGGGF  +SAFS +YHH+ N  VSQ N I VSVEYRLAPEHPLPA Y DCWEAL+W
Sbjct  76    LVFFHGGGFFFESAFSQLYHHHFNTFVSQTNCIVVSVEYRLAPEHPLPACYLDCWEALKW  135

Query  795   VASHASNDGQQVPLK-EPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             VASH+S +    P+  E WL++HG+F+++F+GGDSAGGNIVHN+A+RAG EPL    KLL
Sbjct  136   VASHSSENS---PINAEQWLISHGNFQRVFIGGDSAGGNIVHNIAMRAGTEPLPCGVKLL  192

Query  618   GGILSFPYFWSSNE------KGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
             G I + PYF SS         G EQS+   VWDFVYP+  GGIDNPM+ P+A  APSLA 
Sbjct  193   GAIFAHPYFCSSYPIGSEPVTGHEQSLPYVVWDFVYPSVPGGIDNPMVNPVAPGAPSLAE  252

Query  456   LRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             L CSK+ VCVA +D+LR+  + Y EAVKKSGWKG++E+ +  GE+H + I +P +E A  
Sbjct  253   LGCSKIIVCVASEDKLRDRGVWYYEAVKKSGWKGDLELFEENGEDHVYHIFHPESENATK  312

Query  276   TFKRIASFIQD  244
               KR+  F+ +
Sbjct  313   LIKRLGLFLNE  323



>gb|KCW60818.1| hypothetical protein EUGRSUZ_H03554 [Eucalyptus grandis]
Length=373

 Score =   319 bits (818),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 169/313 (54%), Positives = 216/313 (69%), Gaps = 12/313 (4%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITV--SPNISVRVYLPKLASATQ---  988
             L+R YKDG VER+   PYVPP  ED  TGV+SKDIT+   P I  R++LPKL    +   
Sbjct  59    LLRAYKDGTVERLSGTPYVPPCLEDPKTGVASKDITIREDPLIQARLHLPKLEPVNEQPE  118

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLPILVYYHGGGFC++SAFS + H YL  LV++  ++AVS+EYRLAPE P+P  ++DCWE
Sbjct  119   KLPILVYYHGGGFCIESAFSLVEHQYLTTLVAEGKILAVSIEYRLAPECPVPTIFDDCWE  178

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
              LQWVASH+ ++G    +KEPWL +HGDF ++FV GDSAG  I HNV +RAG +P+    
Sbjct  179   GLQWVASHSIDNGGPA-VKEPWLADHGDFHRVFVAGDSAGATIAHNVLMRAGRDPIVGGM  237

Query  627   KLLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             K+ G  L+ PYFW S   G E      + +   VW  +YPTAKGGID+PMI P    APS
Sbjct  238   KISGAYLTHPYFWGSEPIGSEPKTDHDKELPHIVWTSLYPTAKGGIDSPMINPFVTGAPS  297

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             LAGL C +L V VAEKD LR   L+Y EAVK+SG+KGE+E+V+ EGE+H F I+    E 
Sbjct  298   LAGLGCGRLLVSVAEKDLLRNRGLKYCEAVKESGFKGEVELVEAEGEDHAFHIVTYEKES  357

Query  285   AKDTFKRIASFIQ  247
             A+   KR+A+F+ 
Sbjct  358   AQVMIKRLAAFLN  370



>ref|XP_008358549.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Malus domestica]
Length=339

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 180/326 (55%), Positives = 225/326 (69%), Gaps = 25/326 (8%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPY---VPPSP-EDSATGVSSKDITVS--PNISVRVYLPKL-AS  997
             P IR+++DG VERI  +PY   VPPSP +D  TGV SKDIT+S  P  S R++LP L  +
Sbjct  14    PFIRIFEDGTVERI-PFPYSSYVPPSPDQDPETGVYSKDITISDNPKFSARLFLPNLPQN  72

Query  996   ATQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYED  817
              TQKL ILVY+HGG FC+ S FS ++  YLN LVS+A V+AVSVEYRLAPE+PLP  YED
Sbjct  73    QTQKLSILVYFHGGAFCMASTFSFLHQRYLNRLVSEAKVVAVSVEYRLAPENPLPIAYED  132

Query  816   CWEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLN  637
             CW ALQWVASH+ N G     KE WL+N+G F+++++GGDSAGGNI HN+ ++AG E L 
Sbjct  133   CWAALQWVASHSINKGSSDGNKETWLLNYGXFDRVYIGGDSAGGNIAHNLVMKAGVEGLC  192

Query  636   QKSKLLGGILSFPYFWSSNEKGG-------EQSILQKVWDFVYPTAKGGIDNPMIYPMAE  478
                K+LG  LS PYFW S   G        E+++   VWDFVYP+A GGIDNPM+ P  E
Sbjct  193   GGVKILGVFLSCPYFWGSKPIGSEPKGXNFEKTLPYLVWDFVYPSAPGGIDNPMVNPAGE  252

Query  477   NAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPI---  307
              APSL GL CSKL VCVA KD LR+  ++Y + VK+SGWKGE+E+ +VEGE+HCF +   
Sbjct  253   GAPSLTGLGCSKLLVCVAGKDHLRDRGVQYYDLVKESGWKGELELFEVEGEDHCFHVSLG  312

Query  306   -------MNPGTEKAKDTFKRIASFI  250
                        TE  K  FKR+ASF+
Sbjct  313   IETKTDQTETTTENVKKMFKRLASFL  338



>gb|ABB89008.1| CXE carboxylesterase [Malus pumila]
Length=339

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 180/326 (55%), Positives = 225/326 (69%), Gaps = 25/326 (8%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPY---VPPSP-EDSATGVSSKDITVS--PNISVRVYLPKL-AS  997
             P IR+++DG VERI  +PY   VPPSP +D  TGV SKDIT+S  P  S R++LP L  +
Sbjct  14    PFIRIFEDGTVERI-PFPYSSYVPPSPDQDPETGVYSKDITISDNPKFSARLFLPNLPQN  72

Query  996   ATQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYED  817
              TQKL ILVY+HGG FC+ S FS ++  YLN LVS+A V+AVSVEYRLAPE+PLP  YED
Sbjct  73    QTQKLSILVYFHGGAFCMASTFSFLHQRYLNRLVSEAKVVAVSVEYRLAPENPLPIAYED  132

Query  816   CWEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLN  637
             CW ALQWVASH+ N G     KE WL+N+G F+++++GGDSAGGNI HN+ ++AG E L 
Sbjct  133   CWAALQWVASHSINKGSSDGNKETWLLNYGYFDRVYIGGDSAGGNIAHNLVMKAGVEGLC  192

Query  636   QKSKLLGGILSFPYFWSSNEKGG-------EQSILQKVWDFVYPTAKGGIDNPMIYPMAE  478
                K+LG  LS PYFW S   G        E+++   VWDFVYP+A GGIDNPM+ P  E
Sbjct  193   GGVKILGVFLSCPYFWGSKPIGSEPKGENFEKTLPYLVWDFVYPSAPGGIDNPMVNPAGE  252

Query  477   NAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPI---  307
              APSL GL CSKL VCVA KD LR+  ++Y + VK+SGWKGE+E+ +VEGE+HCF +   
Sbjct  253   GAPSLTGLGCSKLLVCVAGKDHLRDRGVQYYDLVKESGWKGELELFEVEGEDHCFHVSLG  312

Query  306   -------MNPGTEKAKDTFKRIASFI  250
                        TE  K  FKR+ASF+
Sbjct  313   IETKTDQTETTTENVKKMFKRLASFL  338



>ref|XP_006489582.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Citrus sinensis]
Length=373

 Score =   318 bits (816),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 176/313 (56%), Positives = 214/313 (68%), Gaps = 12/313 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSP-EDSATGVSSKDITVS--PNISVRVYLPKLAS--AT  991
             PL+RVYKDG VER+   P V PSP ED  TGVSSKDIT+S  P IS RVYLPKLA   +T
Sbjct  59    PLLRVYKDGSVERLSGSPMVLPSPDEDPETGVSSKDITISENPKISARVYLPKLAQPIST  118

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
             QKLPIL Y HGGGFC +SAFS +    +N LVS+A V+A+S+EYRLAPEHPLP  YED W
Sbjct  119   QKLPILFYTHGGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPLPIAYEDSW  178

Query  810   EALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
              ALQWVASH+ N+G     KEPWL   GDF+++FV GDSAG NI H+V +RAG E L   
Sbjct  179   SALQWVASHSVNNG-GFDNKEPWLARFGDFDRVFVAGDSAGANIAHHVVMRAGREKLAGG  237

Query  630   SKLLGGILSFPYFWSSNEKGGEQS------ILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
              K+LG  L+ PYFW S   G E +      +   VW F+ P   GG DNPMI  ++  AP
Sbjct  238   VKILGAFLTHPYFWGSKPVGSEDTRDFEKLLPSLVWKFLCPNVAGGADNPMINVVSPEAP  297

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
             +LA L C +L V VAE D LR+  + Y  AVK+SGW+GE+E+V VEGE+H F I+   TE
Sbjct  298   TLAQLGCRRLLVSVAELDVLRDRGILYYNAVKESGWEGEVELVQVEGEDHAFHILKYETE  357

Query  288   KAKDTFKRIASFI  250
              A+   KR+ASF+
Sbjct  358   NARKMIKRLASFV  370



>ref|NP_001239627.1| uncharacterized protein LOC100785409 [Glycine max]
 gb|ACU19943.1| unknown [Glycine max]
 gb|KHN02696.1| Putative carboxylesterase 7 [Glycine soja]
Length=343

 Score =   317 bits (812),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 174/313 (56%), Positives = 219/313 (70%), Gaps = 16/313 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLP-KLA-SATQ  988
             PL+RVY DG VER    P+VPPS  D  T VSSKDI +S  P+IS RVYLP KL  S  Q
Sbjct  35    PLLRVYNDGTVERFLGSPHVPPSLLDPETLVSSKDIVISENPSISARVYLPPKLNNSHQQ  94

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLPI VY+HGG FC++SAFS ++H YLN++ S+A V+ VSVEYRLAPE+PLPA YED WE
Sbjct  95    KLPIFVYFHGGAFCLESAFSFLHHRYLNLIASEAKVLVVSVEYRLAPENPLPAAYEDSWE  154

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ-K  631
             AL+WV SH +++       EPWLV HGDF + ++GGD+AG N+ HN  +R G E      
Sbjct  155   ALKWVTSHFNSNKS-----EPWLVEHGDFNRFYIGGDTAGANVAHNAVLRVGVESETLWG  209

Query  630   SKLLGGILSFPYFWSSNE------KGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
              K+ G +L+FP FWSS        +G E+S   +VW FVYP A GGIDNP+I P+A  AP
Sbjct  210   VKIAGVVLAFPLFWSSEPVLSEMVEGFEESSAMQVWKFVYPDAPGGIDNPLINPLASGAP  269

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
             SLA L C K+ + VA KD+LR+  + Y +AVKKSGW+G++E+V VEGEEHCF I +P TE
Sbjct  270   SLASLGCHKVLIFVAGKDDLRDRGIWYYDAVKKSGWEGDVELVRVEGEEHCFQIYHPETE  329

Query  288   KAKDTFKRIASFI  250
              +K    RIASF+
Sbjct  330   NSKGVISRIASFL  342



>ref|XP_004496762.1| PREDICTED: probable carboxylesterase 12-like [Cicer arietinum]
Length=339

 Score =   317 bits (812),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 170/319 (53%), Positives = 218/319 (68%), Gaps = 17/319 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLAS--ATQ  988
             PL+RVYKDG VER     +VPPS +D  T VSSKDI +S N  IS R++LPKL +   TQ
Sbjct  20    PLLRVYKDGSVERFLGSSFVPPSLQDPQTSVSSKDIVISQNPLISARIHLPKLTNNDLTQ  79

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             K PI VYYHGG FC++SAFS ++  YLNI+ S++NV+ VSVEYRLAPEHPLPA YED W 
Sbjct  80    KFPIFVYYHGGAFCLESAFSFLHQRYLNIIASKSNVLVVSVEYRLAPEHPLPAAYEDGWF  139

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGN-------  649
             AL+WVASH+  +   +   EPWL+ HGDF + ++GGD++G NI HN  +R GN       
Sbjct  140   ALKWVASHSIENNSSIENLEPWLIKHGDFNRFYIGGDTSGANIAHNALLRVGNGIVTEKI  199

Query  648   EPLNQKSKLLGGILSFPYFWSS------NEKGGEQSILQKVWDFVYPTAKGGIDNPMIYP  487
             E L    K+ G +L+FP FWSS      + +  EQS   KVW+FVYP A  GIDN +I P
Sbjct  200   ETLPGDVKIRGALLAFPLFWSSKPVLSESVEEHEQSSPMKVWNFVYPDAVNGIDNFLINP  259

Query  486   MAENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPI  307
             +A  APSL  + C K+ + VA KD+LRE  + Y  AVK+SGWKGE+E+V V+GEEHCF I
Sbjct  260   LAPGAPSLEKIGCPKMLIFVAGKDDLRERGIWYYNAVKESGWKGEVELVHVDGEEHCFQI  319

Query  306   MNPGTEKAKDTFKRIASFI  250
              +P T+ + D   RIA+F+
Sbjct  320   YHPETQNSIDMVNRIAAFL  338



>gb|ACU19949.1| unknown [Glycine max]
Length=323

 Score =   316 bits (810),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 176/311 (57%), Positives = 223/311 (72%), Gaps = 13/311 (4%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKLPI  976
             IRV+ DG VER    P+VPPS +D  TGVSSKDI +S N  +S R+YLPKL +  Q +PI
Sbjct  17    IRVFSDGTVERPRETPFVPPSIDDPQTGVSSKDIVISQNPLVSARIYLPKLTTINQ-VPI  75

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LV++HGGGF  +SAFS +YHH+ N  VSQ N I VSVEYRLAPEHPLPA Y DCWEAL+W
Sbjct  76    LVFFHGGGFFFESAFSQLYHHHFNTFVSQTNCIVVSVEYRLAPEHPLPACYLDCWEALKW  135

Query  795   VASHASNDGQQVPLK-EPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             VASH+S +    P+  E WL++HG+F+++F+GGDS GGNIVHN+A+RAG EPL    KLL
Sbjct  136   VASHSSENS---PINAEQWLISHGNFQRVFIGGDSTGGNIVHNIAMRAGTEPLPCGVKLL  192

Query  618   GGILSFPYFWSSNE------KGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
             G I + PYF SS         G EQS+   VWDFVYP+  GGIDNPM+ P+A  APSLA 
Sbjct  193   GAIFAHPYFCSSYPIGSEPVTGHEQSLPYVVWDFVYPSVPGGIDNPMVNPVAPGAPSLAE  252

Query  456   LRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             L CSK+ VCVA +D+LR+  + Y EAVKKSGWKG++E+ +  GE+H + I +P +E A  
Sbjct  253   LGCSKIIVCVASEDKLRDRGVWYYEAVKKSGWKGDLELFEENGEDHVYHIFHPESENATK  312

Query  276   TFKRIASFIQD  244
               KR+  F+ +
Sbjct  313   LIKRLGLFLNE  323



>gb|KDO74707.1| hypothetical protein CISIN_1g020576mg [Citrus sinensis]
Length=324

 Score =   316 bits (809),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 175/313 (56%), Positives = 213/313 (68%), Gaps = 12/313 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSP-EDSATGVSSKDITVS--PNISVRVYLPKLAS--AT  991
             PL+RVYKDG VER+   P V PSP ED  TGVSSKDIT+S  P IS RVYLPKLA   +T
Sbjct  10    PLLRVYKDGSVERLSGSPMVLPSPDEDPETGVSSKDITISENPKISARVYLPKLAQPIST  69

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
             QKLPIL Y HGGGFC +SAFS +    +N LVS+A V+A+S+EYRLAPEHPLP  YED W
Sbjct  70    QKLPILFYTHGGGFCFESAFSLVETKLMNALVSEAKVVAISIEYRLAPEHPLPIAYEDSW  129

Query  810   EALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
              ALQWVASH+ N+G     KEPWL   GDF+++FV GDSAG NI H+V +RAG E L   
Sbjct  130   SALQWVASHSVNNG-GFDNKEPWLARFGDFDRVFVAGDSAGANIAHHVVMRAGREKLAGG  188

Query  630   SKLLGGILSFPYFWSSNEKGGEQS------ILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
              K+LG  L+ PYFW S   G E +      +   VW F+ P   GG DNPMI  ++  AP
Sbjct  189   VKILGAFLTHPYFWGSKPVGSEDTRDFEKLLPSLVWKFLCPNVAGGADNPMINVVSPEAP  248

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
             +LA L C +L V VAE D LR+  + Y  AVK+SGW+GE+E+V VEGE+H F I+   TE
Sbjct  249   TLAQLGCRRLLVSVAELDVLRDRGILYYNAVKESGWEGEVELVQVEGEDHAFHILKYETE  308

Query  288   KAKDTFKRIASFI  250
              A+   KR+ SF+
Sbjct  309   NARKMIKRLGSFV  321



>ref|XP_004240012.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum lycopersicum]
Length=322

 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 166/308 (54%), Positives = 219/308 (71%), Gaps = 8/308 (3%)
 Frame = -2

Query  1155  PLIRVYKDGRVER---ICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQK  985
             P  R+YKDGRVER   +     VPPS ED ATGVSSKD+++S ++S R+YLPK  +  QK
Sbjct  16    PYYRLYKDGRVERFYELGGVHQVPPSLEDPATGVSSKDVSISAHVSARLYLPKNTAPNQK  75

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVYYHGGG  + SAF    H YLN LVS++N IA+SV+YRLAPEH +   Y+DCW+A
Sbjct  76    LPVLVYYHGGGLVLGSAFFKTEHCYLNHLVSESNCIAISVDYRLAPEHDIHTIYQDCWDA  135

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             LQWVASH+ +D      KEPW+ NH +F ++FVGGDSAGGNIV+N+ +RAG E L    K
Sbjct  136   LQWVASHSVSDTIN---KEPWIENHSNFNRLFVGGDSAGGNIVYNMIMRAGREKLIGDVK  192

Query  624   LLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCS  445
             +LG IL FPY    + +  ++ +  K+W+ + P ++ G D+PM+ P+++  PSL+ L CS
Sbjct  193   ILGAILGFPYLMIPSIENYDKGMAYKLWNMICPLSERGNDSPMVNPVSKKCPSLSKLGCS  252

Query  444   KLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTF  271
             +L VC  EKDEL   E+++++ EAVKKSGW+GEIE + VEGE HCF   NP  EK+KD  
Sbjct  253   RLFVCTGEKDELVPGEVAIKFAEAVKKSGWEGEIESIIVEGEGHCFHCENPQAEKSKDLI  312

Query  270   KRIASFIQ  247
             KRI SFIQ
Sbjct  313   KRIVSFIQ  320



>ref|XP_008222956.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Prunus mume]
Length=334

 Score =   315 bits (808),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 178/318 (56%), Positives = 223/318 (70%), Gaps = 17/318 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPK---LASAT  991
             PLIRVYKDG VER+   PYVPP P D  T VSSKDI +S  P+IS R++LP+        
Sbjct  17    PLIRVYKDGTVERLWGSPYVPPCPHDPQTNVSSKDINISHNPSISARLFLPQNQIYQKPQ  76

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
               LPILVY+HGGGFC +SAFSS +H  LN LVSQA V+ VSVEYRLAPE+PLP  Y+DCW
Sbjct  77    HLLPILVYFHGGGFCFESAFSSDHHRLLNRLVSQAQVLGVSVEYRLAPENPLPNCYQDCW  136

Query  810   EALQWVASHASN---DGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPL  640
             +ALQWV+SH ++   D      KEPWLVN+G+F+K+++GGDSAGGNIVHNVA++AG E L
Sbjct  137   DALQWVSSHRTHKELDADNTN-KEPWLVNYGNFDKLYIGGDSAGGNIVHNVAMKAGVERL  195

Query  639   NQKSKLLGGILSFPYFWSSNEKGG-------EQSILQKVWDFVYPTAKGGIDNPMIYPMA  481
                 K+LG  +S PYF  S   G        E+ +  KVW F+YP+A GGI+NPM+ P+ 
Sbjct  196   CGDVKILGAFMSHPYFLGSKPIGSEPRGEDFEKWLPCKVWKFLYPSAPGGINNPMVNPVG  255

Query  480   ENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIM-  304
               APSLAGL C ++ VCV+ KDELR+  + Y E VK+SGW+GE+EV +VEGEEH F I+ 
Sbjct  256   PGAPSLAGLGCPRMLVCVSSKDELRDRGVWYYELVKESGWRGEVEVFEVEGEEHAFHILV  315

Query  303   NPGTEKAKDTFKRIASFI  250
                T   K   KR+ASF+
Sbjct  316   EAETVNVKIMIKRLASFL  333



>ref|XP_007157159.1| hypothetical protein PHAVU_002G047500g [Phaseolus vulgaris]
 gb|ESW29153.1| hypothetical protein PHAVU_002G047500g [Phaseolus vulgaris]
Length=365

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/311 (52%), Positives = 213/311 (68%), Gaps = 12/311 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPK-LASATQK  985
             PLIR+YKDG V+R+ + P VPPS +D  TGVSSKDI ++  P +S R++LPK   + + K
Sbjct  57    PLIRLYKDGTVDRLLSSPNVPPSVQDPETGVSSKDIVIADDPLVSARIFLPKNHTNPSHK  116

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LPI VY+HGG FCV+SAFS   H YLNILVSQANVIA+SV++RL P HPLPA Y+D W  
Sbjct  117   LPIFVYFHGGAFCVESAFSFFVHRYLNILVSQANVIAISVDFRLLPHHPLPAAYQDGWTT  176

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             LQW+ASHA+N        EPWL+N+ DF K+++GG+++G N+ HN+ +RAG+E L    K
Sbjct  177   LQWIASHAANTAAN---PEPWLLNYADFNKLYIGGETSGANLAHNLLLRAGDESLQGDLK  233

Query  624   LLGGILSFPYFW------SSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G +LS P+FW      S   +G EQS+  KVW    P A GGIDNP I P    APSL
Sbjct  234   IFGALLSSPFFWGLVPIGSEPVEGHEQSLAMKVWSLACPDAPGGIDNPWINPCVAGAPSL  293

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             A L CSK+ + +  KDE R+ ++ Y + +KKSGWKGE+E+ D   EEH F +  P T++A
Sbjct  294   ATLACSKILITITGKDEFRDRNILYHDTIKKSGWKGEVEIFDAGDEEHAFQLFKPETDRA  353

Query  282   KDTFKRIASFI  250
             K   K +ASF+
Sbjct  354   KAMIKHLASFL  364



>ref|NP_001276288.1| uncharacterized protein LOC100813532 [Glycine max]
 gb|ACU22898.1| unknown [Glycine max]
Length=320

 Score =   315 bits (806),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 170/312 (54%), Positives = 216/312 (69%), Gaps = 24/312 (8%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQ---  988
             L+R+YKDG +ER+ N P VPP+ +D     SSKD+ +S  P IS R++LP    + Q   
Sbjct  20    LVRLYKDGTIERLQNSPIVPPTLQDP---TSSKDVVISGDPLISARLFLPNRIRSQQEGH  76

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             K+PILVY+HGGGF  +SAF+ ++H+Y N  VS A+V+ VSVEYRLAPE  LPA Y+DCW+
Sbjct  77    KVPILVYFHGGGFFFESAFNQLHHNYFNKFVSVADVLVVSVEYRLAPETLLPAAYDDCWD  136

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             AL+WVA++           EPWLV HGDF ++F+GGDSAG NIVHN+A+RAG E L    
Sbjct  137   ALKWVATNT----------EPWLVKHGDFNRVFIGGDSAGANIVHNIAMRAGAEALPGGV  186

Query  627   KLLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             KLLG  LS  YF+ S   G E      QS+   VWDFVYP+A GGIDNPMI PM   APS
Sbjct  187   KLLGAFLSHSYFYGSRPIGSEPVAGHQQSVPYLVWDFVYPSAPGGIDNPMINPMVTGAPS  246

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             LAGL CSK+ VCVAEKD +++  + Y EAVKKSGW+GE E+ +VEGE+H F I NP T+ 
Sbjct  247   LAGLGCSKILVCVAEKDLIKDRGVAYYEAVKKSGWQGEAELFEVEGEDHAFHIHNPQTQN  306

Query  285   AKDTFKRIASFI  250
             A    KR++ F+
Sbjct  307   AMKMIKRLSDFL  318



>gb|KHN30461.1| Putative carboxylesterase 2 [Glycine soja]
Length=320

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 170/312 (54%), Positives = 216/312 (69%), Gaps = 24/312 (8%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQ---  988
             L+R+YKDG +ER+ N P VPP+ +D     SSKD+ +S  P IS R++LP    + Q   
Sbjct  20    LVRLYKDGTIERLQNSPIVPPTLQDP---TSSKDVVISGDPLISARLFLPNRIRSQQEGH  76

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             K+PILVY+HGGGF  +SAF+ ++H+Y N  VS A+V+ VSVEYRLAPE  LPA Y+DCW+
Sbjct  77    KVPILVYFHGGGFFFESAFNQLHHNYFNKFVSVADVLVVSVEYRLAPETLLPAAYDDCWD  136

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             AL+WVA++           EPWLV HGDF ++F+GGDSAG NIVHN+A+RAG E L    
Sbjct  137   ALKWVATNT----------EPWLVKHGDFNRVFIGGDSAGANIVHNIAMRAGAEALPGGV  186

Query  627   KLLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             KLLG  LS  YF+ S   G E      QS+   VWDFVYP+A GGIDNPMI PM   APS
Sbjct  187   KLLGAFLSHSYFYGSKPIGSEPVAGHQQSVPYLVWDFVYPSAPGGIDNPMINPMVTGAPS  246

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             LAGL CSK+ VCVAEKD +++  + Y EAVKKSGW+GE E+ +VEGE+H F I NP T+ 
Sbjct  247   LAGLGCSKILVCVAEKDLIKDRGVAYYEAVKKSGWQGEAELFEVEGEDHAFHIHNPQTQN  306

Query  285   AKDTFKRIASFI  250
             A    KR++ F+
Sbjct  307   AMKMIKRLSDFL  318



>ref|XP_010277778.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Nelumbo nucifera]
Length=350

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 166/312 (53%), Positives = 215/312 (69%), Gaps = 12/312 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             P +RVY+DGRVER+    +VP S  D+ TGVSSKD+ +S    +S R++LPKL    QKL
Sbjct  41    PYVRVYEDGRVERLKGSEFVPASLNDTQTGVSSKDVLISSESAVSARLFLPKLTCNRQKL  100

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+LVY+HGG FC++SAFS ++H YLNILV++ANV+AVSVEYR APEH LPA YEDCW AL
Sbjct  101   PVLVYFHGGAFCIESAFSFLFHRYLNILVNEANVVAVSVEYRRAPEHLLPAAYEDCWAAL  160

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WV+SH+   G      EPWL ++ DF++IF+GGDSAGGNIVHNVA+RAG++ L    ++
Sbjct  161   EWVSSHSVGRGANY---EPWLTDYADFDRIFLGGDSAGGNIVHNVAMRAGSQSLPHNIRV  217

Query  621   LGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
              G  L  PYFW S   G E        S+  +VW FV P++  G+D+PMI PM+  AP L
Sbjct  218   RGAFLVHPYFWGSEPIGSESMEDHTPNSLANRVWLFVCPSSAAGVDDPMINPMSPGAPRL  277

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             + L CS+L VCVA KD L      Y  AV  SGW+GE+E+ +VEGE H + I +P TE A
Sbjct  278   SKLGCSRLLVCVAGKDILCYRGRLYHSAVGNSGWEGEVELFEVEGEGHVYHIFDPYTENA  337

Query  282   KDTFKRIASFIQ  247
                 KR+ASF+ 
Sbjct  338   GLMIKRLASFLN  349



>ref|XP_004516320.1| PREDICTED: probable carboxylesterase 1-like [Cicer arietinum]
Length=330

 Score =   315 bits (806),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/311 (52%), Positives = 209/311 (67%), Gaps = 11/311 (4%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKLP  979
              IR++ DG VER     + PPS  D  TG+SSKDI +S  P IS RVYLPK+ + + K P
Sbjct  23    FIRIFSDGSVERPLQSLFAPPSLNDPKTGLSSKDIVISHNPTISSRVYLPKITNPSSKFP  82

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             ILVY+HGG F  +SAFS IYH ++    ++AN+I VSVEY LAPEHPLP  Y +CW AL+
Sbjct  83    ILVYFHGGAFVFESAFSQIYHEHIKAFATEANIIVVSVEYSLAPEHPLPTCYHECWAALK  142

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WV+SH++N        EPWL+ HGDF ++F+GGDSAGGNI HN+AI+AG E L    K+L
Sbjct  143   WVSSHSNNTLNNA---EPWLIQHGDFNRVFIGGDSAGGNITHNIAIQAGIESLPCDVKIL  199

Query  618   GGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
             G IL  PYF SS   G       E SI  KVW  VYP A  GIDNP++ P+ E A SL  
Sbjct  200   GAILIHPYFHSSYPIGSEPIIEPENSICHKVWHLVYPNAPSGIDNPLVNPLGEGATSLEK  259

Query  456   LRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             L CSK+ VCVA KD LR+  + Y E+V+KSGWKG++E+ + + E+H + ++ P +E AK 
Sbjct  260   LGCSKIIVCVAGKDMLRDRGIWYFESVEKSGWKGKLELFEEKDEDHVYHLLKPESEIAKK  319

Query  276   TFKRIASFIQD  244
               KR+ SF+Q+
Sbjct  320   FIKRLVSFVQE  330



>ref|XP_010688718.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Beta vulgaris 
subsp. vulgaris]
Length=312

 Score =   314 bits (804),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 172/307 (56%), Positives = 218/307 (71%), Gaps = 15/307 (5%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKLP  979
             LIRV+KDG VER+   P+VPP+ ED  TGVSSKDIT+S   N+  R+YLPKL + T    
Sbjct  15    LIRVFKDGSVERLFGSPHVPPTLEDPKTGVSSKDITISTEKNLLARLYLPKLTTTTTNKK  74

Query  978   --ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
               ILVY+HGGGFC++SAFS I H Y+N L SQA VI +SVEYRLAPEHPLPA YEDCW A
Sbjct  75    LPILVYFHGGGFCLESAFSLIDHRYMNNLSSQAQVIVLSVEYRLAPEHPLPAAYEDCWTA  134

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L WVAS+        P  EPW+ NH D + IF+GGDSAG NIVHN+A++AG E L    K
Sbjct  135   LNWVASY--------PTDEPWIANHADLDAIFIGGDSAGANIVHNIAMKAGQESLKCGVK  186

Query  624   LLGGILSFPYFWSSNEKG-GEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRC  448
             +LG  LS PYF   +EK   E  +  K+W+FVYP A GG+++ MI P+   APSL+G+ C
Sbjct  187   ILGAFLSHPYFL--DEKSVPELEMAYKIWEFVYPNAAGGLESYMINPLGGGAPSLSGIGC  244

Query  447   SKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFK  268
             S++ V VAEKDELR+  +RY E+VKKSG++G +E+ +V GE HCF   NP ++ AK   +
Sbjct  245   SRVFVVVAEKDELRDSGVRYYESVKKSGFEGIVELFEVVGEGHCFHAFNPDSDNAKVLIQ  304

Query  267   RIASFIQ  247
             R+ASF+Q
Sbjct  305   RLASFLQ  311



>gb|KEH33676.1| 2-hydroxyisoflavanone dehydratase [Medicago truncatula]
Length=333

 Score =   310 bits (794),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 158/311 (51%), Positives = 206/311 (66%), Gaps = 8/311 (3%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITV--SPNISVRVYLPKLASATQKLP  979
              IR++ DG VER    P VPPS  D  TG+SSKDI +  +P IS R+YL K+ +   K P
Sbjct  23    FIRIFSDGSVERPSQSPLVPPSLNDPNTGLSSKDIEIPHNPTISSRIYLLKITNPPSKFP  82

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             ILVY+HGG F  +SAFS +YH +L I  SQANVI VS+EYRLAPE+PLP  Y DCW AL+
Sbjct  83    ILVYFHGGAFIFESAFSKLYHDHLKIFASQANVIVVSIEYRLAPEYPLPTCYHDCWAALK  142

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WV+SH+++    +   EPWL+ HGDF+K+F+GGDSAG NI HN+AI+AG E L    K+L
Sbjct  143   WVSSHSNHTNDTINNAEPWLIEHGDFDKVFIGGDSAGANIAHNIAIQAGIEKLPYDVKIL  202

Query  618   GGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
             G IL  PYF SSN  G       E ++  KVW  VYP A  GIDNP + P+ E APSL  
Sbjct  203   GAILIHPYFHSSNPIGSEPIIEPENNLFHKVWHLVYPNAPFGIDNPRVNPLGEGAPSLEK  262

Query  456   LRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             L CS++ VCVA +D LR+  + Y E VK SGW G++E  + + E H + +  P +E AK 
Sbjct  263   LGCSRIIVCVAGQDRLRDRGVWYWECVKNSGWNGKLEFFEEKDENHVYHLFKPESECAKI  322

Query  276   TFKRIASFIQD  244
               +R+ +F+Q+
Sbjct  323   LIQRLDNFVQE  333



>ref|XP_010099276.1| putative carboxylesterase 2 [Morus notabilis]
 gb|EXC44832.1| putative carboxylesterase 2 [Morus notabilis]
Length=343

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 179/316 (57%), Positives = 225/316 (71%), Gaps = 15/316 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASAT---  991
             PL+RVYKDG VER+   P VPPS  D  TGVS+KDIT+S  PNIS R+YLP L       
Sbjct  28    PLLRVYKDGSVERLLGSPVVPPSSPDPETGVSTKDITISTHPNISARIYLPNLPQTNAND  87

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
             +KLPILVY+HGGGFC++SAFS + H YLN L S+  V+AVSVEYRLAPE PLPA Y+D W
Sbjct  88    KKLPILVYFHGGGFCLESAFSFLDHRYLNRLASETGVLAVSVEYRLAPESPLPAAYDDSW  147

Query  810   EALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAG--NEPLN  637
              ALQWVA+H+  + Q +  +EPWLV+HGDF ++++GGDSAG NIVHNVA+RAG  +E L 
Sbjct  148   AALQWVANHSGLE-QVLVQQEPWLVSHGDFGRLYIGGDSAGANIVHNVALRAGTESESLP  206

Query  636   QKSKLLGGILSFPYFWSSN------EKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMA-E  478
                K+ G  L+ PYFW S       ++G E ++ + VWDF YP+A  GIDN MI P++  
Sbjct  207   CNVKIHGAFLAHPYFWGSKPIGSEPKEGFENALERLVWDFAYPSASWGIDNLMINPVSGG  266

Query  477   NAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNP  298
              APSLAGL CS++ VCVA KD LRE  + Y EAVK+SGWKGE+E+ +VE E+H F I N 
Sbjct  267   GAPSLAGLGCSRMLVCVAGKDRLRERGVWYYEAVKESGWKGEVELFEVEEEDHAFHIYNI  326

Query  297   GTEKAKDTFKRIASFI  250
              +  A    KR+ASF+
Sbjct  327   DSHNANVMIKRLASFL  342



>ref|XP_006359900.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum tuberosum]
Length=327

 Score =   307 bits (787),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 164/307 (53%), Positives = 220/307 (72%), Gaps = 8/307 (3%)
 Frame = -2

Query  1146  RVYKDGRVERICN---YPYVPPSPEDSATGVSSKDITVSPNISVRVYLPK-LASATQKLP  979
             R+YKDGRVER+ +     YVPPS ED A GVSSKD+T+S ++S R+YLPK   ++TQKLP
Sbjct  20    RIYKDGRVERLYDTIGIAYVPPSLEDPAGGVSSKDVTISSHVSARLYLPKNTNNSTQKLP  79

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             I VYYHGG   + SAF ++Y  YLN+LVS++N IA+SVEYRLAPEH +   YEDCW ALQ
Sbjct  80    IFVYYHGGALVLGSAFFNVYQRYLNVLVSKSNAIAISVEYRLAPEHDVTTIYEDCWTALQ  139

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNE-PLNQKSKL  622
             WVASHA+        ++PW+ N+GDF ++ + GDSAGGNIV+++A+RAG E  +N+K  +
Sbjct  140   WVASHANEKKFTSDNEDPWIKNYGDFSRLTIIGDSAGGNIVYHMAMRAGREGGINEKVAI  199

Query  621   LGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCSK  442
              G IL  PY     E   EQ++  K W  +   ++ G+ +PMI P+AENAPSL+ L CS+
Sbjct  200   NGSILVCPYLLVPLEN-IEQNVSYKNWIIISSPSEAGLHSPMINPLAENAPSLSQLGCSR  258

Query  441   LHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFK  268
             + +C AEKDE   +EI +R VE VKKSGWKG++E+++VE E  CF + NP TEK++D  K
Sbjct  259   MLLCFAEKDEYIPKEIGVRLVEGVKKSGWKGDLELIEVEDEGQCFQLANPETEKSQDLIK  318

Query  267   RIASFIQ  247
             R A+FIQ
Sbjct  319   RFAAFIQ  325



>ref|XP_008390965.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Malus domestica]
Length=332

 Score =   306 bits (785),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 172/319 (54%), Positives = 223/319 (70%), Gaps = 19/319 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQK-  985
             PLIR+YKD  VER+   PYVPPS  D  T VSSKDIT+S  P+IS R+YLP      Q  
Sbjct  15    PLIRIYKDSTVERLMGSPYVPPSLRDPETNVSSKDITISQNPSISARLYLPLQNQNYQPP  74

Query  984   ---LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDC  814
                +P+LVY+HGGGFC +SAFSS +H +LN LVSQA V+AVSVEYRLAPE+P+P  Y+DC
Sbjct  75    KNPIPVLVYFHGGGFCFESAFSSDHHRFLNRLVSQAQVLAVSVEYRLAPENPIPMCYQDC  134

Query  813   WEALQWVAS---HASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEP  643
             W+AL+WV+S   H  +D  +   +EPWLV +G F+K+++GGDSAGGNIVHNVA++AG E 
Sbjct  135   WDALEWVSSHKPHKESDASKAD-EEPWLVQYGTFDKLYIGGDSAGGNIVHNVAMKAGFES  193

Query  642   LNQKSKLLGGILSFPYFWSSNEKGG-------EQSILQKVWDFVYPTAKGGIDNPMIYPM  484
             L    K++G  +S PYF  S   G        E+ +  +VW F++P+A+G  DN M+   
Sbjct  194   LCGGVKIVGAFMSHPYFLGSRPIGSEPKGENFEKWLPCRVWKFLFPSARGS-DNQMVNXA  252

Query  483   AENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIM  304
              E APSLAGL CS+L VCV+EKDELR+  + Y + V+KSGW+GE EV ++EGEEH F I+
Sbjct  253   GEGAPSLAGLGCSRLLVCVSEKDELRDRGIWYYDLVRKSGWEGEXEVFEMEGEEHAFHIL  312

Query  303   NPG-TEKAKDTFKRIASFI  250
               G TE  K   KR+ASF+
Sbjct  313   CEGKTENVKIMIKRLASFL  331



>ref|XP_004247376.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum lycopersicum]
Length=327

 Score =   305 bits (782),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 161/307 (52%), Positives = 219/307 (71%), Gaps = 8/307 (3%)
 Frame = -2

Query  1146  RVYKDGRVERICN---YPYVPPSPEDSATGVSSKDITVSPNISVRVYLPK-LASATQKLP  979
             R+YK+GRVER  +     YVPPS +D    VSSKD+T+SP++S R+YLPK   ++TQKLP
Sbjct  20    RIYKNGRVERFYDNFGVTYVPPSLDDPQNNVSSKDVTISPHVSARLYLPKNTTNSTQKLP  79

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             I+VYYHGG   + SAF + YH+YLN+LVS++N IA+SVEYRLAPEH +   Y+DCW ALQ
Sbjct  80    IIVYYHGGALVLGSAFFNTYHNYLNVLVSESNAIAISVEYRLAPEHDVTTIYDDCWTALQ  139

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNE-PLNQKSKL  622
             WVASHA+        ++PW+ N+GDF ++ + GDSAGGNIV+++A+RAG E  +N+K  +
Sbjct  140   WVASHANEKKFTSDNEDPWIKNYGDFSRLSIIGDSAGGNIVYHMAMRAGREGGINEKVSI  199

Query  621   LGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCSK  442
              G I   PYF    E   EQ++  K W  +   ++ G+ +P+I P+AENAPSL+ L CS+
Sbjct  200   NGSIFVCPYFLVPIEN-IEQNVSYKNWIVISSPSESGLHSPLINPLAENAPSLSQLGCSR  258

Query  441   LHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFK  268
             + +C AEKDE   +EI +R+VE VKKSGWKG++E + VE E HC  + NP TEK++D  K
Sbjct  259   MLLCFAEKDEYIPKEIGVRFVEGVKKSGWKGDLEFIVVEDEGHCSQLNNPNTEKSQDLIK  318

Query  267   RIASFIQ  247
             R ASFIQ
Sbjct  319   RFASFIQ  325



>ref|XP_006588437.1| PREDICTED: uncharacterized protein LOC100785409 isoform X1 [Glycine 
max]
Length=677

 Score =   316 bits (810),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 174/313 (56%), Positives = 219/313 (70%), Gaps = 16/313 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLP-KLA-SATQ  988
             PL+RVY DG VER    P+VPPS  D  T VSSKDI +S  P+IS RVYLP KL  S  Q
Sbjct  369   PLLRVYNDGTVERFLGSPHVPPSLLDPETLVSSKDIVISENPSISARVYLPPKLNNSHQQ  428

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLPI VY+HGG FC++SAFS ++H YLN++ S+A V+ VSVEYRLAPE+PLPA YED WE
Sbjct  429   KLPIFVYFHGGAFCLESAFSFLHHRYLNLIASEAKVLVVSVEYRLAPENPLPAAYEDSWE  488

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ-K  631
             AL+WV SH +++       EPWLV HGDF + ++GGD+AG N+ HN  +R G E      
Sbjct  489   ALKWVTSHFNSNKS-----EPWLVEHGDFNRFYIGGDTAGANVAHNAVLRVGVESETLWG  543

Query  630   SKLLGGILSFPYFWSSNE------KGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
              K+ G +L+FP FWSS        +G E+S   +VW FVYP A GGIDNP+I P+A  AP
Sbjct  544   VKIAGVVLAFPLFWSSEPVLSEMVEGFEESSAMQVWKFVYPDAPGGIDNPLINPLASGAP  603

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
             SLA L C K+ + VA KD+LR+  + Y +AVKKSGW+G++E+V VEGEEHCF I +P TE
Sbjct  604   SLASLGCHKVLIFVAGKDDLRDRGIWYYDAVKKSGWEGDVELVRVEGEEHCFQIYHPETE  663

Query  288   KAKDTFKRIASFI  250
              +K    RIASF+
Sbjct  664   NSKGVISRIASFL  676


 Score =   305 bits (781),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 167/316 (53%), Positives = 215/316 (68%), Gaps = 20/316 (6%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN----ISVRVYLPKLA-SATQK  985
             IRV+KDG VER  ++P VPP+     TG+SSKDIT+S +    IS R+YLP +  S T+K
Sbjct  18    IRVFKDGTVERPLDFPIVPPTLN---TGLSSKDITISHHPPKPISARIYLPNITNSQTKK  74

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LPI VY+HGGGF  +SAFS +++ +   LV QAN+I VSVEYRLAPEHPLPA Y+DCW+A
Sbjct  75    LPIYVYFHGGGFFFESAFSKLFNDHFLKLVPQANIIVVSVEYRLAPEHPLPAAYDDCWDA  134

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNV-AIRAGNEPLNQKS  628
             L+WVASH++ D       E WL  HGDF ++F+GGDSAG NIVHN+ + R G EPL    
Sbjct  135   LKWVASHSTKDTTPNN-TESWLTEHGDFNRVFIGGDSAGANIVHNILSFRVGPEPLPGDV  193

Query  627   KLLGGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             ++LG IL+ PYF+ S   G       EQ+    VW  VYP+A GGIDNP I P+   APS
Sbjct  194   QILGSILAHPYFYGSEPVGSEPVTGLEQNFFNLVWKLVYPSAPGGIDNPFINPLGAGAPS  253

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCF----PIMNP  298
             LA L CS++ VCVAEKD LR+  + Y EAVKKSGWKGEI++ + + E+H +    P +N 
Sbjct  254   LAELACSRMLVCVAEKDGLRDRGVWYYEAVKKSGWKGEIQLFEEKDEDHVYHLLKPALNQ  313

Query  297   GTEKAKDTFKRIASFI  250
              + KA    K +ASF+
Sbjct  314   DSHKADALIKLMASFL  329



>ref|XP_006359901.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum tuberosum]
Length=327

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 164/307 (53%), Positives = 217/307 (71%), Gaps = 8/307 (3%)
 Frame = -2

Query  1146  RVYKDGRVERICN---YPYVPPSPEDSATGVSSKDITVSPNISVRVYLPK-LASATQKLP  979
             R+YKDGRVER  +     YVPPS ED ATGVSSKD+T+SP++S R+YLPK   ++TQKLP
Sbjct  20    RIYKDGRVERFYDTLGVAYVPPSLEDPATGVSSKDVTISPHVSARLYLPKNTNNSTQKLP  79

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             I+VYYHGG   + SAF + YH+YLN+LVS++N IA+SVEYRLAPEH +   YED W ALQ
Sbjct  80    IIVYYHGGALVLGSAFFNTYHNYLNVLVSESNAIAISVEYRLAPEHDVTTIYEDSWTALQ  139

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEP-LNQKSKL  622
             WVASHAS        ++ W+ N GDF ++ + GDSAGGNIV+++A+RAG E  +N+K  +
Sbjct  140   WVASHASEKKFTSDNEDQWIKNFGDFSRLSIIGDSAGGNIVYHMAMRAGREDGINEKVAI  199

Query  621   LGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCSK  442
              G IL  PYF    E   E S   K W  +   ++ G+ +P+I P+AENAPSL+ L CS+
Sbjct  200   NGSILVCPYFLVPIENIKE-SGAYKNWIIISSPSEAGLHSPLINPLAENAPSLSQLGCSR  258

Query  441   LHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFK  268
             + +C  +KD    +EI +R+VE VKKSGWKG++E + VE E HCF + NP TEK++D  K
Sbjct  259   MLLCFTDKDVYISKEIGIRFVEGVKKSGWKGDLEFIVVEDEVHCFQLNNPNTEKSQDLIK  318

Query  267   RIASFIQ  247
             R ASFI+
Sbjct  319   RFASFIR  325



>gb|KHN02697.1| Putative carboxylesterase 1 [Glycine soja]
Length=331

 Score =   305 bits (780),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 167/316 (53%), Positives = 215/316 (68%), Gaps = 20/316 (6%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN----ISVRVYLPKLA-SATQK  985
             IRV+KDG VER  ++P VPP+     TG+SSKDIT+S +    IS R+YLP +  S T+K
Sbjct  18    IRVFKDGTVERPLDFPIVPPTLN---TGLSSKDITISHHPPKPISARIYLPNITNSQTKK  74

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LPI VY+HGGGF  +SAFS +++ +   LV QAN+I VSVEYRLAPEHPLPA Y+DCW+A
Sbjct  75    LPIYVYFHGGGFFFESAFSKLFNDHFLKLVPQANIIVVSVEYRLAPEHPLPAAYDDCWDA  134

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNV-AIRAGNEPLNQKS  628
             L+WVASH++ D       E WL  HGDF ++F+GGDSAG NIVHN+ + R G EPL    
Sbjct  135   LKWVASHSTKDTTPNN-TESWLTEHGDFNRVFIGGDSAGANIVHNILSFRVGPEPLPGDV  193

Query  627   KLLGGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             ++LG IL+ PYF+ S   G       EQ+    VW  VYP+A GGIDNP I P+   APS
Sbjct  194   QILGSILAHPYFYGSEPVGSEPVTGLEQNFFNLVWKLVYPSAPGGIDNPFINPLGAGAPS  253

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCF----PIMNP  298
             LA L CS++ VCVAEKD LR+  + Y EAVKKSGWKGEI++ + + E+H +    P +N 
Sbjct  254   LAELACSRMLVCVAEKDGLRDRGVWYYEAVKKSGWKGEIQLFEEKDEDHVYHLLKPALNQ  313

Query  297   GTEKAKDTFKRIASFI  250
              + KA    K +ASF+
Sbjct  314   DSHKADALIKLMASFL  329



>ref|XP_007143223.1| hypothetical protein PHAVU_007G054400g [Phaseolus vulgaris]
 gb|ESW15217.1| hypothetical protein PHAVU_007G054400g [Phaseolus vulgaris]
Length=354

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 209/316 (66%), Gaps = 16/316 (5%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN----ISVRVYLPKLA-SATQK  985
             IRV+ DG VER  ++P VPP+  DS TGV SKDI +S N    IS R+YLP +  S TQK
Sbjct  37    IRVFSDGTVERPRDFPIVPPTLRDSNTGVCSKDIAISNNPPEPISARIYLPNITDSQTQK  96

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LPI VY+HGG F  +S FS +Y  +L  L S A V+ VSVEYRLAP HPLPAGY+DCWEA
Sbjct  97    LPIYVYFHGGAFFFESTFSKLYDDHLRKLASDAKVLVVSVEYRLAPAHPLPAGYDDCWEA  156

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNV-AIRAGNEPLNQKS  628
             L+WVASH+ +        EPWL++H DF ++F+GGDSAG NIVHN+ A R G +PL    
Sbjct  157   LKWVASHSDSAKYPTHNTEPWLIHHADFNRLFIGGDSAGANIVHNILAFRFGPQPLPGDV  216

Query  627   KLLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             K+LG +L+ PYF+SS   G E      Q++  +VW+  YP+  GG+D+P I P+A  AP 
Sbjct  217   KILGAVLAHPYFYSSEPVGSEPVTVLDQNLYNQVWNLAYPSVPGGLDHPFINPLAPQAPD  276

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCF----PIMNP  298
             LA L CS++ VCVAEKD L E  + Y EAVKKSGW+G+I++   + E+H +    P +N 
Sbjct  277   LAQLACSRIFVCVAEKDGLCERGVWYYEAVKKSGWQGQIQLFHQKDEDHIYHLLKPSLNQ  336

Query  297   GTEKAKDTFKRIASFI  250
              T  A      +ASF+
Sbjct  337   DTRNANKLINLMASFL  352



>ref|XP_006359931.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum tuberosum]
Length=327

 Score =   301 bits (772),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 168/313 (54%), Positives = 219/313 (70%), Gaps = 11/313 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERI---CNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASAT--  991
             P+ R+YK+GRVER     N  YVPPS ED ATGVSSKDIT+S ++S R+YLPK  + T  
Sbjct  14    PVFRLYKNGRVERFNENFNMFYVPPSLEDPATGVSSKDITISSHVSARLYLPKNTNVTCN  73

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
             +KLP+LV+YHGGG  + SAF +  H++LN LVS++N I VSVEYRLAPE+ L   YEDCW
Sbjct  74    EKLPVLVFYHGGGLVLGSAFFNEVHYFLNHLVSKSNAICVSVEYRLAPENDLSILYEDCW  133

Query  810   EALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
               LQWVASH  N+G     K+ WL +  DF ++F+GG+SAGGNI +++A+RAG E LN  
Sbjct  134   TGLQWVASH-HNNGSSNTSKDSWLTSCADFNRVFIGGESAGGNIAYHMAMRAGKESLNGD  192

Query  630   SKLLGGILSFPYFWSSNEK-GGEQSILQKVWDFVYPTA--KGGIDNPMIYPMAENAPSLA  460
              K++G IL+ P+F   ++    E ++  +VW  +         ID+PMI P+AE APSL+
Sbjct  193   VKIMGCILACPFFLMQDDSLDMENNLAYQVWITICQMEYRYSPIDSPMINPLAEKAPSLS  252

Query  459   GLRCSKLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
              L CS+L + +AEKD L  REI +R+VE VKKSGW GE+E ++VEGEEHCF + NP  EK
Sbjct  253   SLGCSRLFMVIAEKDVLVPREIMIRFVEGVKKSGWNGELEFLEVEGEEHCFFVKNPQVEK  312

Query  285   AKDTFKRIASFIQ  247
             AKD  KR AS IQ
Sbjct  313   AKDVIKRFASLIQ  325



>ref|XP_003610685.1| Neutral cholesterol ester hydrolase [Medicago truncatula]
 gb|AES93643.1| 2-hydroxyisoflavanone dehydratase [Medicago truncatula]
Length=332

 Score =   301 bits (771),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 216/317 (68%), Gaps = 18/317 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASAT---  991
             P + VY DG ++R+ N+P VPP  ED  TGVSSKDI  S  P ++ R+YLPKL       
Sbjct  19    PHLVVYNDGTIDRLRNFPIVPPQQEDPKTGVSSKDIVFSNDPYLTARLYLPKLTQTNDQN  78

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
             QKL ILVY++GG F  +SA+SSI+H Y N+L SQAN++  S+E+R APEH LPAGY DCW
Sbjct  79    QKLSILVYFYGGAFSFESAYSSIHHAYCNLLASQANILIASIEHRNAPEHYLPAGYNDCW  138

Query  810   EALQWVASHASNDGQQVPLK-EPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             + L WVASHA+    Q P+  +PW++NHG+F ++F+GGDS+GGN+ HNVA+RAG E L  
Sbjct  139   DGLYWVASHAT----QNPINSDPWIINHGNFNRVFIGGDSSGGNLCHNVAMRAGVEDLPG  194

Query  633   KSKLLGGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENA  472
               K+ G  L+ PYFW +   G       E+++  ++W F YP+A GG+DNPMI P+A  A
Sbjct  195   GVKVFGAYLNHPYFWGAKPIGEEPVIGFEETLQSRIWKFAYPSAPGGLDNPMINPLASGA  254

Query  471   PSLAGLRCSKLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNP  298
             PSLA L CS++ +  A KD+L  R+ S RY EAVKKSGWKGE+E  + + E+H + + + 
Sbjct  255   PSLATLGCSRMLITAAGKDQLLFRDRSERYFEAVKKSGWKGEVEFFEEKDEDHVYYMYDL  314

Query  297   GTEKAKDTFKRIASFIQ  247
              T+++K   K +  F++
Sbjct  315   ETDQSKRFIKVLVDFLR  331



>ref|XP_009619342.1| PREDICTED: uncharacterized protein LOC104111364 [Nicotiana tomentosiformis]
Length=639

 Score =   310 bits (795),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 170/315 (54%), Positives = 219/315 (70%), Gaps = 13/315 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERI---CNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASAT--  991
             P  R+YK+GRVER     N  YVPPSPED ATGVSSKDIT+S ++SVR+YLPK  + T  
Sbjct  14    PTFRLYKNGRVERFYEQFNVFYVPPSPEDPATGVSSKDITISSHVSVRLYLPKNTNITVN  73

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
             +KLPILV+YHGGG  V SAF +  H +LN LVS++N I VSVEYRLAPE+ L   Y+DCW
Sbjct  74    EKLPILVFYHGGGLVVGSAFFNKMHRFLNYLVSESNAIGVSVEYRLAPENDLTTLYQDCW  133

Query  810   EALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
              ALQWVASH+ ND      K+ WL  + D +++F+ GDSAGGNIV+++A+RAG E LN  
Sbjct  134   TALQWVASHSENDNFTHTSKDSWLTTYADLKRVFIAGDSAGGNIVYHMAMRAGRESLNGD  193

Query  630   SKLLGGILSFPYFWSSNEKGGEQ-SILQKVWDFVYPTAKGGI-----DNPMIYPMAENAP  469
              ++LG IL+ PYF    +    Q +    +W  + P  + G+     D+PMI P+AE AP
Sbjct  194   VEILGSILACPYFMIPVDNVNLQDNDAYNLWMTICPKLESGLSATATDSPMINPLAEKAP  253

Query  468   SLAGLRCSKLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPG  295
             SL+GL CSKL + +AEKD L  REI +++VE VKKSGW GE+   +VEGE+HCF I +P 
Sbjct  254   SLSGLGCSKLFMGIAEKDVLVPREIMVKFVEGVKKSGWNGELTFFEVEGEDHCFFIEDPE  313

Query  294   TEKAKDTFKRIASFI  250
             TEKAKD  +R  SF+
Sbjct  314   TEKAKDLIQRFXSFL  328



>ref|XP_009616956.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Nicotiana 
tomentosiformis]
Length=324

 Score =   299 bits (765),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 207/310 (67%), Gaps = 11/310 (4%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYP---YVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLP  979
              RVYK GRVER  N P   YVPPSPE+ + GV SKD+T+SP++S R+YLP+  +A QKLP
Sbjct  16    FRVYKSGRVERPYNVPGAFYVPPSPENPSAGVFSKDVTISPHVSTRLYLPENTTAGQKLP  75

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             +LVYYHGGG  V+SAF +  H Y+N L S+ NVIAVS+EYRLAPE  +P  YEDCW ALQ
Sbjct  76    VLVYYHGGGLVVESAFFNGIHCYVNSLSSELNVIAVSIEYRLAPEVDVPTIYEDCWTALQ  135

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WVASHA  D   V  K+ WL NHGDF ++F+ GDSAGGN+V+++ + AG E LN + K+ 
Sbjct  136   WVASHA-EDKSTVVNKDSWLTNHGDFSRVFLAGDSAGGNLVYHMTMMAGKESLNNEVKIT  194

Query  618   GGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGG----IDNPMIYPMAENAPSLAGLR  451
             G I ++PYF   N    E+ +  K+W  + P  + G    I++P+I P++E APSL+GL 
Sbjct  195   GSIFAYPYFLFPNIDIDEEGLANKIWVNICPPLESGLVSPIESPLINPLSEKAPSLSGLG  254

Query  450   CSKLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             CS++ VC+ +KD++    I +R+VE VK+SGW+          E H F I  P TE+AK 
Sbjct  255   CSRILVCMGKKDDIIPLRIGVRFVEGVKESGWE-GELEYLEVDEAHAFQIYKPETEEAKL  313

Query  276   TFKRIASFIQ  247
                R A F+ 
Sbjct  314   MMSRYADFVH  323



>ref|XP_004511449.1| PREDICTED: probable carboxylesterase 4-like [Cicer arietinum]
Length=329

 Score =   297 bits (760),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/312 (48%), Positives = 203/312 (65%), Gaps = 10/312 (3%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKLP  979
              I VY DG +ER+ + P VPPSP D  T VSSKDI  S  P+   R+YLPKL    QK+P
Sbjct  17    FINVYSDGTIERLDDKPKVPPSPLDPQTCVSSKDIFFSNDPSFKARLYLPKLTQNNQKIP  76

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             ILVY+HGG FC +S F+S +H Y N++ SQ  V+  S+EYR APEH +P  Y+DCW  L+
Sbjct  77    ILVYFHGGAFCCESPFASHHHKYCNVVASQGKVLIFSIEYRRAPEHFIPTQYDDCWVGLK  136

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WVAS  +N+ +     +PW++NHGDF ++F+GGDS+GGNIVHN+AIRAG E L    K+ 
Sbjct  137   WVASQNNNETKDPTNCDPWIINHGDFNRVFIGGDSSGGNIVHNIAIRAGAEELPCGVKIF  196

Query  618   GGILSFPYFWSSNEKGGEQ--------SILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             G  ++ P+FW S   G E+             +W+FVYP A GGIDNPM+ P+   AP+L
Sbjct  197   GAYMNHPFFWGSKPIGFEKVEEFEKISEFANLLWNFVYPNAPGGIDNPMVNPLDPKAPNL  256

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             A L CSK+ + V  KD  R  ++ Y EAVK+S WKGE+E+ + E E+HC+ + +  +EK 
Sbjct  257   ATLGCSKMLITVGGKDRFRNRTVLYYEAVKQSEWKGEVELFEDEDEDHCYYMFDLDSEKG  316

Query  282   KDTFKRIASFIQ  247
             K   K +A F+ 
Sbjct  317   KIFIKILADFLH  328



>ref|XP_009627861.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Nicotiana 
tomentosiformis]
Length=317

 Score =   295 bits (756),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 167/312 (54%), Positives = 215/312 (69%), Gaps = 19/312 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVER---ICNYPYVPPSP-EDSATGVSSKDITVSPNISVRVYLPKLASAT-  991
             P IRVYK+GRVER   + N  YVPPSP +D  TGVSSKDIT+S ++S R+YLPK  +++ 
Sbjct  14    PHIRVYKNGRVERFYHLHNLFYVPPSPDQDPDTGVSSKDITISSHVSARLYLPKNTNSSD  73

Query  990   -QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDC  814
              +KLPI+V+YHGGG  ++SAF +++H +LN+LVS++N IAVSVEYRLAPEH +   YED 
Sbjct  74    QKKLPIIVFYHGGGLILNSAFFNVFHRFLNLLVSESNSIAVSVEYRLAPEHDVTTVYEDS  133

Query  813   WEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             W ALQWVAS           K+ WL N+GDF KIF+ G+S G NIV N+ +RAG E LN 
Sbjct  134   WTALQWVASG----------KDLWLTNYGDFNKIFIVGESGGANIVFNMVMRAGREKLNG  183

Query  633   KSKLLGGILSFPYFWSSNEKGGEQSIL-QKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
               K+ G IL+ PYF    E    ++++  K+W  V       +D PMI P+ + APSL+G
Sbjct  184   DVKICGSILACPYFVIPYENVDVKNLMVYKLWTNVICPKLEPLDCPMINPLCKMAPSLSG  243

Query  456   LRCSKLHVCVAEKDELR--EISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             L CSKL VC+AEKDEL   E+ +R+VE VKKSGW GE     VEGE H F I++P TEKA
Sbjct  244   LGCSKLFVCLAEKDELAPGEMEMRFVEGVKKSGWNGEFVFFVVEGEGHSFFILDPETEKA  303

Query  282   KDTFKRIASFIQ  247
             +D  KR A+FIQ
Sbjct  304   RDLIKRFANFIQ  315



>ref|XP_004511348.1| PREDICTED: probable carboxylesterase 12-like [Cicer arietinum]
Length=329

 Score =   293 bits (751),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 154/313 (49%), Positives = 205/313 (65%), Gaps = 13/313 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKL  982
             PL+ VY DG ++R      VPP  ED  TGVSSKDI  S  P ++ R+YLPKL  + +KL
Sbjct  19    PLVAVYSDGTIDRPNECSTVPPQEEDPKTGVSSKDIVFSKDPYLTARLYLPKLTQSNEKL  78

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             PILVYY+GG F  +SAFS I+H Y N + SQA V+  S+E+R APEH LP  Y DCW  L
Sbjct  79    PILVYYYGGAFSFESAFSDIHHSYCNRIASQAKVVIASIEHRNAPEHYLPTAYNDCWAGL  138

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
              WVA+HA+   Q     +PW+ NHGDF ++F+GGDS+GGN+VHNVA+RAG E L    KL
Sbjct  139   CWVATHAT---QNPTNSDPWITNHGDFNRVFIGGDSSGGNLVHNVAMRAGVEALPGGVKL  195

Query  621   LGGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              G  L+  YFW S   G       E+++  ++W F YP+A GG+DNPM+ P+A  APSLA
Sbjct  196   FGAYLNHAYFWGSKPIGKEPVIGFEETLQSRIWKFAYPSAPGGLDNPMLNPLAPGAPSLA  255

Query  459   GLRCSKLHVCVAEKDE--LREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
              L CS++ V VA  D+    E   RY EAVK+SGWKGE+E+ + +GE H + + +  +E+
Sbjct  256   TLGCSRMLVTVAGNDQYLFNEREKRYYEAVKQSGWKGEVELFEEKGEIHVYYMYDSESEQ  315

Query  285   AKDTFKRIASFIQ  247
             AK  FK +  F++
Sbjct  316   AKRIFKLLVDFLK  328



>ref|XP_004496760.1| PREDICTED: probable carboxylesterase 4-like [Cicer arietinum]
Length=327

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 163/310 (53%), Positives = 212/310 (68%), Gaps = 11/310 (4%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKLPI  976
             I V+ DG VER    P VPP  +D  + VSSKDI +S  PNIS R+YLP   + T KLPI
Sbjct  21    ITVFSDGTVERPRQAPIVPPVLDDPNSQVSSKDIIISHNPNISARLYLPN--THTHKLPI  78

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LV++HGGGF  +SAFS +YH + NI   + N I VSVEYRLAPEH LPA Y DCW+AL+W
Sbjct  79    LVFFHGGGFFFESAFSKLYHEHFNIFAPKTNSIVVSVEYRLAPEHSLPACYHDCWDALKW  138

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
             VAS++S D + +  +EPWL+NHGDF ++F+GGDSAGGNIVHN+ +RAG EPL    K+LG
Sbjct  139   VASNSSLDQKPIN-EEPWLINHGDFNRVFIGGDSAGGNIVHNIVMRAGIEPLPYDVKILG  197

Query  615   GILSFPYFWSS------NEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGL  454
              IL  PYF+SS        K  E+ +   VW  VYP+A GGIDNPM+ P+   APSL G+
Sbjct  198   AILQHPYFYSSYPVGLETVKSPEEDLCYLVWKLVYPSAPGGIDNPMVNPVGPGAPSLDGI  257

Query  453   RCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDT  274
              C ++ VCVA +D LRE  + Y E VKKSGW G++E+ + + E+H + I +P +E     
Sbjct  258   GCCRMIVCVAGEDGLRERGVWYYELVKKSGWNGKLELFEQQDEDHVYHIFHPESENGMKL  317

Query  273   FKRIASFIQD  244
              KR+ASF+ +
Sbjct  318   IKRLASFLHE  327



>ref|XP_003516761.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Glycine max]
Length=333

 Score =   291 bits (746),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 207/316 (66%), Gaps = 15/316 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASA--TQ  988
             P I VY DG +ER  N P  PPS ED ATGV+SKDI  S N  +  R++LPKL +    Q
Sbjct  21    PYIYVYNDGSLERPINIPRTPPSLEDPATGVASKDILFSKNPFLFARLFLPKLTTPPPNQ  80

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             K+PILVY HGG FC +SAF++ +  Y N++ SQANVI VSVE+R APEH LPA Y D W 
Sbjct  81    KIPILVYSHGGAFCFESAFAAHHTKYCNLIASQANVIIVSVEHRKAPEHFLPAAYNDSWA  140

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             AL+WVASH+          + WL+NHGDF KIF+GGDS+G NIVHN+A+RAG E L    
Sbjct  141   ALKWVASHSHATNSN---SDTWLINHGDFSKIFIGGDSSGANIVHNLAMRAGVEALPGGV  197

Query  627   KLLGGILSFPYFWSSNEKGGEQSI------LQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             K+ G  L+ PYFW S   G E  I         +W+F YP A GG+DNPMI P+A  APS
Sbjct  198   KVYGAYLNHPYFWGSKPIGSEAVIGFEETPQSLIWNFAYPDAPGGLDNPMINPLAPGAPS  257

Query  465   LAGLRCSKLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
             LA L CSK+ + VA KD L  R+ +L Y +AVK+SGWKG++E+ + E E+H + + N  T
Sbjct  258   LAQLGCSKMLLTVAGKDHLLFRDRTLLYYKAVKESGWKGQVELFEEEQEDHVYHMFNMET  317

Query  291   EKAKDTFKRIASFIQD  244
              +AK     +A+F++ 
Sbjct  318   HQAKRLITIVANFLRQ  333



>gb|AES62689.2| 2-hydroxyisoflavanone dehydratase [Medicago truncatula]
Length=324

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 167/312 (54%), Positives = 214/312 (69%), Gaps = 17/312 (5%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKLPI  976
             I VY DG V+R    P VPP+P+   +   SKDI +S  PNIS R+YLPK  + T KLPI
Sbjct  20    ITVYSDGTVDRPRQAPTVPPNPDHPNS--PSKDIIISQNPNISARIYLPK--NPTTKLPI  75

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LV++HGGGF  +SAFS +YH + N+ V QAN I VSVEYRLAPEHPLPA Y DCW +LQW
Sbjct  76    LVFFHGGGFFFESAFSKLYHEHFNVFVPQANSIVVSVEYRLAPEHPLPACYNDCWNSLQW  135

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
             VAS+++ +       E WL+NHGDF ++F+GGDSAGGNIVHN+A+RAG+E L    KLLG
Sbjct  136   VASNSAPNPVN---PESWLINHGDFNRVFIGGDSAGGNIVHNIAMRAGSEALPNGVKLLG  192

Query  615   GILSFPYFWSSNEKGGEQSILQ--------KVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              IL  PYF+SS   G E   L+         VW+FVYP+A GGIDNPMI P+   APSL 
Sbjct  193   AILQQPYFYSSYPVGLESVKLKSSDKDFHYSVWNFVYPSAPGGIDNPMINPVGIGAPSLD  252

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
             GL C ++ +CVA KD +RE  + Y E VKKSGWKG++E+ + E E+H + I +P +E  +
Sbjct  253   GLGCDRIIICVAGKDGIRERGVWYYELVKKSGWKGKLELFEEEDEDHVYHIFHPESESGQ  312

Query  279   DTFKRIASFIQD  244
                K +ASF+ +
Sbjct  313   KLIKHLASFLHE  324



>ref|XP_006359899.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum tuberosum]
Length=328

 Score =   291 bits (744),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 216/309 (70%), Gaps = 10/309 (3%)
 Frame = -2

Query  1146  RVYKDGRVERICN-----YPYVPPSPEDSATGVSSKDITVSPNISVRVYLPK-LASATQK  985
             R+YKDGRVER          YVPPS +D    VSSKD+ +SP++S R+YLPK   ++TQK
Sbjct  20    RIYKDGRVERYIYKKSNLSTYVPPSLDDPQNNVSSKDVIISPHVSARLYLPKNTTNSTQK  79

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LPI+VYYHGG   + SAF   YH+YLN+LVS++N IA+SVEYRLAPEH +   YED W A
Sbjct  80    LPIIVYYHGGALALGSAFFKSYHNYLNVLVSESNAIAISVEYRLAPEHDVTTIYEDSWTA  139

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNE-PLNQKS  628
             LQWVASHA+        ++ W+ N+GDF ++ + GDSAGGNIV+++ +RAG E  +N+K 
Sbjct  140   LQWVASHANEKKFTSDNEDQWIKNYGDFNRLSIIGDSAGGNIVYHMTMRAGKEGGINEKV  199

Query  627   KLLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRC  448
              + G IL  PYF    E   E+S   K W  +   ++ G+ +P+I P+AENAP+L+ L C
Sbjct  200   TINGSILVCPYFVIPIE-NIEESASYKNWIIISSPSEAGLHSPLINPLAENAPNLSQLGC  258

Query  447   SKLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDT  274
             S++ +C  EKDE   +EI +R+V+ VKKSGWKG++E+++VEGE HCF + NP +EK+++ 
Sbjct  259   SRMLLCFTEKDEFISKEIGIRFVKGVKKSGWKGDLELIEVEGEGHCFQLANPESEKSQEL  318

Query  273   FKRIASFIQ  247
              KR A+FIQ
Sbjct  319   IKRFAAFIQ  327



>ref|XP_007017298.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY14523.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=326

 Score =   290 bits (742),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 158/309 (51%), Positives = 209/309 (68%), Gaps = 16/309 (5%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKLP  979
             +IRVYKDG VER+    +VPPS  D  TG SSKDIT+ P  N+S R++LPKL S  QKLP
Sbjct  16    IIRVYKDGHVERLIETGFVPPS-TDPQTGGSSKDITMIPESNVSARLFLPKLTSPHQKLP  74

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             +LVY+HGG FCV S F+  Y+ YLN LV++ANVIAVSV YR APEHP+P  YED W ALQ
Sbjct  75    LLVYFHGGAFCVSSPFTPKYNSYLNALVAEANVIAVSVNYRKAPEHPIPTAYEDSWAALQ  134

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WV SH ++ G      E WL +H DF+++F+GG+SAG NI HN+AI AGN       +L 
Sbjct  135   WVVSHCNSKG-----PEAWLNDHADFQRVFLGGESAGANIAHNLAIIAGNPEFGLNVQLR  189

Query  618   GGILSFPYFWSSNEKG-------GEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
             G  L  P+FW S+  G       G++S+L +VW F+ P+     D P   P+A +APSL 
Sbjct  190   GIALVHPFFWGSDPIGSEALMDPGKKSVLDRVWPFICPSNPDNND-PRFNPVAMDAPSLV  248

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
             GL C+++ VCVAEKD +R+    Y EA+ +SGW G +E+++ EGE+H F + +  +EKAK
Sbjct  249   GLGCTRVLVCVAEKDGVRDRGRLYFEALGRSGWMGVVEIMETEGEDHGFHLSDLESEKAK  308

Query  279   DTFKRIASF  253
             D  KR+A+F
Sbjct  309   DLIKRLAAF  317



>gb|KHN30463.1| Putative carboxylesterase 2 [Glycine soja]
Length=333

 Score =   290 bits (743),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 160/315 (51%), Positives = 207/315 (66%), Gaps = 15/315 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASA--TQ  988
             P I VY DG +ER  + P  PPS ED ATGV+SKDI  S N  +  R++LPKL +    Q
Sbjct  21    PYIYVYNDGSIERPIDIPRTPPSLEDPATGVASKDILFSKNPFLFARLFLPKLTTPPPNQ  80

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             K+PILVY HGG FC +SAF++ +  Y N++ SQANVI VSVE+R APEH LPA Y D W 
Sbjct  81    KIPILVYSHGGAFCFESAFAAHHTKYCNLIASQANVIIVSVEHRKAPEHFLPAAYNDSWA  140

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             AL+WVASH+          + WL+NHGDF KIF+GGDS+G NIVHN+A+RAG E L    
Sbjct  141   ALKWVASHSHATNSN---SDTWLINHGDFSKIFIGGDSSGANIVHNLAMRAGVEALPGGV  197

Query  627   KLLGGILSFPYFWSSNEKGGEQSI------LQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             K+ G  L+ PYFW S   G E  I         +W+F YP A GG+DNPMI P+A  APS
Sbjct  198   KVYGAYLNHPYFWGSKPIGSEAVIGFEETPQSLIWNFAYPDAPGGLDNPMINPLAPGAPS  257

Query  465   LAGLRCSKLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
             LA L CSK+ + VA KD L  R+ +L Y +AVK+SGWKG++E+ + E E+H + + N  T
Sbjct  258   LAQLGCSKMLLTVAGKDHLLFRDRTLLYYKAVKESGWKGQVELFEEEQEDHVYHMFNMET  317

Query  291   EKAKDTFKRIASFIQ  247
              +AK     +A+F++
Sbjct  318   HQAKRLITIVANFLR  332



>gb|AFK46020.1| unknown [Medicago truncatula]
Length=324

 Score =   289 bits (740),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 165/312 (53%), Positives = 212/312 (68%), Gaps = 17/312 (5%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKLPI  976
             I VY DG V+R    P VPP+P+   +   SKDI +S  PNIS R+YLPK  + T KLPI
Sbjct  20    ITVYSDGTVDRPRQAPTVPPNPDHPNS--PSKDIIISQNPNISARIYLPK--NPTTKLPI  75

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LV++ GGGF  +SAFS +YH + N+   QAN I VSVEYRLAPEHPLPA Y DCW +LQW
Sbjct  76    LVFFPGGGFFFESAFSKLYHEHFNVFAPQANSIVVSVEYRLAPEHPLPACYNDCWNSLQW  135

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
             VAS+++ +       E WL+NHGDF ++F+GGDSAGGNIVHN+A+RAG+E L    KLLG
Sbjct  136   VASNSAPNPVN---PESWLINHGDFNRVFIGGDSAGGNIVHNIAMRAGSEALPNGVKLLG  192

Query  615   GILSFPYFWSSNEKGGEQSILQ--------KVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              IL  PYF+SS   G E   L+         VW+FVYP+A GGIDNPMI P+   APSL 
Sbjct  193   AILQQPYFYSSYPVGLESVKLKSSDKDFHYSVWNFVYPSAPGGIDNPMINPVGIGAPSLD  252

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
             GL C ++ +CVA KD +RE  + Y E VKKSGWKG++E+ + E E+H + I +P +E  +
Sbjct  253   GLGCGRIIICVAGKDGIRERGVWYYELVKKSGWKGKLELFEEEDEDHVYHIFHPESESGQ  312

Query  279   DTFKRIASFIQD  244
                K +ASF+ +
Sbjct  313   KLIKHLASFLHE  324



>ref|XP_003627985.1| Hormone-sensitive lipase [Medicago truncatula]
 gb|AET02461.1| 2-hydroxyisoflavanone dehydratase [Medicago truncatula]
Length=330

 Score =   289 bits (739),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 152/311 (49%), Positives = 204/311 (66%), Gaps = 11/311 (4%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITV--SPNISVRVYLPKLASATQKLP  979
             ++R++ DG +ER    P+ PPS  D  TG+SSKDI +  +P IS R+YLPK+ +   K P
Sbjct  23    ILRIFSDGSIERPKQSPFAPPSLNDPNTGISSKDIQIPHNPTISSRIYLPKITNPLSKFP  82

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             ILVY+HGG F  +S FS  YH +L    SQANVI VS+EY LAPE+PLP  Y DCW AL+
Sbjct  83    ILVYFHGGVFMFESTFSKKYHEHLKTFASQANVIIVSIEYSLAPEYPLPTCYHDCWAALK  142

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             W++SH++N+       EPWL+ HG+F K+F+GGDSAG NI HN+AI+AG E L    K+L
Sbjct  143   WISSHSNNNINN---PEPWLIEHGNFNKLFIGGDSAGANIAHNIAIQAGLENLPCDVKIL  199

Query  618   GGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
             G I+  PYF+S+N  G       E +I+   W F YP A  GIDNP   P+ E APSL  
Sbjct  200   GAIIIHPYFYSANPIGSEPIIEPENNIIHTFWHFAYPNAPFGIDNPRFNPLGEGAPSLEK  259

Query  456   LRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             L CS++ VCVA KD+LRE  + Y E VK SGWKG++E  + + E H + ++ P +E AK 
Sbjct  260   LGCSRIIVCVAGKDKLRERGVWYWEGVKNSGWKGKLEFFEEKDEGHVYQLVKPESESAKI  319

Query  276   TFKRIASFIQD  244
               +R+  F+Q+
Sbjct  320   FIQRLVGFVQE  330



>ref|XP_008805243.1| PREDICTED: probable carboxylesterase 2 [Phoenix dactylifera]
Length=318

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 209/317 (66%), Gaps = 28/317 (9%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASA--TQ  988
             P IR YKDGRVER+    +VPPS  D  +G++SKD+ +    N+S R+YLP LAS   +Q
Sbjct  14    PFIRTYKDGRVERLLPTDFVPPS-LDPTSGLTSKDVMIDRETNVSARLYLPDLASLHPSQ  72

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLPILVY+HGGGFC+ S F + YH++LN LV++ANV+AVSV+YRLAPE+P+PA YED W 
Sbjct  73    KLPILVYFHGGGFCIGSPFWTQYHNHLNSLVTRANVVAVSVDYRLAPENPIPAAYEDSWR  132

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             ALQWV SH+   G      EPWL  HGDF ++F+ GDSAG NIVHN+ + A       K+
Sbjct  133   ALQWVVSHSEGAG-----PEPWLAEHGDFSRVFLAGDSAGANIVHNIVMGA-------KA  180

Query  627   KLLGGILSFPYFWSSNEKGGEQSILQK----------VWDFVYPTAKGGIDNPMIYPMAE  478
             ++ G +L  P+FW S   G E++   K          +W  V P A G  D+P + PMA+
Sbjct  181   RIEGVVLLHPFFWGSERMGCEKNRDDKPLLDPVTTDLMWSLVCPGAAGS-DDPRLNPMAK  239

Query  477   NAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNP  298
              APSLAGL C ++ V VAE+D LR+    Y EA+K SGW G +E+ + +GE+H F +  P
Sbjct  240   GAPSLAGLGCGRVLVVVAERDLLRDRGRAYYEALKGSGWGGMVELFETKGEDHVFHLFEP  299

Query  297   GTEKAKDTFKRIASFIQ  247
               EKA + F+R+A FI+
Sbjct  300   ACEKALELFQRLAGFIR  316



>ref|XP_003610683.1| Arylacetamide deacetylase [Medicago truncatula]
 gb|AES93641.1| 2-hydroxyisoflavanone dehydratase [Medicago truncatula]
Length=328

 Score =   286 bits (733),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 200/312 (64%), Gaps = 10/312 (3%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKLP  979
              I VY DG +ER+ + P V PSP+D  T VSSKDI  S  P++  R+YLPKL    QK+P
Sbjct  16    FIHVYNDGTIERLNDMPKVTPSPQDLETNVSSKDILFSNEPSLFARLYLPKLTDQNQKIP  75

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             ILVY+HGG FC +S F+S +H Y NI+ SQ NV+  S+EYR APEH LP  Y DCW+ L 
Sbjct  76    ILVYFHGGAFCCESTFASHHHKYCNIIASQGNVLIFSIEYRKAPEHFLPTQYNDCWDGLN  135

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WVASH +         +PW++NHGDF K+F+GGDS+G NIVHN+A+RAG   +    K+ 
Sbjct  136   WVASHNTTIENVPENSDPWIINHGDFNKVFIGGDSSGANIVHNIAMRAGVTRIPNGVKIF  195

Query  618   GGILSFPYFWSSNEKGGEQ-SILQKV-------WDFVYPTAKGGIDNPMIYPMAENAPSL  463
             G  ++  +FW S   G E+    +KV       W FVYP A  GID+P + P+   +P+L
Sbjct  196   GAYMNHTFFWGSKPLGFEKVEKFEKVNEFATLLWKFVYPRAPFGIDDPNVNPLGPMSPNL  255

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             A L CSK+ V VA KD  R+ ++ Y EAVK+S W GE+E  + E E+HC+ +++P ++K 
Sbjct  256   ALLGCSKMLVTVAGKDRFRDRAVLYYEAVKRSHWNGEVEFFEEEDEDHCYYMVHPESDKG  315

Query  282   KDTFKRIASFIQ  247
             K   K +A F+ 
Sbjct  316   KKLIKVVADFLH  327



>gb|KHN35189.1| Putative carboxylesterase 2 [Glycine soja]
Length=289

 Score =   285 bits (728),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 148/287 (52%), Positives = 192/287 (67%), Gaps = 14/287 (5%)
 Frame = -2

Query  1086  PEDSATGVSSKDITVS--PNISVRVYLPKLASATQKLPILVYYHGGGFCVDSAFSSIYHH  913
             PED  TGVSSKDI ++  P +S R++LPK      KLPI +Y+HGG FCV+SAFS   H 
Sbjct  8     PEDPQTGVSSKDIVIADNPYVSARIFLPKSHHTNNKLPIFLYFHGGAFCVESAFSFFVHR  67

Query  912   YLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQWVASHASNDGQQVPLKEPWLVN  733
             YLNIL S+AN+IA+SV++RL P HP+PA Y+D W  LQW+ASHA+N     P  EPWL+N
Sbjct  68    YLNILASEANIIAISVDFRLLPHHPIPAAYQDGWTTLQWIASHANNTNNTNP--EPWLLN  125

Query  732   HGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLGGILSFPYFWSSNE------KG  571
             H DF K++VGG+++G NI HN+ +RAGNE L    K+LGG+L  P+FW S        +G
Sbjct  126   HADFTKVYVGGETSGANIAHNLLLRAGNESLPGDLKILGGLLCCPFFWGSKPIGSEAVEG  185

Query  570   GEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCSKLHVCVAEKDELREISLR  391
              EQS+  KVW+F  P A GGIDNP +      APSLA L CSKL V +  KDE R+  + 
Sbjct  186   HEQSLAMKVWNFACPDAPGGIDNPCV----PGAPSLATLACSKLLVTITGKDEFRDRDIL  241

Query  390   YVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFKRIASFI  250
             Y   V++SGW+GE+++ D   EEH F +  P T  AK   KR+ASF+
Sbjct  242   YHHTVEQSGWQGELQLFDAGDEEHAFQLFKPETHLAKAMIKRLASFL  288



>ref|XP_004241152.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum lycopersicum]
Length=325

 Score =   286 bits (731),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 160/317 (50%), Positives = 209/317 (66%), Gaps = 17/317 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYP---YVPPSPEDSATGVSSKDITVSPNISVRVYLPK-LASATQ  988
             P  RVYKDGRVER  +     Y+PPS   ++  VSSKDIT+SP++  R+YLPK   +  Q
Sbjct  12    PFFRVYKDGRVERFYDVHGTYYLPPS--QTSDNVSSKDITISPDVFARLYLPKNTTTPNQ  69

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLPILVYYHGGG  ++S F++  H Y+N+L SQ N I VSV YRLAPE+ +   Y D W 
Sbjct  70    KLPILVYYHGGGLVIESPFTNWTHRYVNLLASQLNTIIVSVNYRLAPENDVSTIYNDGWT  129

Query  807   ALQWVASHASNDGQQVPLK----EPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPL  640
             ALQWV SHA+ D   +       +PWL  +GDF+K+F+ GDSAGGNIV  + +RAG E L
Sbjct  130   ALQWVTSHANKDDSVMTSTFTNYDPWLKTYGDFDKLFLVGDSAGGNIVFTMTMRAGKESL  189

Query  639   NQKSKLLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGG---IDNPMIYPMAENAP  469
             N    + G IL+FPYF   N    ++ I  K+W  + P+ + G   ID+PMI P+A+NAP
Sbjct  190   NCGVGICGSILAFPYFLIENID--QEGIPYKIWINICPSLEQGLFAIDSPMINPLAKNAP  247

Query  468   SLAGLRCSKLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPG  295
             SL+ L CS+L VC+AE+DE   RE  +R+VE VKKSGWKGE++V+++E   H F I  P 
Sbjct  248   SLSVLGCSRLLVCIAERDEYISRETLIRFVEGVKKSGWKGELKVIELEEVGHSFQIYKPD  307

Query  294   TEKAKDTFKRIASFIQD  244
              EKAKD     ASFI +
Sbjct  308   CEKAKDMMMHYASFIHN  324



>ref|XP_004247529.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum lycopersicum]
Length=328

 Score =   282 bits (722),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 153/309 (50%), Positives = 211/309 (68%), Gaps = 10/309 (3%)
 Frame = -2

Query  1146  RVYKDGRVERICN-----YPYVPPSPEDSATGVSSKDITVSPNISVRVYLPK-LASATQK  985
             R+YKDG+VER          YV P  +D    +SSKD+ +SP++S R+YLPK   ++TQK
Sbjct  20    RIYKDGQVERYIYQKSILLTYVSPLLDDPKNNISSKDVIISPHVSARLYLPKNTTNSTQK  79

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
              PI+VYYHGG   + SAF   YH+YLN+LVS++N IA+SVEYRLAPEH +   YED W A
Sbjct  80    HPIIVYYHGGALVLGSAFFKTYHNYLNVLVSKSNAIAISVEYRLAPEHDVTTIYEDSWTA  139

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNE-PLNQKS  628
             LQWVASHA+        ++PW+ N+GDF ++ + GDSAGGNIV+++A+RAG E  +N+K 
Sbjct  140   LQWVASHANEKKFTSDNEDPWIKNYGDFSRLSIIGDSAGGNIVYHMAMRAGREGGINEKV  199

Query  627   KLLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRC  448
              +   I   PYF    E   E +   K W  +   ++ G+ +P+I P+AENAPSL+ L C
Sbjct  200   TINSSIFVCPYFLVPIENIEEHASY-KNWLIISSPSEAGLHSPLINPLAENAPSLSQLGC  258

Query  447   SKLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDT  274
             SK+ +C  EKDE   +EI +R+VE VKKSGWKG++E+++VEGE HCF + +P  EK++D 
Sbjct  259   SKMLLCFTEKDEYIPKEIGVRFVEGVKKSGWKGDLELIEVEGEGHCFQLASPEIEKSQDL  318

Query  273   FKRIASFIQ  247
              KR A+FIQ
Sbjct  319   IKRFAAFIQ  327



>ref|XP_006355613.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum tuberosum]
Length=302

 Score =   281 bits (719),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 156/308 (51%), Positives = 201/308 (65%), Gaps = 33/308 (11%)
 Frame = -2

Query  1155  PLIRVYKDGRVER---ICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQK  985
             P  R+YKDG+VER   +     VPPS ED  TGVSSKD+++S ++S R+Y+PK  +  QK
Sbjct  21    PFYRLYKDGQVERFYELAGVHEVPPSLEDPTTGVSSKDVSISAHVSARLYIPKNTAPNQK  80

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVYYHGGG  + SAF    H YLN LVS++N IA+SV+YRLAPEH +P  Y+DCW+A
Sbjct  81    LPVLVYYHGGGLVIGSAFFKTEHCYLNHLVSESNCIAISVDYRLAPEHDIPTIYQDCWDA  140

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             LQWVASH+  D      K+PW+ NH DF ++FVGGDSAGGNIV+N+ +RAG E L    K
Sbjct  141   LQWVASHSVFDTIN---KDPWIENHSDFNRVFVGGDSAGGNIVYNMIMRAGREKLIGDVK  197

Query  624   LLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCS  445
             LLG IL+FPY            I+  + +F   + K              +P L+ L CS
Sbjct  198   LLGAILAFPYL-----------IIPSIENFDKVSTK--------------SPGLSMLGCS  232

Query  444   KLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTF  271
             +L VC  EKDEL   E+  ++V+ VKKSGWKGE+E ++V GE H F   NP  EK+KD  
Sbjct  233   RLFVCTGEKDELVPAEVGTKFVKVVKKSGWKGEVEFIEVAGEGHVFQCENPQAEKSKDLI  292

Query  270   KRIASFIQ  247
             KR+ASFIQ
Sbjct  293   KRMASFIQ  300



>ref|XP_010107991.1| putative carboxylesterase 12 [Morus notabilis]
 gb|EXC17556.1| putative carboxylesterase 12 [Morus notabilis]
Length=423

 Score =   285 bits (729),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/251 (59%), Positives = 176/251 (70%), Gaps = 17/251 (7%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKL  982
             P +RVYKDG V+R+   P VP SP D  TGVSSKDI++S  P IS R++LP L    QKL
Sbjct  14    PFMRVYKDGSVDRLLESPLVPTSPGDPETGVSSKDISISLNPAISARLFLPPLNHNNQKL  73

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+LVY+HGGGFC +SAFSS +H +LN LVSQA V+AVSVEYRLAPE+PLP  YEDCW AL
Sbjct  74    PVLVYFHGGGFCFESAFSSDHHRFLNSLVSQAKVLAVSVEYRLAPEYPLPVAYEDCWYAL  133

Query  801   QWVASHASNDGQQVP-----LKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLN  637
             QWVASH SN   +        KE WL NHGDFEK+F+GGDSAG NIVH++A+R   E LN
Sbjct  134   QWVASHNSNHDDRDDHDQDITKETWLTNHGDFEKVFLGGDSAGANIVHSMAMRFSKEDLN  193

Query  636   QKSK-LLGGILSFPYFWSSNEKGGE---------QSILQKVWDFVYPTAKGGIDNPMIYP  487
              + K + G  L+ PYFW S    G          +SI + VWDFVYP A GG+DNPMI P
Sbjct  194   NRIKSISGAFLTHPYFWGSEPLVGSSEPCAEELAKSIPRLVWDFVYPCAPGGVDNPMINP  253

Query  486   MAENAPSLAGL  454
             +  +APSLAGL
Sbjct  254   VGPDAPSLAGL  264


 Score =   130 bits (327),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 106/162 (65%), Gaps = 9/162 (6%)
 Frame = -2

Query  708  VGGDSAGGNIVHNVAIRAG--NEPLNQKSKLLGGILSFPYFWSSN------EKGGEQSIL  553
            + G  AG NIVHNVA+RAG  +E L    K+ G  L+ PYFW S       ++G E ++ 
Sbjct  261  LAGLGAGANIVHNVALRAGTESESLPCNVKIHGAFLAHPYFWGSKPIGSEPKEGFENALE  320

Query  552  QKVWDFVYPTAKGGIDNPMIYPMAEN-APSLAGLRCSKLHVCVAEKDELREISLRYVEAV  376
            + VWDF YP+A  GIDN MI P++   APSLAGL CS++ VCVA KD LRE  + Y EAV
Sbjct  321  RLVWDFAYPSASWGIDNLMINPVSGGGAPSLAGLGCSRMLVCVAGKDRLRERGVWYYEAV  380

Query  375  KKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFKRIASFI  250
            K+SGWKGE+E+ +VE E+H F I N  +  A    KR+ASF+
Sbjct  381  KESGWKGEVELFEVEEEDHAFHIYNIDSHNANVMIKRLASFL  422



>ref|XP_003622702.1| Hormone-sensitive lipase [Medicago truncatula]
 gb|ABD33408.1| Esterase/lipase/thioesterase [Medicago truncatula]
 gb|AES78920.1| 2-hydroxyisoflavanone dehydratase [Medicago truncatula]
Length=327

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 162/313 (52%), Positives = 212/313 (68%), Gaps = 16/313 (5%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLA-SATQKLP  979
             I VY DG V+R    P V P+P+   +   SKDI +S  PNIS R+YLPK++ S TQK  
Sbjct  20    ITVYSDGTVDRPRQAPTVSPNPDHPNS--PSKDIIISQNPNISARIYLPKVSHSETQKFS  77

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             ILV++HGGGF  +SAFS I+H + N+ V  AN I VSVEYRLAPEHPLPA Y+DCW +LQ
Sbjct  78    ILVFFHGGGFFFESAFSKIHHEHCNVFVPLANSIVVSVEYRLAPEHPLPACYDDCWNSLQ  137

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WVAS+++ +       EPWL+NHGDF ++F+GG S+GGNIVHN+A+RAG+E L    KL+
Sbjct  138   WVASNSAKNPVNA---EPWLINHGDFNRVFIGGPSSGGNIVHNIAMRAGSEALPNDVKLV  194

Query  618   GGILSFPYFWSS--------NEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             G IL  P F+SS          K  ++ +   VW+FVYP+A  GIDNPMI P+   APSL
Sbjct  195   GAILQQPLFFSSYPVGLESVKFKSSDKDLYSSVWNFVYPSAPCGIDNPMINPVGIGAPSL  254

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
              GL C ++ VCVA KD LRE  + Y E VKKSGWKG++E+ + E E+H + I +P +E A
Sbjct  255   DGLGCDRMIVCVAGKDGLRERGVWYYELVKKSGWKGKLELFEEENEDHVYHIFHPESESA  314

Query  282   KDTFKRIASFIQD  244
                 K +ASF+ +
Sbjct  315   HKLIKHLASFLHE  327



>ref|XP_006359894.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like isoform X1 
[Solanum tuberosum]
Length=328

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 151/313 (48%), Positives = 199/313 (64%), Gaps = 13/313 (4%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYP---YVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLP  979
              R+YK GRVER  +     YVPPSPE+ + G  SKD+T+SPN+S R+YLP+  +A QKLP
Sbjct  16    FRLYKSGRVERFYDVHGSFYVPPSPENPSAGAFSKDVTISPNVSARLYLPENTTAGQKLP  75

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             +LVYYHGGG C++SAF +  H Y+N L S+ NV+AVSV+YRLAPE  +P  YEDCW ALQ
Sbjct  76    VLVYYHGGGLCIESAFFTWTHRYVNSLASELNVVAVSVDYRLAPEVDVPVIYEDCWNALQ  135

Query  798   WVASHASN--DGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS-  628
             WVASHA           K+ WL N  DF K+F+ GDSAGGNIV+++ +RAG E LN    
Sbjct  136   WVASHADENSSSNNNNNKDSWLTNFCDFSKVFLVGDSAGGNIVYHMTMRAGKETLNNNEV  195

Query  627   KLLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGG----IDNPMIYPMAENAPSLA  460
             K+ G I + PYF        E+ +  K+W  + PT + G    ID+P+I P+ E APSL+
Sbjct  196   KITGSICACPYFLIRGVDIDEEGLAYKIWVNICPTLESGLLSPIDSPLINPLCEKAPSLS  255

Query  459   GLRCSKLHVCVAEKDELREISL--RYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             GL CS+L +C+ +KD +  I +  R+VE VKKSGW           E H F +  P +E+
Sbjct  256   GLGCSRLLLCMGKKDYVITIEIGGRFVEEVKKSGWN-GELEFVEIDEGHSFQMYKPESEE  314

Query  285   AKDTFKRIASFIQ  247
             AK   K  A+FI 
Sbjct  315   AKRMMKCYAAFIN  327



>ref|XP_009400390.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Musa acuminata 
subsp. malaccensis]
Length=324

 Score =   281 bits (718),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 149/309 (48%), Positives = 205/309 (66%), Gaps = 13/309 (4%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLP  979
             SP  RVY+DG +ER+    + P S  D  TGV+SKDI++S ++S R+YLPKLA A  KLP
Sbjct  13    SPYFRVYQDGSIERLVTEEHTPASI-DPHTGVTSKDISISTDVSARLYLPKLAEARHKLP  71

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             ++VY+ GG FC+ S+ S   H +LN LV++ANV+ VSV+YR APEH +P  Y+D W AL+
Sbjct  72    LVVYFRGGAFCMMSSSSPTLHAHLNSLVAEANVVLVSVDYRRAPEHRIPVAYDDSWAALE  131

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             W    ASN G      EPWLV+H DF+++F+ GDSAGGNI HN+A+RAG   L    KL 
Sbjct  132   WA---ASNRGVGA---EPWLVDHVDFDRVFLAGDSAGGNIAHNLAMRAGERELPHGVKLS  185

Query  618   GGILSFPYFWSSNEKGGEQ------SILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
             G +L  PYFW S     E+      + L ++W  V P++  G D+P + P+A +APSLAG
Sbjct  186   GIVLVDPYFWGSKPTASEEANPEMTARLDQLWPMVCPSSASGNDDPRVNPVAPSAPSLAG  245

Query  456   LRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             L C++L VC AEKD +R+ +  Y EA++KSGW GE+E+ +  GE+H F   +P  + AK 
Sbjct  246   LACARLLVCAAEKDAMRDRARIYHEALRKSGWSGEVEMYETAGEDHGFYFSHPNGQNAKL  305

Query  276   TFKRIASFI  250
               KRIA+F+
Sbjct  306   LVKRIATFL  314



>ref|XP_010943016.1| PREDICTED: tuliposide A-converting enzyme 2, chloroplastic-like 
[Elaeis guineensis]
Length=319

 Score =   280 bits (715),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 148/311 (48%), Positives = 195/311 (63%), Gaps = 14/311 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             P IR+YK GR+ER+     VP S  D ATGV+SKD+T+ P+  +S R+YLP       KL
Sbjct  13    PFIRIYKSGRIERLLGTDVVPAS-VDPATGVTSKDVTIDPSTGVSARLYLPTTTDNKNKL  71

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             PIL+Y HGGGF +++AFS  YH+YLN LVSQA ++AVSVEYR  PEHPLPA Y+D W   
Sbjct  72    PILIYIHGGGFVIETAFSPTYHNYLNSLVSQAQILAVSVEYRRVPEHPLPAAYDDAWATA  131

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WVASHA   G      EPWL  HGDF ++F+ GDSAG NI HNV  RAG   L    ++
Sbjct  132   KWVASHAGASGG----PEPWLSEHGDFNRVFLAGDSAGANIAHNVVQRAGTTDLGSGVRI  187

Query  621   LGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              G +L  P+FW S   G E      +   +++W F  P    G+D+P I P+AE AP L 
Sbjct  188   KGLLLVHPFFWGSKPVGSESRDPEPRRKTEELWRFACPGTT-GVDDPWINPLAEGAPGLE  246

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
             GL C ++ V VAEKD ++E    Y EA+K SGW G+ E+++ EGE H F + NP  + A 
Sbjct  247   GLPCERVLVTVAEKDFIKERGRAYYEALKGSGWGGQAELLESEGENHVFHLQNPTCDSAV  306

Query  279   DTFKRIASFIQ  247
                +R+ +F+ 
Sbjct  307   AKMERVIAFLN  317



>ref|XP_003592438.1| Paired amphipathic helix protein Sin3 [Medicago truncatula]
Length=804

 Score =   293 bits (750),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 168/312 (54%), Positives = 214/312 (69%), Gaps = 17/312 (5%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKLPI  976
             I VY DG V+R    P VPP+P+   +   SKDI +S  PNIS R+YLPK  + T KLPI
Sbjct  20    ITVYSDGTVDRPRQAPTVPPNPDHPNS--PSKDIIISQNPNISARIYLPK--NPTTKLPI  75

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LV++HGGGF  +SAFS +YH + N+ V QAN I VSVEYRLAPEHPLPA Y DCW +LQW
Sbjct  76    LVFFHGGGFFFESAFSKLYHEHFNVFVPQANSIVVSVEYRLAPEHPLPACYNDCWNSLQW  135

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
             VAS+++ +       E WL+NHGDF ++F+GGDSAGGNIVHN+A+RAG+E L    KLLG
Sbjct  136   VASNSAPNPVN---PESWLINHGDFNRVFIGGDSAGGNIVHNIAMRAGSEALPNGVKLLG  192

Query  615   GILSFPYFWSSNEKGGEQSILQ--------KVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              IL  PYF+SS   G E   L+         VW+FVYP+A GGIDNPMI P+   APSL 
Sbjct  193   AILQQPYFYSSYPVGLESVKLKSSDKDFHYSVWNFVYPSAPGGIDNPMINPVGIGAPSLD  252

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
             GL C ++ +CVA KD +RE  + Y E VKKSGWKG++E+ + E E+H + I +P +E  +
Sbjct  253   GLGCDRIIICVAGKDGIRERGVWYYELVKKSGWKGKLELFEEEDEDHVYHIFHPESESGQ  312

Query  279   DTFKRIASFIQD  244
                K +ASF+ D
Sbjct  313   KLIKHLASFLHD  324


 Score =   273 bits (699),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 161/308 (52%), Positives = 209/308 (68%), Gaps = 13/308 (4%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKLPI  976
             I VY DG V+R    P V   P  +     SKDI +S  PNIS R+YLPK  + T KLPI
Sbjct  346   ITVYSDGTVDRPRQPPTV--PPNPNHPNSPSKDIIISQNPNISARIYLPK--NPTTKLPI  401

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LV++HGGGF  +SAFS ++H + NI +  AN I VSVEYRLAPEHPLPA Y DCW +LQW
Sbjct  402   LVFFHGGGFFFESAFSKVHHEHFNIFIPLANSIVVSVEYRLAPEHPLPACYNDCWNSLQW  461

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
             VAS+++ +       EPWL+NHGDF ++F+GG SAGGNIVHN+A+RAG+E L    KLLG
Sbjct  462   VASNSAKNPVN---PEPWLINHGDFNRVFIGGASAGGNIVHNIAMRAGSEALPNDVKLLG  518

Query  615   GILSFPYFWSSNEKGGEQSILQK----VWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRC  448
              IL  P F+SS   G E   L+     +W+FVYP+A GGIDNPM+ P+   APSL GL C
Sbjct  519   AILQHPLFYSSYPVGLENVKLKDFYSYLWNFVYPSAPGGIDNPMVNPVGIGAPSLDGLGC  578

Query  447   SKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFK  268
              ++ VCVA KD+LRE  + Y E +KKSGWKG++E+ + E E+H + I +P +E  +   K
Sbjct  579   DRMIVCVAGKDKLRERGVWYYELIKKSGWKGKLELFEEEDEDHVYHIFHPESESGQKLIK  638

Query  267   RIASFIQD  244
              +ASF+ +
Sbjct  639   HLASFLHE  646



>ref|XP_008805244.1| PREDICTED: probable carboxylesterase 2 [Phoenix dactylifera]
Length=333

 Score =   280 bits (715),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 151/317 (48%), Positives = 210/317 (66%), Gaps = 28/317 (9%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASA--TQ  988
             PL+R YKDGR+ER+     VPPS  D +TGV+S+D+ + P  N+S R++LP L+S   +Q
Sbjct  30    PLLRTYKDGRIERLFGTDLVPPS-LDPSTGVTSEDVVIDPDTNLSARLFLPDLSSLGPSQ  88

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             K P+LVYYHGGGFC  S FS++YH+++N LV +A VIAVSV+YRLAPEHPLPA YED   
Sbjct  89    KFPVLVYYHGGGFCSLSPFSALYHNFVNSLVVEAKVIAVSVDYRLAPEHPLPAAYEDAAR  148

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             ALQWVASHA   G       PWL    +F ++F+GGDSAG NI HN+A+ A       ++
Sbjct  149   ALQWVASHAEGPGPV-----PWLAERVEFSRVFLGGDSAGANIAHNMAMWA-------EA  196

Query  627   KLLGGILSFPYFWSSNEKGGEQS----------ILQKVWDFVYPTAKGGIDNPMIYPMAE  478
             K+ G +L  PYFW S+  G E+           +L ++W F + +A    D+P I PMAE
Sbjct  197   KIEGLVLIHPYFWGSDRMGCEKDRVDKPFLEAEMLDRLWPFAWGSAVES-DDPQINPMAE  255

Query  477   NAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNP  298
              APSLAGL C ++ V  AE+D LR+    Y +A++ SGW+G +E+++ E E+H F ++NP
Sbjct  256   GAPSLAGLGCGRVLVVTAERDVLRDRGRTYCKALRGSGWRGVVELLETEAEDHVFHLLNP  315

Query  297   GTEKAKDTFKRIASFIQ  247
             G +KA +   R+A F++
Sbjct  316   GCDKALEMMTRLAGFLR  332



>ref|XP_002284587.1| PREDICTED: probable carboxylesterase 2 [Vitis vinifera]
Length=326

 Score =   279 bits (714),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 155/313 (50%), Positives = 205/313 (65%), Gaps = 17/313 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNI--SVRVYLPKLASATQKL  982
             PL+R++KDG VER+     VP +  D  TGVSSKD+T+ P I  S R++LPKL +  QKL
Sbjct  14    PLLRIHKDGSVERLRGTEVVP-AGTDPQTGVSSKDVTIIPEIDLSARLFLPKLTNPNQKL  72

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+LVY+HGGGF + + F+  YH+YLN LVSQANV+AVSV YR APEHP+PA YED W AL
Sbjct  73    PLLVYFHGGGFYLSTPFAPNYHNYLNSLVSQANVVAVSVNYRKAPEHPIPAAYEDSWAAL  132

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRA--GNEPLNQKS  628
             QWVASH + +G      E WL  H +FE+IF+ G+SAG NIVHN+A+ A  G+       
Sbjct  133   QWVASHCNGNG-----PEAWLNEHANFERIFLSGESAGANIVHNLAMAAGRGDAESGLGV  187

Query  627   KLLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             +LLG  L  P+FW S   G E      ++ +  VW FV P+     D+P + P+AE APS
Sbjct  188   RLLGVALVHPFFWGSTPIGSEAVDPERKAWVDSVWPFVCPSMPDS-DDPRLNPVAEGAPS  246

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L GL C +  VCVAEKD LR+  L Y  A+  SGW G  E+ + +GE+H F + + G EK
Sbjct  247   LVGLGCGRALVCVAEKDVLRDRGLVYYSALAGSGWMGVAEMFETDGEDHAFHLHDLGCEK  306

Query  285   AKDTFKRIASFIQ  247
             A+D  +R+A+F+ 
Sbjct  307   ARDLIQRLAAFLN  319



>ref|XP_006359895.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like isoform X2 
[Solanum tuberosum]
 ref|XP_006359896.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like isoform X3 
[Solanum tuberosum]
Length=324

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/310 (46%), Positives = 202/310 (65%), Gaps = 11/310 (4%)
 Frame = -2

Query  1146  RVYKDGRVERICNYP---YVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLPI  976
             R+Y+ GRVER  +     YVPPSP+  + GV SKD+T+SP++S R+YLP+    +QK+P+
Sbjct  15    RLYQSGRVERFYDVHGLFYVPPSPQHPSNGVFSKDVTISPHVSARLYLPENIPNSQKIPV  74

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LVYYHGGG  +DSAF +++H+Y+N L S+  ++AVS+EYRLAPE  +P  YEDCW ALQW
Sbjct  75    LVYYHGGGLVIDSAFFNLHHNYVNSLASELKMVAVSIEYRLAPEVDVPTIYEDCWTALQW  134

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS-KLL  619
             VASHA+ +   +  K+ WL N  DF K+F+ GDSAGGN+V+++ +RAG E LN    K+ 
Sbjct  135   VASHANENSSSIHNKDSWLTNSCDFSKVFLAGDSAGGNLVYHMTMRAGKETLNNNEVKIT  194

Query  618   GGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGG----IDNPMIYPMAENAPSLAGLR  451
             G I + PYF        E+ +  K+W  + PT + G    ID+P+I P+ E APSL+GL 
Sbjct  195   GSICACPYFLIRGVDIDEEGLAYKIWVNICPTLESGLLSPIDSPLINPLCEKAPSLSGLG  254

Query  450   CSKLHVCVAEKDELREISL--RYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             CS+L +C+ +KD +  I +  R+VE VKKSGW           E H F +  P +E+AK 
Sbjct  255   CSRLLLCMGKKDYVITIEIGGRFVEEVKKSGWN-GELEFVEIDEGHSFQMYKPESEEAKR  313

Query  276   TFKRIASFIQ  247
               K  A+FI 
Sbjct  314   MMKCYAAFIN  323



>ref|XP_010916645.1| PREDICTED: probable carboxylesterase 2 [Elaeis guineensis]
Length=333

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 213/319 (67%), Gaps = 29/319 (9%)
 Frame = -2

Query  1155  PLIRVYKDGRVERI-CNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASA--T  991
             PL+R YKDGR+ER+  +  +VPPS  D+ATGV+SKD+ + P  N+S R++LP L S   +
Sbjct  13    PLLRTYKDGRIERLYGSNDFVPPS-LDTATGVTSKDVLIDPHTNLSARLFLPDLTSLGPS  71

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
             QKLP+L+YYHGGGFCV S FS +YH+++N +V +A VIAVSV YRLAPEHPLPA YED  
Sbjct  72    QKLPVLIYYHGGGFCVQSPFSPLYHNFVNSVVVEAKVIAVSVNYRLAPEHPLPAAYEDAA  131

Query  810   EALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
              ALQWVA+HA   G      EPWL   G+  ++F+ GDSAG NI HN+A+RA       K
Sbjct  132   RALQWVAAHAEGPG-----PEPWLAQRGEISRVFLAGDSAGANIAHNMAMRA-------K  179

Query  630   SKLLGGILSFPYFWSSNEKGGEQS----------ILQKVWDFVYPTAKGGIDNPMIYPMA  481
             +++ G +L  P+FW S   G E+           ++ ++W F + +A    D+P + PMA
Sbjct  180   ARIEGLVLIHPHFWGSERLGCEKDRADKPFLEAEVVDRLWPFAWGSAVES-DDPQVNPMA  238

Query  480   ENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMN  301
             E APSLAGL C ++ V VAE+D LR+    Y +A++ SGW G +E+++ EGE+H F ++N
Sbjct  239   EGAPSLAGLGCGRVLVAVAERDVLRDRGRAYCKALRGSGWSGVVELLETEGEDHVFHLLN  298

Query  300   PGTEKAKDTFKRIASFIQD  244
             P  +KA +   R+A F+++
Sbjct  299   PCCDKAVEMMARLAGFLRE  317



>ref|XP_010275601.1| PREDICTED: probable carboxylesterase 2 [Nelumbo nucifera]
Length=324

 Score =   278 bits (711),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 149/311 (48%), Positives = 207/311 (67%), Gaps = 15/311 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             P +RVYKDG VER+     VP S  DS TGVSSKD+ + P+  +S R+YLPKLA A QKL
Sbjct  14    PFLRVYKDGHVERLLGTDSVPAS-LDSETGVSSKDVLIVPDSGVSARLYLPKLADANQKL  72

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             PILVY+HGGGF +    + +YHH+LN+LV++AN++AVSV YRLAPE+P+PA Y+D W AL
Sbjct  73    PILVYFHGGGFIIGHPSTPMYHHHLNLLVAEANIVAVSVAYRLAPENPIPAAYDDSWAAL  132

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGN-EPLNQKSK  625
             QWVASH+  +G      E WL  H DF ++F+ G+S+G NI H++A+RAG+        +
Sbjct  133   QWVASHSKGEG-----PESWLTEHADFGRVFLAGESSGANIAHHMAMRAGDPNSGGLGME  187

Query  624   LLGGILSFPYFWSSNEKGGE-----QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
             +LG  L  P+FW +   G E     +++  ++W +V P+     D+P I P+A NAPSL 
Sbjct  188   ILGIALVHPHFWGATPIGSEAMAPVKALFDRLWPYVCPSQPDN-DDPQINPLAANAPSLL  246

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
             GL C+++ V VA KD LR+    Y E++ +SGW G +E  + EGEEH F + NP TE A+
Sbjct  247   GLGCTRVIVFVAGKDALRDRGWLYYESLARSGWIGVVEFAETEGEEHGFHLYNPNTETAR  306

Query  279   DTFKRIASFIQ  247
             +  KR+A F+ 
Sbjct  307   ELLKRLAFFLN  317



>ref|XP_008795140.1| PREDICTED: probable carboxylesterase 2 [Phoenix dactylifera]
Length=317

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 152/319 (48%), Positives = 214/319 (67%), Gaps = 29/319 (9%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYP-YVPPSPEDSATGVSSKDITV--SPNISVRVYLPKLASA--T  991
             PLIR YKDGR+ER+     +VPPS  D ATGV+S+D+ +  + N+S R++LP L S   +
Sbjct  13    PLIRTYKDGRIERLFGSDDFVPPS-LDPATGVTSEDVLIDSATNLSARLFLPDLTSLGPS  71

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
             QKLP+++YYH GGFC  SAFS++YH++++ LV +A VIAVSV+YRLAPEHPLP  YED  
Sbjct  72    QKLPVVLYYHAGGFCSQSAFSAVYHNFVSSLVVEARVIAVSVDYRLAPEHPLPGAYEDAA  131

Query  810   EALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
              ALQWVASHA   G   P+  PWL   G+F ++F+ GDSAG NI HN+A+RA       +
Sbjct  132   RALQWVASHAEGPG---PV--PWLAERGEFSRVFLAGDSAGANIAHNMAMRA-------E  179

Query  630   SKLLGGILSFPYFWSSNEKGGEQS----------ILQKVWDFVYPTAKGGIDNPMIYPMA  481
             +K+ G +L  PYFW S+  G E+           +L ++W F + +A    D+P I PMA
Sbjct  180   AKIEGLVLIHPYFWGSDRMGCEKDRVDKPFLEAEMLDRLWPFAWGSAVES-DDPQINPMA  238

Query  480   ENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMN  301
             E APSLAGL C ++ V  AE+D LR+    Y +A++ SGW+G +E+++ EGE+H F ++N
Sbjct  239   EGAPSLAGLGCGRVLVVTAERDVLRDRGRAYCKALRASGWRGVVELLETEGEDHVFHLLN  298

Query  300   PGTEKAKDTFKRIASFIQD  244
             PG +KA +   R+A F ++
Sbjct  299   PGCDKALEMMARLADFFRE  317



>ref|XP_010916828.1| PREDICTED: probable carboxylesterase 2 [Elaeis guineensis]
Length=318

 Score =   277 bits (709),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 155/317 (49%), Positives = 204/317 (64%), Gaps = 28/317 (9%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLAS--ATQ  988
             P IR Y+DGRVER+     V PS  D  TGV+SKD+ +    N+S R+Y P LAS   +Q
Sbjct  14    PFIRTYRDGRVERLVPTDVVSPS-LDPTTGVTSKDVMIDRETNVSARLYHPDLASFDPSQ  72

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLPILVY+HGGGFC  S F ++YH+YLN LV++A V+AVSV+YRLAPE+P+PA YED W+
Sbjct  73    KLPILVYFHGGGFCFGSPFWTLYHNYLNSLVAKAKVVAVSVDYRLAPENPIPAAYEDSWQ  132

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             ALQWV SH+   G      EPWL   GD  ++F+ GDSAG NIVHN+A+RA       K+
Sbjct  133   ALQWVVSHSEGAGS-----EPWLAERGDLSRVFLAGDSAGANIVHNMAMRA-------KA  180

Query  627   KLLGGILSFPYFWSSNEKGGEQSILQK----------VWDFVYPTAKGGIDNPMIYPMAE  478
             ++ G +L  P+FW S   G E+    K          VW FV P A G  D+P + PMA+
Sbjct  181   RIEGVVLVHPFFWGSERMGCEKDRDDKPLLDPVTTDLVWPFVCPGAVGS-DDPRLNPMAK  239

Query  477   NAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNP  298
               PSLAGL C ++ V VAEKD LR+    Y EA+K S W G +E+ + +GE+H F +   
Sbjct  240   GGPSLAGLGCGRVLVVVAEKDLLRDRGRAYYEALKGSRWGGMVEIFETKGEDHVFHLFES  299

Query  297   GTEKAKDTFKRIASFIQ  247
             G +KA + F+R+A FI+
Sbjct  300   GCDKALELFQRLAGFIR  316



>gb|ABW74473.1| CXE carboxylesterase [Paeonia suffruticosa]
Length=325

 Score =   277 bits (708),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 146/304 (48%), Positives = 205/304 (67%), Gaps = 19/304 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLPI  976
             P  RVYKDGRVER      VPP+ +D  TGV SKD+ +SP ++VR++LPK+   TQK+P+
Sbjct  41    PFFRVYKDGRVERFMPTEKVPPT-DDPNTGVRSKDVQISPEVAVRIFLPKIDDPTQKVPV  99

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             L Y HGGGF + SAF+  YH+Y++ LV++ANVIAVSV+YRLAPEHP+PA YED WEA +W
Sbjct  100   LFYTHGGGFSIGSAFAQGYHNYVSSLVAEANVIAVSVDYRLAPEHPIPACYEDSWEAFKW  159

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
             VASHA+ +G      EPWL +H DF ++F+ GDSAG NI H +A R G+  L    K++G
Sbjct  160   VASHANGNG-----PEPWLNDHADFRRVFMTGDSAGANITHTLAARIGSTEL-PGVKVIG  213

Query  615   GILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCSKLH  436
               L  PYF  +++         K+W F+ PT  GG+++P + P  E+   LA L C K+ 
Sbjct  214   IALVHPYFGGTDD--------DKMWLFLCPT-NGGLEDPRLKPATED---LAKLGCEKML  261

Query  435   VCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFKRIAS  256
             + VA++D L+E  + Y + +KKSGWKG +E+ + +G+ H F +MNP  + AK   KR+ S
Sbjct  262   IFVADEDHLKERGISYYDELKKSGWKGTVEIEENKGQHHVFHLMNPTCDDAKAMKKRLVS  321

Query  255   FIQD  244
             FI++
Sbjct  322   FIKE  325



>ref|XP_006359897.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like isoform X4 
[Solanum tuberosum]
Length=323

 Score =   277 bits (708),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 138/309 (45%), Positives = 203/309 (66%), Gaps = 10/309 (3%)
 Frame = -2

Query  1146  RVYKDGRVERICNYP---YVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLPI  976
             R+Y+ GRVER  +     YVPPSP+  + GV SKD+T+SP++S R+YLP+    +QK+P+
Sbjct  15    RLYQSGRVERFYDVHGLFYVPPSPQHPSNGVFSKDVTISPHVSARLYLPENIPNSQKIPV  74

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LVYYHGGG  +DSAF +++H+Y+N L S+  ++AVS+EYRLAPE  +P  YEDCW ALQW
Sbjct  75    LVYYHGGGLVIDSAFFNLHHNYVNSLASELKMVAVSIEYRLAPEVDVPTIYEDCWTALQW  134

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
             VASHA+ +   +  K+ WL N  DF K+F+ GDSAGGN+V+++ +RA  E LN   K+ G
Sbjct  135   VASHANENSSSIHNKDSWLTNSCDFSKVFLAGDSAGGNLVYHMTMRADKETLNNDLKITG  194

Query  615   GILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGI----DNPMIYPMAENAPSLAGLRC  448
              I ++PYF   N +  E+ +  K+W ++ P  + G+    D+P+I P++E A SL+ L C
Sbjct  195   SIFAYPYFLFPNVEIDEEGLANKIWGYICPPLEFGLLSPKDSPLINPLSEKAQSLSELGC  254

Query  447   SKLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDT  274
              ++ VC+ +KD++   EI +R+VE VK+SGW+    V       H F +  P  ++AK  
Sbjct  255   LRILVCMGKKDDIIPLEIGVRFVEGVKESGWE-GEVVYLEVDGGHSFQMHQPEYDEAKRM  313

Query  273   FKRIASFIQ  247
              K  A FI 
Sbjct  314   MKCYADFIH  322



>ref|XP_008803544.1| PREDICTED: tuliposide A-converting enzyme 2, chloroplastic-like 
[Phoenix dactylifera]
Length=318

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 146/312 (47%), Positives = 198/312 (63%), Gaps = 15/312 (5%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQK  985
             +P IR+YK GR+ER+     VP S  D ATGV+SKD+T+ P+  +S R+YLP   + T K
Sbjct  12    APFIRIYKSGRIERLVGTDVVPAS-VDPATGVTSKDVTIDPSTGVSARLYLPTTTNKT-K  69

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+L+Y HGGGF +++AFS  YH+YLN LVSQA ++AVSV+YR  PEHPLPA Y+D   A
Sbjct  70    LPVLIYIHGGGFVIETAFSPTYHNYLNSLVSQAQILAVSVDYRRVPEHPLPAAYDDVLAA  129

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
              +WVASHA+  G      EPWL  HGD  ++F+ GDSAG NI HNV +RAG   L    +
Sbjct  130   AKWVASHAAGSGG----PEPWLSEHGDLNRVFLAGDSAGANIAHNVTLRAGKTDLGSGMR  185

Query  624   LLGGILSFPYFWSSNEKGGEQS------ILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G +L  P+FW S   G E +        +++W F  P   G  D+P I P+AE  P L
Sbjct  186   IKGLLLVHPFFWGSKPVGSESTDPEPRRRTEELWGFACPGTTGA-DDPWINPLAEGGPGL  244

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
              GL C ++ V VAEKD +RE    Y E +K SGW GE E+++ EG  H F +++P +EKA
Sbjct  245   EGLPCERVLVTVAEKDFIRERGRAYYEGLKGSGWGGEAELLESEGMGHVFHLLDPTSEKA  304

Query  282   KDTFKRIASFIQ  247
                 +R+ +F+ 
Sbjct  305   VAKMERVVAFLN  316



>ref|XP_010066035.1| PREDICTED: probable carboxylesterase 12 [Eucalyptus grandis]
 gb|KCW63803.1| hypothetical protein EUGRSUZ_G01468 [Eucalyptus grandis]
Length=323

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 213/316 (67%), Gaps = 19/316 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLA-SATQ  988
             SPL +VYKDGRVER+ +   VPPS  D  TGV SKD+ +S +  +S R+Y+PK A  + Q
Sbjct  10    SPLAKVYKDGRVERLMSTATVPPS-LDEKTGVQSKDVAISSDSTVSARLYIPKAAVGSLQ  68

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+LVY+HGGGF +++A+S  YH+YLN LV++AN+IAVSVEYR APEHPLPA Y+D W 
Sbjct  69    KLPVLVYFHGGGFIIETAWSPTYHNYLNPLVAEANIIAVSVEYRRAPEHPLPAAYDDSWT  128

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             AL+WVASH++ +G      E WL +H + +K+F+ GDSAG NIVHN+ IR G E LN   
Sbjct  129   ALKWVASHSAGNG-----PEEWLNSHANLKKVFMSGDSAGANIVHNMGIRLGEEKLN-GI  182

Query  627   KLLGGILSFPYFWS------SNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             ++ G ++  PYFW          +  ++S ++ +W    PT   G+D+P++ P  +  P 
Sbjct  183   EIPGVVMVHPYFWGEEPLPLETTEPEKRSKIRDIWHAAKPTTT-GLDDPLMNPATD--PR  239

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L+GL  S++ +CVAEKD LR+    Y E + KSGWKG++EV++   E+H F ++ PG E 
Sbjct  240   LSGLGVSRVLICVAEKDMLRQRGWYYKEVLSKSGWKGDVEVMEAPEEDHVFHLVKPGCEN  299

Query  285   AKDTFKRIASFIQD*I  238
             A+   K++ SF+ + I
Sbjct  300   AEKMMKKLVSFMNEDI  315



>ref|XP_009418893.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Musa acuminata 
subsp. malaccensis]
Length=318

 Score =   274 bits (701),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 153/315 (49%), Positives = 204/315 (65%), Gaps = 18/315 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLP  979
             +P+IRVYKDGR+ER+    ++PPS  D+ATGV+SKD+ ++  ++ R+YLP +A A  KLP
Sbjct  12    APIIRVYKDGRIERLNADVHLPPS-VDTATGVASKDVPIAAGVTARLYLPAVA-APSKLP  69

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             + VYYHGG FC+ SAFSSIYH +LN +VS A+VIAVSV+YRLAPEH +PA YED W ALQ
Sbjct  70    VFVYYHGGCFCIGSAFSSIYHDFLNTIVSTASVIAVSVDYRLAPEHLIPAAYEDAWCALQ  129

Query  798   WVASHASNDGQQVPLKEPWLV-NHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLN-QKSK  625
             WVASHA          EPWL  +  DF ++F+ GDSAG NI HNVA+R   E L    ++
Sbjct  130   WVASHAEGG------PEPWLAKDRTDFTRLFLAGDSAGANIAHNVAMRVAAEGLGVGGAR  183

Query  624   LLGGILSFPYFWSSNEKGGEQS------ILQKVWDFVYPTAKGGIDN--PMIYPMAENAP  469
             +   +L  PYFW +     E        I     D ++    GG DN  P + P+AE AP
Sbjct  184   VESAVLLHPYFWGTARLPSEVGRVDHPFIPPHTVDSMWQLITGGADNDDPRLNPLAEGAP  243

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
             SLAGL C ++ V VAEKD LR+    Y EA++KSGW GE ++ + +GE+H F +  PG  
Sbjct  244   SLAGLGCRRVMVAVAEKDTLRDRGRAYFEALRKSGWGGEAQLWETQGEDHVFFLFKPGCN  303

Query  288   KAKDTFKRIASFIQD  244
             +     KR+ SF++D
Sbjct  304   EVSLLVKRLVSFLKD  318



>gb|AFK39787.1| unknown [Medicago truncatula]
 gb|KEH43899.1| 2-hydroxyisoflavanone dehydratase [Medicago truncatula]
Length=318

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 161/308 (52%), Positives = 209/308 (68%), Gaps = 13/308 (4%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQKLPI  976
             I VY DG V+R    P V   P  +     SKDI +S  PNIS R+YLPK  + T KLPI
Sbjct  18    ITVYSDGTVDRPRQPPTV--PPNPNHPNSPSKDIIISQNPNISARIYLPK--NPTTKLPI  73

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LV++HGGGF  +SAFS ++H + NI +  AN I VSVEYRLAPEHPLPA Y DCW +LQW
Sbjct  74    LVFFHGGGFFFESAFSKVHHEHFNIFIPLANSIVVSVEYRLAPEHPLPACYNDCWNSLQW  133

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
             VAS+++ +       EPWL+NHGDF ++F+GG SAGGNIVHN+A+RAG+E L    KLLG
Sbjct  134   VASNSAKNPVN---PEPWLINHGDFNRVFIGGASAGGNIVHNIAMRAGSEALPNDVKLLG  190

Query  615   GILSFPYFWSSNEKGGEQSILQK----VWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRC  448
              IL  P F+SS   G E   L+     +W+FVYP+A GGIDNPM+ P+   APSL GL C
Sbjct  191   AILQHPLFYSSYPVGLENVKLKDFYSYLWNFVYPSAPGGIDNPMVNPVGIGAPSLDGLGC  250

Query  447   SKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFK  268
              ++ VCVA KD+LRE  + Y E +KKSGWKG++E+ + E E+H + I +P +E  +   K
Sbjct  251   DRMIVCVAGKDKLRERGVWYYELIKKSGWKGKLELFEEEDEDHVYHIFHPESESGQKLIK  310

Query  267   RIASFIQD  244
              +ASF+ +
Sbjct  311   HLASFLHE  318



>ref|XP_010066040.1| PREDICTED: probable carboxylesterase 12 [Eucalyptus grandis]
 gb|KCW63804.1| hypothetical protein EUGRSUZ_G01469 [Eucalyptus grandis]
Length=315

 Score =   273 bits (698),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 206/314 (66%), Gaps = 19/314 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLA-SATQ  988
             SP  R+YKDGRVER+     V PS  D  TG+ SKD+ +  +  +S R+Y+PK A  + Q
Sbjct  10    SPFARIYKDGRVERLLGTATVSPS-LDEKTGIQSKDVAIPSDSAVSARLYIPKAAVDSLQ  68

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+LVY+HGGGF +++A+S  YH+YLN LV++AN+IAVSVEYR APEHPLPA Y+D W 
Sbjct  69    KLPVLVYFHGGGFIIETAWSPTYHNYLNALVAEANIIAVSVEYRRAPEHPLPAAYDDSWT  128

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             AL+WVASH++ +G      E WL +H +F+K+F+ GDSAG NIVHN+ IR G E LN   
Sbjct  129   ALKWVASHSAGNG-----PEEWLNSHANFKKVFMSGDSAGANIVHNMCIRLGEEKLN-GV  182

Query  627   KLLGGILSFPYFWSS------NEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             +  G ++  PYFW          +  ++S ++ +W  V PT   G D+P++ P  +  P 
Sbjct  183   EFSGIMMVHPYFWGDEPLPLETTEPEKRSQVRDIWRMVNPTTT-GCDDPLVNPATD--PR  239

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L+GL   ++ +CVAEKD LR+    Y E + KSGW G +EVV+  GE+H F ++NPG E 
Sbjct  240   LSGLGVDRILICVAEKDMLRQRGWYYKEVLSKSGWSGVVEVVEAPGEDHVFHLLNPGCEN  299

Query  285   AKDTFKRIASFIQD  244
             A    K++ SF+ D
Sbjct  300   AAKMMKKLVSFMND  313



>ref|XP_004247377.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum lycopersicum]
Length=330

 Score =   272 bits (695),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 200/315 (63%), Gaps = 15/315 (5%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYP---YVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLP  979
              R+YK GRVER  +     YVPPSPE+ + G  SKDIT+SP++S R+YLP+  +A QKLP
Sbjct  16    FRLYKSGRVERFYDVHGSFYVPPSPENPSAGAFSKDITISPHVSARLYLPENTTAGQKLP  75

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             +LVYYHGGG C++SAF +  H Y+N L S+ NV+AVSV YRLAPE  +P  YEDCW ALQ
Sbjct  76    VLVYYHGGGLCIESAFFTWTHRYVNSLASELNVVAVSVNYRLAPEVDVPIIYEDCWTALQ  135

Query  798   WVASHASN---DGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             W+ASHA       +     + WL N  DF K+F+ GDSAGGNIV+++ +RAG E LN  +
Sbjct  136   WIASHADENSNSDKNNNNDDSWLTNFCDFSKVFLVGDSAGGNIVYHMTMRAGKETLNNNN  195

Query  627   --KLLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGG----IDNPMIYPMAENAPS  466
               K++G I ++PYF   +    E+ +  K+W  + PT + G    ID+P+I P+ E APS
Sbjct  196   EVKIIGSICAYPYFLIGDIDIDEEGLAYKIWVNICPTLEFGLLSPIDSPLINPLCEKAPS  255

Query  465   LAGLRCSKLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
             L+GL CS+L +C+ +KD +   EI  R+VE VKKSGW           E H F I    +
Sbjct  256   LSGLGCSRLLLCMGKKDYVIPIEIGGRFVEEVKKSGWD-GDLQFVEIDEGHSFQIYKSES  314

Query  291   EKAKDTFKRIASFIQ  247
             E+AK   K   +FI 
Sbjct  315   EEAKRMMKCYDAFIN  329



>ref|XP_004957047.1| PREDICTED: probable carboxylesterase 12-like [Setaria italica]
Length=326

 Score =   271 bits (694),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 145/314 (46%), Positives = 201/314 (64%), Gaps = 20/314 (6%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQ------  988
             IRVYK GRVER      VP S  D+ATGV+SKD  +SP+++VR+YLP  A+ T+      
Sbjct  19    IRVYKSGRVERYFGSDPVPAS-TDAATGVTSKDRAISPDVAVRLYLPPAANPTEDDGGSI  77

Query  987   -KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
              KLPILVY+HGGGFC+ +AF+ ++H YL  L ++   I VSVEYRLAPEHPLPA Y+D W
Sbjct  78    KKLPILVYFHGGGFCLHTAFNFVFHAYLTSLAARTRAIVVSVEYRLAPEHPLPAAYDDSW  137

Query  810   EALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
              AL+WVASHA+  G+     EPWL +HGDF ++ VGG+SAG NI H++A+RAG EPL   
Sbjct  138   RALRWVASHATGSGE-----EPWLTDHGDFSRLCVGGESAGANIAHHMAMRAGAEPLPDG  192

Query  630   SKLLGGILSFPYFWSSNEKGGEQS------ILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
             +++ G ++  PYF  +     E++       +  +W  V P    G+D+P I P+A  AP
Sbjct  193   ARINGAVVVHPYFLGAVRVASEETDPAMARSVVTMWRVVCP-GSAGVDDPWINPLAAAAP  251

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
              L GL C ++ VC+AEKD +R+    Y E +  SGW G++EV++V G+ HCF +++    
Sbjct  252   GLRGLACGRVLVCLAEKDVVRDRGRAYAEGLGASGWAGKVEVLEVAGQGHCFHLVDFACA  311

Query  288   KAKDTFKRIASFIQ  247
              A      IA F+ 
Sbjct  312   DAVKQDDAIARFVN  325



>ref|XP_004237066.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum lycopersicum]
Length=317

 Score =   271 bits (692),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 152/312 (49%), Positives = 209/312 (67%), Gaps = 19/312 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVER---ICNYPYVPPSPE-DSATGVSSKDITVSPNISVRVYLPKLASAT-  991
             P  R+YK+GRVER   + N  YVPP+ E DS TGVSSKD+ ++ ++S R++LP +   T 
Sbjct  14    PHFRIYKNGRVERFYHLQNCFYVPPTHEPDSDTGVSSKDVAINSHVSARLFLPNVTINTN  73

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
             +KLPI+V+YHGG   + SAF +  + +LN+LVS++N IAV+V+YRL PEH +   YEDCW
Sbjct  74    KKLPIIVFYHGGALVLGSAFFNKVYRFLNLLVSESNSIAVAVDYRLTPEHDVSTVYEDCW  133

Query  810   EALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
              ALQWVAS           ++ WL +HGDF K+F+ G+SAG NI  N+ IRA  E LN  
Sbjct  134   TALQWVASS----------QDSWLTSHGDFGKVFLLGESAGANIAFNMIIRADREKLNGD  183

Query  630   SKLLGGILSFPYFWSSNEKGGEQSILQ-KVW-DFVYPTAKGGIDNPMIYPMAENAPSLAG  457
              K+ G IL+ PYF   +E    +++L  K W + + P  +   D PMI P+ + +P+L+ 
Sbjct  184   VKINGLILACPYFLIPHENIDVENLLAYKAWREIICPNLESPFDCPMINPLCKTSPNLSK  243

Query  456   LRCSKLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             L CSKL VC+AEKDEL   E+ +++V++VKKSGW G+  +  VEGE HCF I N  TEKA
Sbjct  244   LVCSKLFVCLAEKDELIPVEMLMQFVDSVKKSGWNGQFVLHVVEGEGHCFLIDNLETEKA  303

Query  282   KDTFKRIASFIQ  247
             +D+ KR ASFIQ
Sbjct  304   RDSIKRFASFIQ  315



>ref|XP_007200925.1| hypothetical protein PRUPE_ppb022581mg [Prunus persica]
 gb|EMJ02124.1| hypothetical protein PRUPE_ppb022581mg [Prunus persica]
Length=315

 Score =   270 bits (691),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 151/316 (48%), Positives = 200/316 (63%), Gaps = 22/316 (7%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLA---SA  994
             SPLI++YKDGR+ER+     +PPS  D  TGV SKD+ +S  P +S R+YLP  +   S 
Sbjct  10    SPLIKIYKDGRIERLTGTTTLPPS-LDPQTGVESKDVVISKEPALSARLYLPTKSTTNSP  68

Query  993   TQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDC  814
              +KLP+LVY HGGGF V+ A SSIYH+YLN LV++ N++AVSVEYRLAPEH LPA Y+D 
Sbjct  69    NKKLPLLVYIHGGGFVVERASSSIYHNYLNALVAETNIVAVSVEYRLAPEHSLPAAYDDA  128

Query  813   WEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             W + +WVASH+   G      E WL  H DF+++F+ GDSAG NI HNV +R G+E L  
Sbjct  129   WGSFKWVASHSDAKGS-----EDWLNRHADFQRVFIAGDSAGANIAHNVGLRVGSEGLGG  183

Query  633   KSKLLGGILSFPYFWSSNEKGGEQSI-------LQKVWDFVYPTAKGGIDNPMIYPMAEN  475
               K  G +L  PYF  S   G EQS+       +  +W   YP+  G  D+P+  P  + 
Sbjct  184   -VKPKGIVLVHPYFGGSEAIGAEQSLPPMVREYMVGLWLLAYPSTSGS-DDPLFNPGKD-  240

Query  474   APSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPG  295
              P L GL C K+ VCVAEKD L++    Y E +KKSGWKG ++V++ +GE H F + NP 
Sbjct  241   -PKLGGLGCEKVLVCVAEKDALKDRGWHYSEVLKKSGWKGAVDVIESKGENHVFHLFNPT  299

Query  294   TEKAKDTFKRIASFIQ  247
              + A    K++ SFI 
Sbjct  300   CDNAVALLKKMVSFIN  315



>ref|XP_004247530.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum lycopersicum]
Length=329

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/310 (45%), Positives = 201/310 (65%), Gaps = 11/310 (4%)
 Frame = -2

Query  1146  RVYKDGRVERICNYP---YVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLPI  976
             R+YK GRVER        YVPPSP+  ++GV SKD+T+SP++S R+YLP+    ++K+P+
Sbjct  18    RLYKSGRVERFYEVHGSFYVPPSPQIPSSGVFSKDVTISPHVSARLYLPENIPNSRKIPV  77

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LVYYHGGG  ++SAF +  H Y+N L S+ NV+ VSVEYRLAPE  +P  YEDCW ALQW
Sbjct  78    LVYYHGGGLVIESAFFNRMHAYVNSLASELNVVVVSVEYRLAPEVDVPTIYEDCWTALQW  137

Query  795   VASHASNDGQQVP-LKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             +ASHA  +   V    + WL N  DF K+FV GDSAGGN+V+++ +RAG E LN   K+ 
Sbjct  138   IASHADENLSSVDNNNDSWLTNFCDFSKVFVVGDSAGGNLVYHMTMRAGKEGLNNDMKIT  197

Query  618   GGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGG----IDNPMIYPMAENAPSLAGLR  451
             G I ++PYF   N +  E+ +  K+W ++ P  + G    ID+P+I P+++ APSL+ L 
Sbjct  198   GSIFAYPYFLFPNVEIDEEGLANKIWGYICPPLECGVLSPIDSPLINPLSKKAPSLSRLG  257

Query  450   CSKLHVCVAEKDEL--REISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             C ++ VC+ +KD++   EI +R+VE VK+SGW     V     + H F +  P +++AK 
Sbjct  258   CLRILVCMGKKDDIIPLEIGVRFVEGVKESGWD-GEVVYLEVDDGHAFQMYKPESDEAKR  316

Query  276   TFKRIASFIQ  247
               K  A FI 
Sbjct  317   MMKCYADFIH  326



>ref|XP_010269100.1| PREDICTED: probable carboxylesterase 2 [Nelumbo nucifera]
Length=317

 Score =   270 bits (689),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 150/312 (48%), Positives = 199/312 (64%), Gaps = 20/312 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             P   +YKDG V+R+    +V  S  D  TGVSSKD+ + P   +S R+YLPK+    QKL
Sbjct  14    PFYVLYKDGHVKRLIGTDFVQAS-LDPQTGVSSKDVIIVPETGVSARLYLPKITDPHQKL  72

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+L+Y+HGGGF +++AFS  YH+YLN LV+QAN++AVSVEYR APE+PLP  Y+D W  L
Sbjct  73    PLLIYFHGGGFVIETAFSPTYHYYLNSLVAQANIVAVSVEYRRAPEYPLPIAYDDSWAVL  132

Query  801   QWVASHASN-DGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             QWV SH+ + DG      EPWL +H D ++IF+ GDSAG NI H++A+RAG   L    K
Sbjct  133   QWVVSHSMDQDG-----AEPWLRDHVDCKRIFLAGDSAGANIAHDMAMRAGATGL----K  183

Query  624   LLGGILSFPYFWSSNEKGGEQS------ILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             L G  L  PYFW     G E        +  K+W    P++ G  D+P I P+ E APSL
Sbjct  184   LRGIALIHPYFWGEKRIGSEAEDPDKAKMADKMWLLACPSSAGA-DDPRINPVGEGAPSL  242

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             + L CS+L VCV EKD L++  L Y E + KSGW GE E+++ +GE+H F + NP  EKA
Sbjct  243   SRLGCSRLLVCVGEKDILKDRGLIYYETLVKSGWSGEAEIMESQGEDHVFHLFNPTCEKA  302

Query  282   KDTFKRIASFIQ  247
                 KR+ SF+ 
Sbjct  303   VTLMKRLVSFVN  314



>ref|XP_004294833.1| PREDICTED: probable carboxylesterase 12-like [Fragaria vesca 
subsp. vesca]
Length=315

 Score =   269 bits (688),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 154/317 (49%), Positives = 203/317 (64%), Gaps = 24/317 (8%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKD--ITVSPNISVRVYLPKLASAT--  991
             SPL++VYKDGRVER+     VP S     TGV SKD  I+ SP IS R+Y+PK ++++  
Sbjct  10    SPLLKVYKDGRVERLLGTARVPASIHPQ-TGVQSKDVVISTSPPISARLYIPKSSASSES  68

Query  990   -QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDC  814
              QKLP+LVY+HGGGFC++SAFS  YH+YLN LVS+ANV+AVSV+YRLAPEHPLPA YED 
Sbjct  69    SQKLPVLVYFHGGGFCIESAFSPAYHNYLNSLVSEANVVAVSVDYRLAPEHPLPAAYEDS  128

Query  813   WEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNE-PLN  637
             W AL+WV SH +  G      E WL  H D  ++F  GDSAG NI H++ +R G+E P+ 
Sbjct  129   WAALKWVESHFAGMG-----PEEWLNRHADLNRVFFSGDSAGANIAHHMGLRVGSEKPVG  183

Query  636   QKSKLLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAE  478
                KL G +L  PYFW     GGE       +++L  +W F YP   G  D+P+  P  +
Sbjct  184   --FKLNGIVLVHPYFWGEEPIGGELALGESHRNLLATLWRFCYPLTSGS-DDPLYNPGKD  240

Query  477   NAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNP  298
               P L  + C K+ VCVAEKD L++    Y E +KKSGW G +EV++ + E+H F + NP
Sbjct  241   --PKLGEMGCEKVLVCVAEKDSLKDRGWYYSELLKKSGWNGVVEVMEAKEEQHVFHLFNP  298

Query  297   GTEKAKDTFKRIASFIQ  247
               + A    K+I SF+ 
Sbjct  299   TCDNAVAMLKKIVSFMN  315



>ref|XP_006379208.1| hypothetical protein POPTR_0009s10720g [Populus trichocarpa]
 gb|ERP57005.1| hypothetical protein POPTR_0009s10720g [Populus trichocarpa]
Length=313

 Score =   268 bits (686),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/312 (46%), Positives = 204/312 (65%), Gaps = 19/312 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQK  985
             SP +R+YKDG +ER+     VPP   D  + V S+D+  SP  ++S R+YLPK     QK
Sbjct  9     SPFLRLYKDGHIERLMGVDIVPPV--DPNSNVMSRDVVYSPALDLSCRLYLPKNTDPNQK  66

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVY+HGGGF +++AFSS YH+YLN LV++ANVI VSV+YR APEHPLPA Y+D W A
Sbjct  67    LPLLVYFHGGGFLIETAFSSTYHNYLNTLVAEANVIGVSVDYRRAPEHPLPAAYDDSWTA  126

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+WVASH + DG      E WL +H DF K+F  GDSAG NI H +A+R G E L     
Sbjct  127   LKWVASHVNGDG-----PEEWLNSHADFSKVFFNGDSAGANISHQMAMRHGQEKL-VGVN  180

Query  624   LLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G +L+ PYFW  +  G E      ++  + +W    PT+  G D+ ++ P+ +  P+L
Sbjct  181   VAGIVLAHPYFWGKDPIGNEPRESSQRAFAEGLWRLACPTSN-GCDDLLLNPLVD--PNL  237

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             AGL CSK+ V VAEKD LR+    Y E ++++GW GE+E+++ +GE H F +++P  E A
Sbjct  238   AGLECSKVLVAVAEKDLLRDRGWHYYEKLRENGWSGEVEIMEAKGESHVFHLLSPPGENA  297

Query  282   KDTFKRIASFIQ  247
             +   K+I+SF+ 
Sbjct  298   RLMLKKISSFLN  309



>ref|XP_008670244.1| PREDICTED: tuliposide A-converting enzyme 1, chloroplastic-like 
[Zea mays]
 tpg|DAA40257.1| TPA: hypothetical protein ZEAMMB73_795940 [Zea mays]
Length=327

 Score =   268 bits (685),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/315 (47%), Positives = 200/315 (63%), Gaps = 20/315 (6%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQ-----  988
              IRVYK GRVER      VP S  D+ATGV+SKD  VSP+++VR+YLP  A  T+     
Sbjct  18    FIRVYKSGRVERYFGSDPVPAS-TDTATGVASKDRAVSPDVAVRLYLPPPAKDTEDNGGS  76

Query  987   --KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDC  814
               KLPILVY+HGGGFC+ +AF+ ++H YL  L ++A  I VSVEYRLAPEHPLPA Y+D 
Sbjct  77    SKKLPILVYFHGGGFCLHTAFNFVFHAYLTSLAARARAIVVSVEYRLAPEHPLPAAYDDS  136

Query  813   WEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             W AL WVASHA+  G+++     WL +HGDF ++ VGGDSAG NI H++A+RAG EPL  
Sbjct  137   WRALLWVASHATGSGEEL-----WLTDHGDFSRLCVGGDSAGANIAHHMAMRAGAEPLPH  191

Query  633   KSKLLGGILSFPYFWSSNEKGGEQSI------LQKVWDFVYPTAKGGIDNPMIYPMAENA  472
              +++ G  +  PYF  ++    E++       +  +W  V P    G+D+P I P+A  A
Sbjct  192   GARISGAAIVHPYFLGADRVASEETDPALAENVVTMWRVVCPGTT-GLDDPWINPLAAGA  250

Query  471   PSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
             P L GL C+++ VC+AEKD  R+    Y   ++ SGW GE+EVV+V G+ HCF +++   
Sbjct  251   PGLEGLACARVLVCLAEKDVARDRGRAYAAELRASGWAGEVEVVEVNGQGHCFHLVDFAC  310

Query  291   EKAKDTFKRIASFIQ  247
               A      IA F+ 
Sbjct  311   SDAVAQDDAIARFVN  325



>emb|CAN61111.1| hypothetical protein VITISV_006466 [Vitis vinifera]
Length=323

 Score =   268 bits (684),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 203/316 (64%), Gaps = 18/316 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             P +RV+KDG+VER      VPPS  +  TGV+SKDI + P   +S R+Y+PK+   +QKL
Sbjct  15    PFLRVFKDGKVERFVGTDSVPPS-LNIETGVNSKDIVIEPETGVSARLYIPKINDQSQKL  73

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+LVY+HGG FC++++ S  YH+YL+ LV++ANV+AVS+EYR APEHPLP  Y+DCW A+
Sbjct  74    PLLVYFHGGAFCIETSSSPTYHNYLDSLVAEANVVAVSIEYRRAPEHPLPVAYDDCWAAV  133

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS-K  625
             +WV SH+++ G      EPWL ++ D + +F  GDSAG N+ HN+AIRAG       S K
Sbjct  134   KWVVSHSNSQG-----PEPWLNDYADLDXLFFAGDSAGANLSHNMAIRAGTRGHELGSVK  188

Query  624   LLGGILSFPYFWSSNEKGGEQSILQK------VWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G IL  PYFW  +  G E   LQK      +W FV PT   G D+P+I P  +  P L
Sbjct  189   VSGIILIHPYFWGKDPVGAEVKDLQKKGLVDSLWLFVCPTTS-GCDDPLINPATD--PKL  245

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             A L C ++ V VAEKD LR+    Y E + KSGW G +EV++ EGE+H F + NP  +KA
Sbjct  246   ASLGCQRVLVFVAEKDTLRDRGWFYHETLGKSGWSGVVEVMEAEGEDHVFHLFNPTCDKA  305

Query  282   KDTFKRIASFIQD*IC  235
                 K++A F+    C
Sbjct  306   VAMLKQMAMFLNXAQC  321



>ref|XP_008375948.1| PREDICTED: probable carboxylesterase 12 [Malus domestica]
Length=312

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 204/314 (65%), Gaps = 21/314 (7%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLAS-ATQ  988
             SP I+ YKDGRVER+     VPPS      GV SKD+ +S  P IS R+YLPK A+ +T 
Sbjct  10    SPFIKTYKDGRVERLLGTSTVPPSTPQ--IGVQSKDVVISQEPPISARLYLPKSATNSTD  67

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+L+Y+HGGGFCV+SAFS  YH+YLN LVS+ANV+AVSVEYRLAPEHPLPA Y+D W+
Sbjct  68    KLPLLIYFHGGGFCVESAFSPTYHNYLNSLVSEANVVAVSVEYRLAPEHPLPAAYDDSWD  127

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             A++WVASH   +G      E WL ++ D  ++F  GDSAG NI HN+A + G+E L+   
Sbjct  128   AVKWVASHFDGNGF-----EDWLNHYADCHRVFFAGDSAGANIAHNLASKLGSEGLD-GV  181

Query  627   KLLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
             KL G +L  PYFW +   GGE       +  +  +W FV+P+  G  D+ +I P  +  P
Sbjct  182   KLFGLVLIHPYFWGTEPVGGELTTPEATREFMAGMWRFVHPSTSGS-DDLLINPCKD--P  238

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
              LA L C K+ +  AEKD L++ +  Y E ++K GW G +EV++ +GEEH F +  P  E
Sbjct  239   KLAELGCEKVLIFAAEKDGLKDRAWHYGETLRKCGWSGAVEVIESKGEEHVFHLFKPTCE  298

Query  288   KAKDTFKRIASFIQ  247
              A    K+I+SF+ 
Sbjct  299   NAVAMKKKISSFLN  312



>ref|XP_011088283.1| PREDICTED: 2-hydroxyisoflavanone dehydratase [Sesamum indicum]
Length=365

 Score =   269 bits (687),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 147/313 (47%), Positives = 209/313 (67%), Gaps = 19/313 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP---NISVRVYLPKLASATQK  985
             P IRVYKDG V+R      VP S  D  TGV SKD+ ++    +IS R+YLPK A++T K
Sbjct  44    PFIRVYKDGTVKRFIGTEVVPAS-VDPTTGVRSKDVVITAPELHISARLYLPKYATSTHK  102

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVY+HGG F  +SAFS +YH++LN +V++ANV+AVSV YRLAPEHPLP GY+D W A
Sbjct  103   LPLLVYFHGGAFFTESAFSPLYHNHLNSIVAKANVVAVSVNYRLAPEHPLPIGYQDSWHA  162

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNE-PLNQKS  628
             L+WV SH+  +G      E WL N+ DF  +++GGDSAGGNI HN AIRAG E  +  + 
Sbjct  163   LKWVFSHSDGNGN-----ETWLKNYADFMHVYLGGDSAGGNIAHNTAIRAGLEHEMVHRV  217

Query  627   KLLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
              + G  L+ P+FW     G E      +++++ +W   YP +  G+D+P++ P  +  P+
Sbjct  218   VIDGMFLNCPHFWGKTPIGNEASKPKREALMESIWIHAYPNST-GLDDPLVNPAMD--PN  274

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L+ LRC ++ V VAEKD LR+    Y +A++KS W G ++VV+V+GE+H F I+ P + K
Sbjct  275   LSKLRCKRVLVYVAEKDILRDRGWYYEKALRKSKWDGVVKVVEVKGEDHDFSIIFPNSRK  334

Query  285   AKDTFKRIASFIQ  247
             AK   +++ASF+ 
Sbjct  335   AKIVLRQLASFLN  347



>ref|XP_011015827.1| PREDICTED: probable carboxylesterase 5 isoform X1 [Populus euphratica]
 ref|XP_011015828.1| PREDICTED: probable carboxylesterase 5 isoform X2 [Populus euphratica]
Length=311

 Score =   267 bits (682),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 144/307 (47%), Positives = 202/307 (66%), Gaps = 15/307 (5%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERI-CNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQ  988
             SP  R+YK+G+VERI  +   VPPS  D  TGV +KD  VS   ++SVR+++PK+   TQ
Sbjct  14    SPFFRIYKNGKVERITADTETVPPSI-DPLTGVQTKDTVVSQENSLSVRLFIPKITDPTQ  72

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+L+Y HGG FC++S FSS+YH+YL  LV  ANVIAVSV+YR APEHPLPA Y+D W 
Sbjct  73    KLPLLIYIHGGAFCIESPFSSLYHNYLTDLVHNANVIAVSVQYRRAPEHPLPAAYDDSWA  132

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             A+QWVASH + +G      E WL  H DF++ F+ GDSAG NI HN+A+RAG+       
Sbjct  133   AIQWVASHVNGEGS-----ESWLNGHADFDRTFLAGDSAGANIAHNMAVRAGSTNGLNGV  187

Query  627   KLLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRC  448
             K++G +L+ P+F  +     E      V +F++P+ +   D+P I P       LA L C
Sbjct  188   KIVGVVLAHPFFGDN-----EPDTFSPVIEFIFPSVR-IYDDPRINPAGAGGAELASLGC  241

Query  447   SKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFK  268
             +++ + VA KD LR+  +RY EA+K+SGW G +E+V+ EGE+H F ++NP   KA+   +
Sbjct  242   ARVLIFVAGKDGLRDRGVRYYEALKRSGWGGMVEIVETEGEDHVFHLLNPNCPKARVMME  301

Query  267   RIASFIQ  247
             ++ SFI 
Sbjct  302   KVVSFIN  308



>ref|XP_008236607.1| PREDICTED: probable carboxylesterase 12 [Prunus mume]
Length=315

 Score =   267 bits (683),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 152/315 (48%), Positives = 200/315 (63%), Gaps = 23/315 (7%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLA---SA  994
             SPLI++YKDGR+ER+     +PPS  D  T V SKD+ VS  P +S R+YLP  +   S 
Sbjct  10    SPLIKIYKDGRIERLTGTT-LPPS-LDPQTRVESKDVVVSKEPALSARLYLPTKSTTNSP  67

Query  993   TQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDC  814
              +KLP+LVY HGGGF V+ A SSIYH+YLN LV++ N++AVSVEYRLAPEH LPA Y+D 
Sbjct  68    NKKLPLLVYIHGGGFVVEHASSSIYHNYLNALVAETNIVAVSVEYRLAPEHSLPAAYDDA  127

Query  813   WEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             W +L+WVASH+   G      E WL  H DF+ +F+ GDSAG NI HNV +R G+E L  
Sbjct  128   WGSLKWVASHSDGKGS-----EDWLNRHADFQCVFIAGDSAGANIAHNVGLRVGSEGLGG  182

Query  633   KSKLLGGILSFPYFWSSNEKGGEQSI-------LQKVWDFVYPTAKGGIDNPMIYPMAEN  475
               K  G +L  PYFW S   G EQ++       +  +W   YP+  G  D+P+  P  + 
Sbjct  183   -VKPKGIVLVHPYFWGSEAIGAEQALPPVVREYMVGLWRLAYPSTSGS-DDPLFNPGKD-  239

Query  474   APSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPG  295
              P L GL C K+ VCVAEKD L++    Y E +KKSGWKG ++V++ +GE H F + NP 
Sbjct  240   -PKLGGLGCEKVLVCVAEKDALKDRGWNYSEVLKKSGWKGAVDVIESKGENHVFHLFNPT  298

Query  294   TEKAKDTFKRIASFI  250
              + A    K++ SFI
Sbjct  299   CDNAVALIKKMVSFI  313



>ref|XP_011016435.1| PREDICTED: probable carboxylesterase 2 [Populus euphratica]
Length=324

 Score =   267 bits (683),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 201/312 (64%), Gaps = 20/312 (6%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKLPI  976
             +RV+KDG VER+    ++PPS  D  TGVSSKDI V P  NI+ R++LPK+    +KL +
Sbjct  16    LRVHKDGHVERLIPTDFIPPS-TDPITGVSSKDIVVVPESNITARLFLPKITDPKEKLAV  74

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LVY+HGG F +++ F + +H ++  +VS+ANV+AVSV+YR APEHP+PA YED   AL+W
Sbjct  75    LVYFHGGAFVINTPFITPFHKFVTNIVSEANVVAVSVDYRKAPEHPIPAAYEDSMAALKW  134

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
             VASH+S DG      EPWL NH DF+++F+GGDS+G NI HN+A+ AGN        LLG
Sbjct  135   VASHSSGDG-----PEPWLNNHADFQQVFLGGDSSGANIAHNLAMTAGNPETGLSIGLLG  189

Query  615   GILSFPYFWSSNEKGGE-----------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
               L  PYFW S   G E           +  + +VW F+ P+     D+P + P+AE AP
Sbjct  190   IALVHPYFWGSVPVGSEADYPDDKSIINRDYVDRVWPFICPSNPDN-DDPRVNPVAEGAP  248

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
             SL GL C ++ VCVAE D +++    Y EA+ +SGWKG +E+ + +GE H F   +   E
Sbjct  249   SLGGLGCQRVLVCVAEHDLMKDRGWLYYEALSRSGWKGVVEIFETQGEHHGFHCSDLEHE  308

Query  288   KAKDTFKRIASF  253
             K+K   +R+A+F
Sbjct  309   KSKQLTQRLAAF  320



>ref|XP_011030271.1| PREDICTED: probable carboxylesterase 2 [Populus euphratica]
Length=324

 Score =   267 bits (682),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 200/312 (64%), Gaps = 20/312 (6%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKLPI  976
             + V+KDG VER+    ++PPS  D  TGVSSKD  V P  NI+ R++LPK+    +KL +
Sbjct  16    LHVHKDGHVERLIPTVFIPPS-TDPITGVSSKDTVVVPQSNITARLFLPKITDPKEKLAV  74

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LVY+HGG F +++ F + +H ++ ILVS+ANV+AVSV+YR APEHP+PA YED   AL+W
Sbjct  75    LVYFHGGAFVINTPFITPFHKFVTILVSEANVVAVSVDYRKAPEHPIPAAYEDSMAALKW  134

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
             VASH+S DG      EPWL NH DF+++F+GGDS+G NI HN+A+ AGN        LLG
Sbjct  135   VASHSSGDG-----PEPWLNNHADFQQVFLGGDSSGANIAHNLAMTAGNPETGLSIGLLG  189

Query  615   GILSFPYFWSSNEKGGE-----------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
               L  PYFW S   G E           +  + +VW F+ P+     D+P + P+AE AP
Sbjct  190   IALVHPYFWGSVPVGSEADYPDDKSIINRDYVDRVWPFICPSNPDN-DDPRVNPVAEGAP  248

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
             SL GL C ++ VCVAE D +++    Y EA+ +SGWKG +E+ + +GE H F   +   E
Sbjct  249   SLGGLGCQRVLVCVAEHDLMKDRGWLYYEALSRSGWKGVVEIFETQGEHHGFHCSDLEHE  308

Query  288   KAKDTFKRIASF  253
             K+K   +R+A+F
Sbjct  309   KSKQLTQRLAAF  320



>gb|ACU15060.1| unknown [Glycine max]
Length=267

 Score =   265 bits (676),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 138/254 (54%), Positives = 174/254 (69%), Gaps = 16/254 (6%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN----ISVRVYLPKLA-SATQK  985
             IRV+KDG VER  ++P VPP+     TG+SSKDIT+S +    IS R+YLP +  S T+K
Sbjct  18    IRVFKDGTVERPLDFPIVPPT---LNTGLSSKDITISHHPPKPISARIYLPNITNSQTKK  74

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LPI VY+HGGGF  +SAFS +++ +   LV QAN+I VSVEYRLAPEHP PA Y+DCW+A
Sbjct  75    LPIYVYFHGGGFFFESAFSKLFNDHFLKLVPQANIIVVSVEYRLAPEHPPPAAYDDCWDA  134

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNV-AIRAGNEPLNQKS  628
             L+WVASH++ D       E WL  HGDF ++F+GGDSAG NIVHN+ + R G EPL    
Sbjct  135   LKWVASHSTKDTTPN-NTESWLTEHGDFNRVFIGGDSAGANIVHNILSFRVGPEPLPGDV  193

Query  627   KLLGGILSFPYFWSSNEKGG------EQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             ++LG IL+ PYF+ S   G       EQ+    VW  VYP+A GGIDNP I P+   APS
Sbjct  194   QILGSILAHPYFYGSEPVGSEPVTGLEQNFFNLVWKLVYPSAPGGIDNPFINPLGAGAPS  253

Query  465   LAGLRCSKLHVCVA  424
             LA L CS++ VCVA
Sbjct  254   LAELACSRMLVCVA  267



>ref|XP_009350610.1| PREDICTED: probable carboxylesterase 12 [Pyrus x bretschneideri]
Length=312

 Score =   266 bits (680),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 203/314 (65%), Gaps = 21/314 (7%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLAS-ATQ  988
             SP I+ YKDGRVER+     VPPS      GV SKD+ +S  P IS R+YLPK A+ +T 
Sbjct  10    SPFIKTYKDGRVERLLGTSTVPPS--TPQIGVQSKDVVISQEPPISARLYLPKSATNSTD  67

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+LVY+HGGGFCV+SAFS  YH+YLN LVS+ANV+AVSVEYRLAPEHPLPA Y D W+
Sbjct  68    KLPLLVYFHGGGFCVESAFSPTYHNYLNSLVSEANVVAVSVEYRLAPEHPLPAAYNDSWD  127

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             A++WVASH   +G      E WL  + D  ++F  GDSAG NI +N+A + G+E L+   
Sbjct  128   AIKWVASHFDGNGF-----EDWLNRYADCHRVFFAGDSAGANIAYNLASKLGSEGLD-GV  181

Query  627   KLLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
             KL G +L  PYFW +   GGE       +  +  +W FV+P+  G  D+P+I P  +  P
Sbjct  182   KLFGLVLIHPYFWGTEPVGGELTTPEAPREFMASMWRFVHPSTSGS-DDPLINPCKD--P  238

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
              LA L C K+ +  AEKD L++ + +Y E ++K G    +EV++ +GEEH F + NP  E
Sbjct  239   KLAELGCEKVLIFAAEKDVLKDRAWQYGETLRKCGCCAAVEVIESKGEEHVFHLFNPTCE  298

Query  288   KAKDTFKRIASFIQ  247
              A    K+I+SF+ 
Sbjct  299   NAVAMKKKISSFLN  312



>ref|XP_010943012.1| PREDICTED: tuliposide A-converting enzyme 2, chloroplastic-like 
[Elaeis guineensis]
Length=318

 Score =   266 bits (679),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 157/316 (50%), Positives = 197/316 (62%), Gaps = 23/316 (7%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPS--PEDSATGVSSKDITVSPN--ISVRVYLPKLA-SAT  991
             P IR YK GR+ER  +   +P +  PE    GVSSKD+ + P+  +S R+YLP L  +  
Sbjct  13    PFIRRYKSGRIERFYSADPIPAAIDPE----GVSSKDVAIDPDTGVSARLYLPNLPDTPP  68

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
             +KLP+ VY+HGGGF V SAFS   H YLN LV+QANVIAVSVEYRLAPEHPLP  YED W
Sbjct  69    KKLPVFVYFHGGGFVVGSAFSPTTHAYLNSLVAQANVIAVSVEYRLAPEHPLPIAYEDSW  128

Query  810   EALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
              AL+WVASHA+  G      E WL  HGDF +IF+ G SAGGNI H++A+RAG   L   
Sbjct  129   AALKWVASHAAGGGA-----EAWLTEHGDFGRIFLAGCSAGGNIAHHMALRAGAADLGPG  183

Query  630   SKLLGGILSFPYFWSSN-------EKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENA  472
              ++ G  L  PYF   +       +KG ++  +  +W    P    G+D+P++ P+AE A
Sbjct  184   VRIRGMALVHPYFGGRDPLPSELVDKGLKEK-MDGMWVLACPGTV-GMDDPLVNPLAEAA  241

Query  471   PSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
             PSL GL C K+ VCVAEKD LRE    Y E VK+SGW GE+E  + EGE H F  M    
Sbjct  242   PSLKGLGCKKVLVCVAEKDVLRERGRVYYEGVKRSGWGGELEWFESEGEGHAFHFMKLSC  301

Query  291   EKAKDTFKRIASFIQD  244
             EKA +  +R   FI D
Sbjct  302   EKALELMERTVKFIND  317



>ref|XP_010066037.1| PREDICTED: probable carboxylesterase 7 [Eucalyptus grandis]
Length=315

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 141/314 (45%), Positives = 204/314 (65%), Gaps = 19/314 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASAT-Q  988
             SP  R+YKDGRVER      VPPS  D  TGV SKD+ +SP+  +S R+Y+PK A+ + Q
Sbjct  10    SPYARIYKDGRVERFLGTETVPPS-LDEKTGVQSKDVAISPDSAVSARLYIPKAATGSLQ  68

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+LVY+HGGGF ++SA S  YH+YLN LV++AN+IA+SV+YR APEHP+PA Y+D W 
Sbjct  69    KLPVLVYFHGGGFIIESAQSPTYHNYLNALVAEANIIAISVDYRSAPEHPIPAAYDDSWT  128

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             AL+WVASH++ +G      E WL +HG+ +K+F+ GDSAG NIV+N+ IR G E LN   
Sbjct  129   ALKWVASHSTRNG-----PEDWLNSHGNLKKVFMAGDSAGANIVNNMGIRLGEEKLN-GI  182

Query  627   KLLGGILSFPYFWS------SNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             +  GGI+  PYFW          +  ++S+++  W    PT   G D+P++ P  +  P 
Sbjct  183   EFRGGIMVHPYFWGEEPLPLETTEPKKRSLIRDFWRAASPTTT-GCDDPLMNPATD--PR  239

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L+    +++ +CVAE D  R+    Y E + KSGW G +EV++  GE+H F + NP ++ 
Sbjct  240   LSSFNVNRVLICVAEIDMFRQRGWYYKEVLSKSGWSGVVEVMEAPGEDHMFHMSNPSSDN  299

Query  285   AKDTFKRIASFIQD  244
             A    K++ +F+ +
Sbjct  300   AAKMMKKLVTFMNE  313



>ref|XP_008805888.1| PREDICTED: tuliposide A-converting enzyme 2, chloroplastic-like 
[Phoenix dactylifera]
Length=319

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 151/312 (48%), Positives = 197/312 (63%), Gaps = 16/312 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLAS-ATQK  985
             P IR YK GR+ER   +P   P+  D  TGV+SKD+ + P   +SVR++LPKL   A +K
Sbjct  13    PFIRQYKSGRIERF-YFPRNTPAAFDPETGVTSKDVVIDPETGVSVRLFLPKLGDIARKK  71

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LPI VY+HGGGF + SAF    HHYL  LV++ANVIAVSV+YRLAPEHPLP  YED W A
Sbjct  72    LPIYVYFHGGGFVIGSAFDPPSHHYLTPLVARANVIAVSVDYRLAPEHPLPIAYEDSWAA  131

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+WVASHA+  G      E WL  HGDF +IF+ G SAGGNI H++A+RAG   L  + +
Sbjct  132   LKWVASHAAGGGT-----EAWLAEHGDFGRIFLDGCSAGGNIAHHMALRAGTAELGPEVR  186

Query  624   LLGGILSFPYFW------SSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G +L  PYF       S     G +  +  +W    P    G+D+P++ P+AE APSL
Sbjct  187   IRGMVLIHPYFGGREPFPSELADMGLKEKMDGMWVLACPGTV-GMDDPLVNPLAEAAPSL  245

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
              GL C KL VCVA+KD L+E    Y + V++SGW GE+E ++ EGE H F +     EKA
Sbjct  246   KGLGCEKLLVCVADKDILKERGRAYYDGVQRSGWGGEMEWLESEGEGHGFHVQKFNCEKA  305

Query  282   KDTFKRIASFIQ  247
              +  +R   FI+
Sbjct  306   VELMERTVKFIR  317



>ref|XP_010677107.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Beta vulgaris 
subsp. vulgaris]
Length=342

 Score =   266 bits (679),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 147/315 (47%), Positives = 193/315 (61%), Gaps = 23/315 (7%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQK  985
             SPLIRVY DG VER+   P VP + ED  TGV+SKDIT+SP  N+  R++LPKL    QK
Sbjct  39    SPLIRVYTDGSVERLWGPPTVPATLEDPETGVASKDITLSPTTNLIARLHLPKLTQQNQK  98

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LPI+VY+HGGGFC+ SAFSS  H Y+N L ++A+ + V+V+YRLAPEHPLPA Y D W A
Sbjct  99    LPIVVYFHGGGFCLKSAFSSTEHRYMNFLATEAHALIVNVKYRLAPEHPLPAAYNDGWTA  158

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L  +AS          + EPW+ NHG+   IFVGGDSAG NI HN+A+RAG+E LN   K
Sbjct  159   LNSLAS----------IDEPWITNHGNLNTIFVGGDSAGANIAHNLAMRAGSETLNNGIK  208

Query  624   LLGGILSFPYFWS---------SNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENA  472
             L G  L  PYF            ++ G  +      W   YP A  G ++ MI P  ++A
Sbjct  209   LRGIYLCHPYFLGPKRVGTRDPKHDMGFNKERAYDTWKLAYPGA--GPNHYMINPSVKDA  266

Query  471   PSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
             PSL GL C K+ V   E D++ +  + Y   +K+SG+ G +E+ +V+ E H F + NP  
Sbjct  267   PSLKGLGCEKVLVITGENDDIVDWGVLYYNGLKESGYGGNVELFEVKDEGHSFQVFNPTC  326

Query  291   EKAKDTFKRIASFIQ  247
             E AK   + +ASF  
Sbjct  327   ENAKLMIQCLASFFH  341



>ref|XP_002285067.1| PREDICTED: probable carboxylesterase 2 [Vitis vinifera]
Length=322

 Score =   265 bits (676),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 196/313 (63%), Gaps = 20/313 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             P +RV+KDGRVER      VPPS  +   GV SKDI + P   IS R+Y+PK+   +QKL
Sbjct  15    PFLRVFKDGRVERFLGNDTVPPS-LNVENGVHSKDIVIEPETGISARLYIPKITYPSQKL  73

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+L+Y+HGGGFC++++ S  YH+YL+ LV++ NV+AVSV YR APE PLP  Y+DCW A 
Sbjct  74    PLLIYFHGGGFCIETSSSPTYHNYLDSLVAEGNVVAVSVNYRRAPEDPLPVAYDDCWTAF  133

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS--  628
             +WV SH+++ G      EPWL +H DF  +F+ GD AG N+ HN+AIRAG   +N+    
Sbjct  134   KWVVSHSNSQGL-----EPWLNDHADFNHLFLAGDDAGANLAHNMAIRAGTR-VNELGGV  187

Query  627   KLLGGILSFPYFWSSNEKGGEQSILQK------VWDFVYPTAKGGIDNPMIYPMAENAPS  466
             K+ G IL  PYFW  +  G E + LQK      +W FV PT   G D+P+I P  +  P 
Sbjct  188   KVSGIILVHPYFWGKDPIGSEMNDLQKKARVDTLWHFVCPTTS-GCDDPLINPATD--PQ  244

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L  L C K+ + +AEKD LR+    Y E + KSGW G +++ + E E+H F I  P  EK
Sbjct  245   LRSLGCQKVLIFLAEKDMLRDRGWFYYETLGKSGWDGVVDLTEAEAEDHVFHIFKPTCEK  304

Query  285   AKDTFKRIASFIQ  247
             A    KR+A F+ 
Sbjct  305   AVAMRKRMALFLN  317



>ref|XP_007042380.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOX98211.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=305

 Score =   264 bits (675),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 141/305 (46%), Positives = 207/305 (68%), Gaps = 19/305 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             PL RVYKDGR+ER+     VPPS  D  TGV SKD  V P  ++S R++LPK+   T K+
Sbjct  17    PLFRVYKDGRIERLRETETVPPS-NDPQTGVQSKDTIVLPESSLSARLFLPKITDPTAKI  75

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+++Y HGG FC++S FS +YH+YL  LV++ANVIAV+++YR APE+PLP  Y+D W A+
Sbjct  76    PLVIYIHGGAFCIESPFSPLYHNYLTSLVNKANVIAVAIQYRKAPEYPLPIAYDDAWTAI  135

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WVASHA+ DG      EPWL +H DFE++F  GDSAG NI HN+ ++AG + L    KL
Sbjct  136   KWVASHANRDG-----PEPWLNDHADFERVFFAGDSAGANIAHNMTMKAGADGL-IGVKL  189

Query  621   LGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCSK  442
             +G +L  P+F  +NE         ++ ++++P++  G ++P + P A     LAGL CS+
Sbjct  190   VGMLLMNPFF-RNNEP-------DELIEYIFPSS-SGCNDPRMNP-ASAIKELAGLACSR  239

Query  441   LHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFKRI  262
             + VCV+EKD L++  + Y EAV+KSGW G I++V+  GE+H F + +P ++KA D   ++
Sbjct  240   VLVCVSEKDFLKDRGVTYYEAVRKSGWDGVIDIVETPGEKHVFYLFDPSSQKAMDLMDQV  299

Query  261   ASFIQ  247
             +SF+ 
Sbjct  300   SSFLN  304



>ref|XP_006660708.1| PREDICTED: tuliposide A-converting enzyme 1, chloroplastic-like 
[Oryza brachyantha]
Length=324

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 142/315 (45%), Positives = 202/315 (64%), Gaps = 18/315 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASAT----  991
             +P IR++K GRVER      VP S  D+ATGV+SKD  +SP+++VR+YLP +A A+    
Sbjct  16    APFIRIFKGGRVERDFGSDPVPAS-TDAATGVASKDRAISPDVAVRLYLPPVAGASGEGG  74

Query  990   -QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDC  814
              +KLP+LVY+HGGGFC+ +AF++++H YL  L ++   + VSV+YRLAPEHP+PA YED 
Sbjct  75    ARKLPLLVYFHGGGFCLHTAFNAVFHAYLTSLAARTRAVVVSVDYRLAPEHPIPAAYEDS  134

Query  813   WEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             W+A+ W ASHAS  G+     E WL +H DF ++++ G+SAG NI HNVA+RAG E L  
Sbjct  135   WQAVVWAASHASGAGE-----EAWLTDHADFSRMYLAGESAGANIAHNVAMRAGAEGLPN  189

Query  633   KSKLLGGILSFPYFWSSNEKGGEQ------SILQKVWDFVYPTAKGGIDNPMIYPMAENA  472
               K+ G +L  PYF    +   E         + K+W  V P    G+D+P I P+A  A
Sbjct  190   GGKINGVVLVHPYFLGRGKIPSEDLDPVMAENVVKMWSVVCPGTT-GVDDPWINPLAGGA  248

Query  471   PSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
             P+L GL C ++ VC+AE D +R+    Y E +K SGW GE+EV++V G  HCF +++   
Sbjct  249   PALDGLACGRVLVCLAETDVIRDRGRAYCEGLKASGWPGELEVLEVAGHGHCFHLVDFNG  308

Query  291   EKAKDTFKRIASFIQ  247
             E+A      IA F++
Sbjct  309   EEAVKQDDAIAKFVR  323



>ref|XP_006374969.1| hypothetical protein POPTR_0014s03220g [Populus trichocarpa]
 gb|ERP52766.1| hypothetical protein POPTR_0014s03220g [Populus trichocarpa]
Length=329

 Score =   265 bits (676),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 142/314 (45%), Positives = 200/314 (64%), Gaps = 20/314 (6%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKLPI  976
             +RV+KDG VER+    ++PPS  D  TGVSSKDI V P  NI+ R++LPK+    +KL +
Sbjct  16    LRVHKDGHVERLRPTDFIPPS-TDPITGVSSKDIVVVPESNITARLFLPKITDPNKKLAL  74

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LVY+HGG F +++ F++ +H ++  LVS+ANV+AVSV+YR APEHP+PA YED   AL+W
Sbjct  75    LVYFHGGAFVINTPFTTPFHKFVTNLVSEANVVAVSVDYRKAPEHPIPAAYEDSMAALKW  134

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
             VASH++ DG      EPWL NH DF+++F+GGDS+G NI HN+A+ AGN        LLG
Sbjct  135   VASHSNGDG-----PEPWLNNHADFQRVFLGGDSSGANIAHNLAMTAGNPETGLSIGLLG  189

Query  615   GILSFPYFWSSNEKGGE-----------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
               L  PYFW S   G E           +  + +VW F+ P+     D+P + P+AE AP
Sbjct  190   IALVHPYFWGSVPVGSEADYPDDKSVINRDYVDRVWPFICPSNPEN-DDPRVNPVAEGAP  248

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
              L GL C ++ VCVAE D +++    Y EA+ +SGW G +E+ + +G  H F   +   E
Sbjct  249   RLVGLGCKRVLVCVAEHDVMKDRGWLYYEALSRSGWMGVVEIFETQGGHHGFYCNDLEPE  308

Query  288   KAKDTFKRIASFIQ  247
             K+K   +R+A+F Q
Sbjct  309   KSKQLTQRLAAFYQ  322



>ref|XP_010066042.1| PREDICTED: probable carboxylesterase 12 [Eucalyptus grandis]
Length=315

 Score =   264 bits (674),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 140/314 (45%), Positives = 205/314 (65%), Gaps = 19/314 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLAS-ATQ  988
             SP  R+YKDGRVER+     VPPS  D  TGV SKD+ +SP+  +SVR+Y+PK A+ + Q
Sbjct  10    SPYARIYKDGRVERLLGTETVPPS-LDEKTGVQSKDVAISPDSAVSVRLYIPKAATDSLQ  68

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+LVY+HGGGF ++SA S  YH+YLN LV++AN+IA+SV+YR APEHPLPA Y+D W 
Sbjct  69    KLPVLVYFHGGGFIIESAQSPTYHNYLNALVAEANIIAISVDYRRAPEHPLPAAYDDSWT  128

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
              L+WVASH++ +G      E WL +H + +K+F+ GDSAG NI++N+ IR G E LN   
Sbjct  129   TLKWVASHSTRNG-----PEDWLNSHANLKKVFMAGDSAGANIINNMGIRLGEEKLN-GI  182

Query  627   KLLGGILSFPYFWSS------NEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             +  GGI+  PYFW          +  ++S+++ +W    PT   G D+P++ P  +  P 
Sbjct  183   EFRGGIMVHPYFWGDEPLPLETTEPKKRSLIRDLWRAASPTTP-GCDDPLMNPATD--PR  239

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L+    +++ +CVAEKD  R+    Y E + +SGW G +EV++  GE+H F + NP  + 
Sbjct  240   LSSFNVNRVLICVAEKDIFRQRGWYYKEVLSESGWSGVVEVMEAPGEDHIFHLSNPSCDN  299

Query  285   AKDTFKRIASFIQD  244
             A    K++ +F+ +
Sbjct  300   AAKMMKKLVTFVNE  313



>ref|XP_010066041.1| PREDICTED: probable carboxylesterase 12 [Eucalyptus grandis]
Length=315

 Score =   264 bits (674),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 140/314 (45%), Positives = 203/314 (65%), Gaps = 19/314 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLAS-ATQ  988
             SP  R+YKDGRVER+     VPPS  D  TGV SKD+ +SP+  +SVR+Y+PK A+ + Q
Sbjct  10    SPYARIYKDGRVERLLGTETVPPS-LDEKTGVQSKDVAISPDSAVSVRLYIPKAATDSLQ  68

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+LVY+HGGGF ++SA S  YH+YLN LV++AN+IA+SV+YR APEHPLPA Y+D W 
Sbjct  69    KLPVLVYFHGGGFIIESAQSPTYHNYLNALVAEANIIAISVDYRRAPEHPLPAAYDDSWT  128

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
              L+WVASH++ +G      E WL +H + +K+F+ GDSAG NI++N+ IR G E LN   
Sbjct  129   TLKWVASHSTRNG-----PEDWLNSHANLKKVFMAGDSAGANIINNMGIRLGEEKLN-GI  182

Query  627   KLLGGILSFPYFWSS------NEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             +  GGI+  PYFW          +  ++S++   W    PT   G D+P++ P  +  P 
Sbjct  183   EFRGGIMVHPYFWGDEPLPLETTEPKKRSLIMDFWHAASPTTT-GCDDPLMNPATD--PR  239

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L+    +++ +CVAEKD  R+    Y E + +SGW G +EV++  GE+H F + NP  + 
Sbjct  240   LSSFNVNRVLICVAEKDMFRQRGWYYKEVLSESGWSGVVEVMEAPGEDHIFHLSNPSCDN  299

Query  285   AKDTFKRIASFIQD  244
             A    K++ +F+ +
Sbjct  300   AAKMMKKLVTFVNE  313



>ref|XP_008775309.1| PREDICTED: probable carboxylesterase 12 [Phoenix dactylifera]
Length=322

 Score =   264 bits (674),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 146/311 (47%), Positives = 198/311 (64%), Gaps = 15/311 (5%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASA-TQKL  982
             +IRVYK GR+ER+     VP +  D  TGV+SKD+T+ P+  +S R++LP L++A  +KL
Sbjct  14    IIRVYKSGRIERLVGTDTVP-AGVDPDTGVTSKDVTIDPSTAVSARLHLPNLSNAPNKKL  72

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             PILVYYHGGGFC  SAFSS Y H++  LV+Q+ ++ VSV YRLAPEHPLP  Y+D W AL
Sbjct  73    PILVYYHGGGFCSQSAFSSTYFHFIKTLVAQSGILLVSVNYRLAPEHPLPIAYDDSWAAL  132

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WVASH+   G      E WL  HGDF ++F+ GDS+G NI H++A+RAG E L    ++
Sbjct  133   RWVASHSGGGGG----PEAWLSEHGDFLRVFLAGDSSGANIAHHMALRAGAEGLGPGIRI  188

Query  621   LGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              G IL  PYFW       E      +S  +  W  V P    G+D+P+I P++E AP L 
Sbjct  189   EGLILFHPYFWGKEPVESEPALPEFRSYQEAFWRLVCPGTAKGLDDPLINPLSEGAPGLE  248

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
             GL   +  VC+AE DELR     Y E +K SGW+GE E+V+ EGE H F +M P  ++A 
Sbjct  249   GLAGERTLVCLAE-DELRWRGRAYYERLKGSGWRGEAELVESEGEYHVFHLMKPDCQQAL  307

Query  279   DTFKRIASFIQ  247
                +R+  F++
Sbjct  308   LLMERVVEFLK  318



>ref|XP_002285064.2| PREDICTED: probable carboxylesterase 2 [Vitis vinifera]
Length=391

 Score =   266 bits (680),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 202/312 (65%), Gaps = 18/312 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             P +RV+KDG+VER      VPPS  +  TGV+SKDI + P   +S R+Y+PK+   +QKL
Sbjct  83    PFLRVFKDGKVERFVGTDSVPPS-LNIETGVNSKDIVIDPETGVSARLYIPKINDQSQKL  141

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+LVY+HGG FC+++  S  YH+YL+ LV++ANV+AVS+EYR APEHPLP  Y+DCW A+
Sbjct  142   PLLVYFHGGAFCIETFSSPTYHNYLDSLVAEANVVAVSIEYRRAPEHPLPVAYDDCWAAV  201

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS-K  625
             +W+ SH+++ G      EPWL ++ D +++F  GDSAG N+ HN+AIRAG       S K
Sbjct  202   KWLVSHSNSQG-----PEPWLNDYADLDRLFFAGDSAGANLSHNMAIRAGTRGHELGSVK  256

Query  624   LLGGILSFPYFWSSNEKGGEQSILQK------VWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G IL  PYFW  +  G E   LQK      +W FV PT   G D+P+I P  +  P L
Sbjct  257   VSGIILIHPYFWGKDPVGAEVKDLQKKGLVDSLWLFVCPTTS-GCDDPLINPATD--PKL  313

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             A L C ++ V VAEKD LR+    Y E + KSGW G +EV++ EGE+H F + NP  +KA
Sbjct  314   ASLGCQRVLVFVAEKDTLRDRGWFYHETLGKSGWSGVVEVMEAEGEDHVFHLFNPTCDKA  373

Query  282   KDTFKRIASFIQ  247
                 K++A F+ 
Sbjct  374   VAMLKQMAMFLN  385



>emb|CDP07665.1| unnamed protein product [Coffea canephora]
Length=312

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 147/306 (48%), Positives = 198/306 (65%), Gaps = 15/306 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             P  RVYKDGR+ER   +PY PPS ED  TGV SKDI + P  N+SVR+YLP+  +  +KL
Sbjct  15    PYFRVYKDGRIERFTEFPYTPPS-EDPQTGVKSKDILIPPENNVSVRLYLPRTTTPDEKL  73

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             PI++Y HGG F ++SAFS +YH YLN L ++A  IAVS+EYRLAPEHP PA Y+D W A 
Sbjct  74    PIIIYIHGGAFVIESAFSRVYHPYLNSLAAEAKAIAVSIEYRLAPEHPFPACYDDSWIAF  133

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNE-PLNQKSK  625
             +WV +HAS+   Q P  E W+ NH DF +IF+ GDSAG NI H+V +RA  +     + K
Sbjct  134   EWVLAHASS--AQGP--EAWINNHADFARIFLAGDSAGANIAHDVMVRASEKIGPGDEVK  189

Query  624   LLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCS  445
             + G IL  PYF       G+   L K+   + P +    D+P ++PMA +   L+ L C 
Sbjct  190   IAGMILVHPYF-----GDGKPDKLDKLLSLIAPDS-SICDDPRLHPMA-HPDLLSRLVCK  242

Query  444   KLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFKR  265
             ++ V  AEKD +RE SL Y  A+KKS W GE+E+++ E E HCF + NP +E+A+   KR
Sbjct  243   RVLVLTAEKDFVRERSLLYYSALKKSRWDGELEMMETEEEGHCFHLPNPTSERARVLMKR  302

Query  264   IASFIQ  247
             I +F+ 
Sbjct  303   IVTFVN  308



>gb|AFV95085.1| carboxylesterase 1 [Solanum lycopersicum]
 gb|AFV95087.1| carboxylesterase 1 [Solanum cheesmaniae]
 gb|AFV95089.1| carboxylesterase 1 [Solanum galapagense]
Length=339

 Score =   264 bits (675),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 150/338 (44%), Positives = 203/338 (60%), Gaps = 45/338 (13%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             PL+RVYKDGR+ER+    +VPP   D  TGV  KD+ + P  N+S R+YLPK     QK+
Sbjct  10    PLMRVYKDGRIERLAGEGFVPPE-SDPETGVQIKDVQIDPQINLSARLYLPKNVDPVQKI  68

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+ VY+HGGGF ++SAFS  YH YL+++ ++A V  VSV YRLAPE+PLP  YED W AL
Sbjct  69    PLFVYFHGGGFVIESAFSPTYHKYLSLVAAEAKVAIVSVNYRLAPEYPLPIAYEDSWLAL  128

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WV SHA+ DG     +EPWL ++ DF ++F+GGDSAGGNI H++ IR G E   +  K+
Sbjct  129   KWVTSHANGDG-----REPWLKDYADFNRVFLGGDSAGGNIAHHIGIRLGLEKF-EGVKI  182

Query  621   LGGILSFPYFWSSNEKGGE---------------------------------QSILQKVW  541
              G  L+ PYFW  +   GE                                 + + +K+W
Sbjct  183   DGIFLACPYFWGKDRIEGEGENLLAKDFVEDLVLIGNPNSTGLDKDPIDLGSKDLFEKLW  242

Query  540   DFVYPTAKGGIDNPMIYPMAENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGW  361
              FV PT+  G+D+P+I P  E  P L+GL C KL V VA KD LR     Y E ++KSGW
Sbjct  243   LFVNPTSS-GLDDPLINP--EKDPKLSGLGCDKLVVYVAGKDPLRFRGFYYKEVLEKSGW  299

Query  360   KgeievvdvegeEHCFPIMNPGTEKAKDTFKRIASFIQ  247
              G +EVV+V+G+ H F +  P  E+A    K++ASF+ 
Sbjct  300   PGTVEVVEVKGKGHVFHLFVPEAEEAIAMLKKLASFLN  337



>ref|XP_009346270.1| PREDICTED: probable carboxylesterase 12 [Pyrus x bretschneideri]
 ref|XP_009346271.1| PREDICTED: probable carboxylesterase 12 [Pyrus x bretschneideri]
Length=312

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 151/314 (48%), Positives = 201/314 (64%), Gaps = 21/314 (7%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLAS-ATQ  988
             SP I+ YKDGRVER+     VPPS      GV SKD+ +S  P IS R+YLPK A+ +T 
Sbjct  10    SPFIKTYKDGRVERLLGTSTVPPS--TPLIGVQSKDVVISQEPPISARLYLPKSATNSTD  67

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+LVY+HGGGFCV+SAFS  YH+YLN LVS+ANV+A+SVEYRLAPEHPLPA Y D W+
Sbjct  68    KLPLLVYFHGGGFCVESAFSPTYHNYLNSLVSEANVVAISVEYRLAPEHPLPAAYNDSWD  127

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             A++WVASH   +G      E WL  + D  ++F  GDSAG NI +N+A + G+E L+   
Sbjct  128   AVKWVASHFDGNGF-----EDWLNRYADCHRVFFAGDSAGANIAYNLASKLGSEGLDG-V  181

Query  627   KLLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
             KL G +L  PYFW     GGE       +  +  +W FV+P+  G  D+P+I P  +  P
Sbjct  182   KLFGLVLIHPYFWGIEPVGGELTTPEATREFMAGLWRFVHPSTSGS-DDPLINPCKD--P  238

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
              LA L C K+ +  AEKD L++ +  Y E ++K G    +EV++ +GEEH F + NP  E
Sbjct  239   KLAALGCEKVLIFAAEKDVLKDRAWHYGETLRKCGCCAAVEVIESKGEEHVFHLFNPTCE  298

Query  288   KAKDTFKRIASFIQ  247
              A    K+I+SF+ 
Sbjct  299   NAVAMKKKISSFLN  312



>ref|XP_004505200.1| PREDICTED: probable carboxylesterase 12-like [Cicer arietinum]
Length=321

 Score =   263 bits (672),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 148/317 (47%), Positives = 199/317 (63%), Gaps = 22/317 (7%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLAS----  997
             SPL+++Y++G VER+     VPPS  D  T V SKD+T+S   NIS R+++PKL +    
Sbjct  13    SPLLKLYRNGHVERLSGCDVVPPS-FDPTTNVESKDVTISKENNISARIFIPKLNNHDPI  71

Query  996   ATQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYED  817
              TQKLP+LVY+HGGGFC+ + FS  YH +LN +VSQ NVIAVSV YR APEHPLP  Y+D
Sbjct  72    QTQKLPLLVYFHGGGFCIQTPFSQKYHKFLNSIVSQTNVIAVSVHYRRAPEHPLPIAYQD  131

Query  816   CWEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLN  637
              WE+L+WVASH + +G      + W+  + DFEK+F  GDSAG NI H++ IR G E L 
Sbjct  132   SWESLKWVASHINGNGS-----DEWINRYADFEKVFFSGDSAGANIAHHMGIRVGTEGL-  185

Query  636   QKSKLLGGILSFPYFWSSNEKGGEQS------ILQKVWDFVYPTAKGGIDNPMIYPMAEN  475
             Q   L G +L   YFW +   G E        +L+ +W FV PT  G  D+P+I P  E 
Sbjct  186   QGVNLEGIVLVHSYFWGAERIGSEAEKSEHLGLLENLWRFVCPTTIGS-DDPLINP--EK  242

Query  474   APSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPG  295
              P+L  L C K+ +CVAEKD L++    Y E + K GW G +E+V+ +GE+H F + NP 
Sbjct  243   DPNLGKLGCKKVLICVAEKDLLKDRGWYYKELLHKIGWGGVVEIVETKGEDHVFHLFNPN  302

Query  294   TEKAKDTFKRIASFIQD  244
              + A     +I SFI +
Sbjct  303   CDNAFSLLNQITSFITN  319



>ref|NP_001063400.1| Os09g0462200 [Oryza sativa Japonica Group]
 dbj|BAD38548.1| putative PrMC3 [Oryza sativa Japonica Group]
 dbj|BAF25314.1| Os09g0462200 [Oryza sativa Japonica Group]
 dbj|BAG89178.1| unnamed protein product [Oryza sativa Japonica Group]
Length=324

 Score =   263 bits (673),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 143/312 (46%), Positives = 198/312 (63%), Gaps = 18/312 (6%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASAT-----QK  985
             IR++K GRVER      VP S  D+ATGV+SKD  +SP++SVR+YLP +A  +     +K
Sbjct  19    IRIFKGGRVERYFGSDSVPAS-TDAATGVASKDRAISPDVSVRLYLPPVAGVSGEGEGKK  77

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+L+Y+HGGGFC+ +AF+ ++H YL  L ++   I VSVEYRLAPEHPLPA YED W+A
Sbjct  78    LPLLIYFHGGGFCLHTAFNFVFHAYLTSLAARTRAIVVSVEYRLAPEHPLPAAYEDSWQA  137

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             + W ASHA   G+     E WL +H DF ++++ G+SAG NI HN+A+RAG E L    +
Sbjct  138   VLWAASHAPGAGE-----ETWLTDHADFSRVYLAGESAGANIAHNMAMRAGAEGLPHGGR  192

Query  624   LLGGILSFPYFWSSNEKGGEQ------SILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G +L  PYF    +   E         + K+W  V P A  G+D+P I P+A+ AP L
Sbjct  193   VNGVVLVHPYFLGRGKVPSEDWDPAMAENVVKMWSVVCP-ATTGVDDPWINPLADGAPGL  251

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
              GL C ++ VC+AEKD +R+    Y E +K SGW GE+EVV+V G  HCF +M+   ++A
Sbjct  252   EGLACGRVLVCLAEKDVIRDRGRAYCEGLKASGWAGEVEVVEVAGHGHCFHLMDFNGDEA  311

Query  282   KDTFKRIASFIQ  247
                   IA F+ 
Sbjct  312   VRQDDAIAEFVN  323



>ref|XP_011000096.1| PREDICTED: probable carboxylesterase 12 [Populus euphratica]
Length=310

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 150/307 (49%), Positives = 196/307 (64%), Gaps = 16/307 (5%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERI-CNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQ  988
             +PL RVY++G+VERI  +   VPPS  D  TGV SKD  VS   ++SVR+++PK+   +Q
Sbjct  14    APLFRVYRNGKVERITADAETVPPS-SDPHTGVQSKDTVVSQENSLSVRLFIPKIKDPSQ  72

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+L+Y HGG FC +S FSS+YH+YL  L  QANVIAVSV+YR APEHPLP  Y+D W 
Sbjct  73    KLPLLIYIHGGAFCFESPFSSMYHNYLTNLAHQANVIAVSVQYRRAPEHPLPIAYDDSWA  132

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             A+QWVASH S DG      E WL  H DFE+ F+ GDSAG NI HN+ +RAG   L    
Sbjct  133   AIQWVASHVSGDGV-----ESWLNKHADFERTFLAGDSAGANIAHNMTVRAGVNGL-FGV  186

Query  627   KLLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRC  448
             K +G +L+ P+F      G E      V ++++P  K   D+P I P       LAGL C
Sbjct  187   KTVGMVLAHPFF-----GGKEPDFFSPVLEYIFPGVK-IYDDPRINPAGAGGVELAGLGC  240

Query  447   SKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFK  268
             S++ + VA KD LRE    Y +A+KKSGW G +E+V+ EGE+H F + NP  +KA    K
Sbjct  241   SRVLIFVAGKDGLRERGYSYYDALKKSGWGGVLEIVETEGEDHVFHLFNPNCDKAAFVMK  300

Query  267   RIASFIQ  247
             ++ SFI 
Sbjct  301   QVVSFIN  307



>emb|CDP15645.1| unnamed protein product [Coffea canephora]
Length=313

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/309 (46%), Positives = 200/309 (65%), Gaps = 20/309 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSAT--GVSSKDITVSP--NISVRVYLPKL--ASA  994
             P  R++KDGRVE+    P++PPS + +A   GV SKD+ +SP   +  R++LP+   A  
Sbjct  18    PFFRIFKDGRVEKFLQTPFIPPSDDPNAISGGVRSKDVFISPENKVGARLFLPRTIKADE  77

Query  993   TQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDC  814
              QKLP+L+Y+HGG F ++SAFS  YH+YL+ LV++AN+IAVSVEYRLAPEHP+PA ++D 
Sbjct  78    KQKLPLLIYFHGGAFVIESAFSVQYHNYLSSLVAEANIIAVSVEYRLAPEHPMPACFDDS  137

Query  813   WEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             W  + WV SHA    +Q P  E W+ NH DF K+F  GDSAG NI HN+A +A    L  
Sbjct  138   WTMINWVTSHAKT--RQGP--ESWINNHADFTKVFFAGDSAGANIAHNMAAKASQHSLGD  193

Query  633   KSKLLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGL  454
               KLLG IL  P F      G  Q    K+W+ + P   G  D+P ++PMA  +  L+ L
Sbjct  194   GVKLLGLILMHPSF------GNGQP--HKLWELICPDLNGW-DDPRLHPMAHRS-LLSSL  243

Query  453   RCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDT  274
              CSK+ +C++EKD LRE    Y EA+K SGW+GE++ +++E E H F ++NP  + AK  
Sbjct  244   VCSKILICISEKDSLRERGWLYHEALKNSGWEGELDFLEIEDEGHVFHLLNPNCDNAKVL  303

Query  273   FKRIASFIQ  247
              KR+ SF++
Sbjct  304   MKRVVSFLR  312



>ref|XP_002462498.1| hypothetical protein SORBIDRAFT_02g026816 [Sorghum bicolor]
 gb|EER99019.1| hypothetical protein SORBIDRAFT_02g026816 [Sorghum bicolor]
Length=327

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 147/315 (47%), Positives = 200/315 (63%), Gaps = 19/315 (6%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQ-----  988
              IRVYK GRVER      VP S  D+ATGV+SKD  VS +++VR+YLP  A  T+     
Sbjct  18    FIRVYKSGRVERFFGSDPVPAS-TDAATGVASKDHAVSSDVAVRLYLPPPAKETEDNGGS  76

Query  987   --KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDC  814
               KLPILVY+HGGGFC+ +AF+ ++H YL  L ++A  I VSVEYRLAPEHPLPA Y+D 
Sbjct  77    RKKLPILVYFHGGGFCLHTAFNFVFHAYLTSLAARARAIVVSVEYRLAPEHPLPAAYDDS  136

Query  813   WEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             W AL WVASHA     +    EPWL +HGDF ++ VGGDSAG NI H++A+RAG EPL  
Sbjct  137   WRALVWVASHALPGSGE----EPWLTDHGDFSRLCVGGDSAGANIAHHMAMRAGAEPLPH  192

Query  633   KSKLLGGILSFPYFWSSNEKGGEQS---ILQKV---WDFVYPTAKGGIDNPMIYPMAENA  472
              +++ G  +   YF  ++    E++   +++ V   W  V P    G+D+P I P+A  A
Sbjct  193   GARISGVAIVHAYFLGADRVASEETDPALVENVVTMWRVVCP-GTSGLDDPWINPLAAGA  251

Query  471   PSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
             P+L GL C+++ VC+AEKD  R+    Y E ++ SGW GE+EV++V G+ HCF +++   
Sbjct  252   PTLEGLACARVLVCLAEKDVCRDRGRAYAEELRASGWTGEVEVLEVSGQGHCFHLVDLAC  311

Query  291   EKAKDTFKRIASFIQ  247
               A      IA F+ 
Sbjct  312   ADAIAQDDAIARFVN  326



>gb|EEC84711.1| hypothetical protein OsI_31671 [Oryza sativa Indica Group]
Length=324

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/312 (46%), Positives = 198/312 (63%), Gaps = 18/312 (6%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASAT-----QK  985
             IR++K GRVER      VP S  D+ATGV+SKD  +SP++SVR+YLP +A  +     +K
Sbjct  19    IRIFKGGRVERYFGSDSVPAS-TDAATGVASKDRAISPDVSVRLYLPPVAGVSGEGEGKK  77

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+L+Y+HGGGFC+ +AF+ ++H YL  L ++   I VSVEYRLAPEHPLPA YED W+A
Sbjct  78    LPLLIYFHGGGFCLHTAFNFVFHAYLTSLAARTRAIVVSVEYRLAPEHPLPAAYEDSWQA  137

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             + W ASHA   G+     E WL +H DF ++++ G+SAG NI HN+A+RAG E L    +
Sbjct  138   VLWAASHAPGAGE-----ETWLTDHADFSRVYLAGESAGANIAHNMAMRAGAEGLPHGGR  192

Query  624   LLGGILSFPYFWSSNEKGGEQ------SILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G +L  PYF    +   E         + K+W  V P A  G+D+P I P+A+ AP L
Sbjct  193   VNGVVLVHPYFLGRGKVPSEDWDPAMAENVVKMWSVVCP-ATTGVDDPWINPLADGAPGL  251

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
              GL C ++ VC+AEKD +R+    Y E +K SGW GE+EVV+V G  HCF +M+   ++A
Sbjct  252   EGLACGRVLVCLAEKDVIRDRGRAYCEGLKASGWAGEVEVVEVAGHGHCFHLMDFNGDEA  311

Query  282   KDTFKRIASFIQ  247
                   IA F+ 
Sbjct  312   VRQDDAIAEFVN  323



>ref|XP_006487078.1| PREDICTED: probable carboxylesterase 12-like [Citrus sinensis]
Length=321

 Score =   263 bits (672),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 149/312 (48%), Positives = 202/312 (65%), Gaps = 17/312 (5%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQK  985
             SPLI+V+KDG+VER+     VPPS  D  T V SKD+  SP  N+S R+YLPK  +  QK
Sbjct  15    SPLIKVHKDGKVERLRGTDIVPPS-LDPKTNVDSKDVVYSPENNLSARLYLPKNTNQNQK  73

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVY+HGGGFC+++AFS  YH+YLN LVS+AN+IAVSV+YR APEHPLP  YED W+A
Sbjct  74    LPLLVYFHGGGFCIETAFSPTYHNYLNDLVSEANIIAVSVDYRRAPEHPLPIAYEDSWDA  133

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             ++WVASH    G      E WL  + DFE++F  GDSAG NI H++AIR G E ++    
Sbjct  134   VKWVASHVDGSG-----PEDWLNRNADFERVFYSGDSAGANIAHHMAIRNGGEIID-GFN  187

Query  624   LLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             ++G +L  PYFW     G E      ++  ++ W F  P+   G+D+P + P A+ + SL
Sbjct  188   VVGIVLIHPYFWGVEPVGSEPTDVKIRAGTERFWRFTCPSTS-GLDDPWVNPCADGS-SL  245

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             A L C+++ V  AEKD L      Y E +K+SGW G +E+V+ +GE+H F ++NP  E A
Sbjct  246   ASLGCARVLVFAAEKDFLCPRGWFYYEKLKESGWGGHVEIVESKGEQHVFHLINPTCENA  305

Query  282   KDTFKRIASFIQ  247
                 K+I SF  
Sbjct  306   GSMLKKICSFFN  317



>ref|XP_008236532.1| PREDICTED: probable carboxylesterase 12 [Prunus mume]
Length=315

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 150/315 (48%), Positives = 198/315 (63%), Gaps = 21/315 (7%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLA--SAT  991
             SP+I+VYKDGRVER+     VPPS  +   GV SKD+ +S  P IS R+Y+PK +  S  
Sbjct  11    SPMIKVYKDGRVERLAGTDRVPPS-TNPENGVQSKDVVISEEPAISARIYIPKTSTDSPQ  69

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
              KLP+L+Y+HGGGFCV+S FS  YH Y+N LVS+ANV+AVSV+YRL PEHPLPA Y+D W
Sbjct  70    TKLPLLIYFHGGGFCVESPFSPAYHSYVNTLVSEANVVAVSVDYRLVPEHPLPAAYDDSW  129

Query  810   EALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
              A++WVASH   +G      E WL    D +++F  GDSAG NI HN+A++ G E L   
Sbjct  130   AAIKWVASHFDGNGS-----EDWLNRFADLQRVFFAGDSAGANITHNMAVKLGCERL-VG  183

Query  630   SKLLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAENA  472
              KL+G +L  PYFW +   G E       +  +  VW F  P+  G  D+P+I P  +  
Sbjct  184   VKLVGIVLVHPYFWGTEPVGAEITTPAATKEYMAGVWRFACPSTCGS-DDPLINPAKD--  240

Query  471   PSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
               L  L C K+ VCVAEKD L++    Y E +KKSGW G +EVV+ +GE+H F + NP  
Sbjct  241   LKLGKLGCEKVLVCVAEKDGLKDRGWHYSEILKKSGWNGAVEVVEAKGEDHVFHLFNPIC  300

Query  291   EKAKDTFKRIASFIQ  247
             + A    K+I SF+ 
Sbjct  301   DNAVALKKKIVSFLN  315



>ref|XP_010033689.1| PREDICTED: probable carboxylesterase 12 [Eucalyptus grandis]
Length=315

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/314 (45%), Positives = 203/314 (65%), Gaps = 19/314 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLAS-ATQ  988
             SP  R+YKDGRVER+     VPPS  D  TGV SKD+ +SP+  +S R+Y+PK A+ + Q
Sbjct  10    SPYARIYKDGRVERLLGTEIVPPS-LDEKTGVQSKDVAISPDSAVSGRLYIPKAATDSLQ  68

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+LVY+HGGGF ++SA S  YH+YLN LV++AN+IA+SV+YR APEHPLPA Y+D W 
Sbjct  69    KLPVLVYFHGGGFIIESAQSPTYHNYLNALVAEANIIAISVDYRRAPEHPLPAAYDDSWT  128

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
              L+WVASH++ +G      E WL +H + +K+F+ GDSAG NI++N+ IR G E LN   
Sbjct  129   TLKWVASHSTRNG-----PEDWLNSHANLKKVFMAGDSAGANIINNMGIRLGEEKLN-GI  182

Query  627   KLLGGILSFPYFWSS------NEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             +  GGI+  PYFW          +  ++S++   W    PT   G D+P++ P  +  P 
Sbjct  183   EFRGGIMVHPYFWGDEPLPLETTEPKKRSLIMDFWHAASPTTT-GCDDPLMNPATD--PR  239

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L+    +++ +CVAEKD  R+    Y EA+ +SGW G +EV++  GE+H F + NP  + 
Sbjct  240   LSSFNVNRVLICVAEKDMFRQRGWYYKEALSESGWSGVVEVMEAPGEDHIFHLSNPSCDN  299

Query  285   AKDTFKRIASFIQD  244
             A    K++ +F+ +
Sbjct  300   AAKMMKKLVTFVNE  313



>ref|XP_009773904.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Nicotiana 
sylvestris]
Length=314

 Score =   263 bits (671),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 146/311 (47%), Positives = 200/311 (64%), Gaps = 18/311 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             PLIRVYKDGR+ER+     VP +  D  TGV  KD+ + P  N+S R+YLPK     QK+
Sbjct  10    PLIRVYKDGRIERLLGEGVVP-AELDPETGVQIKDVQIDPKINLSARLYLPKNLDQVQKI  68

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+ VY+HGGGF ++SA S  YH +LN++ ++ANVI VSV YRLAPE+PLP  YED W AL
Sbjct  69    PLFVYFHGGGFVIESASSPSYHKHLNLVATEANVIIVSVNYRLAPEYPLPIAYEDSWLAL  128

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +W+ASHA  +G      EPWL +H D   ++ GGDSAG NI HN+AIR G E L+   KL
Sbjct  129   KWIASHAKGEGH-----EPWLKDHADLNHVYFGGDSAGANIAHNIAIRVGLEKLD-GVKL  182

Query  621   LGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              G  L+ PYFW  +   GE      ++ ++K+W F +P +  G+D+P++ P  E  P L+
Sbjct  183   DGIFLACPYFWGIDLIDGEAENLDCKNYIEKLWAFAHPNS-SGLDDPLMNP--EKDPKLS  239

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
              L C K+ V VA KD L+   L Y E ++KSGW+G +EVV+++ EEH F +  P +E A 
Sbjct  240   SLGCDKVLVYVAGKDPLKYRGLYYKELLEKSGWQGTVEVVEIKDEEHVFHLFAPTSENAM  299

Query  279   DTFKRIASFIQ  247
                K++ SF+ 
Sbjct  300   VVLKKLVSFLN  310



>ref|XP_010064185.1| PREDICTED: probable carboxylesterase 2 [Eucalyptus grandis]
Length=340

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 157/323 (49%), Positives = 205/323 (63%), Gaps = 28/323 (9%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITV--------------SPNISVRV  1018
             P+IRVYKDGRVER+     VPPS  D  TGVSSKDIT+              S  IS R+
Sbjct  18    PIIRVYKDGRVERLFGTDVVPPS-ADPETGVSSKDITIPVTAAASTTTSEPSSHVISARL  76

Query  1017  YLPKLASATQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHP  838
             YLPKL + ++KLP+L+Y+HGG FCV S F++ YH YLN +V++A V+ VSV YR APEHP
Sbjct  77    YLPKL-TESRKLPLLIYFHGGAFCVCSPFNAAYHSYLNAVVAKAKVVVVSVNYRKAPEHP  135

Query  837   LPAGYEDCWEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIR  658
             +PA YED W A+QW ASH   DG      E WL  H DF ++F+ G+SAG NI HN+A+ 
Sbjct  136   IPAAYEDSWAAIQWAASHCDGDG-----PEAWLNEHADFGRVFLSGESAGANIAHNMAMA  190

Query  657   AGNEPLNQKSKLLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPM  496
             AG        +LLG  L  P+FW SN  G E      ++ +  +W FV P+ K   D P 
Sbjct  191   AGKPERGLNIRLLGVALVHPFFWGSNPIGSEALPPNTRAYVDWLWPFVCPS-KPDNDEPW  249

Query  495   IYPMAENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHC  316
             + PMA+ APSLAGL C  + +CVAEKD LR+    Y E + +SGW G +E+++ EGE+H 
Sbjct  250   VNPMADGAPSLAGLGCRMVLMCVAEKDILRDRGRLYHEVLGRSGWTGVVEIMETEGEDHA  309

Query  315   FPIMNPGTEKAKDTFKRIASFIQ  247
             F + + GTEKAKD  +R+A F+ 
Sbjct  310   FHLYDMGTEKAKDLIRRLADFLN  332



>ref|XP_004230816.2| PREDICTED: LOW QUALITY PROTEIN: probable carboxylesterase 7 [Solanum 
lycopersicum]
Length=355

 Score =   264 bits (674),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 150/338 (44%), Positives = 203/338 (60%), Gaps = 45/338 (13%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             PL+RVYKDGR+ER+    +VPP   D  TGV  KD+ + P  N+S R+YLPK     QK+
Sbjct  10    PLMRVYKDGRIERLAGEGFVPPE-SDPETGVQIKDVQIDPQINLSARLYLPKNVDPVQKI  68

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+ VY+HGGGF ++SAFS  YH YL+++ ++A V  VSV YRLAPE+PLP  YED W AL
Sbjct  69    PLFVYFHGGGFVIESAFSPTYHKYLSLVAAEAKVAIVSVNYRLAPEYPLPIAYEDSWLAL  128

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WV SHA+ DG     +EPWL ++ DF ++F+GGDSAGGNI H++ IR G E   +  K+
Sbjct  129   KWVTSHANGDG-----REPWLKDYADFNRVFLGGDSAGGNIAHHIGIRLGLEKF-EGVKI  182

Query  621   LGGILSFPYFWSSNEKGGE---------------------------------QSILQKVW  541
              G  L+ PYFW  +   GE                                 + + +K+W
Sbjct  183   DGIFLACPYFWGKDRIEGEGENLLAKDFVEDLVLIGNPNSTGLDKDPIDLGSKDLFEKLW  242

Query  540   DFVYPTAKGGIDNPMIYPMAENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGW  361
              FV PT+  G+D+P+I P  E  P L+GL C KL V VA KD LR     Y E ++KSGW
Sbjct  243   LFVNPTSS-GLDDPLINP--EKDPKLSGLGCDKLVVYVAGKDPLRFRGFYYKEVLEKSGW  299

Query  360   KgeievvdvegeEHCFPIMNPGTEKAKDTFKRIASFIQ  247
              G +EVV+V+G+ H F +  P  E+A    K++ASF+ 
Sbjct  300   PGTVEVVEVKGKGHVFHLFVPEAEEAIAMLKKLASFLN  337



>ref|XP_010943009.1| PREDICTED: probable carboxylesterase 12 [Elaeis guineensis]
Length=323

 Score =   263 bits (671),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 195/312 (63%), Gaps = 16/312 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASA-TQK  985
             P IR+YK GR+ER+     VP +  D  TGV+SKDIT+ P+  +S R+YLP L     +K
Sbjct  13    PFIRIYKSGRIERLVGTDTVPATI-DPGTGVTSKDITIDPSTALSARLYLPNLTDEPNKK  71

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVYYHGGGFC  SAFSS Y  ++N LV+Q+ ++ VSV+YRLAPEHPLP  ++D W A
Sbjct  72    LPVLVYYHGGGFCSQSAFSSTYFRFINSLVAQSRLLLVSVDYRLAPEHPLPIAHDDSWAA  131

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+WVASH+ + G      + WL  HGDF ++F+ GDSAG NI H++A+RAG E L    +
Sbjct  132   LRWVASHSGSGG-----PDAWLAEHGDFLRVFLAGDSAGANIAHHMALRAGAEGLGPGIR  186

Query  624   LLGGILSFPYFWSSNEKGGEQSI------LQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G I   PYFW       E  I       + +W  V P    G+D+P+I P+AE AP L
Sbjct  187   IEGLIFLHPYFWGKEPLVSEPPIPEFRRDQELLWRLVCPGTAKGLDDPLINPLAEGAPGL  246

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
              GL   +  VC+AE DELRE    Y E +K SGW+GE+E+ + EGE H F +  P   +A
Sbjct  247   EGLAGERALVCLAE-DELRERGRAYYERLKGSGWRGEVELFESEGEYHVFHLFKPDCHQA  305

Query  282   KDTFKRIASFIQ  247
                 +R+  F++
Sbjct  306   LLLMQRVVEFLK  317



>ref|XP_004230815.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum lycopersicum]
Length=312

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 150/312 (48%), Positives = 198/312 (63%), Gaps = 18/312 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQK  985
             SPLIRVY+DGR+ER+    +VPP   D  TGV  KDI + P  N+S R+YLPK     QK
Sbjct  9     SPLIRVYRDGRIERMMGEGFVPPE-SDPETGVQIKDIEIDPQINLSARLYLPKNVDPVQK  67

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             +P+ VY+HGG F ++SA S  YH +L+++ ++A VI VS+ YRLAPE+PLP  YED W A
Sbjct  68    IPLFVYFHGGAFVIESASSPTYHKHLSMVAAEAKVIIVSINYRLAPEYPLPIAYEDSWIA  127

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+W+ASHA+ DG      EPWL +H +F +++ GGDSAGGNI H++AIR G E L +  K
Sbjct  128   LKWIASHANGDGD-----EPWLKDHANFNRVYFGGDSAGGNIAHHMAIRVGLEKL-EGVK  181

Query  624   LLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             L G  L+ PYFW  +   GE      +  + K+W F  P    G+D+PMI P  E  P L
Sbjct  182   LDGIFLACPYFWGKDLIDGEGENLFVKDFIDKLWLFANPNGS-GLDDPMINP--EKDPKL  238

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
               L C K+ V VA KD LR   L Y EA++KSGW G +EVV+V+ EEH F +  P  E A
Sbjct  239   CSLGCEKVVVYVAGKDALRLRGLYYKEALEKSGWPGTVEVVEVKDEEHVFHLFAPEAENA  298

Query  282   KDTFKRIASFIQ  247
                 K++ SF+ 
Sbjct  299   MAMLKKLVSFLN  310



>ref|XP_007199215.1| hypothetical protein PRUPE_ppa021861mg [Prunus persica]
 gb|EMJ00414.1| hypothetical protein PRUPE_ppa021861mg [Prunus persica]
Length=316

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 154/316 (49%), Positives = 202/316 (64%), Gaps = 26/316 (8%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPS--PEDSATGVSSKDITVS--PNISVRVYLPKLASATQ-  988
             +I+VYKDGRVER+     VPPS  PE+   GV SKD+ +S  P IS R+Y+PK A+ +  
Sbjct  13    VIKVYKDGRVERLLGTSTVPPSTHPEN---GVQSKDVVISQEPAISARLYIPKSAATSSP  69

Query  987   --KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDC  814
               KLP+LVY+HGGGFC++S+ S  YH+YLN LVS+ANV+AVSV+YRLAPE+PLPA Y+D 
Sbjct  70    QTKLPLLVYFHGGGFCIESSSSPTYHNYLNTLVSEANVVAVSVDYRLAPENPLPAAYDDS  129

Query  813   WEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             W AL+WVASH   +G      E WL    D   +F GGDSAG NI HN+A++ G E L  
Sbjct  130   WAALKWVASHFDGNGS-----EDWLNRFADLRGVFFGGDSAGANIAHNMALKLGCEGL-V  183

Query  633   KSKLLGGILSFPYFWSSNEKGGEQSI-------LQKVWDFVYPTAKGGIDNPMIYPMAEN  475
               KL+G +L  PYFW +   G E +I       +  +W F  P + G  D+P+  P  + 
Sbjct  184   GVKLIGIVLIHPYFWGTEPVGEELTIPAAKREYIAALWRFTCPLSIGS-DDPLFNPGKD-  241

Query  474   APSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPG  295
              P L  L C K+ VCVAEKD  ++    Y E +KKSGWKG +EV++ +GEEH F + NP 
Sbjct  242   -PKLGELGCEKVLVCVAEKDVFKDRGWHYSEVLKKSGWKGVVEVIEAKGEEHVFHLRNPS  300

Query  294   TEKAKDTFKRIASFIQ  247
              E A    K+IASF+ 
Sbjct  301   CENAVAMKKKIASFLN  316



>ref|XP_008372377.1| PREDICTED: LOW QUALITY PROTEIN: probable carboxylesterase 12 
[Malus domestica]
Length=319

 Score =   262 bits (669),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 150/315 (48%), Positives = 202/315 (64%), Gaps = 19/315 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQK  985
             SP+I+ YKDGR+ER+     VPPS +   TGV SKD+ +S  P ISVR+Y+PK  SA  K
Sbjct  11    SPMIKAYKDGRIERLLGTATVPPSTQPE-TGVQSKDVVISQQPAISVRLYIPK--SAATK  67

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVY+HGGGFC++SA S  YH YLN LVS+ANV+AVSVEYRLAPEHP+PA Y+D W A
Sbjct  68    LPLLVYFHGGGFCIESASSPTYHDYLNSLVSEANVVAVSVEYRLAPEHPVPAAYDDSWAA  127

Query  804   LQWVASH--ASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
             L+WVASH   +  G +    E W+ ++ D +++F  GDSAG NI H + ++ G++ L   
Sbjct  128   LKWVASHFDGTRKGGEEE-DEDWITSYADSQRMFFAGDSAGANIAHXMGLKVGSDGL-VG  185

Query  630   SKLLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAENA  472
              KL+G +L  PYFW S   G E       +  +  +W FV P + G  D+P++ P  E  
Sbjct  186   VKLIGVVLVHPYFWGSESIGVELNAPAAMREFMAAMWRFVNPLSSGS-DDPLMNP--EKD  242

Query  471   PSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
             P L  L C K+ V VAEKD L+E    Y E ++KSGW G +EV++ +GE HCF + +   
Sbjct  243   PKLGKLGCGKVVVFVAEKDVLKERGWYYGEVLRKSGWNGVVEVMEAKGEXHCFHLDDLTC  302

Query  291   EKAKDTFKRIASFIQ  247
             E A    K+I SF+ 
Sbjct  303   ENAVAMQKKIVSFLN  317



>gb|AFV95090.1| carboxylesterase 1 [Solanum habrochaites]
Length=339

 Score =   262 bits (670),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 149/338 (44%), Positives = 202/338 (60%), Gaps = 45/338 (13%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             PL+RVYKDGR+ER+    +VPP   D  TGV  KD+ + P  N+S R+YLPK     QK+
Sbjct  10    PLLRVYKDGRIERLAGEGFVPPE-SDPETGVQIKDVQIDPQINLSARLYLPKNVDPVQKI  68

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+ VY+HGGGF ++SAFS  YH YL+++ ++A V  VSV YRLAPE+PLP  YED W AL
Sbjct  69    PLFVYFHGGGFVIESAFSPTYHKYLSLVAAEAKVAIVSVNYRLAPEYPLPIAYEDSWLAL  128

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WV SHA+ DG     +EPWL ++ DF ++F+GGDSAGGNI H++ IR G E   +  K+
Sbjct  129   KWVTSHANGDG-----REPWLKDYADFNRVFLGGDSAGGNIAHHIGIRLGLEKF-EGVKI  182

Query  621   LGGILSFPYFWSSNEKGGE---------------------------------QSILQKVW  541
              G  L+ PYFW  +   GE                                 + + +K+W
Sbjct  183   DGIFLACPYFWGKDRIEGEGENLLAKDFVEDLVLIGNPNSTGLDKDPIDLGSKDLFEKLW  242

Query  540   DFVYPTAKGGIDNPMIYPMAENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGW  361
              FV PT+  G+D+P+I P  E  P L GL C KL V VA KD LR     Y E ++KSGW
Sbjct  243   LFVNPTSS-GLDDPLINP--EKDPKLPGLGCDKLVVYVAGKDPLRFRGFYYKELLEKSGW  299

Query  360   KgeievvdvegeEHCFPIMNPGTEKAKDTFKRIASFIQ  247
              G +E+V+V+G+ H F +  P  E+A    K++ASF+ 
Sbjct  300   PGTVEIVEVKGKGHVFHLFVPEAEEAIAMLKKLASFLN  337



>ref|XP_004230814.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum lycopersicum]
Length=310

 Score =   261 bits (667),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 144/308 (47%), Positives = 201/308 (65%), Gaps = 14/308 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             P +RVYKDGR+ER+    +VPP   D  TGV  KD+ + P  N+S R+YLPK     +K+
Sbjct  10    PFMRVYKDGRIERLMGEGFVPPE-SDPETGVQIKDVQIDPQINLSARLYLPKHVDTVEKI  68

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+ VY+HGGGF ++SA+S  YH +++ + ++A V+ VSV YRLAPE+ LP  YED W AL
Sbjct  69    PLFVYFHGGGFLIESAYSPSYHKHISKVAAEAKVVIVSVNYRLAPEYLLPIAYEDSWLAL  128

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WVASHA+ D       EPWL +H DF ++F+GGDSAGGNI H++AIR G E L+   KL
Sbjct  129   KWVASHANGDDGH----EPWLKDHADFNRLFLGGDSAGGNIAHHIAIRVGLEKLDG-MKL  183

Query  621   LGGILSFPYFWSSNEKGGEQS---ILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLR  451
              G  L+ P+FW  +   GE     +++K+W FV P +  G+D+P+I P+ +  P+L+ L 
Sbjct  184   KGIFLACPFFWGKDPIDGEGEKLVVIEKLWLFVNPNSS-GLDDPLINPVKD--PNLSSLG  240

Query  450   CSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTF  271
             C K+ V VA KD LR   L Y E ++KSGW G +EVV+V+ E H F +    TE A    
Sbjct  241   CDKVVVYVAGKDVLRFRGLYYKEVLEKSGWPGTVEVVEVKDEAHVFYLSATETENAMAMM  300

Query  270   KRIASFIQ  247
             K++ASF+ 
Sbjct  301   KKLASFLN  308



>gb|AFV95086.1| carboxylesterase 1 [Solanum pimpinellifolium]
Length=339

 Score =   262 bits (670),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 150/338 (44%), Positives = 201/338 (59%), Gaps = 45/338 (13%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             PL+RVYKDGR+ER+    +VPP   D  TGV  KD+ + P  N+S R+YLPK     QK+
Sbjct  10    PLMRVYKDGRIERLAGEGFVPPE-SDPETGVQIKDVQIDPQINLSARLYLPKNVDPVQKI  68

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+ VY+HGGGF ++SAFS  YH YL ++ ++A V  VSV YRLAPE+PLP  YED W AL
Sbjct  69    PLFVYFHGGGFVIESAFSPTYHKYLGLVAAEAKVAIVSVNYRLAPEYPLPIAYEDSWLAL  128

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WV SHA+ DG     +EPWL ++ DF ++F+GGDSAGGNI H++ IR G E   +  K+
Sbjct  129   KWVTSHANGDG-----REPWLKDYADFNRVFLGGDSAGGNIAHHIGIRLGLEKF-EGVKI  182

Query  621   LGGILSFPYFWSSNEKGGE---------------------------------QSILQKVW  541
              G  L+ PYFW  +   GE                                 + + +K+W
Sbjct  183   DGIFLACPYFWGKDRIEGEGENLLAKDFGEDHVLIGNPNSTGLDKDPIDLGSKDLFEKLW  242

Query  540   DFVYPTAKGGIDNPMIYPMAENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGW  361
              FV PT+  G+D+P+I P  E  P L GL C KL V VA KD LR     Y E ++KSGW
Sbjct  243   LFVNPTSS-GLDDPLINP--EKDPKLYGLGCDKLVVYVAGKDPLRFRGFYYKEVLEKSGW  299

Query  360   KgeievvdvegeEHCFPIMNPGTEKAKDTFKRIASFIQ  247
              G +EVV+V+G+ H F +  P  E+A    K++ASF+ 
Sbjct  300   PGTVEVVEVKGKGHVFHLFVPEAEEAIAMLKKLASFLN  337



>ref|XP_010275604.1| PREDICTED: probable carboxylesterase 2 [Nelumbo nucifera]
Length=328

 Score =   261 bits (668),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 147/316 (47%), Positives = 208/316 (66%), Gaps = 24/316 (8%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQ--  988
             P  R+YKDG +ER+     VPPSP D  TGV SKD+ VS    +S R++LP + ++ Q  
Sbjct  14    PYFRIYKDGHIERLVGSNMVPPSP-DPHTGVLSKDVIVSTETGVSARIFLPNVNTSDQPH  72

Query  987   -KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
              KLP+LVY+HGG FC+ SAFSS YHHY++ LV++ANVIAVSV+YRLAPEH LP  + DC 
Sbjct  73    RKLPLLVYFHGGAFCIGSAFSSAYHHYVSSLVAEANVIAVSVDYRLAPEHLLPTAHLDCL  132

Query  810   EALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
              AL+WVASH+  +G      E WL +H DF+++F+ GDSAG N+VH VA+R G   ++  
Sbjct  133   AALKWVASHSKGEG-----PEAWLNDHSDFDRVFLAGDSAGANLVHYVAMRVGESEVDGL  187

Query  630   SKLLGGILSFPYF--------WSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAEN  475
               LLG  L  PYF         +S+E+  ++S + K W ++ P+   G D+P+I P A  
Sbjct  188   KNLLGIALIHPYFEGREPVAPGTSDEE--KKSKVSKFWAYLCPSTS-GCDDPLINPAA--  242

Query  474   APSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPG  295
              PS++ L C+++ V VAEKD +R+  + Y E +KKSGW G +E+ + +GEEH F ++ P 
Sbjct  243   GPSMSSLGCTRVAVWVAEKDSVRKEGVFYYEWLKKSGWGGVVEISEEQGEEHVFHLVKPD  302

Query  294   TEKAKDTFKRIASFIQ  247
             +EKA    KR++SF+ 
Sbjct  303   SEKAMAMMKRLSSFLN  318



>ref|XP_007200443.1| hypothetical protein PRUPE_ppa008902mg [Prunus persica]
 gb|EMJ01642.1| hypothetical protein PRUPE_ppa008902mg [Prunus persica]
Length=315

 Score =   261 bits (667),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 147/315 (47%), Positives = 196/315 (62%), Gaps = 21/315 (7%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLA--SAT  991
             SP+I+VYKDGRVER+     VPPS  +   GV SKD+ +S  P IS R+++PK    S  
Sbjct  11    SPMIKVYKDGRVERLAGTDRVPPS-TNPENGVQSKDVVISQEPAISARIFIPKTTTDSPQ  69

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
              KLP+L+Y+HGGGF ++S FS  YH Y+N LVS+ANV+AVSV+YRL PEHPLPA Y D W
Sbjct  70    TKLPLLIYFHGGGFSIESPFSPAYHSYVNTLVSEANVVAVSVDYRLVPEHPLPAAYNDSW  129

Query  810   EALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
              A++WVASH   +G      E WL    DF+++F  GDSAG NI HN+A++ G E L   
Sbjct  130   AAIKWVASHFDGNGS-----EDWLNRFADFQRVFFAGDSAGANITHNMAVKLGCERL-VG  183

Query  630   SKLLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAENA  472
              KL+G +L  PYFW +   G E       +  +  VW F  P+  G  D+P++ P  +  
Sbjct  184   VKLVGIVLVHPYFWGTEPVGAELTTPAATKEYMAAVWRFACPSTIGS-DDPLLNPAKD--  240

Query  471   PSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
             P L  L C K+ VCVAEKD L++    Y E +KKSGW G +EV++ +GE H F + NP  
Sbjct  241   PKLGKLGCEKVLVCVAEKDGLKDRGWHYSEILKKSGWNGAVEVIEAKGEGHVFHLFNPIC  300

Query  291   EKAKDTFKRIASFIQ  247
             + A    K+I SF+ 
Sbjct  301   DNAVALKKKIVSFLN  315



>gb|KDP25935.1| hypothetical protein JCGZ_22840 [Jatropha curcas]
Length=320

 Score =   261 bits (667),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 151/319 (47%), Positives = 204/319 (64%), Gaps = 29/319 (9%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITV--SPNISVRVYLPKLA-SATQ  988
             SPL+R+YKDG VER+     VPP   D  T V SKD+      N+S R+YLP+ A ++ +
Sbjct  14    SPLLRIYKDGHVERLAGNDIVPPGL-DHNTQVQSKDVIYLQEENLSSRLYLPRNAINSDK  72

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+LVYYHGGGFC+++AFS ++H +LN LV++AN+IAVS EYR +PE+PLP GYED W 
Sbjct  73    KLPLLVYYHGGGFCIETAFSPLFHKHLNNLVAEANIIAVSAEYRRSPENPLPIGYEDSWS  132

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             AL+WVASH + +G      E WL ++ DF K+F+GGDSAGGN+ H++ I+ G      K 
Sbjct  133   ALKWVASHVNGNG-----PEEWLNSYADFGKVFLGGDSAGGNVAHHMGIKNG------KG  181

Query  627   KLLG----GI-LSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMA  481
             KLLG    GI L  PYFW     G E      + + + +W    PT   G D+P I P+ 
Sbjct  182   KLLGVNIIGIALVHPYFWGKEPIGNEAKDSEKRFLAEALWHLACPTTS-GCDDPWINPLV  240

Query  480   ENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMN  301
             +  P L  L CSK+ V VAEKD LR+    Y   +K+SGWKG +E+++ + E+H F + N
Sbjct  241   D--PDLGKLGCSKILVMVAEKDLLRDRGWHYYYKLKESGWKGLVEIMESKDEDHVFHLQN  298

Query  300   PGTEKAKDTFKRIASFIQD  244
             P TE A    KR+ASFI +
Sbjct  299   PSTENALAVVKRLASFINE  317



>gb|ABB89006.1| CXE carboxylesterase [Malus pumila]
Length=319

 Score =   261 bits (667),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 203/315 (64%), Gaps = 19/315 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQK  985
             SP+I+ YKDGR+ER+     VPPS +   TGV SKD+ +S  P ISVR+Y+PK  SA  K
Sbjct  11    SPMIKAYKDGRIERLLGTATVPPSTQPE-TGVQSKDVVISQQPAISVRLYIPK--SAATK  67

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVY+HGGGFC++SA S  YH YLN LVS+ANV+AVSVEYRLAPEHP+PA Y+D W A
Sbjct  68    LPLLVYFHGGGFCIESASSPTYHDYLNSLVSEANVVAVSVEYRLAPEHPVPAAYDDSWAA  127

Query  804   LQWVASH--ASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
             L+WVASH   +  G +    E W+ ++ D +++F  GDSAG NI H++ ++ G++ L   
Sbjct  128   LKWVASHFDGTRKGGEEE-DEDWITSYADSQRVFFAGDSAGANIAHHMGLKVGSDGL-VG  185

Query  630   SKLLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAENA  472
              KL+G +L  PYFW S   G E       +  +  +W FV P + G  D+P++ P  E  
Sbjct  186   VKLIGVVLVHPYFWGSESIGVELNAPAAMREFMAAMWRFVNPLSSGS-DDPLMNP--EKD  242

Query  471   PSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
             P L  L C K+ V VAEKD L++    Y E ++KSGW G +EV++ +GE HCF + +   
Sbjct  243   PKLGKLGCGKVVVFVAEKDVLKDRGWYYGEVLRKSGWNGVVEVMEAKGEGHCFHLDDLTC  302

Query  291   EKAKDTFKRIASFIQ  247
             E A    K+I SF+ 
Sbjct  303   ENAVAMQKKIVSFLN  317



>ref|XP_007199222.1| hypothetical protein PRUPE_ppa021907mg [Prunus persica]
 gb|EMJ00421.1| hypothetical protein PRUPE_ppa021907mg [Prunus persica]
Length=315

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 149/317 (47%), Positives = 200/317 (63%), Gaps = 25/317 (8%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPS--PEDSATGVSSKDITVS--PNISVRVYLPKLA--S  997
             SP+I+VYKDGRVER+     VPPS  PE+   GV SKD+ +S  P IS R+++PK +  S
Sbjct  11    SPMIKVYKDGRVERLMGTERVPPSTHPEN---GVQSKDVVISQEPAISARIFIPKTSTHS  67

Query  996   ATQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYED  817
                KLP+L+Y+HGGGFC++S+ S  YH Y+N LVS+ANV+AVSV++RLAPEHPLPA Y D
Sbjct  68    PQTKLPLLIYFHGGGFCIESSSSPAYHSYVNTLVSEANVVAVSVDFRLAPEHPLPAAYND  127

Query  816   CWEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLN  637
              W A++WVASH   +G      E WL    DF+++F  GDSAG NI HN+A++ G E L 
Sbjct  128   SWAAIKWVASHFDGNGS-----EDWLNRFADFQRVFFAGDSAGANITHNMAVKLGCERL-  181

Query  636   QKSKLLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAE  478
                KL+G +L  PYFW +   G E       +  +  VW F  P+  G  D+P+I P  +
Sbjct  182   VGVKLVGIVLVHPYFWGTEPVGDELTTPAAARDYMVGVWRFACPSTSGS-DDPLINPAKD  240

Query  477   NAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNP  298
                 L  L C K+ VCVAEKD L++    Y E +KKSGW G +EV++ +GE H F + NP
Sbjct  241   Q--KLGKLGCEKVLVCVAEKDVLKDRGWHYSEILKKSGWNGAVEVIEAKGEGHVFHLFNP  298

Query  297   GTEKAKDTFKRIASFIQ  247
               + A    K+I SF+ 
Sbjct  299   ICDNAVALEKKIVSFLN  315



>ref|XP_002518792.1| catalytic, putative [Ricinus communis]
 gb|EEF43717.1| catalytic, putative [Ricinus communis]
Length=316

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 197/313 (63%), Gaps = 18/313 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQK  985
             SP +R+YKDGRVER+      PPS     T V SKD+  SP  N+S R+YLP+ A+  QK
Sbjct  13    SPFLRIYKDGRVERLMGTDIAPPSLH-PITQVQSKDVVFSPQHNLSSRLYLPRNANPNQK  71

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVYYHGGGFC+++ +S +YH++LN LV++ANVIAVSV+YR APEHPLP GY+D W A
Sbjct  72    LPLLVYYHGGGFCIETPYSPMYHNHLNNLVAEANVIAVSVDYRRAPEHPLPIGYDDSWAA  131

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+WVASH + +G      E WL ++ D  K+F+ GDSAG NI H++AIR   E L     
Sbjct  132   LKWVASHLNGNGA-----EEWLNSYADIGKVFLAGDSAGANIAHHMAIRNTEEKL-VGIN  185

Query  624   LLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             L+G +L  PYFW     G E      ++ +  +W F  P   G  D+P I P+ +  P +
Sbjct  186   LVGIVLVHPYFWGKEPVGNEPKEAEKRATVDVIWHFACPKTSGN-DDPWINPLLD--PKM  242

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
              GL C K+ V VAEKD LR+    Y E ++ SGW G +E +++  E+H F +     E A
Sbjct  243   CGLGCRKVLVIVAEKDLLRDRGWYYYEKLRNSGWGGLVEFMEITEEDHVFHLQKSTCENA  302

Query  282   KDTFKRIASFIQD  244
                 KR+ASFI++
Sbjct  303   LAMLKRMASFIKE  315



>ref|XP_008444640.1| PREDICTED: probable carboxylesterase 2 [Cucumis melo]
Length=326

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 139/311 (45%), Positives = 193/311 (62%), Gaps = 15/311 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             PLIR+YK+GR+ER+ +  +VPP   D  TGV+SKD+T  P   +S R++LP L  +TQ+L
Sbjct  14    PLIRIYKNGRIERLVDTDFVPPG-TDPLTGVTSKDVTFLPTFGVSARLFLPNLTHSTQRL  72

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P++VY+HGG FC  S F++ YH+YLN L ++A V+AVSV+YR APEHP+P  YED W AL
Sbjct  73    PVVVYFHGGCFCTQSPFTAKYHNYLNALTAEAKVVAVSVDYRKAPEHPIPTAYEDSWAAL  132

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             QWV SH    G ++     WL  H DF+++F+ G SAG NI HN+A+  G+        L
Sbjct  133   QWVISHLDGKGPEI-----WLNKHVDFKRVFLAGASAGANIAHNLAMVVGDPDCGVNIDL  187

Query  621   LGGILSFPYFWSSNEKGGEQS------ILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
             +G  L  PYFW S   G E        +  ++W F+ P A+   D+P + P+AE A  LA
Sbjct  188   IGVALEHPYFWGSVRIGKEAENPVKARLFDQLWGFICP-ARPENDDPWVNPVAEGAGRLA  246

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
             GL   ++ VCVAEKD LR+    Y EA+  SGW G  E+V+ E E+H F + +   +KAK
Sbjct  247   GLGSGRVLVCVAEKDVLRDRGRLYFEALGGSGWFGVAEIVETEDEDHLFHLNDSEGQKAK  306

Query  279   DTFKRIASFIQ  247
             D  + +  F  
Sbjct  307   DLIRDLGDFFN  317



>ref|XP_008236609.1| PREDICTED: probable carboxylesterase 13 [Prunus mume]
Length=320

 Score =   261 bits (666),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 149/320 (47%), Positives = 201/320 (63%), Gaps = 26/320 (8%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASAT--  991
             SP+I+VYKDGRVER+ +   VPPS  D  TGV SKD+ +S  P ISVR+Y+PK  +AT  
Sbjct  11    SPMIKVYKDGRVERLNDTDRVPPS-TDPKTGVQSKDVVISQEPAISVRLYIPKSTTATTT  69

Query  990   -----QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAG  826
                   KLP+L+Y+HGGGFC+ S+ S  +H+YLN LVS+ANV+AVSV+YRL PEHPLP  
Sbjct  70    TSAPQTKLPLLIYFHGGGFCIRSSSSRRHHNYLNALVSEANVVAVSVDYRLVPEHPLPVA  129

Query  825   YEDCWEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNE  646
             Y+D W AL WVASH+  +G      E WL    DF+++F+ G+SAG NI HN+A++ G E
Sbjct  130   YDDSWAALNWVASHSDGNGS-----EDWLNRFADFQRVFLAGNSAGANITHNMAVKLGCE  184

Query  645   PLNQKSKLLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYP  487
              L    K +G +L  PYFW +   G E       +  +  VW F  P+  G  D+P+I P
Sbjct  185   RL-VGVKWIGIVLVHPYFWGTEPVGAELTTPAAAREYMAGVWRFACPSTSGS-DDPLINP  242

Query  486   MAENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPI  307
               +  P L  L C K+ VCVAEKD L++    Y E +KKSGW G +EV++  GE H F +
Sbjct  243   AKD--PKLGQLGCEKVLVCVAEKDVLKDRGWHYSETLKKSGWNGAVEVIEAAGEGHSFHL  300

Query  306   MNPGTEKAKDTFKRIASFIQ  247
              +P  + A    K+I +F+ 
Sbjct  301   EDPTCDNAVAMEKKIVAFLN  320



>ref|XP_011088284.1| PREDICTED: 2-hydroxyisoflavanone dehydratase [Sesamum indicum]
Length=314

 Score =   260 bits (665),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 146/312 (47%), Positives = 208/312 (67%), Gaps = 22/312 (7%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             PL+R YKDGRVER+     VP S  D  TGV +KD+ ++   N+S R+YLPK A+  +KL
Sbjct  14    PLLREYKDGRVERLVGKDLVPASV-DPETGVQTKDVVIAQEINLSARLYLPKNAAPGKKL  72

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+LVY+HGGGF V+SAFS++Y  +LN+LV++AN +AVSV YRLAPEHPLPA Y+D W AL
Sbjct  73    PLLVYFHGGGFLVESAFSAMYQKHLNLLVAEANCVAVSVNYRLAPEHPLPAAYDDSWLAL  132

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WVAS ++++         W+ ++ D  ++++GGDSAGG I H+VAIR G++ L+   +L
Sbjct  133   KWVASQSTDE---------WIKDYADLNRVYLGGDSAGGTIAHHVAIRVGDKTLD-GIRL  182

Query  621   LGGILSFPYFWSSNEKGGEQ-------SILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
              G  L+ P+F S +  G E+       S L ++W +  P++  G D+P I P  +  P +
Sbjct  183   SGVFLNCPFFCSKDAMGKEETHPVFSKSYLDRLWHYACPSSTEGSDHPWINPTMD--PKI  240

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             +   C +L V VAEKD LRE    Y +A+ KSGW GEIEVV+V+GE+H F +++P TE  
Sbjct  241   SSFGCKRLLVYVAEKDVLRERGWWYKDAISKSGWNGEIEVVEVKGEDHVFSVISPTTENG  300

Query  282   KDTFKRIASFIQ  247
                 KR+ASF+ 
Sbjct  301   IAMLKRVASFLN  312



>ref|XP_008346180.1| PREDICTED: probable carboxylesterase 12 [Malus domestica]
Length=319

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 201/316 (64%), Gaps = 21/316 (7%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQK  985
             SP+I+ YKDGR+ER+     VPPS +   TGV SKD+ +S  P ISVR+Y+PK  SA  K
Sbjct  11    SPMIKAYKDGRIERLLGTATVPPSTQPE-TGVQSKDVVISQQPAISVRLYIPK--SAATK  67

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVY+HGGGFC++SA S  YH YLN LVS+ANV+AVSVEYRLAPEHP+PA Y+D W A
Sbjct  68    LPLLVYFHGGGFCIESASSPTYHDYLNSLVSEANVVAVSVEYRLAPEHPVPAAYDDSWAA  127

Query  804   LQWVASH---ASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             L+WVASH       G++    E W+ ++ D +++F  GDSAG NI H++ ++ G++ L  
Sbjct  128   LKWVASHFDGTRKGGEEX--DEDWITSYADSQRMFFAGDSAGANIAHHMGLKVGSDGL-V  184

Query  633   KSKLLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAEN  475
               KL+G +L  PYFW S   G E       +  +  +W FV P + G  D+P++ P  E 
Sbjct  185   GVKLIGVVLVHPYFWGSESIGVELNAPAAMREFMAAMWRFVNPLSSGS-DDPLMNP--EK  241

Query  474   APSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPG  295
              P L  L C K+ V VAEKD L+     Y E ++KSGW G +EV++  GE HCF + +  
Sbjct  242   DPKLGKLGCGKVVVFVAEKDVLKXRGWYYGEVLRKSGWNGVVEVMEAXGEXHCFHLDDLT  301

Query  294   TEKAKDTFKRIASFIQ  247
              E A    K+I SF+ 
Sbjct  302   CENAVAMQKKIVSFLN  317



>gb|KGN62538.1| hypothetical protein Csa_2G360060 [Cucumis sativus]
Length=326

 Score =   260 bits (665),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 140/311 (45%), Positives = 194/311 (62%), Gaps = 15/311 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             PLIR+YK+GR+ER+    +VP S  D  TGV+SKD+T+ P   +S R++LP L  +TQ+L
Sbjct  14    PLIRIYKNGRIERLVGIDFVP-SGTDPLTGVTSKDVTLLPTFGVSARLFLPNLTHSTQRL  72

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P++VY+HGG FC  S F++ YH+YLN L ++A V+AVSV YR APEHP+P  YED W AL
Sbjct  73    PVVVYFHGGCFCTQSPFTAKYHNYLNALTAEAKVVAVSVNYRKAPEHPIPTAYEDSWAAL  132

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             QWV SH    G ++     W+  H DF+++F+ G SAG NI HN+A+ AG+        L
Sbjct  133   QWVISHRDGKGPEM-----WMNKHVDFKRVFLAGASAGANIAHNLAMVAGDPDCGVNINL  187

Query  621   LGGILSFPYFWSSNEKGGEQS------ILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
             +G  L  PYFW S   G E        +  ++W F+ P A+   D+P + P+AE A  LA
Sbjct  188   IGVALEHPYFWGSVRIGKEAENPVKARLFDQLWGFICP-ARPENDDPWVNPVAEGAGRLA  246

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
             GL   ++ VCVAEKD LR+    Y EA+  SGW G  E+V+ E E+H F + +   +KAK
Sbjct  247   GLGSGRVLVCVAEKDVLRDRGRLYFEALGGSGWFGVAEIVETEDEDHMFHLNDLEGQKAK  306

Query  279   DTFKRIASFIQ  247
             D  +R+  F  
Sbjct  307   DLIRRLGDFFN  317



>ref|XP_006384426.1| hypothetical protein POPTR_0004s14970g [Populus trichocarpa]
 gb|ERP62223.1| hypothetical protein POPTR_0004s14970g [Populus trichocarpa]
Length=318

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 152/313 (49%), Positives = 193/313 (62%), Gaps = 19/313 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQK  985
             SP I VYKDG +ER+     VPPS  D  + V SKD   S    +S R+YLP      +K
Sbjct  13    SPFIIVYKDGSIERLVGNEIVPPS-LDPKSSVLSKDAVYSKEAKLSSRLYLPPGVDPDKK  71

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+L+Y++GGGFCV+SAFS  YH+YLNILV++A VIAVSV+YR  PEHP+P  Y+D W A
Sbjct  72    LPLLIYFYGGGFCVESAFSPAYHNYLNILVAEAKVIAVSVDYRRVPEHPIPVPYDDSWTA  131

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+WVASH + DG      E WL NH DF K+++ GDSAGGNI H++A+R G E L    K
Sbjct  132   LKWVASHVNGDGP-----EKWLNNHADFGKVYLAGDSAGGNIAHHMAMRYGQERL-FGVK  185

Query  624   LLGGILSFPYFWSSNEKGGEQSILQKV-------WDFVYPTAKGGIDNPMIYPMAENAPS  466
              +G +L  PYFW     G E   L++V       W    PT   G D+P+I P  +  P 
Sbjct  186   AVGVVLIHPYFWGKEPIGNEVHELERVLKGIAATWHLACPTTS-GCDDPLINPTTD--PK  242

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             LA L CSK+ V VAEKD LR+  L Y EA+KK GW G +E ++ EGE H F + NP    
Sbjct  243   LASLGCSKVLVAVAEKDLLRDRDLLYCEALKKCGWGGAVETMEAEGEGHVFHLFNPTCGN  302

Query  285   AKDTFKRIASFIQ  247
             A    K+ A+FI 
Sbjct  303   AVAMLKKTAAFIS  315



>gb|KCW63808.1| hypothetical protein EUGRSUZ_G01474, partial [Eucalyptus grandis]
Length=326

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 141/314 (45%), Positives = 203/314 (65%), Gaps = 19/314 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASAT-Q  988
             SP  R+YKDGRVER      VPPS  D  T V SKD+ +S +  +S R+Y+PK A+ + Q
Sbjct  20    SPYARIYKDGRVERFVGTETVPPS-LDEKTSVQSKDVAISSDSAVSARLYIPKAATDSFQ  78

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+LVY+HGGGF +++A+S  YH+YLN LV++AN+IAVSV YR APEHPLPA Y+D W 
Sbjct  79    KLPVLVYFHGGGFIIETAWSPAYHNYLNALVAEANIIAVSVNYRRAPEHPLPAAYDDSWT  138

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
              L+WVASH++ +G      E WL +H + +K+F+ GDSAGGNIVHN+ IR   + L +  
Sbjct  139   TLKWVASHSTGNG-----PEEWLNSHANLKKVFMAGDSAGGNIVHNMGIRLAEQTL-KGI  192

Query  627   KLLGGILSFPYFWSS------NEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             + LG I+  PYFW          +  ++S+++K+W    PT     D+P+I P  +  P 
Sbjct  193   EFLGVIMVHPYFWGDKPLPLETTEPEKRSVVEKLWCAANPTTT-ACDHPLINPAMD--PR  249

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L+GL  +++ +CVAEKD  R+    Y E + + GW G +EV +  GE+H F ++NP  + 
Sbjct  250   LSGLAFNRILICVAEKDIFRQRGWHYKEVLSERGWSGFVEVTEAPGEDHVFHLINPSCDN  309

Query  285   AKDTFKRIASFIQD  244
             A    K++ASF+ +
Sbjct  310   AVKMMKKLASFMNE  323



>ref|XP_002510250.1| Gibberellin receptor GID1, putative [Ricinus communis]
 gb|EEF52437.1| Gibberellin receptor GID1, putative [Ricinus communis]
Length=338

 Score =   260 bits (665),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 143/312 (46%), Positives = 198/312 (63%), Gaps = 17/312 (5%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDI--TVSP--NISVRVYLPKLASATQK  985
             ++R+YKDG VER+ +  YVPPS  +   G+SSKD+  T+ P  NIS R+YLPKL    QK
Sbjct  28    IVRLYKDGHVERLRDTDYVPPS-SNLLPGLSSKDVATTLGPDINISARLYLPKLNHPKQK  86

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
              P+LV++HGG FC+ S F+  YH YL  LV++ANV+AVSV YR APEHP+P  YED W A
Sbjct  87    FPLLVFFHGGAFCISSPFTVKYHSYLTKLVAEANVVAVSVNYRKAPEHPIPVAYEDSWAA  146

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L W+ SH  ++G      EPWL +H DF ++F+ G+SAG NI HN+AI AG+        
Sbjct  147   LNWIVSHCDSNG-----PEPWLNDHADFGRMFLAGESAGANIAHNMAIAAGDSESGLGIG  201

Query  624   LLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             LLG  L  PYFW S+  G E      ++ + ++W F+ P+     D+P + P+A + PSL
Sbjct  202   LLGIALVHPYFWGSDPIGSEGIDPESKASVDRLWPFICPSNPDN-DDPRVNPVANDGPSL  260

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
              GL C ++ V VAEKD L+E    Y +A+ +SGW G +E+ + EGE H F + +   +KA
Sbjct  261   VGLGCKRVLVSVAEKDVLKERGWLYYQALSRSGWMGVVEIDETEGEGHGFHLYDLECDKA  320

Query  282   KDTFKRIASFIQ  247
             KD  K +A+F  
Sbjct  321   KDLIKGLAAFFN  332



>ref|XP_010943013.1| PREDICTED: probable carboxylesterase 12 [Elaeis guineensis]
Length=321

 Score =   260 bits (664),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 152/313 (49%), Positives = 194/313 (62%), Gaps = 18/313 (6%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVP-PSPEDSATGVSSKDITVSP--NISVRVYLPKLA-SATQK  985
             LIR YK GR+ER   Y     P+  D  TGV+SKD+ + P   +SVR++LPKL  +A +K
Sbjct  14    LIRQYKSGRIERFAFYVTNKIPAAADPETGVTSKDVVIDPETGVSVRLFLPKLGDTAPKK  73

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LPI VY+HGGGF + SAF    HHYL  LV++ANVIAVSV+YRLAPEHPLP  YED W A
Sbjct  74    LPIYVYFHGGGFVMGSAFDPPSHHYLTHLVAKANVIAVSVDYRLAPEHPLPIAYEDSWAA  133

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+WV SHA+  G      E WL  HGDF  IF+ G SAGGNI H++A+RAG   L    +
Sbjct  134   LKWVMSHAAGGGA-----ESWLAEHGDFGAIFLDGCSAGGNIAHHMALRAGAAELGPGVR  188

Query  624   LLGGILSFPYFWSSN-------EKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             + G +L  PYF           +KG ++ I   +W  V P    G+D+P++ P+AE APS
Sbjct  189   VRGLVLVHPYFLRREPYPSELVDKGLKEKI-DGLWLLVCPGTV-GMDDPLVNPLAEAAPS  246

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L GL C K+ VC AEKD L++    Y E V++SGW GE+E  + EGE H F  M    EK
Sbjct  247   LKGLGCEKVLVCAAEKDGLKDSGRAYYEGVRRSGWGGELEWFESEGEGHAFHFMKMSCEK  306

Query  285   AKDTFKRIASFIQ  247
             A +  +R   FI 
Sbjct  307   ALELMERTVKFIN  319



>ref|XP_004152796.1| PREDICTED: probable carboxylesterase 2-like [Cucumis sativus]
 ref|XP_004160045.1| PREDICTED: probable carboxylesterase 2-like [Cucumis sativus]
Length=344

 Score =   261 bits (666),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/311 (45%), Positives = 194/311 (62%), Gaps = 15/311 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             PLIR+YK+GR+ER+    +VP S  D  TGV+SKD+T+ P   +S R++LP L  +TQ+L
Sbjct  32    PLIRIYKNGRIERLVGIDFVP-SGTDPLTGVTSKDVTLLPTFGVSARLFLPNLTHSTQRL  90

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P++VY+HGG FC  S F++ YH+YLN L ++A V+AVSV YR APEHP+P  YED W AL
Sbjct  91    PVVVYFHGGCFCTQSPFTAKYHNYLNALTAEAKVVAVSVNYRKAPEHPIPTAYEDSWAAL  150

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             QWV SH    G ++     W+  H DF+++F+ G SAG NI HN+A+ AG+        L
Sbjct  151   QWVISHRDGKGPEM-----WMNKHVDFKRVFLAGASAGANIAHNLAMVAGDPDCGVNINL  205

Query  621   LGGILSFPYFWSSNEKGGEQS------ILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
             +G  L  PYFW S   G E        +  ++W F+ P A+   D+P + P+AE A  LA
Sbjct  206   IGVALEHPYFWGSVRIGKEAENPVKARLFDQLWGFICP-ARPENDDPWVNPVAEGAGRLA  264

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
             GL   ++ VCVAEKD LR+    Y EA+  SGW G  E+V+ E E+H F + +   +KAK
Sbjct  265   GLGSGRVLVCVAEKDVLRDRGRLYFEALGGSGWFGVAEIVETEDEDHMFHLNDLEGQKAK  324

Query  279   DTFKRIASFIQ  247
             D  +R+  F  
Sbjct  325   DLIRRLGDFFN  335



>ref|XP_010066036.1| PREDICTED: probable carboxylesterase 12 [Eucalyptus grandis]
Length=316

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 141/314 (45%), Positives = 203/314 (65%), Gaps = 19/314 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASAT-Q  988
             SP  R+YKDGRVER      VPPS  D  T V SKD+ +S +  +S R+Y+PK A+ + Q
Sbjct  10    SPYARIYKDGRVERFVGTETVPPS-LDEKTSVQSKDVAISSDSAVSARLYIPKAATDSFQ  68

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+LVY+HGGGF +++A+S  YH+YLN LV++AN+IAVSV YR APEHPLPA Y+D W 
Sbjct  69    KLPVLVYFHGGGFIIETAWSPAYHNYLNALVAEANIIAVSVNYRRAPEHPLPAAYDDSWT  128

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
              L+WVASH++ +G      E WL +H + +K+F+ GDSAGGNIVHN+ IR   + L +  
Sbjct  129   TLKWVASHSTGNG-----PEEWLNSHANLKKVFMAGDSAGGNIVHNMGIRLAEQTL-KGI  182

Query  627   KLLGGILSFPYFWSS------NEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             + LG I+  PYFW          +  ++S+++K+W    PT     D+P+I P  +  P 
Sbjct  183   EFLGVIMVHPYFWGDKPLPLETTEPEKRSVVEKLWCAANPTTT-ACDHPLINPAMD--PR  239

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L+GL  +++ +CVAEKD  R+    Y E + + GW G +EV +  GE+H F ++NP  + 
Sbjct  240   LSGLAFNRILICVAEKDIFRQRGWHYKEVLSERGWSGFVEVTEAPGEDHVFHLINPSCDN  299

Query  285   AKDTFKRIASFIQD  244
             A    K++ASF+ +
Sbjct  300   AVKMMKKLASFMNE  313



>gb|EMS55581.1| putative carboxylesterase 2 [Triticum urartu]
Length=319

 Score =   259 bits (663),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 137/309 (44%), Positives = 193/309 (62%), Gaps = 19/309 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLPI  976
             P IR+Y++ RVER     +V  S  D+ATGV+S+D T+SP +S R+YLP+L  A  KLP+
Sbjct  23    PCIRIYRN-RVERYLGSEFVASS-TDAATGVTSRDRTISPQVSARLYLPRL-DAAAKLPV  79

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LVYYHGGGFC+ SAF+ ++H YLN LV+ ANV+ VSVEYRLAPEHP+PA Y D WEAL W
Sbjct  80    LVYYHGGGFCLGSAFNPMFHAYLNNLVALANVLVVSVEYRLAPEHPVPAAYADSWEALTW  139

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
               SH         + EPWL +H DF ++++GGDS+G NI H++A+R G E L + +K+ G
Sbjct  140   AVSH---------VDEPWLADHADFSRLYLGGDSSGANIAHHMAMRVGAEGLARGAKIHG  190

Query  615   GILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGL  454
              ++  PYF  SN+ G +      +  L   W  + PT  G  D+P I P+ +  P L  L
Sbjct  191   LVMIHPYFLGSNKVGSDDLDPTARETLASAWRIMCPTTTGE-DDPRINPLVDGVPGLEAL  249

Query  453   RCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDT  274
                ++ VC+AE D LR+    Y + ++ SGW GE ++    G+ H F ++ P  ++A   
Sbjct  250   ASGRVLVCIAEGDVLRDRGRAYYDRLRASGWSGETDIWQAPGKGHTFHLLEPCCQEAVAQ  309

Query  273   FKRIASFIQ  247
              K IA F+ 
Sbjct  310   DKVIAEFLN  318



>ref|XP_008236535.1| PREDICTED: probable carboxylesterase 12 [Prunus mume]
Length=315

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 150/317 (47%), Positives = 199/317 (63%), Gaps = 25/317 (8%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPS--PEDSATGVSSKDITVS--PNISVRVYLPKLA--S  997
             SP+I+VYKDGRVER+     VPPS  PE+   GV SKD+ +S  P IS R+Y+PK +  S
Sbjct  11    SPMIKVYKDGRVERLMGIERVPPSTHPEN---GVQSKDVVISQEPAISARIYIPKTSTDS  67

Query  996   ATQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYED  817
                KLP+L+Y+HGGGF V+S FS  YH Y+N LVS+ANV+AVSV YRL PEHPLPA Y+D
Sbjct  68    PQTKLPLLIYFHGGGFSVESPFSPAYHSYVNTLVSEANVVAVSVGYRLVPEHPLPAAYDD  127

Query  816   CWEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLN  637
              W A++WVASH   +G      E WL    DF+++F  GDS+G NI HN+A++ G E L 
Sbjct  128   SWAAIKWVASHFDGNGS-----EDWLNRFADFQRVFFAGDSSGANITHNMAVKLGCERL-  181

Query  636   QKSKLLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAE  478
                KL+G +L  P+FW +   G E       +  +  VW F  P+  G  D+P+I P  +
Sbjct  182   VGVKLVGIVLVHPFFWGTEPVGAELTTPAATKEYMAGVWRFACPSTCGS-DDPLINPAKD  240

Query  477   NAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNP  298
               P L  L C K+ VCVAEKD L++    Y E +KKSGW G +EV++ +GE H F + NP
Sbjct  241   --PKLGELGCEKVLVCVAEKDGLKDRGWHYSEILKKSGWNGAVEVIESKGEGHVFHLFNP  298

Query  297   GTEKAKDTFKRIASFIQ  247
               + A    K+I SF+ 
Sbjct  299   ICDNAVALKKKIVSFLN  315



>ref|XP_008805889.1| PREDICTED: tuliposide A-converting enzyme 2, chloroplastic-like 
[Phoenix dactylifera]
Length=318

 Score =   259 bits (662),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 148/311 (48%), Positives = 193/311 (62%), Gaps = 17/311 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLA-SATQK  985
             PLIR YK GR+ER    P   P+  D  TGV+SKD+ +     +SVR++LPKL  +A +K
Sbjct  13    PLIRQYKSGRIERF-YLPRKAPAAIDPETGVTSKDVVIDQETGVSVRLFLPKLGDTAPKK  71

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LPI VY+HGGGF + SAF  + H YL  LV++ANVIAVSV+YRLAPEHPLP  YED W A
Sbjct  72    LPIYVYFHGGGFVIGSAFDHLTHDYLTPLVARANVIAVSVDYRLAPEHPLPIAYEDSWAA  131

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+WVASHA+  G      E WL   GDF +IF+ G SAGGNI H++A+RAG   L    +
Sbjct  132   LKWVASHAAGGGT-----EAWLAEQGDFGRIFLDGCSAGGNIAHHMALRAGTAELGPGVR  186

Query  624   LLGGILSFPYFWSSN------EKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G +L  PYF   +         G +  +  +W    P    G+D+P++ P+AE APSL
Sbjct  187   IRGMVLIHPYFAGRDPFPSELADMGLKEKMDGLWVLACPGTV-GMDDPLVNPLAEAAPSL  245

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
              GL C K+ VCVAEKD LRE    Y E +K+SGW G +E ++ EG  H F + N   E+A
Sbjct  246   KGLGCEKVLVCVAEKDVLRERGRAYYEGLKRSGWGGVVEWLESEGVGHAFHVQND-CEQA  304

Query  282   KDTFKRIASFI  250
              +  +R   FI
Sbjct  305   LELMERTVKFI  315



>gb|KCW63810.1| hypothetical protein EUGRSUZ_G01481, partial [Eucalyptus grandis]
Length=317

 Score =   259 bits (662),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 201/308 (65%), Gaps = 19/308 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLAS-ATQ  988
             SP  R+YKDGRVER+     VPPS  D  TGV SKD+ +SP+  +SVR+Y+PK A+ + Q
Sbjct  20    SPYARIYKDGRVERLLGTETVPPS-LDEKTGVQSKDVAISPDSAVSVRLYIPKAATDSLQ  78

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+LVY+HGGGF ++SA S  YH+YLN LV++AN+IA+SV+YR APEHPLPA Y+D W 
Sbjct  79    KLPVLVYFHGGGFIIESAQSPTYHNYLNALVAEANIIAISVDYRRAPEHPLPAAYDDSWT  138

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
              L+WVASH++ +G      E WL +H + +K+F+ GDSAG NI++N+ IR G E LN   
Sbjct  139   TLKWVASHSTRNG-----PEDWLNSHANLKKVFMAGDSAGANIINNMGIRLGEEKLN-GI  192

Query  627   KLLGGILSFPYFWSS------NEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             +  GGI+  PYFW          +  ++S+++ +W    PT   G D+P++ P  +  P 
Sbjct  193   EFRGGIMVHPYFWGDEPLPLETTEPKKRSLIRDLWRAASPTTP-GCDDPLMNPATD--PR  249

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L+    +++ +CVAEKD  R+    Y E + +SGW G +EV++  GE+H F + NP  + 
Sbjct  250   LSSFNVNRVLICVAEKDIFRQRGWYYKEVLSESGWSGVVEVMEAPGEDHIFHLSNPSCDN  309

Query  285   AKDTFKRI  262
             A    K++
Sbjct  310   AAKMMKKL  317



>ref|XP_011000158.1| PREDICTED: probable carboxylesterase 12 [Populus euphratica]
Length=313

 Score =   259 bits (661),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 142/312 (46%), Positives = 204/312 (65%), Gaps = 19/312 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQK  985
             SPL+R+YKDGR+ER+       P   D  + V S+D+  SP  ++S R+YLPK  +  QK
Sbjct  9     SPLLRLYKDGRIERLMGVDIALPG--DPNSNVMSRDVVYSPALDLSCRLYLPKNTNPHQK  66

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVY+HGGGF +++AFSS YH+YLN LV++ANVI VSV+YR APEHPLPA Y+D W A
Sbjct  67    LPLLVYFHGGGFVIETAFSSTYHNYLNTLVAEANVIGVSVDYRRAPEHPLPAAYDDSWTA  126

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+WVASH + DG      E WL +H DF K+F  GDSAG NI H +A+R G E +     
Sbjct  127   LKWVASHVNGDG-----PEEWLNSHADFSKVFFYGDSAGANISHQMAMRHGQEKI-VGFN  180

Query  624   LLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G +L+ PYFW  +  G E      ++  + +W    PT+  G D+ ++ P+ +  P+L
Sbjct  181   VAGIVLAHPYFWGKDPIGNEPKESSQRAFAEGLWRLSCPTSN-GCDDLLLNPLVD--PNL  237

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             A L CSK+ V VAEKD LR+   RY E ++++ W GE+E+++ +GE H F +++P  E A
Sbjct  238   ARLECSKVLVAVAEKDLLRDRGWRYYEKLRENEWSGEVEIMEAKGENHVFHLLSPPGENA  297

Query  282   KDTFKRIASFIQ  247
             +   ++I+SF+ 
Sbjct  298   RLMLEKISSFLN  309



>gb|KCW63809.1| hypothetical protein EUGRSUZ_G01478, partial [Eucalyptus grandis]
Length=317

 Score =   259 bits (662),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 199/308 (65%), Gaps = 19/308 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLAS-ATQ  988
             SP  R+YKDGRVER+     VPPS  D  TGV SKD+ +SP+  +SVR+Y+PK A+ + Q
Sbjct  20    SPYARIYKDGRVERLLGTETVPPS-LDEKTGVQSKDVAISPDSAVSVRLYIPKAATDSLQ  78

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+LVY+HGGGF ++SA S  YH+YLN LV++AN+IA+SV+YR APEHPLPA Y+D W 
Sbjct  79    KLPVLVYFHGGGFIIESAQSPTYHNYLNALVAEANIIAISVDYRRAPEHPLPAAYDDSWT  138

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
              L+WVASH++ +G      E WL +H + +K+F+ GDSAG NI++N+ IR G E LN   
Sbjct  139   TLKWVASHSTRNG-----PEDWLNSHANLKKVFMAGDSAGANIINNMGIRLGEEKLN-GI  192

Query  627   KLLGGILSFPYFWSS------NEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             +  GGI+  PYFW          +  ++S++   W    PT   G D+P++ P  +  P 
Sbjct  193   EFRGGIMVHPYFWGDEPLPLETTEPKKRSLIMDFWHAASPTTT-GCDDPLMNPATD--PR  249

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L+    +++ +CVAEKD  R+    Y E + +SGW G +EV++  GE+H F + NP  + 
Sbjct  250   LSSFNVNRVLICVAEKDMFRQRGWYYKEVLSESGWSGVVEVMEAPGEDHIFHLSNPSCDN  309

Query  285   AKDTFKRI  262
             A    K++
Sbjct  310   AAKMMKKL  317



>ref|XP_007156545.1| hypothetical protein PHAVU_003G295100g [Phaseolus vulgaris]
 gb|ESW28539.1| hypothetical protein PHAVU_003G295100g [Phaseolus vulgaris]
Length=316

 Score =   259 bits (661),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 143/312 (46%), Positives = 197/312 (63%), Gaps = 18/312 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQK  985
             SP ++VYKDG V+R+     VPP   D+ T V SKD+ +S +  +S R+++PKL   TQK
Sbjct  13    SPFLKVYKDGTVQRVSGCDVVPPC-FDTETNVESKDVVISKDDDVSARLFIPKLTDQTQK  71

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVY+HGGGFC+++ +S  YH +LN +VS+AN++AVSV YR APEHP+P  YED W +
Sbjct  72    LPLLVYFHGGGFCIETPYSPPYHKFLNSIVSKANIVAVSVHYRRAPEHPVPIAYEDSWTS  131

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+WVASH   +G      E WL  H DF K+F GGDSAG NIVHN+ IRAG   L     
Sbjct  132   LKWVASHFDGNG-----PEEWLNRHADFGKVFCGGDSAGANIVHNMGIRAGTHGL-PGLN  185

Query  624   LLGGILSFPYFW------SSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G +L  PYFW      S +EK    +++  +W FV PT+ G  D+P+I P  +  P+L
Sbjct  186   IEGIVLVHPYFWGVERIGSESEKAELLAMVDNLWRFVSPTSTGS-DDPLINPGTD--PNL  242

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
               L C ++ + VAE D +++    Y E V+K GW+G  EVV+ +GE H F + NP ++ A
Sbjct  243   GKLGCKRVVIFVAENDLMKDRGWYYKELVEKCGWEGVAEVVEAKGENHVFHLFNPDSDNA  302

Query  282   KDTFKRIASFIQ  247
                  R ASFI 
Sbjct  303   ISLLHRFASFIN  314



>ref|XP_006387587.1| hypothetical protein POPTR_0807s00200g [Populus trichocarpa]
 gb|ERP46501.1| hypothetical protein POPTR_0807s00200g [Populus trichocarpa]
Length=328

 Score =   259 bits (662),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 143/312 (46%), Positives = 197/312 (63%), Gaps = 20/312 (6%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKLPI  976
             +RV+KDG VER+    ++PPS  D  TGVSSKDI V P  NI+ R++LPK+    +KL +
Sbjct  16    LRVHKDGHVERLRPTDFIPPS-TDPITGVSSKDIVVVPESNITARLFLPKITDPNEKLAV  74

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
             LVY+HGG F   + F+S  H+++  LVS+ANV+ VSV+YR APEHP+PA YED   AL+W
Sbjct  75    LVYFHGGAFVARTPFTSPIHNFVTNLVSEANVVVVSVDYRKAPEHPIPAAYEDSRAALKW  134

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
             VASH++ +G      EPWL NH DF+++FVGGDS+  NI HN+A+ AG+  L     LLG
Sbjct  135   VASHSNRNG-----PEPWLNNHADFQRVFVGGDSSRANIAHNLAMAAGSPELGLDIGLLG  189

Query  615   GILSFPYFWSSNEKGGE-----------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
               L  PYFW S   G E           +  L  +W F+ P+     D+P + P+AE AP
Sbjct  190   IALVHPYFWGSVRIGSETVYPDDKAVINRGFLDMLWPFICPSNPDN-DDPRLNPVAEGAP  248

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
             SL GL C ++ VCVAE D L++    Y EA+ +SGW G +E+ + +GE H F   +   E
Sbjct  249   SLVGLGCKRVLVCVAEHDVLKDRGWLYYEALSRSGWMGVVEIFETQGEHHGFHYRDVECE  308

Query  288   KAKDTFKRIASF  253
             K+K   +R+A+F
Sbjct  309   KSKQLIQRLAAF  320



>emb|CDP21662.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   259 bits (661),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 150/307 (49%), Positives = 201/307 (65%), Gaps = 20/307 (7%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPED---SATGVSSKDITVSPNISV--RVYLPKLASAT  991
             P  RVYKDGRVE+    P+VPPS  D   S  GV SKD+ +SP   V  R+YLP      
Sbjct  21    PFFRVYKDGRVEKFLQAPFVPPSDSDDPQSTGGVRSKDVIISPETQVGARLYLPATVKPD  80

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
             +KLP+L+Y HGG F + SAFS +YH+YL  + ++ANV+AVS+EYRLAPEHP+PA ++D W
Sbjct  81    EKLPVLIYIHGGAFVIGSAFSVVYHNYLTSVAAEANVVAVSIEYRLAPEHPIPACFDDSW  140

Query  810   EALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQK  631
                +WVASHA+  G      EPW  NH DF ++F+ GDSAGGNI H +A++A  E L   
Sbjct  141   AVTKWVASHANRQG-----PEPWFNNHADFSRVFLAGDSAGGNIAHYMAVKASREGLGDG  195

Query  630   SKLLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLR  451
              KL+G IL+ PYF     KGG     +++W+++    K G D+P + PMA +   L+GL 
Sbjct  196   VKLVGLILAHPYF----GKGGR----EELWEYITSDFK-GWDDPRLNPMASSG-LLSGLL  245

Query  450   CSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTF  271
             C K+ +C +E D +R+ SL Y EA+KKSGW+GE+EVVDVE E H F I+NP  + A    
Sbjct  246   CEKILLCTSETDFIRDRSLHYSEALKKSGWRGELEVVDVEKEGHVFHILNPSGDNAGILM  305

Query  270   KRIASFI  250
             KR+ SF+
Sbjct  306   KRLVSFL  312



>gb|AFV95088.1| carboxylesterase 1 [Solanum chmielewskii]
Length=369

 Score =   260 bits (665),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 148/338 (44%), Positives = 203/338 (60%), Gaps = 45/338 (13%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             PL+RVYKDGR+ER+    +VP +  D  TGV  KD+ + P  N+S R+YLPK     QK+
Sbjct  10    PLMRVYKDGRIERLAGEGFVP-TESDPETGVQIKDVQIDPQINLSARLYLPKNVDPVQKI  68

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+ VY+HGGGF ++SAFS  YH YL+++ ++A V  VSV YRLAPE+PLP  YED W AL
Sbjct  69    PLFVYFHGGGFVIESAFSPTYHKYLSLVAAEAKVAIVSVNYRLAPEYPLPIAYEDSWLAL  128

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WV SHA+ DG     +EPWL ++ DF ++F+GGDSAGGN+ H++ IR G E   +  K+
Sbjct  129   KWVTSHANGDG-----REPWLKDYADFNRVFLGGDSAGGNVAHHIGIRLGLEKF-EGVKI  182

Query  621   LGGILSFPYFWSSNEKGGE---------------------------------QSILQKVW  541
              G  L+ PYFW  +   GE                                 + + +K+W
Sbjct  183   DGIFLACPYFWGKDRIEGEGENLLAKDLVEDLVLVGNPNSTGLDKDPIDLGSKDLFEKLW  242

Query  540   DFVYPTAKGGIDNPMIYPMAENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGW  361
              FV PT+  G+D+P+I P  E  P L+GL C+KL V VA KD LR     Y E  +KSGW
Sbjct  243   LFVNPTSS-GLDDPLINP--EKDPELSGLGCAKLVVYVAGKDPLRFRGFYYKELFEKSGW  299

Query  360   KgeievvdvegeEHCFPIMNPGTEKAKDTFKRIASFIQ  247
              G +EVV+V+G+ H F +  P  E+A    K++ASF+ 
Sbjct  300   PGTVEVVEVKGKGHVFHLFVPEAEEAIAMLKKLASFLN  337



>ref|XP_004294832.1| PREDICTED: probable carboxylesterase 12-like [Fragaria vesca 
subsp. vesca]
Length=317

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 145/317 (46%), Positives = 198/317 (62%), Gaps = 24/317 (8%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLAS--ATQ  988
             P+IRVYKDGR++R+ +   VP +  D  T V SKD+ +S  P IS R+YLPK A+  +T 
Sbjct  11    PIIRVYKDGRIDRLWDTSPVPATI-DPQTSVQSKDVVISTTPLISARLYLPKSATPESTG  69

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             K P+L+Y+HGGGFC  SAFS  YH++LN+LVS+ANV+AVSVEYRL PEHPLPA YED W 
Sbjct  70    KFPLLIYFHGGGFCNGSAFSPTYHNHLNLLVSEANVVAVSVEYRLVPEHPLPAAYEDSWA  129

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             A++WV +H +  G      E WL  H D  ++F  GDSAG NI H + ++ G E L    
Sbjct  130   AVKWVETHFAGTG-----PEEWLNQHADLNRVFFSGDSAGANIAHQMGLKVGTEKL-VGF  183

Query  627   KLLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAP  469
             KL G +L  PYFW     GGE       + +L  +W F YP    G D+P + P  +  P
Sbjct  184   KLNGIVLVHPYFWGEEPIGGELALAENTRKMLADLWRFCYPLTS-GTDDPFLNPGKD--P  240

Query  468   SLAGLRCSKLHVCVAEKDELREISLRY---VEAVKKSGWKgeievvdvegeEHCFPIMNP  298
              LA L C K+ VCVAEKD +++  L Y    E +KKSGW G +EV++ + E+H F +++ 
Sbjct  241   KLAELGCGKVLVCVAEKDSVKDRGLYYSEVSEVLKKSGWNGVVEVMEAKEEDHVFHLIDN  300

Query  297   GTEKAKDTFKRIASFIQ  247
               + A+   K++ SF+ 
Sbjct  301   SCDNARTMLKKVVSFMN  317



>emb|CDP21304.1| unnamed protein product [Coffea canephora]
Length=314

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 142/309 (46%), Positives = 197/309 (64%), Gaps = 20/309 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPS----PEDSATGVSSKDITVSP--NISVRVYLPKLASA  994
             PL RV+KDGRVER    P+ PPS    P     GV SKDI +SP   +  R++LPK    
Sbjct  19    PLFRVFKDGRVERFSQTPFTPPSDSEDPNAVTGGVRSKDIVISPENKVGARLFLPKTIKP  78

Query  993   TQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDC  814
              +K P+L+Y HGG F ++SAFS  YH+Y++ LV++AN+IAVSVEYRLAPEHP+PA Y+D 
Sbjct  79    DEKRPLLIYIHGGAFAIESAFSIQYHNYVSSLVAEANIIAVSVEYRLAPEHPVPACYDDS  138

Query  813   WEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             W  + WV +HA +  +Q P  + W+ NH DF K+F  GDSAGGNI HN+A+RAG + L  
Sbjct  139   WAVINWVTAHAKD--RQGP--DLWINNHADFTKVFFSGDSAGGNIAHNMAVRAGQDGLGD  194

Query  633   KSKLLGGILSFPYFWSSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGL  454
               KL G IL  P+F              K+W+ +    K G ++P + PMA    SL+ L
Sbjct  195   GVKLEGVILMHPFFGDGKP--------NKLWELICSDFK-GWEDPRLNPMAHPG-SLSSL  244

Query  453   RCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDT  274
              C K+ +C++EKD +RE    Y EA+KK+GWKGE+++VD+E E H F ++NP   +A   
Sbjct  245   VCGKILICISEKDIIRESGQLYYEALKKNGWKGELDLVDIEEEGHVFHLLNPDCHRAGVL  304

Query  273   FKRIASFIQ  247
              +R+ SF++
Sbjct  305   MRRVVSFLR  313



>ref|XP_008236533.1| PREDICTED: probable carboxylesterase 12 [Prunus mume]
Length=318

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 151/318 (47%), Positives = 203/318 (64%), Gaps = 24/318 (8%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPK---LASA  994
             SP I+VYKDGRVER+     VPPS  D  TGV SKD+ +S  P IS R+Y+PK    +S 
Sbjct  11    SPGIKVYKDGRVERLQGTDIVPPS-TDPKTGVQSKDVVISQEPAISARLYIPKSTTTSSP  69

Query  993   TQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVS--QANVIAVSVEYRLAPEHPLPAGYE  820
               KLP+L+Y+HGGGFC++S+ S  YH+YLN LVS  +ANV+AVSV+YRLAPE+PLPA YE
Sbjct  70    QTKLPLLIYFHGGGFCIESSSSPTYHNYLNALVSDSEANVVAVSVDYRLAPENPLPAAYE  129

Query  819   DCWEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPL  640
             D W AL+WVASH+  DG      E WL +  DF+++F  GDSAGGN+ HN+A++ G E L
Sbjct  130   DSWAALKWVASHS--DGNS---SEDWLNSFADFQRVFFSGDSAGGNLAHNMALKVGCEGL  184

Query  639   NQKSKLLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMA  481
                  L+G +L  PYFW +   G E       + I+  +W F YP+  G  D+P   P  
Sbjct  185   -AGVNLIGIVLVHPYFWGTEPVGEELTAPAAAREIVSALWRFTYPSTSGS-DDPFFNPGK  242

Query  480   ENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMN  301
             ++   L  L C K+ V VAEKD L++  L Y E +KKSGWKG +E+++  GE H F + +
Sbjct  243   DS--KLGELGCVKVLVFVAEKDILKDRGLYYSEILKKSGWKGVVELIEAMGEGHVFHLED  300

Query  300   PGTEKAKDTFKRIASFIQ  247
             P  + A    K+I +F+ 
Sbjct  301   PTCDNAVAMEKKIVAFLN  318



>gb|KCW53399.1| hypothetical protein EUGRSUZ_J02629, partial [Eucalyptus grandis]
Length=317

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/308 (45%), Positives = 199/308 (65%), Gaps = 19/308 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLAS-ATQ  988
             SP  R+YKDGRVER+     VPPS  D  TGV SKD+ +SP+  +S R+Y+PK A+ + Q
Sbjct  20    SPYARIYKDGRVERLLGTEIVPPS-LDEKTGVQSKDVAISPDSAVSGRLYIPKAATDSLQ  78

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+LVY+HGGGF ++SA S  YH+YLN LV++AN+IA+SV+YR APEHPLPA Y+D W 
Sbjct  79    KLPVLVYFHGGGFIIESAQSPTYHNYLNALVAEANIIAISVDYRRAPEHPLPAAYDDSWT  138

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
              L+WVASH++ +G      E WL +H + +K+F+ GDSAG NI++N+ IR G E LN   
Sbjct  139   TLKWVASHSTRNG-----PEDWLNSHANLKKVFMAGDSAGANIINNMGIRLGEEKLN-GI  192

Query  627   KLLGGILSFPYFWSS------NEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             +  GGI+  PYFW          +  ++S++   W    PT   G D+P++ P  +  P 
Sbjct  193   EFRGGIMVHPYFWGDEPLPLETTEPKKRSLIMDFWHAASPTTT-GCDDPLMNPATD--PR  249

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L+    +++ +CVAEKD  R+    Y EA+ +SGW G +EV++  GE+H F + NP  + 
Sbjct  250   LSSFNVNRVLICVAEKDMFRQRGWYYKEALSESGWSGVVEVMEAPGEDHIFHLSNPSCDN  309

Query  285   AKDTFKRI  262
             A    K++
Sbjct  310   AAKMMKKL  317



>ref|XP_004230812.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum lycopersicum]
Length=309

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/311 (48%), Positives = 200/311 (64%), Gaps = 21/311 (7%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             PL+RVYKDGR+ER+    +VPP   D  TG+  KDI + P  N+S R+YLPK     QK+
Sbjct  10    PLMRVYKDGRIERLAGEGFVPPE-SDPETGLQIKDIEIDPQINLSARLYLPK---NVQKI  65

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+ VY+HGGGF ++SA S  YH +L+ + ++A V+ VSV YRLAPE+PLP  YED W AL
Sbjct  66    PLFVYFHGGGFVIESASSPSYHKHLSTVAAEAKVVIVSVNYRLAPEYPLPIAYEDSWLAL  125

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +W+ASHA+ DG      EPWL  H DF +++ GGDSAGGNI H++AIR G E L+   KL
Sbjct  126   KWIASHANGDGH-----EPWLKEHADFSRVYFGGDSAGGNIAHHIAIRVGLEKLD-GVKL  179

Query  621   LGGILSFPYFWSSN------EKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              G  L+ P+FW  +      E  G +  ++K+W F YP +  G+D+P+I P  E  P+L+
Sbjct  180   EGIFLACPFFWGKDPIDGEGENLGAKDFVEKLWLFAYPNSL-GLDDPLINP--EKDPNLS  236

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
              L C K+ V VA KD LR     Y EA++KSGW G +EVV+V+ EEH F +    TE A 
Sbjct  237   SLGCDKVVVYVAGKDPLRFRGFYYKEALEKSGWPGTVEVVEVKDEEHVFHLFATETENAM  296

Query  279   DTFKRIASFIQ  247
                K++ SF+ 
Sbjct  297   SMMKKLVSFLN  307



>ref|XP_006487080.1| PREDICTED: probable carboxylesterase 12-like [Citrus sinensis]
Length=321

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 201/312 (64%), Gaps = 17/312 (5%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQK  985
             SPL++V+KDG+VER+     VPPS  D  T V SKD+  SP  N+S R+YLPK  +  QK
Sbjct  15    SPLLKVHKDGKVERLMGTDIVPPS-LDPKTNVDSKDVVYSPEHNLSARLYLPKNTNQNQK  73

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVY+HGGGF +++AFS  YH+YLN LVS+AN+IAVSV+YR APEHPLP  YED W+A
Sbjct  74    LPLLVYFHGGGFFIETAFSPTYHNYLNDLVSEANIIAVSVDYRRAPEHPLPIAYEDSWDA  133

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             ++WVASH   +G      E WL  + DFE++F  GDSAG NI H++AIR G E ++    
Sbjct  134   VKWVASHVDGNG-----PEDWLNRNADFERVFYSGDSAGANIAHHMAIRNGGEIID-GFN  187

Query  624   LLGGILSFPYFWSSNEKGGEQSIL------QKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             ++G +L  PYFW     G E + +      ++ W F  P+   G+D+P + P A+ + SL
Sbjct  188   VVGIVLIHPYFWGVEPVGSEPTDVKIRAGTERFWLFACPSTS-GLDDPWVNPCADGS-SL  245

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             A L C+++ V  AEKD L      Y E +K+SGW G +E+V+ +GE+H F + NP  E A
Sbjct  246   ASLGCARVLVFAAEKDFLCPRGWFYYEKLKESGWGGHVEIVESKGEQHVFHLFNPTCENA  305

Query  282   KDTFKRIASFIQ  247
                 K+I SF  
Sbjct  306   GSMLKKICSFFN  317



>ref|XP_004976420.1| PREDICTED: probable carboxylesterase 1-like isoform X1 [Setaria 
italica]
Length=328

 Score =   258 bits (659),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 140/310 (45%), Positives = 197/310 (64%), Gaps = 15/310 (5%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLAS---ATQKLP  979
             IR++K GRVER C     P S  D+ TGV+SKD  +SP+++VR+YLP  A+    + +LP
Sbjct  19    IRIFKSGRVERYCGSDPTPAS-TDAGTGVASKDHAISPDVAVRLYLPPEAAKDDGSSRLP  77

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             +LVY+HGGGFC+ SAF++I H YL  L ++A  + VSVEYRLAPEHP+PA YED W AL 
Sbjct  78    VLVYFHGGGFCLLSAFNAIIHGYLTSLAARARAVVVSVEYRLAPEHPIPAAYEDSWRALG  137

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WVASHAS    +    EPWL +H DF ++ + G+SAG NI H++A+RA  E L   +++ 
Sbjct  138   WVASHASGGAGE----EPWLADHADFSRLCLAGESAGANIAHHMAMRARAEGLPGSARIS  193

Query  618   GGILSFPYFWSSNEKGGEQS------ILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
             G +L  PYF S      E+S       + ++W  V P A  G+D+P I P+A+ AP+L  
Sbjct  194   GVVLVHPYFLSDARVASEESNPAMAANMVRMWRVVAP-ATTGLDDPWINPLADGAPALRA  252

Query  456   LRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             L C ++ VC+AE+D LR+    Y E +  SGW GE+EVV   G++HCF + +  +  A  
Sbjct  253   LACGRVLVCLAEQDVLRDRGRAYCEGLAASGWAGELEVVQAAGQDHCFHLSDFTSGDAVW  312

Query  276   TFKRIASFIQ  247
               + IA F+ 
Sbjct  313   QDEAIARFVN  322



>ref|XP_011000106.1| PREDICTED: probable carboxylesterase 7 [Populus euphratica]
Length=362

 Score =   259 bits (661),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/312 (46%), Positives = 196/312 (63%), Gaps = 18/312 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQK  985
             SP +R+YKDG VER+     VP S  D  T V SKD   SP  N+S R+Y P+  +  +K
Sbjct  57    SPFLRIYKDGHVERLRGTDIVP-SGLDPKTNVLSKDAVYSPELNLSSRLYRPRNTNPDKK  115

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVYYHGGGFC+++ F+  YH +LN LV+ +NV+A+SV+YRLAPEHPLP  Y+D W A
Sbjct  116   LPVLVYYHGGGFCIETPFNFRYHDHLNNLVAASNVLAISVDYRLAPEHPLPIAYDDSWTA  175

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+WVASH + DG      E WL +H DF ++F+ GDSAG N+ H +A+R G E L+    
Sbjct  176   LKWVASHVNGDG-----PEEWLNSHADFGQVFLAGDSAGANLAHQLAMRYGQEKLS-GID  229

Query  624   LLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             L G IL  PYFW     G E      +S +  +W FV PT+  G+D+P+I P+ +  P L
Sbjct  230   LTGVILVHPYFWGKEHIGTEGENLETKSRIDAIWHFVCPTSS-GLDDPLINPLVD--PRL  286

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
               L C +L V +  KD LRE   +Y E + K GW+G +E+++ + +EH F + +P  E A
Sbjct  287   DSLGCDRLLVIIGGKDVLRERGWQYYERLSKGGWEGVVEIMEGKDDEHVFHLSDPTCENA  346

Query  282   KDTFKRIASFIQ  247
                 KRIASFI 
Sbjct  347   VALLKRIASFIN  358



>ref|XP_004294831.1| PREDICTED: probable carboxylesterase 12-like [Fragaria vesca 
subsp. vesca]
Length=313

 Score =   257 bits (657),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 145/315 (46%), Positives = 195/315 (62%), Gaps = 24/315 (8%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLAS--ATQ  988
             P+I+VYKDGR+ER+ +   VP +  D  TGV SKD+ +S  P IS R+YLPK A+  +T 
Sbjct  11    PIIKVYKDGRIERLWDTSPVPATI-DPQTGVQSKDVVISTIPLISARLYLPKSATPESTG  69

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             K P+LVY+HGGGFC++SAFS  YH+YLN  VS+AN++AVSV+YRLAPEHPLPA YED W 
Sbjct  70    KFPLLVYFHGGGFCIESAFSRTYHNYLNSFVSEANIVAVSVDYRLAPEHPLPAAYEDSWA  129

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNE-PLNQK  631
             AL+WV SH +  G      E WL  H D  ++F  GDSAG NI H++ +R G+E P+   
Sbjct  130   ALKWVESHFAGTG-----PEEWLNQHADLNRVFFAGDSAGANIAHHMGLRVGSEKPVG--  182

Query  630   SKLLGGILSFPYFWSSNEKGGEQSILQK-------VWDFVYPTAKGGIDNPMIYPMAENA  472
               L G +L  PYF      GGE ++ +        +W F YP    G D+P + P  +  
Sbjct  183   FMLNGIVLVHPYFGGEEPIGGELALAENTRKRFADLWRFCYPLTS-GTDDPFLNPGKD--  239

Query  471   PSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
             P LA L C K+ VCVAEKD L++    Y E +KKSGW   +  V    E+H F ++N   
Sbjct  240   PKLAELGCEKVLVCVAEKDLLKDRGWHYSEVLKKSGWN-GVVEVMEAEEDHVFHLINNSC  298

Query  291   EKAKDTFKRIASFIQ  247
             + A+   K++ SF+ 
Sbjct  299   DNARTMLKKVVSFMN  313



>ref|XP_007224951.1| hypothetical protein PRUPE_ppa021391mg [Prunus persica]
 gb|EMJ26150.1| hypothetical protein PRUPE_ppa021391mg [Prunus persica]
Length=306

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 159/318 (50%), Positives = 195/318 (61%), Gaps = 45/318 (14%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPK---LASAT  991
             PLIRVYKDG VER+   PYVPP P D  T VSSKDIT+S  P IS R++LP+        
Sbjct  17    PLIRVYKDGTVERLWGSPYVPPCPHDPQTNVSSKDITISHNPTISARLFLPQNQIYQKPQ  76

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
               LPILVY+HGGGFC +SAFSS +H  LN LVSQA V+AVSVEYRLAPE+PLP  Y+DCW
Sbjct  77    HLLPILVYFHGGGFCFESAFSSDHHRLLNRLVSQAQVLAVSVEYRLAPENPLPNCYQDCW  136

Query  810   EALQWVASHASN---DGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPL  640
             +ALQWV+SH ++   D      KEPWLV                  + HNVA++AG E L
Sbjct  137   DALQWVSSHRTHKELDANNTK-KEPWLVV----------------TLSHNVAMKAGVERL  179

Query  639   NQKSKLLGGILSFPYFWSSNEKGGEQSILQ-------KVWDFVYPTAKGGIDNPMIYPMA  481
                 K+LG  +S  YF  S   G E  +         KVW F+YP+A GGIDNPM+ P+ 
Sbjct  180   CGDVKILGAFMSHLYFLGSKPIGSEPKVEDFEKWLPCKVWKFLYPSAPGGIDNPMVNPVG  239

Query  480   ENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMN  301
               APSLAGL C ++ VC             Y + VK+SGW+GE EV +VEGEEH F I++
Sbjct  240   AGAPSLAGLGCPRMLVC------------WYYDLVKESGWRGEAEVFEVEGEEHAFHILS  287

Query  300   PG-TEKAKDTFKRIASFI  250
                TE  K   +R+ASF+
Sbjct  288   EAETENVKIMLERLASFL  305



>ref|XP_006346460.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum tuberosum]
Length=344

 Score =   258 bits (658),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 147/343 (43%), Positives = 204/343 (59%), Gaps = 50/343 (15%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             PL+RVYKDGR+ER+    +VPP   D  TGV  KD+ + P  N+S R+YLPK     QK+
Sbjct  10    PLMRVYKDGRIERLAGEVFVPPE-SDPETGVQIKDVEIDPQINLSARLYLPKNVDPVQKI  68

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+ VY+HGGGF ++SAFS  YH YL+++ ++A V  VSV YRLAPE+PLP  +ED W AL
Sbjct  69    PLFVYFHGGGFVIESAFSPTYHKYLSLVAAEAKVAIVSVNYRLAPEYPLPIAHEDSWLAL  128

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WV SHA+ DG     +EPWL ++ DF  +++GGDSAGGNI H++AIR G E L +  K+
Sbjct  129   KWVTSHANGDG-----REPWLKDNADFNLVYLGGDSAGGNIAHHIAIRFGLEKL-EGVKI  182

Query  621   LGGILSFPYFWSSN--------------------------------------EKGGEQSI  556
              G  L+ P+FW  +                                      E  G + +
Sbjct  183   DGIFLACPFFWGKDPIDGEGENLLAKDFVEDLVLSGNPNSTGLDKDPIDGEGENLGAKDL  242

Query  555   LQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAV  376
              +K+W FV P +  G+D+P+I P  E  P L+GL C K+ + VA KD LR   L Y EA+
Sbjct  243   FEKLWLFVNPNSS-GLDDPLINP--EKDPKLSGLGCEKVLMYVAGKDPLRFRGLYYKEAL  299

Query  375   KKSGWKgeievvdvegeEHCFPIMNPGTEKAKDTFKRIASFIQ  247
             +KSGW G +EVV+V+ + H F +  P  E+A    K++ASF+ 
Sbjct  300   EKSGWLGTVEVVEVKDKAHVFHLFVPEAEEAMAMLKKLASFLN  342



>emb|CDP01339.1| unnamed protein product [Coffea canephora]
Length=322

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 150/314 (48%), Positives = 197/314 (63%), Gaps = 18/314 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             P +RVYKDG VER+     V P+  DS TGVSSKDI V P   ++ R+Y P L + TQ+L
Sbjct  14    PYLRVYKDGTVERLLGTE-VTPAAFDSKTGVSSKDIIVIPEAGVTARLYRPNLVTKTQRL  72

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+LVY+HGG FC+ S     YH+ LN+LV++A +IAVSV+YRL PEHPLPA YED W  L
Sbjct  73    PLLVYFHGGAFCISSPSDPKYHNCLNLLVAEAKIIAVSVDYRLVPEHPLPAAYEDSWAVL  132

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNE--PLNQKS  628
             +WVASH S +G      E WL    DF K+F+ GDSAG N+ H++AIRAGN   P     
Sbjct  133   KWVASHISGEGS-----EDWLRECVDFSKVFLAGDSAGANLSHHMAIRAGNADPPRIGGL  187

Query  627   KLLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAE-NAP  469
             KL G I+  PYFW  +  G E      + ++ K W FV P+ K G D+P+I P  +  A 
Sbjct  188   KLRGTIMIHPYFWGEDPIGIEAKDPVRKGMVDKWWQFVCPSGK-GCDDPLINPFVDGGAE  246

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
             SL+ L C  + + VA+ D L +   RY E + KS W+G+ E+V+  GE+H F I NP ++
Sbjct  247   SLSRLACDFIIIFVAQNDILADRGRRYYEFLAKSKWQGKAEMVETPGEDHVFHIFNPCSD  306

Query  288   KAKDTFKRIASFIQ  247
             KA+   KR ASFI 
Sbjct  307   KARMLIKRCASFIN  320



>ref|XP_008803545.1| PREDICTED: tuliposide A-converting enzyme 2, chloroplastic-like 
[Phoenix dactylifera]
Length=317

 Score =   257 bits (656),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 151/314 (48%), Positives = 204/314 (65%), Gaps = 17/314 (5%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISV--RVYLPKLASATQK  985
             SP +R+YK GR+ER+     VP S  D ATGV+SKD+T+ P+I V  R+YLP    +++K
Sbjct  12    SPFLRLYKSGRIERLLGTDVVPASV-DPATGVASKDVTIDPSIGVSARLYLPTNTISSKK  70

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
              PIL+Y HGG F ++SAFS  YHHYLN LV++A+V+AVSVEYRLAPEHPLPA Y+D W A
Sbjct  71    FPILIYIHGGAFVIESAFSPTYHHYLNALVARAHVLAVSVEYRLAPEHPLPAAYDDAWAA  130

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
              +WVASH S  G      EPWL  HGDF+++F+ GDSAG NI HN+A+RAG E L    +
Sbjct  131   ARWVASHGSGAGG----PEPWLSEHGDFDRVFLAGDSAGANIAHNMAVRAGAEELRGGMR  186

Query  624   LLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G +L  PYF      G E      +  ++  W FV    K G+++P++ P+      +
Sbjct  187   IRGLVLIHPYFCGKEPVGMESRDPRVRERMESTWGFVCGWKK-GLEDPLVDPL--RGEGM  243

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
              GL C ++ V VAE+D LRE    Y E +K SGW G++E+++ EGEEH F + NP  EKA
Sbjct  244   EGLGCEQVLVSVAERDFLRERGRAYYEGLKGSGWGGKVELMESEGEEHVFHLQNPTGEKA  303

Query  282   KDTFKRIASFI-QD  244
                 +R+ SF+ QD
Sbjct  304   LKEMERMISFLYQD  317



>ref|XP_004230813.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum lycopersicum]
Length=312

 Score =   256 bits (655),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 145/311 (47%), Positives = 201/311 (65%), Gaps = 18/311 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             PL+RV+KDGR+ER+    +VPP   D  TGV  KD+ + P  N+S R+YLPK     QK+
Sbjct  10    PLMRVHKDGRIERLAGEVFVPPE-SDPETGVQIKDVQIDPQINLSARLYLPKNVDPVQKI  68

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+ VY+HGGGF ++SAFS  YH YL+++ ++  V  +SV YRLAPE+PLP  YED W AL
Sbjct  69    PLFVYFHGGGFVIESAFSPTYHKYLSLVAAKTKVAIISVNYRLAPEYPLPIAYEDSWLAL  128

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WV SHA+ DG     +EPWL ++ DF ++++GGDSAGGNI H++AIR G E L+ + K+
Sbjct  129   KWVTSHANGDG-----REPWLKDNADFNRVYLGGDSAGGNIAHHIAIRVGLEKLD-RVKI  182

Query  621   LGGILSFPYFWSSNEKGGEQSI------LQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              G  L+ P FW  +   GE  I      ++K+W F  P +  G+D+P+I P  E  P+L+
Sbjct  183   DGIFLACPSFWGKDPIDGEGEIVGAKDFVEKLWLFANPNSS-GLDDPLINP--EKDPNLS  239

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
              L C K+ V VA KD LR   L Y E ++KSGW G +EVV+V+ EEH F +    TE A 
Sbjct  240   RLGCDKVVVYVAGKDLLRFRGLYYKEVLEKSGWPGTVEVVEVKDEEHVFHLTATETENAM  299

Query  279   DTFKRIASFIQ  247
                K++ SF+ 
Sbjct  300   AMMKKLVSFLN  310



>dbj|BAJ90314.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=324

 Score =   256 bits (655),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 144/311 (46%), Positives = 187/311 (60%), Gaps = 17/311 (5%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQ--K  985
              IRVYK GRVER       PP   D+ATGVSSKDIT+ P   +S R+YLP + +  Q  K
Sbjct  18    FIRVYKSGRVERFLRIDLAPPC-TDAATGVSSKDITILPGAGLSARIYLPPVPAGAQQGK  76

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LV++HGGGFC+ SAF +  H + N L ++A  I VSVEYRLAPEHP+PA Y D W A
Sbjct  77    LPVLVFFHGGGFCLSSAFDAAAHGHANQLAARAGAIVVSVEYRLAPEHPVPALYGDAWAA  136

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             LQWVA+HA   G      EPWL NH DF ++ VGG+SAG NI H+ A+RAG E L    K
Sbjct  137   LQWVAAHAGGQG-----AEPWLTNHADFGRVHVGGESAGANIAHHAAMRAGAEELGHGVK  191

Query  624   LLGGILSFPYFWSSNEKGGEQ------SILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             +   +L  PYF   +    ++        L ++W  V P    G D+P I PMAE APSL
Sbjct  192   VSSLLLIHPYFLGGDSSESDEMGMALLDELVRLWPVVCPGTS-GCDDPWINPMAEGAPSL  250

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             AGL C    VCV  KD +R     Y E +  SGW+GE+E+ + +G+ H F +  P   +A
Sbjct  251   AGLGCKLALVCVGGKDAMRGRGRLYCEKLIGSGWQGEVEIWEADGQGHGFHLFRPTCAQA  310

Query  282   KDTFKRIASFI  250
             +   + +A F+
Sbjct  311   EAQVRVVAEFL  321



>ref|XP_007042381.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
 gb|EOX98212.1| Alpha/beta-Hydrolases superfamily protein, putative [Theobroma 
cacao]
Length=439

 Score =   260 bits (665),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 146/313 (47%), Positives = 201/313 (64%), Gaps = 19/313 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNIS--VRVYLPK-LASATQ  988
             +PL+RVYKDGRVER+     VPP   D  T V SKD+  S      VR+Y+PK + S++Q
Sbjct  133   APLLRVYKDGRVERLLGTQTVPPG-LDPKTNVESKDVVFSQETGQYVRLYIPKAIRSSSQ  191

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+LVY+HGGGFC+++A S  YH+YLN LVS+AN++AVSV+YR APEHP+P  Y+D W 
Sbjct  192   KLPLLVYFHGGGFCIETASSPTYHNYLNSLVSEANIVAVSVDYRRAPEHPIPVAYDDSWA  251

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             AL+WVASH   +G      E WL  H DF+K+++ GDSAG NI H++AI+ G E L+  +
Sbjct  252   ALKWVASHFGGNG-----PEEWLNCHADFDKVYLSGDSAGANIAHHIAIKIGKEKLDGVN  306

Query  627   KLLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
              L G +L+ PYFW     G E      ++ L+++W    PT  G  D+P I P+ +   S
Sbjct  307   -LAGIVLAHPYFWGKEPVGDEIKDPAVRAKLEQIWRLASPTTSGS-DDPWINPVDDQ--S  362

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
                L C+++ VCVAEKD LR     Y E +KKSGW GE E+++ +GEEH F +  P  E 
Sbjct  363   FESLGCTRVLVCVAEKDLLRHRGWYYYEKLKKSGWGGEAEIMEAQGEEHVFHLAKPTCEN  422

Query  285   AKDTFKRIASFIQ  247
             A     ++A+F+ 
Sbjct  423   AVAKLNKVAAFMN  435



>ref|XP_006346463.1| PREDICTED: probable carboxylesterase 7-like [Solanum tuberosum]
Length=312

 Score =   256 bits (654),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 146/311 (47%), Positives = 197/311 (63%), Gaps = 18/311 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             PL+RVYKDGR+ER+    +VPP   D  TGV  KDI + P  N+S R+YLPK     QK+
Sbjct  10    PLMRVYKDGRIERLMGEGFVPPE-LDPETGVQIKDIEIDPEINLSARLYLPKNVDTVQKI  68

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+ VY+HGGGF ++SA S  YH +L+ + ++A V+ VSV YRLAPE+PLP  YED W AL
Sbjct  69    PLFVYFHGGGFVIESASSPSYHKHLSTVAAEAKVVIVSVNYRLAPEYPLPIAYEDTWLAL  128

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WVASHA+ DG      EPWL +H DF +++ GGDSAGGNI H++AIR G E L+   KL
Sbjct  129   KWVASHANGDGH-----EPWLKDHADFNRVYFGGDSAGGNIAHHIAIRVGLEKLDG-VKL  182

Query  621   LGGILSFPYFWSSN------EKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              G  L+ P+FW  +      E  G +  ++K+W F  P +  G+D+P+I P  E  P L+
Sbjct  183   EGIFLACPFFWGKDPIDGEGENLGAKDFVEKLWLFANPNSS-GLDDPLINP--EKDPKLS  239

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
              L C K+ V VA KD LR     Y E ++K+GW G +EVV+V+ EEH F +     E A 
Sbjct  240   SLGCDKVLVYVAGKDPLRFRGFYYKEVLEKNGWPGTVEVVEVKDEEHVFHLFATEAENAM  299

Query  279   DTFKRIASFIQ  247
                K++ SF+ 
Sbjct  300   GMMKKLVSFLN  310



>ref|XP_004976421.1| PREDICTED: probable carboxylesterase 1-like isoform X2 [Setaria 
italica]
Length=327

 Score =   256 bits (655),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 136/292 (47%), Positives = 190/292 (65%), Gaps = 15/292 (5%)
 Frame = -2

Query  1149  IRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLAS---ATQKLP  979
             IR++K GRVER C     P S  D+ TGV+SKD  +SP+++VR+YLP  A+    + +LP
Sbjct  19    IRIFKSGRVERYCGSDPTPAS-TDAGTGVASKDHAISPDVAVRLYLPPEAAKDDGSSRLP  77

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             +LVY+HGGGFC+ SAF++I H YL  L ++A  + VSVEYRLAPEHP+PA YED W AL 
Sbjct  78    VLVYFHGGGFCLLSAFNAIIHGYLTSLAARARAVVVSVEYRLAPEHPIPAAYEDSWRALG  137

Query  798   WVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLL  619
             WVASHAS    +    EPWL +H DF ++ + G+SAG NI H++A+RA  E L   +++ 
Sbjct  138   WVASHASGGAGE----EPWLADHADFSRLCLAGESAGANIAHHMAMRARAEGLPGSARIS  193

Query  618   GGILSFPYFWSSNEKGGEQS------ILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
             G +L  PYF S      E+S       + ++W  V P A  G+D+P I P+A+ AP+L  
Sbjct  194   GVVLVHPYFLSDARVASEESNPAMAANMVRMWRVVAP-ATTGLDDPWINPLADGAPALRA  252

Query  456   LRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMN  301
             L C ++ VC+AE+D LR+    Y E +  SGW GE+EVV   G++HCF + +
Sbjct  253   LACGRVLVCLAEQDVLRDRGRAYCEGLAASGWAGELEVVQAAGQDHCFHLSD  304



>ref|XP_009789749.1| PREDICTED: probable carboxylesterase 2 [Nicotiana sylvestris]
Length=326

 Score =   256 bits (655),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 143/313 (46%), Positives = 197/313 (63%), Gaps = 17/313 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDIT-VSPN--ISVRVYLPKLA-SATQ  988
             P +RVYK+G VER+     VP  P DS TGVSSKDI+ + P+  + VR+Y+P ++    Q
Sbjct  14    PYLRVYKNGHVERLLGIDSVPAGP-DSQTGVSSKDISNIIPDTEVYVRIYVPNISILGNQ  72

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+++Y+HGGGFC+ +  SS YH+YLN LVS++ +IAVSV YR  PEHPLP  YED W+
Sbjct  73    KLPLVIYFHGGGFCMFTPSSSNYHNYLNTLVSESRIIAVSVHYRRPPEHPLPIAYEDSWQ  132

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             ALQWV SH + DGQ     EPWL  H +F ++F+ GDSAG NI HN+A+ AG+       
Sbjct  133   ALQWVFSHCNGDGQ-----EPWLNEHANFGRVFLSGDSAGANIAHNLAMAAGSVEPELMV  187

Query  627   KLLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
              +LG  L  PYFW S   G E      ++ + ++W F  P+     D+P I PM E APS
Sbjct  188   DILGVALVHPYFWGSGSIGSEALYPDKKAHVDRLWSFACPSNPDN-DDPRINPMLEGAPS  246

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L  L C ++ + VAEKD L++    Y +A+ +SGW G +E+ + EG +H F + N   +K
Sbjct  247   LTSLGCRRVLISVAEKDILKDRGWAYYQALGRSGWMGVVEIQETEGVDHVFHLNNLQCQK  306

Query  285   AKDTFKRIASFIQ  247
             +KD  K +A F  
Sbjct  307   SKDLIKNLAHFFN  319



>ref|XP_010028485.1| PREDICTED: probable carboxylesterase 12 [Eucalyptus grandis]
 gb|KCW55227.1| hypothetical protein EUGRSUZ_I01161 [Eucalyptus grandis]
Length=312

 Score =   256 bits (653),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 145/313 (46%), Positives = 197/313 (63%), Gaps = 18/313 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQK  985
             SP +R+YKDGR+ER+     VP S +D AT V+SKD+ +S  P  S R+YLP  A    K
Sbjct  10    SPFLRIYKDGRIERLIGTATVPASLDD-ATRVASKDVPLSSHPAFSARLYLPAAAPRPGK  68

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVY+HGGGFC+++A S  YH+YLN + S+A V+ VSV+YR APE PLPA Y+D W A
Sbjct  69    LPLLVYFHGGGFCIETASSPTYHNYLNAVASEAGVVVVSVDYRRAPEEPLPAAYDDSWAA  128

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             LQWVASHA+ DG      + WL    D +++F+ GDSAG NI H++ +R G + L+  + 
Sbjct  129   LQWVASHAAGDG-----PDEWLNERADLKRVFLAGDSAGANIAHHMGLRIGPDRLDGLA-  182

Query  624   LLGGILSFPYFWSSNEKG------GEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G +L  P+FW S   G      G Q+   K  + + PT  G  D+P+I P A+  P L
Sbjct  183   VAGIVLVHPFFWGSEPVGTETADAGRQAWTVKFLEVLCPTISGA-DDPIINPGAD--PRL  239

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
               L C K+ V VAEKD LR     Y EA+KKSGW G  EVV+ +GE+H F +MNP  + A
Sbjct  240   GALGCDKVLVFVAEKDGLRSRGWYYEEALKKSGWSGRSEVVETKGEDHVFHLMNPSCDNA  299

Query  282   KDTFKRIASFIQD  244
              +  KR+  F+ +
Sbjct  300   LELMKRLVKFLNE  312



>ref|XP_008356214.1| PREDICTED: probable carboxylesterase 12 [Malus domestica]
Length=315

 Score =   256 bits (654),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 149/312 (48%), Positives = 199/312 (64%), Gaps = 19/312 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQK  985
             SP+I+ YKDGR+ER+     VPPS +   TGV S DI +S  P ISVR+Y+PK  SA  K
Sbjct  11    SPVIKAYKDGRIERLLGTATVPPSTQPE-TGVQSNDIVISQQPAISVRLYIPK--SAATK  67

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVY+HGGGF   SA S  YH YLN LVS+ANV+AVSV+YRLAPEHP+PA Y+D W A
Sbjct  68    LPLLVYFHGGGFFFQSASSPTYHDYLNSLVSEANVVAVSVQYRLAPEHPVPAAYDDSWAA  127

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+WVASH     ++    E W+ ++ D +++F  GDSAG NI H++ ++ G+E L    K
Sbjct  128   LKWVASHFDVTQKE---DEDWITSYADSQRMFFAGDSAGANIAHHMGLKVGSEGL-LSVK  183

Query  624   LLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPS  466
             L+G +L  PYFW S   G E       +  +  +W FV P + G  D+P++ P  E  P 
Sbjct  184   LIGVVLVHPYFWGSEPIGVELNAPATMREFMAAMWRFVNPLSSGS-DDPLMNP--EKDPK  240

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L  L C K+ V VAEKD L+E    Y E ++KSGW G +EV++ +GEEHCF + +   E 
Sbjct  241   LGKLGCGKVVVFVAEKDVLKERGWYYGEVLRKSGWNGVVEVMEAKGEEHCFHLDDLTCEN  300

Query  285   AKDTFKRIASFI  250
             A    K+I SF+
Sbjct  301   AVAMQKKIVSFL  312



>gb|AFW62365.1| gibberellin receptor GID1L2 [Zea mays]
Length=327

 Score =   256 bits (655),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 132/309 (43%), Positives = 189/309 (61%), Gaps = 11/309 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLPI  976
             P IRVYK  RVER     +V  S  D+ATGV+S+D+ +SPN+S R+YLP+L   + KLPI
Sbjct  23    PCIRVYKK-RVERYFGTEFVAAS-TDAATGVASRDVVISPNVSARLYLPRLDDESAKLPI  80

Query  975   LVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQW  796
              VYYHGGGFC+ SAF+  +H Y N     ANV+ VSVEYRLAPEHP+PA Y D WEAL W
Sbjct  81    FVYYHGGGFCLGSAFNPTFHSYFNSFAGLANVLVVSVEYRLAPEHPVPAAYADSWEALAW  140

Query  795   VASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKLLG  616
             V SH +  G  V  ++PW+  H DF ++++GG+SAG NI H++A+R   E L   +++ G
Sbjct  141   VVSHLAAAGDNV--RDPWIAGHADFSRLYLGGESAGSNIAHHMAMRVAAEGLAHDARIQG  198

Query  615   GILSFPYFWSSNEKGGEQSILQ------KVWDFVYPTAKGGIDNPMIYPMAENAPSLAGL  454
              ++  PYF  +++   +   L+       +W  + PT  G  D+P+I P  + AP LA L
Sbjct  199   LVMVHPYFLGTDKVPSDDISLEVRESLGSLWRVMCPTTTGE-DDPLINPFVDGAPPLASL  257

Query  453   RCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKDT  274
              C ++ VC+ E D LR+    Y + ++ SGW GE E+     + H F ++ P  ++A   
Sbjct  258   ACGRVLVCIGEGDVLRDRGRAYYDRLRASGWPGEAEIWQAPNKGHTFHLLEPCCDEAVAQ  317

Query  273   FKRIASFIQ  247
              K I+ F+ 
Sbjct  318   DKVISDFLN  326



>ref|XP_010943015.1| PREDICTED: tuliposide A-converting enzyme 2, chloroplastic-like 
[Elaeis guineensis]
Length=317

 Score =   256 bits (653),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 146/311 (47%), Positives = 195/311 (63%), Gaps = 16/311 (5%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNI--SVRVYLPKLASAT-QKL  982
             +IR YK GR+ER+ +   +PP+  D  TGV+SKD+ +      SVR++LPKL   T +KL
Sbjct  12    IIRQYKSGRIERLFSPDKIPPAI-DPETGVTSKDVVIDQETGASVRLFLPKLDDTTPKKL  70

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             PI VY+HGGGF + SAF  + H+YL  LV++ANVIAVSV+YRLAPEHPLP  YED W A 
Sbjct  71    PIYVYFHGGGFVIGSAFDFLTHNYLTPLVAKANVIAVSVDYRLAPEHPLPIAYEDTWAAF  130

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WV SHA+  G      E WL  HGDF +IF+ G SAGGNI H++A+RAG        ++
Sbjct  131   KWVVSHAAGGGA-----ESWLAEHGDFGRIFLDGCSAGGNIAHHMAMRAGAADFGPGVRI  185

Query  621   LGGILSFPYFW------SSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              G +L  PYF       S     G +  +  +W    P    G+D+P++ P+AE APSL 
Sbjct  186   RGMVLVHPYFARGEPYPSELVDKGLKEKMDGLWFLACPGTV-GMDDPLVNPLAEAAPSLK  244

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
             GL C K+ VCVAEKD L++    Y E VKKSGW G++E ++ EGE H F ++   +EKA 
Sbjct  245   GLGCEKVLVCVAEKDVLKDSGRAYYEGVKKSGWGGDVEWLESEGEGHGFHVVKLNSEKAL  304

Query  279   DTFKRIASFIQ  247
             +  +R   FI 
Sbjct  305   ELMERTVKFIN  315



>ref|XP_007017300.1| Catalytic, putative [Theobroma cacao]
 gb|EOY14525.1| Catalytic, putative [Theobroma cacao]
Length=325

 Score =   256 bits (654),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 140/311 (45%), Positives = 194/311 (62%), Gaps = 14/311 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQKL  982
             P ++VYKDG +ERI     V P   D  T V SKDI + P   +S R+Y P LA+  +KL
Sbjct  14    PYLKVYKDGTLERIAGVEVVSPGL-DPETDVLSKDIVIVPETGVSARIYRPNLATTHEKL  72

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P++VY+HGG FCV S     YH  LN LV++AN++A+SV+YRL PE PLP  YED W AL
Sbjct  73    PLVVYFHGGAFCVASPAFPNYHTSLNKLVAEANIVALSVDYRLVPEFPLPTAYEDSWAAL  132

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +W+ASH   D       E W+ +H D +++F+ GDSAG NI H++A+R  +  L QK K+
Sbjct  133   EWIASHKEGDSCH----EAWIKDHADLDQVFLAGDSAGSNISHHLALRLKDSDLGQKLKI  188

Query  621   LGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
             LG  +  PYFW +N  G E      + ++ K W +V P+ K G D+P+I P  + +  L+
Sbjct  189   LGIGMIHPYFWGTNPIGSEFADQFRKELVDKWWLYVCPSDK-GCDDPLINPFVDGSSDLS  247

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
             GL C  + V VAEKD L++    Y + + KSGWKG+ E+++ EGE+H F I NP   KAK
Sbjct  248   GLACDGILVIVAEKDILKDRGRLYYDKLVKSGWKGKAEILETEGEDHVFHIFNPDCAKAK  307

Query  279   DTFKRIASFIQ  247
                KR+ASF+ 
Sbjct  308   SLIKRLASFLN  318



>gb|KCW66448.1| hypothetical protein EUGRSUZ_F00245, partial [Eucalyptus grandis]
Length=319

 Score =   256 bits (653),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 154/319 (48%), Positives = 201/319 (63%), Gaps = 28/319 (9%)
 Frame = -2

Query  1143  VYKDGRVERICNYPYVPPSPEDSATGVSSKDITV--------------SPNISVRVYLPK  1006
             VYKDGRVER+     VPPS  D  TGVSSKDIT+              S  IS R+YLPK
Sbjct  1     VYKDGRVERLFGTDVVPPS-ADPETGVSSKDITIPVTAAASTTTSEPSSHVISARLYLPK  59

Query  1005  LASATQKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAG  826
             L + ++KLP+L+Y+HGG FCV S F++ YH YLN +V++A V+ VSV YR APEHP+PA 
Sbjct  60    L-TESRKLPLLIYFHGGAFCVCSPFNAAYHSYLNAVVAKAKVVVVSVNYRKAPEHPIPAA  118

Query  825   YEDCWEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNE  646
             YED W A+QW ASH   DG      E WL  H DF ++F+ G+SAG NI HN+A+ AG  
Sbjct  119   YEDSWAAIQWAASHCDGDG-----PEAWLNEHADFGRVFLSGESAGANIAHNMAMAAGKP  173

Query  645   PLNQKSKLLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPM  484
                   +LLG  L  P+FW SN  G E      ++ +  +W FV P+ K   D P + PM
Sbjct  174   ERGLNIRLLGVALVHPFFWGSNPIGSEALPPNTRAYVDWLWPFVCPS-KPDNDEPWVNPM  232

Query  483   AENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIM  304
             A+ APSLAGL C  + +CVAEKD LR+    Y E + +SGW G +E+++ EGE+H F + 
Sbjct  233   ADGAPSLAGLGCRMVLMCVAEKDILRDRGRLYHEVLGRSGWTGVVEIMETEGEDHAFHLY  292

Query  303   NPGTEKAKDTFKRIASFIQ  247
             + GTEKAKD  +R+A F+ 
Sbjct  293   DMGTEKAKDLIRRLADFLN  311



>ref|XP_009403370.1| PREDICTED: probable carboxylesterase 12 [Musa acuminata subsp. 
malaccensis]
Length=318

 Score =   256 bits (653),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 150/311 (48%), Positives = 204/311 (66%), Gaps = 20/311 (6%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLA--SATQK  985
             L RVYK GRVER      V P+  D ATGV+SKD+ V P  N+++R+YLP LA  S+ +K
Sbjct  15    LARVYKSGRVERFLGND-VLPAGVDPATGVASKDVIVDPATNLTLRLYLPDLAGSSSERK  73

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVYYHGGGF +++AFS  YH+YLN LV+ A V+AVSVEYR APEHPLPA Y+D W A
Sbjct  74    LPVLVYYHGGGFVIETAFSPTYHNYLNSLVAAAGVVAVSVEYRRAPEHPLPAAYDDSWAA  133

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+WVAS         P +E WL   GD  ++F+ GDSAG NIVH +A+RA +E L   + 
Sbjct  134   LRWVASR--------PAEEAWLSERGDLGRVFLAGDSAGANIVHQMAVRAADEGLGGGAA  185

Query  624   LLGGILSFPYFW------SSNEKGGEQSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G +L  P+FW      S +     +  + ++W FV P    G+D P I P+AE APSL
Sbjct  186   IRGLVLIHPFFWGAEPLESESRDPNAREWVGRIWAFVRP-GTAGLDAPWINPLAEGAPSL  244

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
             A L CS++ V VAEKD LR     Y  A+K+SGW+GE  +++ EGE+H F +++P ++KA
Sbjct  245   ARLPCSRVLVTVAEKDLLRCRGQAYYAALKRSGWEGEARLLETEGEQHVFHLLSPKSDKA  304

Query  282   KDTFKRIASFI  250
                 + +A+F+
Sbjct  305   LAKLQAVAAFL  315



>ref|XP_011000170.1| PREDICTED: probable carboxylesterase 12 [Populus euphratica]
Length=323

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 149/313 (48%), Positives = 196/313 (63%), Gaps = 19/313 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQK  985
             SP I +YKDGR+ER+     VPPS +D  + V SKD+  S    +S R+YLPK     +K
Sbjct  18    SPFIILYKDGRIERLIGNEIVPPS-QDPKSDVLSKDVIYSKEARLSCRLYLPKGVHPNKK  76

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVY HGGGF V+SAFS  YH+Y+N+LV++A VIA+SV+YR  PEHP+P  Y+D W A
Sbjct  77    LPLLVYVHGGGFYVESAFSPTYHNYVNLLVAEAKVIAISVDYRRVPEHPIPIPYDDSWAA  136

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+W ASH + DG      E WL  H D  K+F+ GDSAGGNI H+VA+R G E +     
Sbjct  137   LKWAASHVNGDGP-----EEWLNKHADLSKVFLAGDSAGGNIAHHVAMRFGQENI-IGVN  190

Query  624   LLGGILSFPYFWSSNEKGGEQSILQKV-------WDFVYPTAKGGIDNPMIYPMAENAPS  466
             + G +L  PYFW     G E + L++V       W    P    G D+P+I P  +  P+
Sbjct  191   VAGIVLINPYFWGEERIGNEVNELERVLKGMSATWHLACPKTS-GCDDPLINPTYD--PN  247

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L+ L CSK+ V VAEKD LR+  L Y E +KKSGW G IE+++V+GEEH F +  P T+ 
Sbjct  248   LSSLGCSKVFVAVAEKDLLRDRGLLYCETLKKSGWGGVIEIMEVKGEEHVFHLFKPATDN  307

Query  285   AKDTFKRIASFIQ  247
             A    K+I SFI 
Sbjct  308   AVAMLKKIVSFIH  320



>ref|XP_004973681.1| PREDICTED: probable carboxylesterase 12-like [Setaria italica]
Length=331

 Score =   256 bits (653),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 132/311 (42%), Positives = 193/311 (62%), Gaps = 11/311 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASAT--QKL  982
             P IR+YK+ RVER     +V  S  D+ATGV+S+D+ +SPN+S R+YLP+LA      KL
Sbjct  23    PCIRIYKN-RVERYFGSEFVAAS-TDAATGVASRDVVISPNVSARLYLPRLADGAPATKL  80

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+LVYYHGGGFC+ SAF+  +H Y N   + ANV+ VSVEYRLAPEHP+PA Y D WEAL
Sbjct  81    PVLVYYHGGGFCLGSAFNPTFHAYFNSFAALANVLVVSVEYRLAPEHPVPAAYADSWEAL  140

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
              WV SH ++       ++PW+  H DF ++++GG+SAG NI H++A+R   E L   +++
Sbjct  141   AWVVSHLADSPNDGGNRDPWVAGHADFARLYLGGESAGSNIAHHMAMRVAAEGLPHGAQI  200

Query  621   LGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              G +L  PYF  +++   +      +  L  +W  + PT  G  D+P+I P  + AP+LA
Sbjct  201   RGLVLIHPYFLGTDKVPSDDLSPEARESLGSLWRVMCPTTTGE-DDPLINPFVDGAPALA  259

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
              L C ++ VCV E D LR+    Y + +K SGW+GE  +     + H F ++ P  ++A 
Sbjct  260   TLACGRVLVCVGEGDVLRDRGRAYHDRLKASGWQGEAAIWQAPDKGHTFHLLEPCCDEAV  319

Query  279   DTFKRIASFIQ  247
             +  K I+ F+ 
Sbjct  320   EQDKVISDFLN  330



>gb|AFV95084.1| carboxylesterase 1 [Solanum pennellii]
Length=339

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/338 (43%), Positives = 201/338 (59%), Gaps = 45/338 (13%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             PL+RV KDGR+ER+    +VP S  D  TGV  KD+ + P  N+S R+YLPK     QK+
Sbjct  10    PLMRVNKDGRIERLAGEGFVP-SESDPETGVQIKDVQIDPQINLSARLYLPKNVDPVQKI  68

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+ VY+HGGGF ++SAFS  YH YL+++ ++A V  VS  YRLAPE+PLP  YED W AL
Sbjct  69    PLFVYFHGGGFVIESAFSPTYHKYLSLVAAEAKVAIVSANYRLAPEYPLPIAYEDSWLAL  128

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WV SHA+ DG     +EPWL ++ DF ++F+GGDSAGGNI H++ IR G E   +  K+
Sbjct  129   KWVTSHANGDG-----REPWLKDYADFNRVFLGGDSAGGNIAHHIGIRLGLEKF-EGVKI  182

Query  621   LGGILSFPYFWSSNEKGGE---------------------------------QSILQKVW  541
              G  L+ PYFW  +   GE                                 +++ +K+W
Sbjct  183   DGIFLACPYFWGKDRIEGEGENLLAKDFVEDLVLVGNPNSTGLDKDPIDLGSKNLFEKLW  242

Query  540   DFVYPTAKGGIDNPMIYPMAENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGW  361
              FV PT+  G D+P+I P  E  P L+GL C K+ V VA KD LR     Y E ++KSGW
Sbjct  243   LFVNPTSS-GFDDPLINP--EKDPKLSGLGCDKVVVYVAGKDPLRFRGFYYKEVLEKSGW  299

Query  360   KgeievvdvegeEHCFPIMNPGTEKAKDTFKRIASFIQ  247
              G +EVV+V+G+ H F +  P  E+A    K++ASF+ 
Sbjct  300   PGTVEVVEVKGKGHVFHLFVPEAEEAIAMLKKLASFLN  337



>ref|XP_006346461.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Solanum tuberosum]
Length=312

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 148/311 (48%), Positives = 196/311 (63%), Gaps = 18/311 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             PLIRVYKDGR+ER+    +VPP   D  TGV  KDI + P  N+S R+YLPK     QK+
Sbjct  10    PLIRVYKDGRIERLMGEGFVPPE-SDPETGVQIKDIEIDPQINLSARLYLPKNIDPIQKI  68

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+ VY+HGG F ++SA S  YH +L+++ ++A V+ VSV YRLAPE+PLP  YED W AL
Sbjct  69    PLFVYFHGGAFVIESATSPTYHKHLSMVAAEAKVVIVSVNYRLAPEYPLPIAYEDSWIAL  128

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +W+ASHA+ DG      EPWL +H +F +++ GGDSAGGNI H++AIR G E L +  KL
Sbjct  129   KWIASHANGDGY-----EPWLKDHANFNRVYFGGDSAGGNIAHHMAIRVGLEKL-EGVKL  182

Query  621   LGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              G  L+ PYFW  +   GE      +  + K+W F  P    G+D+P+I P  E  P L 
Sbjct  183   DGIFLACPYFWGKDLIDGEGENLFVKDCIDKLWLFANPNGF-GLDDPLINP--EKDPKLC  239

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
              L C K+ V VA KD LR   L Y EA++KSGW G +EVV+V+ EEH F +  P  E   
Sbjct  240   SLGCEKVLVYVAGKDPLRFRGLYYKEALEKSGWPGTVEVVEVKDEEHVFHLFAPEAENGM  299

Query  279   DTFKRIASFIQ  247
                K++ SF+ 
Sbjct  300   AMLKKLVSFLN  310



>ref|XP_003550344.1| PREDICTED: probable carboxylesterase 13-like [Glycine max]
Length=337

 Score =   255 bits (652),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 139/316 (44%), Positives = 196/316 (62%), Gaps = 23/316 (7%)
 Frame = -2

Query  1152  LIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITV----SPNISVRVYLPKLASATQK  985
             LIRV+ DGRV+R      VPPS   +   ++SKDIT+    S  +S R++LP   + +++
Sbjct  24    LIRVFTDGRVQRFTGTDVVPPS---TTPHITSKDITLLHPHSATLSARLFLPTPQTTSRR  80

Query  984   ---LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDC  814
                LP+L+Y+HGG FC  S F++ YH+Y+  +V++A V+AVSV+YRLAPEHP+PA YED 
Sbjct  81    NNNLPLLIYFHGGAFCASSPFTANYHNYVATIVAEAKVVAVSVDYRLAPEHPIPAAYEDS  140

Query  813   WEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             W ALQWVASH + +GQ     EPWL  H DF ++F+ GDSAG NIVHN+ +  G+   + 
Sbjct  141   WAALQWVASHRNKNGQ-----EPWLNEHADFGRVFLAGDSAGANIVHNLTMLLGDPDWDI  195

Query  633   KSKLLGGILSFPYFWSSNEKGGEQ-------SILQKVWDFVYPTAKGGIDNPMIYPMAEN  475
                +LG  L  PYFW S   G E+       +++ ++W FV P      D+P + P+AE 
Sbjct  196   GMDILGVCLVHPYFWGSVPVGSEEAVDPERKAVVDRLWRFVSPEMADK-DDPRVNPVAEG  254

Query  474   APSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPG  295
             APSL  L C ++ VCVAEKD LR+    Y  A+ +SGW G +EV +  GE H F + +  
Sbjct  255   APSLGWLGCRRVLVCVAEKDVLRDRGWLYYNALSRSGWMGVVEVEETLGEGHAFHLYDLA  314

Query  294   TEKAKDTFKRIASFIQ  247
             + KA+   KR+A F  
Sbjct  315   SHKAQCLIKRLALFFN  330



>ref|XP_007156546.1| hypothetical protein PHAVU_003G295200g [Phaseolus vulgaris]
 gb|ESW28540.1| hypothetical protein PHAVU_003G295200g [Phaseolus vulgaris]
Length=314

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 138/310 (45%), Positives = 191/310 (62%), Gaps = 16/310 (5%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQK  985
             SP +++YKDG +ER+     VPP   D AT V SKD+ +S +  +S R+++PKL   TQK
Sbjct  13    SPFVKIYKDGHIERVTGNDIVPPC-LDPATNVESKDVVISKDDDVSARIFIPKLTDQTQK  71

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVY+HGGGFC+++ +S  YH ++N LVS+AN++AVSV YR APEHP+P  +ED W +
Sbjct  72    LPLLVYFHGGGFCIETPYSPPYHKFINSLVSKANIVAVSVHYRRAPEHPVPIAHEDSWTS  131

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+WV SH   +G      E WL  H DF K+F GGDSAG NI H++A+R G   L     
Sbjct  132   LKWVVSHFDGNG-----PEEWLNRHADFGKVFCGGDSAGANISHHMALRIGIHGL-PGMN  185

Query  624   LLGGILSFPYFWSSNEKGGEQS----ILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLAG  457
             L G +L  PYFW     G E      I++ +W F  P + G  D+P++ P  +  P L  
Sbjct  186   LQGIVLVHPYFWGVERIGSEAQEHVPIVENLWRFTSPASTGS-DDPLLNPAKD--PDLGK  242

Query  456   LRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAKD  277
             L C ++ VCVAEKD L++    Y E ++KS W+G  EV++  GE H F + NP  + A  
Sbjct  243   LGCKRVLVCVAEKDFLKDRGWHYKELLEKSEWEGVAEVLEANGEGHVFHLFNPDCDNAVS  302

Query  276   TFKRIASFIQ  247
                +IASFI 
Sbjct  303   LLDQIASFIN  312



>ref|NP_001062036.1| Os08g0475400 [Oryza sativa Japonica Group]
 dbj|BAD09193.1| putative PrMC3 [Oryza sativa Japonica Group]
 dbj|BAD09347.1| putative PrMC3 [Oryza sativa Japonica Group]
 dbj|BAF23950.1| Os08g0475400 [Oryza sativa Japonica Group]
 dbj|BAG93738.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87545.1| unnamed protein product [Oryza sativa Japonica Group]
Length=327

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 190/312 (61%), Gaps = 17/312 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKL---ASATQK  985
             P IR+YK+ RVER     +V  S  D+ATGV+S D  +S N+S R+YLP+L   A+A  K
Sbjct  23    PCIRIYKN-RVERYFGSEFVAAS-TDAATGVASHDRVISSNVSARLYLPRLDDSAAAKAK  80

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVYYHGGGFC+ SAF+  +H Y N   + AN + VSVEYRLAPEHP+PA Y D WEA
Sbjct  81    LPVLVYYHGGGFCLGSAFNPTFHAYFNTFAALANALVVSVEYRLAPEHPVPAAYADSWEA  140

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L WVA HA+ DG      E WLV+H DF ++++GG+SAG NI H++A+R   E L   +K
Sbjct  141   LAWVAGHAAGDGD-----EAWLVDHADFSRLYLGGESAGSNIAHHIAMRVAEEGLPHGAK  195

Query  624   LLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G ++  PYF  +N    +      +  L  +W  + P A  G D+P+I P+ + AP+L
Sbjct  196   IRGLVMIHPYFLGTNRVASDDLDPAVRESLGSLWRVMCP-ATTGEDDPLINPLVDGAPAL  254

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
               L C ++ VC+ E D LR+    Y + +  SGW+GE E+     + H F ++ P  + A
Sbjct  255   DALACDRVLVCIGEGDVLRDRGRAYYDRLTSSGWRGEAEIWQAPEKGHTFHLLEPHCDAA  314

Query  282   KDTFKRIASFIQ  247
                 K I+ F+ 
Sbjct  315   IAQDKVISGFLN  326



>ref|XP_011006470.1| PREDICTED: probable carboxylesterase 12 [Populus euphratica]
Length=323

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 148/313 (47%), Positives = 191/313 (61%), Gaps = 19/313 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQK  985
             SP I VYKDG +ER+     VPPS  D  + V SKD   S    +S R+YLP      +K
Sbjct  18    SPYIIVYKDGSIERLVGNEIVPPS-LDPKSSVLSKDAVYSEEAKLSSRLYLPPGVDPDKK  76

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+L+Y+HGGGFCV SAFS  YH++LNILV++  VIAVSV+YR  PEHP+P  Y+D W A
Sbjct  77    LPLLIYFHGGGFCVGSAFSPAYHNFLNILVAEGKVIAVSVDYRKVPEHPIPVPYDDSWTA  136

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             ++WVASH + DG      E WL NH DF K+++ GDSAGGNI H++A+R G E L     
Sbjct  137   MKWVASHVNGDGP-----EKWLNNHADFGKVYMAGDSAGGNIAHHMAMRYGQEGL-FGVN  190

Query  624   LLGGILSFPYFWSSNEKGGEQSILQKV-------WDFVYPTAKGGIDNPMIYPMAENAPS  466
             + G +L  PYFW     G E   L++V       W    PT   G D+P+I P ++  P 
Sbjct  191   VEGVVLIHPYFWGKEPIGNEVHELERVLKGIVATWHLACPTTS-GCDDPLINPTSD--PK  247

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             LA + CS++ V VAEKD LR+  L Y E +KKSGW G +E ++ EGE H F + NP    
Sbjct  248   LASMGCSRVLVAVAEKDLLRDRGLLYCETLKKSGWGGIVETMEAEGEGHVFHLFNPTCGN  307

Query  285   AKDTFKRIASFIQ  247
             A    KR A+FI 
Sbjct  308   AVAMLKRTAAFIS  320



>ref|XP_002285071.1| PREDICTED: probable carboxylesterase 12 [Vitis vinifera]
Length=320

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 149/315 (47%), Positives = 197/315 (63%), Gaps = 22/315 (7%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             P +R Y DGRVER      VPPS  DS TGVS+KD+ ++P   +S R++ P   +  QKL
Sbjct  14    PFLRAYTDGRVERFFGTDVVPPS-VDSETGVSTKDVAIAPERGVSARIFKPNTINPDQKL  72

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+L+YYHGG  C+ S + +IYH+Y+  LV++AN+IAVSV+YRLAPEHP+P  +ED W A 
Sbjct  73    PLLIYYHGGALCLGSPYCTIYHNYVTSLVAEANIIAVSVDYRLAPEHPVPVPHEDSWAAT  132

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             QWV SH+   G      E WL +H DF+++F+ GDS G NI HN+A RAG E L    KL
Sbjct  133   QWVVSHSLGQG-----PEAWLNDHSDFKRVFLAGDSGGANIAHNMAARAGVEGLG-GVKL  186

Query  621   LGGILSFPYFW----SSNEKGGEQSILQK------VWDFVYPTAKGGIDNPMIYPMAENA  472
              G  L  PYF       + +G   S++ K       W FV PT   GI++P+I P A+  
Sbjct  187   SGICLLHPYFGRREADCDSRGDGDSLVDKKPGVDNRWLFVCPTTS-GINDPIINPAADQ-  244

Query  471   PSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
              +L  L CSK+ VCVAEKD LR+    Y E + KSGW G +E+V+ EGE+H F +  PG 
Sbjct  245   -NLRKLGCSKVLVCVAEKDGLRKRGWFYYEVLGKSGWGGALEIVETEGEDHVFFLFKPGC  303

Query  291   EKAKDTFKRIASFIQ  247
             EKA    KR+ASF+ 
Sbjct  304   EKAVALMKRLASFMN  318



>ref|XP_009623230.1| PREDICTED: 2-hydroxyisoflavanone dehydratase-like [Nicotiana 
tomentosiformis]
Length=315

 Score =   254 bits (650),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 147/312 (47%), Positives = 199/312 (64%), Gaps = 19/312 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSP--NISVRVYLPKLASATQKL  982
             PLIRVYKDGR+ER+     VP +  D  TGV  KD+ + P  N+S R+YLPK     QK+
Sbjct  10    PLIRVYKDGRIERLMGEGVVP-AELDPETGVQIKDVQIDPTINLSARLYLPKNLDPVQKI  68

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
              + VY+HGGGF ++SA S+ YH +LN++ ++ANVI VSV YRLAP++PLP  YED W A+
Sbjct  69    SLFVYFHGGGFVIESASSTSYHKHLNLVATEANVIIVSVNYRLAPKYPLPIAYEDSWVAV  128

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
             +WVASHA  DG      EPWL +H DF  ++ GGDSAG NI HN+AIR G E L+   KL
Sbjct  129   KWVASHAKGDGH-----EPWLKDHADFNHVYFGGDSAGANISHNMAIRVGLEKLDG-VKL  182

Query  621   LGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              G  L+ PYFW  +   GE      ++ ++K+W F +P +  G+D+ +I P  E  P L+
Sbjct  183   DGIFLACPYFWGIDLIDGEAKNLDCKNYIEKLWAFAHPNS-SGLDDLLINP--EKDPKLS  239

Query  459   GLRCSKLHVCVAEKDELREISLRYVE-AVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
              L C K+ V VA KD LR   L Y E  ++KSGW+G  EVV+++ EEH F +  P +E A
Sbjct  240   SLGCDKVLVYVAGKDPLRYRGLYYKELLLEKSGWQGTAEVVEIKDEEHVFHLFAPKSENA  299

Query  282   KDTFKRIASFIQ  247
                 K++ SF+ 
Sbjct  300   IVVLKKLVSFLN  311



>ref|XP_007201337.1| hypothetical protein PRUPE_ppa007658mg [Prunus persica]
 gb|EMJ02536.1| hypothetical protein PRUPE_ppa007658mg [Prunus persica]
Length=360

 Score =   256 bits (653),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 137/278 (49%), Positives = 179/278 (64%), Gaps = 22/278 (8%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASAT--  991
             SP+I+VYKDGRVER+ +   VPPS  D  TGV SKD+ +S  P IS R+Y+PK  + +  
Sbjct  11    SPMIKVYKDGRVERLNDTDRVPPS-TDPKTGVQSKDVVISQEPAISARLYIPKSTTTSAP  69

Query  990   -QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDC  814
               KLP+L+Y+HGGGFCV S+ S+ YH YLN LVS+ANV+AVSV+YRL PEHPLPA Y+D 
Sbjct  70    QTKLPLLIYFHGGGFCVRSSSSAKYHSYLNALVSEANVVAVSVDYRLVPEHPLPAAYDDS  129

Query  813   WEALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             W AL+WVASH+  +G      E WL    DF+++F  G+SAG NI HN+A++ G E L  
Sbjct  130   WAALKWVASHSDGNGS-----EDWLNRFADFQRVFFAGNSAGANITHNMAVKLGCEGL-V  183

Query  633   KSKLLGGILSFPYFWSSNEKGGE-------QSILQKVWDFVYPTAKGGIDNPMIYPMAEN  475
               KL+G +L  PYFW +   G E       +  +  VW F  P+  G  D+P+I P  + 
Sbjct  184   GVKLIGIVLEHPYFWGTEPVGEELTTPAAAREYMAGVWRFACPSTSGS-DDPLINPAKDQ  242

Query  474   APSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGW  361
                L  L C K+ VCVAEKD L++    Y E +KKSGW
Sbjct  243   --KLGKLGCEKVLVCVAEKDVLKDRGWHYSETLKKSGW  278



>ref|XP_009418894.1| PREDICTED: probable carboxylesterase 12 [Musa acuminata subsp. 
malaccensis]
Length=318

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 144/315 (46%), Positives = 199/315 (63%), Gaps = 18/315 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASATQKLP  979
             +P+IR+YKDGR+ER+     +PPS  D+ATGV SKD+ ++  ++ R+YLP +  A  KLP
Sbjct  12    APIIRIYKDGRIERLDADVQLPPS-VDTATGVVSKDVPIAAGVTARLYLPAV-DAPSKLP  69

Query  978   ILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEALQ  799
             + VYYHGGGFC+ SA SSIYH +LN +VS A+VIAVSV+YRLAPEH +PA YED W AL+
Sbjct  70    VFVYYHGGGFCIGSASSSIYHVFLNTIVSTASVIAVSVDYRLAPEHLIPAAYEDAWCALR  129

Query  798   WVASHASNDGQQVPLKEPWLV-NHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLN-QKSK  625
             WVASHA          EP L  +  DF ++F+ GDSAG NI HNVA+R   E L    ++
Sbjct  130   WVASHAEGG------PEPCLAKDRTDFTRLFLAGDSAGANIAHNVAMRVAAEGLGVGGAR  183

Query  624   LLGGILSFPYFWSSNEKGGEQS------ILQKVWDFVYPTAKGGIDN--PMIYPMAENAP  469
             +   +L  PYFW +     E        I     D ++    GG DN  P + P+A+ AP
Sbjct  184   VESMVLLHPYFWGTTRLPCEVGRVDHPVIPPHTVDSMWQLITGGADNDDPRLNPLADGAP  243

Query  468   SLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTE  289
             SLAGL C ++ V VAEKD LR+    Y EA++K GW GE ++ + +GE+H F +  PG  
Sbjct  244   SLAGLGCRRVMVAVAEKDTLRDRGRAYFEALRKCGWSGEAQLWETQGEDHVFFLFKPGCN  303

Query  288   KAKDTFKRIASFIQD  244
             +     +++ SF+++
Sbjct  304   EVSLLVQKLVSFLKE  318



>ref|XP_010671193.1| PREDICTED: probable carboxylesterase 12 [Beta vulgaris subsp. 
vulgaris]
Length=336

 Score =   255 bits (651),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 200/319 (63%), Gaps = 22/319 (7%)
 Frame = -2

Query  1158  SPLIRVYKDGRVER--ICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASAT  991
             SP IR YK GRVER    N P VPPS  D  TGV SKDI +S   N+ VR++ P   +  
Sbjct  17    SPAIRFYKTGRVERHPRLNTPAVPPSL-DPKTGVESKDIKISIETNVFVRLFKP---NNQ  72

Query  990   QKLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCW  811
             +KLPIL+Y+HGGGFC++S FS  YH+YLN L S+A V+ VSVEYR APEH LPA Y DCW
Sbjct  73    KKLPILLYFHGGGFCLESTFSPKYHNYLNSLASKAQVMIVSVEYRRAPEHRLPAAYHDCW  132

Query  810   EALQWVASHASNDGQ-QVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQ  634
             +AL WV  HA++D       KE WL ++ DF K+F+ GDS+GGNI H +A+R G E L++
Sbjct  133   DALNWVIFHATDDTHNNTHTKELWLQDNVDFSKVFLMGDSSGGNIAHYLALRVGIEGLSR  192

Query  633   KS--KLLGGILSFPYFWSSNEKGGEQS---------ILQKVWDFVYPTAKGGIDNPMIYP  487
                  + G IL  PYFWS    G E S         + +K+W+   P    GID+P I P
Sbjct  193   GRAFHINGVILVHPYFWSKRRIGDEASKRSYLSVRGLAEKIWELARPEKSSGIDDPWINP  252

Query  486   MAENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPI  307
                N   L+ L C+++ +CVA+KD  R+  L Y E ++KSGW+G +EVV+ +GE+H F +
Sbjct  253   A--NDQCLSSLGCNRVLICVAQKDLFRDRGLYYKEVLEKSGWQGTVEVVESKGEDHTFHL  310

Query  306   MNPGTEKAKDTFKRIASFI  250
             +N     + +  +++ +FI
Sbjct  311   LNRSCANSLELLRKVVAFI  329



>ref|XP_003574615.1| PREDICTED: tuliposide A-converting enzyme 1, chloroplastic-like 
[Brachypodium distachyon]
Length=327

 Score =   254 bits (650),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 137/311 (44%), Positives = 192/311 (62%), Gaps = 15/311 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASAT--QKL  982
             P IR+YK+ RVER     ++  S  D+ATGV S+D T+SP +S R+YLP+L +     KL
Sbjct  23    PCIRIYKN-RVERYFGSEFIAAS-TDAATGVVSRDRTISPEVSARLYLPRLDADAPAAKL  80

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+LVYYHGGGFC+ SAF+  +H Y N   + ANV+ VSVEYRLAPEHP+PA Y D WEAL
Sbjct  81    PVLVYYHGGGFCLGSAFNPTFHAYFNSFAALANVVVVSVEYRLAPEHPVPAAYADSWEAL  140

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
              WV SHA+         EPWL +H DF ++++GG+SAG N+ H++A+R G E L   +K+
Sbjct  141   AWVVSHAAGSAGD----EPWLSDHADFSRLYLGGESAGANLAHHMAMRVGAEGLAHDTKI  196

Query  621   LGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              G ++  PYF  SN+   +      +  L  +W  + PT  G  D+P+I P  E AP L 
Sbjct  197   RGLVMIHPYFLGSNKVDSDDLDPATRESLGSLWSVMCPTTTGE-DDPLINPFVEGAPDLE  255

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
              L C ++ VCVA  D LR+    Y + ++ SGW+GE E+  V G+ H F ++ P  ++A 
Sbjct  256   ALACGRVLVCVALGDVLRDRGRNYYDRLRASGWRGEAEIWQVPGKGHTFHLLEPCCDEAV  315

Query  279   DTFKRIASFIQ  247
                K I+ F+ 
Sbjct  316   AQDKVISDFLN  326



>gb|EEC83733.1| hypothetical protein OsI_29586 [Oryza sativa Indica Group]
Length=327

 Score =   254 bits (650),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 135/312 (43%), Positives = 190/312 (61%), Gaps = 17/312 (5%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKL---ASATQK  985
             P IR+YK+ RVER     +V  S  D+ATGV+S D  +S N+S R+YLP+L   A+A  K
Sbjct  23    PCIRIYKN-RVERYFGSEFVAAS-TDAATGVASHDRVISSNVSARLYLPRLDDSAAAKAK  80

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+LVYYHGGGFC+ SAF+  +H Y N   + AN + VSVEYRLAPEHP+PA Y D WEA
Sbjct  81    LPVLVYYHGGGFCLGSAFNPTFHAYFNTFAALANALVVSVEYRLAPEHPVPAAYADSWEA  140

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L WVA HA+ DG      E WLV+H DF ++++GG+SAG NI H++A+R   E L   +K
Sbjct  141   LAWVAGHAAGDGD-----EAWLVDHADFSRLYLGGESAGSNIAHHMAMRVAEEGLPHGAK  195

Query  624   LLGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSL  463
             + G ++  PYF  +N    +      +  L  +W  + P A  G D+P+I P+ + AP+L
Sbjct  196   IRGLVMIHPYFLGTNRVASDDLDPAVRESLGSLWRVMCP-ATTGEDDPLINPLVDGAPAL  254

Query  462   AGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKA  283
               L C ++ VC+ E D LR+    Y + +  SGW+GE E+     + H F ++ P  + A
Sbjct  255   DALACDRVLVCIGEGDVLRDRGRAYYDRLTSSGWRGEAEIWQAPEKGHTFHLLEPHCDAA  314

Query  282   KDTFKRIASFIQ  247
                 K I+ F+ 
Sbjct  315   IAQDKVISGFLN  326



>ref|XP_002313105.1| hypothetical protein POPTR_0009s10700g [Populus trichocarpa]
 gb|EEE87060.1| hypothetical protein POPTR_0009s10700g [Populus trichocarpa]
Length=323

 Score =   254 bits (649),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 146/313 (47%), Positives = 194/313 (62%), Gaps = 19/313 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQK  985
             SP I +YKDGR+ER+     V PS +D  + V SKD+  S    +S R+YLPK     +K
Sbjct  18    SPFIILYKDGRIERLIGNEIVSPS-QDPKSDVLSKDVIYSKEARLSCRLYLPKGVDPNKK  76

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+L+Y HGGGFCV+SAFS  YH+Y+N+LV++A VIA+SV+YR  PEHP+P  Y+D W A
Sbjct  77    LPLLIYIHGGGFCVESAFSPAYHNYVNLLVAEAKVIAISVDYRRVPEHPIPIPYDDSWAA  136

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+W ASH + DG      E WL  H D  K+F+ GDSAGGNI H+VA+R G E +     
Sbjct  137   LKWAASHVNGDGP-----EEWLNKHADLSKVFLAGDSAGGNIAHHVAMRFGQEKI-IGVN  190

Query  624   LLGGILSFPYFWSSNEKGGEQSILQKV-------WDFVYPTAKGGIDNPMIYPMAENAPS  466
             + G +L  PYFW     G E + L++V       W    P    G D+P+I P  +  P+
Sbjct  191   VAGIVLINPYFWGEEPIGNEVNELERVLKGISATWHLACPKTS-GCDDPLINPTYD--PN  247

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L+ L CSK+ V VAEKD LR+  L Y E +KKSGW G IE ++V+GE H F +  P ++ 
Sbjct  248   LSSLGCSKVFVSVAEKDLLRDRGLLYCETLKKSGWVGVIETMEVKGEGHVFHLFKPASDN  307

Query  285   AKDTFKRIASFIQ  247
             A    K+I SFI 
Sbjct  308   AVAMLKKIVSFIH  320



>gb|EYU42665.1| hypothetical protein MIMGU_mgv1a025384mg [Erythranthe guttata]
Length=342

 Score =   254 bits (650),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 143/316 (45%), Positives = 197/316 (62%), Gaps = 19/316 (6%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLA--SATQ  988
             P IRVYKDGRV+R     + PPS  D AT V SKD+  S  PN+S R+YLP  A  S  +
Sbjct  32    PFIRVYKDGRVQRFIGQDFSPPS-TDPATAVRSKDVVFSTNPNLSARLYLPAAAFSSNKK  90

Query  987   KLPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWE  808
             KLP+L+Y+HGGGF  +SAFS  YH +LN LV+++N+ AVSV YRLAPEHPLPA Y+D W 
Sbjct  91    KLPLLIYFHGGGFFTESAFSPTYHRHLNSLVAKSNIAAVSVNYRLAPEHPLPAAYQDSWL  150

Query  807   ALQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKS  628
             AL W  SH++         EPWL NH DF+++++GGDSAGGNI H+++ R G+E      
Sbjct  151   ALNWTLSHSAAGAAA----EPWLNNHADFQRVYLGGDSAGGNIAHHISTRVGSENPYPNV  206

Query  627   KLLGGILSFPYFWSSNEKGGE--------QSILQKVWDFVYPTAKGGIDNPMIYPMAENA  472
             K  G  L+ PYF      G E        +++++K+W   YP +  G+D+P++ P  +  
Sbjct  207   KFGGMFLNCPYFLGKKPVGNELSPEYSYAETLMKKLWVHAYPNSPAGLDDPLVNPGMD--  264

Query  471   PSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGT  292
             P L  + C ++ V VA  D LR     Y E ++KS W GE++VV+VEGE H F ++NP T
Sbjct  265   PGLKRVGCKRVLVYVAGNDVLRFRGWYYKERLEKSLWGGEVKVVEVEGENHVFNLINPTT  324

Query  291   EKAKDTFKRIASFIQD  244
              KA      +A+F+ +
Sbjct  325   PKAISMLNVLANFLNN  340



>ref|XP_011000218.1| PREDICTED: probable carboxylesterase 12 [Populus euphratica]
Length=323

 Score =   254 bits (648),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 146/313 (47%), Positives = 195/313 (62%), Gaps = 19/313 (6%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVS--PNISVRVYLPKLASATQK  985
             SP I +YKDGR+ER+     VPPS +D  + V SKD+  S    +S R+YLPK     +K
Sbjct  18    SPFIILYKDGRIERLIGNEIVPPS-QDPKSDVLSKDVIYSKEARLSCRLYLPKGVDPNKK  76

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+L+Y HGGGF V+SAFS  YH+Y+N+LV++A VIA+SV+YR  PEHP+P  Y+D W A
Sbjct  77    LPLLIYVHGGGFYVESAFSPTYHNYVNLLVAEAKVIAISVDYRRVPEHPIPIPYDDSWAA  136

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSK  625
             L+W ASH + DG      E WL  H D  K+F+ GDSAGGNI H+VA+R G E +     
Sbjct  137   LKWAASHVNGDGP-----EEWLNKHADLSKVFLAGDSAGGNIAHHVAMRFGQEKI-IGVN  190

Query  624   LLGGILSFPYFWSSNEKGGEQSILQKV-------WDFVYPTAKGGIDNPMIYPMAENAPS  466
             + G +L  PYFW     G E + L++V       W    P    G D+P+I P  +  P+
Sbjct  191   VAGIVLINPYFWGEERIGNEVNELERVLKGMSATWHLACPKTS-GCDDPLINPTYD--PN  247

Query  465   LAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEK  286
             L+ L CSK+ V VAEKD LR+  L Y E +KKSGW G IE+++V+GE H F +  P ++ 
Sbjct  248   LSSLGCSKVFVSVAEKDLLRDRGLLYCETLKKSGWGGVIEIMEVKGEGHVFHLFKPASDN  307

Query  285   AKDTFKRIASFIQ  247
             A    K+I SFI 
Sbjct  308   AVAMLKKIVSFIH  320



>ref|XP_004973680.1| PREDICTED: probable carboxylesterase 12-like [Setaria italica]
Length=331

 Score =   254 bits (648),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 132/311 (42%), Positives = 194/311 (62%), Gaps = 11/311 (4%)
 Frame = -2

Query  1155  PLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPNISVRVYLPKLASA--TQKL  982
             P IR+YK+ RVER     +V  S  D+ATGV+S+D+ +SPN+S R+YLP+LA      KL
Sbjct  23    PYIRIYKN-RVERYSGSEFVAAS-TDAATGVASRDVVISPNVSARLYLPRLADGEPATKL  80

Query  981   PILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEAL  802
             P+LVYYHGGGFC  SAF   +H Y N   + ANV+ VSVEYRLAPEHP+PA Y D WEAL
Sbjct  81    PVLVYYHGGGFCRGSAFDPTFHAYFNSFAALANVLVVSVEYRLAPEHPVPAAYADSWEAL  140

Query  801   QWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGNEPLNQKSKL  622
              WV SH ++       ++PW+  H DF ++++GG+SAG NI H++A+R   E L   +++
Sbjct  141   AWVVSHLADSPNDGGNRDPWVAGHADFARLYLGGESAGSNIAHHMAMRVAAEGLPHGAQI  200

Query  621   LGGILSFPYFWSSNEKGGE------QSILQKVWDFVYPTAKGGIDNPMIYPMAENAPSLA  460
              G ++  PYF  +++   +      +  L  +W  + PT  G  D+P+I P+ + AP+LA
Sbjct  201   RGLVMIHPYFLGTDKVPSDDLSPEMRERLGTLWRVMCPTTTGE-DDPLINPLVDGAPALA  259

Query  459   GLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdvegeEHCFPIMNPGTEKAK  280
              L C ++ VCV E D LR+    Y + +K SGW+GE  +    G++H F ++ P  ++A 
Sbjct  260   TLACGRVLVCVGEGDVLRDRGRAYHDRLKASGWQGEAAIWQAPGKDHRFHLLEPCCDEAV  319

Query  279   DTFKRIASFIQ  247
             +  K I+ F+ 
Sbjct  320   EQGKVISDFLN  330



>ref|XP_003518853.1| PREDICTED: probable carboxylesterase 12-like isoform 2 [Glycine 
max]
 gb|KHN37495.1| Putative carboxylesterase 2 [Glycine soja]
Length=333

 Score =   254 bits (648),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 144/328 (44%), Positives = 198/328 (60%), Gaps = 33/328 (10%)
 Frame = -2

Query  1158  SPLIRVYKDGRVERICNYPYVPPSPEDSATGVSSKDITVSPN--ISVRVYLPKLASATQK  985
             SPL+++YKDG VER+     VPP   D AT V SKDI +S +  +S R+Y+PKL   TQK
Sbjct  13    SPLLKLYKDGHVERLIGCDVVPPG-HDPATNVESKDIVISKDNDVSARIYIPKLTDQTQK  71

Query  984   LPILVYYHGGGFCVDSAFSSIYHHYLNILVSQANVIAVSVEYRLAPEHPLPAGYEDCWEA  805
             LP+ +Y+HGGGFC+++  SS YH +LN +VS+ANVI VSV YR APEHP+P  +ED W +
Sbjct  72    LPLFLYFHGGGFCIETPSSSTYHKFLNSIVSKANVIGVSVHYRRAPEHPVPIAHEDSWTS  131

Query  804   LQWVASHASNDGQQVPLKEPWLVNHGDFEKIFVGGDSAGGNIVHNVAIRAGN------EP  643
             L+WVASH + +G      E WL  H DF K+F GGDSAG NI H++AIR G+      +P
Sbjct  132   LKWVASHFNGNG-----PEEWLNRHVDFGKVFFGGDSAGANIAHHMAIRVGSHGLPGADP  186

Query  642   LNQKSKLL----------GGILSFPYFWSSNEKGGEQ------SILQKVWDFVYPTAKGG  511
             +     LL          G +L  PYFW     G E       ++++ +W F  PT  G 
Sbjct  187   IQGSEFLLERPCAGVNFKGMVLVHPYFWGVERVGSEARKPEHVALVENLWRFTCPTTVGS  246

Query  510   IDNPMIYPMAENAPSLAGLRCSKLHVCVAEKDELREISLRYVEAVKKSGWKgeievvdve  331
              D+P++ P  E  P+L  L C ++ V VAE D L++    Y E ++K GW G +EV++ +
Sbjct  247   -DDPLMNP--EKDPNLGKLACERVMVFVAENDLLKDRGWYYKELLEKCGWNGVVEVIEAK  303

Query  330   geEHCFPIMNPGTEKAKDTFKRIASFIQ  247
             GE H F ++NP  + A     R+ASFI 
Sbjct  304   GEGHVFHLLNPDCDNAVSLLDRVASFIN  331



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3357008055404