BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16512_g1_i2 len=908 path=[93:0-646 92:647-753 846:754-907]

Length=908
                                                                      Score     E

emb|CDP15008.1|  unnamed protein product                                329   5e-105   
ref|XP_009793091.1|  PREDICTED: CBS domain-containing protein CBS...    322   2e-103   
ref|XP_009618967.1|  PREDICTED: CBS domain-containing protein CBS...    323   2e-103   
ref|XP_003634219.1|  PREDICTED: CBS domain-containing protein CBS...    323   7e-103   
ref|XP_009793090.1|  PREDICTED: CBS domain-containing protein CBS...    323   1e-102   
ref|XP_006351513.1|  PREDICTED: CBS domain-containing protein CBS...    320   2e-101   
ref|XP_010663763.1|  PREDICTED: CBS domain-containing protein CBS...    318   8e-101   
ref|XP_004234305.1|  PREDICTED: CBS domain-containing protein CBS...    315   9e-100   
ref|XP_002511166.1|  conserved hypothetical protein                     312   1e-98    Ricinus communis
gb|ABK94323.1|  unknown                                                 311   2e-98    Populus trichocarpa [western balsam poplar]
ref|XP_008464422.1|  PREDICTED: CBS domain-containing protein CBS...    311   3e-98    
ref|XP_008464421.1|  PREDICTED: CBS domain-containing protein CBS...    311   3e-98    
ref|XP_006376905.1|  hypothetical protein POPTR_0012s10140g             309   1e-97    
ref|XP_009773159.1|  PREDICTED: CBS domain-containing protein CBS...    309   2e-97    
ref|XP_009596837.1|  PREDICTED: CBS domain-containing protein CBS...    309   3e-97    
ref|XP_009772357.1|  PREDICTED: CBS domain-containing protein CBS...    308   5e-97    
emb|CAN79772.1|  hypothetical protein VITISV_019408                     308   1e-96    Vitis vinifera
gb|KDP22605.1|  hypothetical protein JCGZ_26436                         306   2e-96    
ref|XP_009620985.1|  PREDICTED: CBS domain-containing protein CBS...    304   5e-96    
ref|XP_006347393.1|  PREDICTED: CBS domain-containing protein CBS...    305   8e-96    
ref|XP_009620984.1|  PREDICTED: CBS domain-containing protein CBS...    305   1e-95    
ref|XP_010086967.1|  CBS domain-containing protein                      305   1e-95    
ref|XP_004138042.1|  PREDICTED: CBS domain-containing protein CBS...    304   2e-95    
ref|XP_004241489.1|  PREDICTED: CBS domain-containing protein CBS...    303   6e-95    
ref|XP_007210567.1|  hypothetical protein PRUPE_ppa003833mg             302   8e-95    
ref|XP_010037404.1|  PREDICTED: CBS domain-containing protein CBS...    301   2e-94    
gb|KCW49109.1|  hypothetical protein EUGRSUZ_K02712                     301   3e-94    
ref|XP_008346679.1|  PREDICTED: CBS domain-containing protein CBS...    300   7e-94    
ref|XP_008346677.1|  PREDICTED: CBS domain-containing protein CBS...    300   7e-94    
ref|XP_009359422.1|  PREDICTED: CBS domain-containing protein CBS...    300   7e-94    
ref|XP_009359421.1|  PREDICTED: CBS domain-containing protein CBS...    300   9e-94    
ref|XP_009375201.1|  PREDICTED: CBS domain-containing protein CBS...    300   1e-93    
ref|XP_011044120.1|  PREDICTED: LOW QUALITY PROTEIN: CBS domain-c...    299   1e-93    
ref|XP_009375200.1|  PREDICTED: CBS domain-containing protein CBS...    299   1e-93    
gb|KHG10806.1|  CBS domain-containing CBSCBSPB5 -like protein           298   2e-93    
ref|XP_008239489.1|  PREDICTED: CBS domain-containing protein CBS...    297   7e-93    
gb|EYU23085.1|  hypothetical protein MIMGU_mgv1a004047mg                297   8e-93    
ref|XP_007038000.1|  CBS / octicosapeptide/Phox/Bemp1 domains-con...    296   1e-92    
ref|XP_011073082.1|  PREDICTED: CBS domain-containing protein CBS...    296   3e-92    
ref|XP_002322269.1|  hypothetical protein POPTR_0015s11000g             295   3e-92    Populus trichocarpa [western balsam poplar]
ref|XP_011083659.1|  PREDICTED: CBS domain-containing protein CBS...    293   4e-92    
ref|XP_011083651.1|  PREDICTED: CBS domain-containing protein CBS...    294   2e-91    
ref|XP_011083643.1|  PREDICTED: CBS domain-containing protein CBS...    293   3e-91    
ref|XP_011083634.1|  PREDICTED: CBS domain-containing protein CBS...    293   4e-91    
ref|XP_004297541.1|  PREDICTED: CBS domain-containing protein CBS...    292   1e-90    
ref|XP_011023987.1|  PREDICTED: CBS domain-containing protein CBS...    291   1e-90    
ref|XP_007038001.1|  CBS / octicosapeptide/Phox/Bemp1 domains-con...    291   2e-90    
ref|XP_006341908.1|  PREDICTED: CBS domain-containing protein CBS...    290   4e-90    
ref|XP_004252206.2|  PREDICTED: CBS domain-containing protein CBS...    288   2e-89    
gb|KHG07436.1|  CBS domain-containing CBSCBSPB5 -like protein           287   7e-89    
ref|XP_011023986.1|  PREDICTED: CBS domain-containing protein CBS...    286   1e-88    
ref|NP_001141602.1|  uncharacterized protein LOC100273720               280   2e-88    Zea mays [maize]
gb|EYU43042.1|  hypothetical protein MIMGU_mgv1a003842mg                285   8e-88    
ref|XP_002318739.2|  hypothetical protein POPTR_0012s10140g             284   8e-88    Populus trichocarpa [western balsam poplar]
ref|XP_010314158.1|  PREDICTED: CBS domain-containing protein CBS...    284   9e-88    
gb|KEH21022.1|  CBS/octicosapeptide/phox/Bemp1 (PB1) domain protein     280   4e-86    
ref|XP_004503747.1|  PREDICTED: CBS domain-containing protein CBS...    280   4e-86    
ref|XP_008654600.1|  PREDICTED: uncharacterized protein LOC100273...    280   6e-86    
ref|XP_004503746.1|  PREDICTED: CBS domain-containing protein CBS...    279   1e-85    
ref|XP_010545947.1|  PREDICTED: CBS domain-containing protein CBS...    278   2e-85    
ref|XP_010926835.1|  PREDICTED: CBS domain-containing protein CBS...    273   4e-85    
ref|XP_006436857.1|  hypothetical protein CICLE_v10031167mg             275   2e-84    
ref|XP_010926834.1|  PREDICTED: CBS domain-containing protein CBS...    274   7e-84    
ref|XP_006580610.1|  PREDICTED: CBS domain-containing protein CBS...    272   2e-83    
ref|XP_010550740.1|  PREDICTED: CBS domain-containing protein CBS...    272   3e-83    
ref|XP_010250674.1|  PREDICTED: CBS domain-containing protein CBS...    272   3e-83    
ref|XP_006580609.1|  PREDICTED: CBS domain-containing protein CBS...    272   4e-83    
gb|KHN23672.1|  CBS domain-containing protein CBSCBSPB5                 271   6e-83    
dbj|BAJ87164.1|  predicted protein                                      271   8e-83    
ref|XP_006580608.1|  PREDICTED: CBS domain-containing protein CBS...    272   1e-82    
ref|XP_006578708.1|  PREDICTED: CBS domain-containing protein CBS...    273   1e-82    
ref|XP_006580607.1|  PREDICTED: CBS domain-containing protein CBS...    271   2e-82    
ref|XP_006580606.1|  PREDICTED: CBS domain-containing protein CBS...    271   3e-82    
gb|EAY77028.1|  hypothetical protein OsI_04983                          268   3e-82    Oryza sativa Indica Group [Indian rice]
ref|XP_008392806.1|  PREDICTED: CBS domain-containing protein CBS...    263   9e-82    
ref|XP_003602797.1|  Meiotically up-regulated gene 70 protein           268   9e-82    
gb|EMS59026.1|  Meiotically up-regulated gene 70 protein                267   1e-81    
gb|AFK45149.1|  unknown                                                 268   1e-81    
ref|XP_008806421.1|  PREDICTED: CBS domain-containing protein CBS...    263   2e-81    
ref|XP_006645249.1|  PREDICTED: CBS domain-containing protein CBS...    267   2e-81    
ref|XP_002456864.1|  hypothetical protein SORBIDRAFT_03g044210          267   3e-81    Sorghum bicolor [broomcorn]
ref|XP_010913013.1|  PREDICTED: CBS domain-containing protein CBS...    266   3e-81    
emb|CDM85799.1|  unnamed protein product                                267   4e-81    
ref|XP_004501712.1|  PREDICTED: CBS domain-containing protein CBS...    266   5e-81    
gb|EMT21949.1|  hypothetical protein F775_07841                         266   6e-81    
ref|XP_003564957.1|  PREDICTED: CBS domain-containing protein CBS...    266   6e-81    
ref|XP_008806419.1|  PREDICTED: CBS domain-containing protein CBS...    265   2e-80    
ref|XP_008806418.1|  PREDICTED: CBS domain-containing protein CBS...    265   3e-80    
dbj|BAF02080.1|  hypothetical protein                                   257   3e-80    Arabidopsis thaliana [mouse-ear cress]
dbj|BAC42522.1|  unknown protein                                        256   4e-80    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001145822.1|  uncharacterized protein LOC100279329               256   7e-80    Zea mays [maize]
gb|EPS72476.1|  hypothetical protein M569_02281                         259   8e-80    
ref|XP_008798932.1|  PREDICTED: CBS domain-containing protein CBS...    261   5e-79    
ref|XP_010037405.1|  PREDICTED: CBS domain-containing protein CBS...    259   7e-79    
gb|KHN16849.1|  CBS domain-containing protein CBSCBSPB5                 258   1e-78    
ref|XP_009410641.1|  PREDICTED: CBS domain-containing protein CBS...    258   6e-78    
ref|XP_009410642.1|  PREDICTED: CBS domain-containing protein CBS...    258   7e-78    
ref|XP_004971094.1|  PREDICTED: CBS domain-containing protein CBS...    258   1e-77    
ref|XP_006282310.1|  hypothetical protein CARUB_v10028624mg             258   1e-77    
ref|XP_006584706.1|  PREDICTED: CBS domain-containing protein CBS...    258   2e-77    
ref|NP_568736.1|  CBS / octicosapeptide/Phox/Bemp1 domain-contain...    257   2e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865817.1|  CBS domain-containing protein                      257   2e-77    
ref|NP_001151563.1|  CBS domain containing protein                      257   2e-77    Zea mays [maize]
ref|XP_006584705.1|  PREDICTED: CBS domain-containing protein CBS...    258   3e-77    
gb|ACN34655.1|  unknown                                                 257   3e-77    Zea mays [maize]
ref|XP_010442542.1|  PREDICTED: CBS domain-containing protein CBS...    255   9e-77    
ref|XP_010555551.1|  PREDICTED: CBS domain-containing protein CBS...    255   1e-76    
ref|XP_007137901.1|  hypothetical protein PHAVU_009G1653000g            253   3e-76    
ref|XP_008672690.1|  PREDICTED: uncharacterized protein LOC100279...    256   5e-76    
ref|XP_010695379.1|  PREDICTED: CBS domain-containing protein CBS...    253   7e-76    
ref|XP_010442213.1|  PREDICTED: CBS domain-containing protein CBS...    253   7e-76    
ref|XP_006402080.1|  hypothetical protein EUTSA_v10013164mg             253   7e-76    
ref|XP_010482366.1|  PREDICTED: CBS domain-containing protein CBS...    253   1e-75    
emb|CDX84421.1|  BnaC03g50790D                                          251   2e-74    
ref|XP_006848282.1|  hypothetical protein AMTR_s00013p00090250          249   3e-74    
ref|XP_009127349.1|  PREDICTED: CBS domain-containing protein CBS...    249   3e-74    
ref|XP_009127348.1|  PREDICTED: CBS domain-containing protein CBS...    249   3e-74    
ref|XP_009381338.1|  PREDICTED: CBS domain-containing protein CBS...    247   1e-73    
emb|CDY16356.1|  BnaA02g11600D                                          247   1e-73    
ref|XP_009381337.1|  PREDICTED: CBS domain-containing protein CBS...    247   2e-73    
ref|XP_009387683.1|  PREDICTED: CBS domain-containing protein CBS...    246   2e-73    
ref|XP_010695378.1|  PREDICTED: CBS domain-containing protein CBS...    246   2e-73    
ref|XP_010536618.1|  PREDICTED: CBS domain-containing protein CBS...    246   4e-73    
ref|XP_007160025.1|  hypothetical protein PHAVU_002G286300g             244   1e-72    
ref|XP_007160024.1|  hypothetical protein PHAVU_002G286300g             244   2e-72    
emb|CDY66379.1|  BnaCnng50610D                                          244   3e-72    
gb|EPS71553.1|  hypothetical protein M569_03205                         238   2e-70    
ref|XP_010444246.1|  PREDICTED: CBS domain-containing protein CBS...    237   1e-69    
ref|XP_010460513.1|  PREDICTED: CBS domain-containing protein CBS...    237   1e-69    
ref|XP_006281875.1|  hypothetical protein CARUB_v10028072mg             236   2e-69    
dbj|BAF01754.1|  hypothetical protein                                   228   3e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150401.1|  PREDICTED: CBS domain-containing protein CBS...    235   5e-69    
gb|KHG27053.1|  CBS domain-containing CBSCBSPB5 -like protein           234   9e-69    
ref|XP_010484082.1|  PREDICTED: CBS domain-containing protein CBS...    234   1e-68    
emb|CDY66666.1|  BnaAnng22680D                                          234   2e-68    
ref|XP_002866558.1|  CBS domain-containing protein                      232   7e-68    
ref|XP_009130255.1|  PREDICTED: CBS domain-containing protein CBS...    232   8e-68    
emb|CDY31370.1|  BnaA02g33710D                                          231   1e-67    
emb|CDY16721.1|  BnaA09g06610D                                          234   2e-67    
ref|NP_201154.1|  CBS / octicosapeptide/Phox/Bemp1 domain-contain...    231   2e-67    Arabidopsis thaliana [mouse-ear cress]
emb|CDY39865.1|  BnaC02g42530D                                          234   3e-67    
ref|XP_009112082.1|  PREDICTED: CBS domain-containing protein CBS...    230   3e-67    
ref|XP_006394271.1|  hypothetical protein EUTSA_v10003950mg             227   5e-66    
emb|CDY66237.1|  BnaCnng50100D                                          229   6e-66    
ref|XP_008806420.1|  PREDICTED: CBS domain-containing protein CBS...    224   4e-65    
ref|XP_009415889.1|  PREDICTED: CBS domain-containing protein CBS...    224   5e-65    
ref|XP_007048555.1|  CBS / octicosapeptide/Phox/Bemp1 (PB1) domai...    224   9e-65    
ref|XP_011031088.1|  PREDICTED: CBS domain-containing protein CBS...    224   1e-64    
ref|XP_002306284.2|  hypothetical protein POPTR_0005s07150g             222   7e-64    Populus trichocarpa [western balsam poplar]
emb|CDY13325.1|  BnaC06g14320D                                          222   8e-64    
ref|XP_011022844.1|  PREDICTED: CBS domain-containing protein CBS...    221   9e-64    
ref|XP_004309727.1|  PREDICTED: LOW QUALITY PROTEIN: CBS domain-c...    220   2e-63    
ref|XP_002272502.1|  PREDICTED: CBS domain-containing protein CBS...    220   2e-63    Vitis vinifera
emb|CBI21626.3|  unnamed protein product                                220   3e-63    
ref|XP_009125245.1|  PREDICTED: CBS domain-containing protein CBS...    220   3e-63    
ref|XP_009415888.1|  PREDICTED: CBS domain-containing protein CBS...    219   4e-63    
emb|CDX67553.1|  BnaA07g15930D                                          219   5e-63    
ref|XP_010237711.1|  PREDICTED: CBS domain-containing protein CBS...    219   5e-63    
ref|XP_006432072.1|  hypothetical protein CICLE_v10000793mg             219   6e-63    
gb|KDP23089.1|  hypothetical protein JCGZ_00502                         219   6e-63    
ref|XP_009769594.1|  PREDICTED: CBS domain-containing protein CBS...    218   1e-62    
ref|XP_009624290.1|  PREDICTED: CBS domain-containing protein CBS...    218   2e-62    
ref|XP_002309952.2|  hypothetical protein POPTR_0007s04880g             218   2e-62    Populus trichocarpa [western balsam poplar]
ref|XP_010530693.1|  PREDICTED: CBS domain-containing protein CBS...    217   5e-62    
ref|XP_010025715.1|  PREDICTED: CBS domain-containing protein CBS...    216   9e-62    
ref|XP_006341904.1|  PREDICTED: CBS domain-containing protein CBS...    215   2e-61    
ref|XP_008378756.1|  PREDICTED: CBS domain-containing protein CBS...    215   2e-61    
ref|XP_002528012.1|  conserved hypothetical protein                     215   2e-61    Ricinus communis
gb|AAM91587.1|  putative protein                                        213   3e-61    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004252207.1|  PREDICTED: CBS domain-containing protein CBS...    214   4e-61    
ref|XP_006290839.1|  hypothetical protein CARUB_v10016950mg             214   4e-61    
ref|XP_008244974.1|  PREDICTED: CBS domain-containing protein CBS...    214   5e-61    
ref|XP_009420329.1|  PREDICTED: CBS domain-containing protein CBS...    212   9e-61    
ref|NP_190863.3|  CBS / octicosapeptide/Phox/Bemp1 domain-contain...    213   1e-60    Arabidopsis thaliana [mouse-ear cress]
gb|EEE52132.1|  hypothetical protein OsJ_33959                          213   1e-60    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009420328.1|  PREDICTED: CBS domain-containing protein CBS...    213   1e-60    
ref|XP_006847013.1|  hypothetical protein AMTR_s00017p00156440          213   2e-60    
ref|XP_009379458.1|  PREDICTED: CBS domain-containing protein CBS...    213   2e-60    
ref|XP_010426927.1|  PREDICTED: CBS domain-containing protein CBS...    212   3e-60    
ref|XP_010504047.1|  PREDICTED: CBS domain-containing protein CBS...    212   3e-60    
ref|XP_010515774.1|  PREDICTED: CBS domain-containing protein CBS...    212   3e-60    
ref|XP_004979306.1|  PREDICTED: CBS domain-containing protein CBS...    212   3e-60    
ref|XP_006403747.1|  hypothetical protein EUTSA_v10010265mg             212   3e-60    
ref|XP_010099759.1|  CBS domain-containing protein                      211   3e-60    
gb|KHG09902.1|  CBS domain-containing CBSCBSPB3 -like protein           211   4e-60    
ref|XP_002973475.1|  hypothetical protein SELMODRAFT_149040             211   5e-60    
ref|XP_002876175.1|  CBS domain-containing protein                      211   6e-60    
ref|XP_007221791.1|  hypothetical protein PRUPE_ppa003919mg             210   1e-59    
ref|XP_011031089.1|  PREDICTED: CBS domain-containing protein CBS...    209   2e-59    
ref|XP_002986681.1|  hypothetical protein SELMODRAFT_446714             209   3e-59    
gb|KHG09657.1|  CBS domain-containing CBSCBSPB3 -like protein           209   3e-59    
ref|XP_002450774.1|  hypothetical protein SORBIDRAFT_05g017490          207   1e-58    Sorghum bicolor [broomcorn]
ref|XP_008781501.1|  PREDICTED: CBS domain-containing protein CBS...    207   3e-58    
gb|EYU20625.1|  hypothetical protein MIMGU_mgv1a004155mg                206   3e-58    
ref|XP_009362444.1|  PREDICTED: CBS domain-containing protein CBS...    205   1e-57    
ref|XP_004146397.1|  PREDICTED: CBS domain-containing protein CBS...    205   1e-57    
ref|XP_008442154.1|  PREDICTED: CBS domain-containing protein CBS...    204   2e-57    
ref|XP_006663464.1|  PREDICTED: CBS domain-containing protein CBS...    204   2e-57    
ref|XP_010912484.1|  PREDICTED: CBS domain-containing protein CBS...    204   3e-57    
ref|XP_010912483.1|  PREDICTED: CBS domain-containing protein CBS...    204   3e-57    
ref|XP_002879614.1|  CBS domain-containing protein                      204   4e-57    
ref|XP_010912482.1|  PREDICTED: CBS domain-containing protein CBS...    204   4e-57    
ref|XP_003532113.1|  PREDICTED: CBS domain-containing protein CBS...    203   5e-57    
emb|CDP04583.1|  unnamed protein product                                203   7e-57    
ref|XP_004166825.1|  PREDICTED: LOW QUALITY PROTEIN: CBS domain-c...    203   7e-57    
ref|XP_003525140.1|  PREDICTED: CBS domain-containing protein CBS...    202   8e-57    
ref|XP_011099699.1|  PREDICTED: CBS domain-containing protein CBS...    203   8e-57    
gb|EEC68207.1|  hypothetical protein OsI_36187                          203   9e-57    Oryza sativa Indica Group [Indian rice]
gb|EPS59555.1|  hypothetical protein M569_15250                         201   1e-56    
gb|KHN17410.1|  CBS domain-containing protein CBSCBSPB3                 202   1e-56    
gb|AIZ68176.1|  CBS domain-containing protein CBSCBSPB3                 202   2e-56    
ref|XP_010243860.1|  PREDICTED: CBS domain-containing protein CBS...    199   1e-55    
gb|EYU20613.1|  hypothetical protein MIMGU_mgv1a004020mg                199   1e-55    
ref|XP_010509462.1|  PREDICTED: CBS domain-containing protein CBS...    199   2e-55    
gb|AAO64148.1|  unknown protein                                         199   2e-55    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010674377.1|  PREDICTED: CBS domain-containing protein CBS...    199   2e-55    
ref|NP_181191.1|  CBS / octicosapeptide/Phox/Bemp1 domain-contain...    199   2e-55    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003602694.1|  Octicosapeptide/Phox/Bem1p domain-containing...    192   2e-55    
emb|CDX73591.1|  BnaC08g24120D                                          199   3e-55    
ref|XP_010242795.1|  PREDICTED: CBS domain-containing protein CBS...    198   4e-55    
emb|CDX78137.1|  BnaA09g33320D                                          198   5e-55    
ref|XP_003630364.1|  Meiotically up-regulated gene 70 protein           197   7e-55    
ref|XP_010516875.1|  PREDICTED: CBS domain-containing protein CBS...    197   1e-54    
ref|XP_004503889.1|  PREDICTED: CBS domain-containing protein CBS...    196   1e-54    
ref|XP_010505198.1|  PREDICTED: CBS domain-containing protein CBS...    196   2e-54    
ref|XP_006410827.1|  hypothetical protein EUTSA_v10016477mg             196   2e-54    
ref|XP_006578764.1|  PREDICTED: CBS domain-containing protein CBS...    196   2e-54    
ref|XP_006578763.1|  PREDICTED: CBS domain-containing protein CBS...    196   3e-54    
gb|KHN31200.1|  CBS domain-containing protein CBSCBSPB3                 195   3e-54    
ref|XP_009115994.1|  PREDICTED: CBS domain-containing protein CBS...    195   5e-54    
gb|AFW60740.1|  hypothetical protein ZEAMMB73_016218                    195   9e-54    
ref|NP_001145716.1|  uncharacterized protein LOC100279220               195   9e-54    Zea mays [maize]
gb|KEH35628.1|  CBS/octicosapeptide/phox/Bemp1 (PB1) domain protein     192   1e-53    
gb|AES72945.2|  CBS/octicosapeptide/phox/Bemp1 (PB1) domain protein     192   2e-53    
ref|XP_003602693.1|  Octicosapeptide/Phox/Bem1p domain-containing...    192   3e-53    
ref|XP_009389510.1|  PREDICTED: CBS domain-containing protein CBS...    192   7e-53    
ref|XP_006293975.1|  hypothetical protein CARUB_v10022966mg             191   2e-52    
gb|KHN09655.1|  CBS domain-containing protein CBSCBSPB3                 189   4e-52    
ref|XP_006581792.1|  PREDICTED: CBS domain-containing protein CBS...    189   8e-52    
ref|XP_007038003.1|  CBS / octicosapeptide/Phox/Bemp1 (PB1) domai...    187   9e-52    
dbj|BAK00651.1|  predicted protein                                      188   2e-51    
ref|XP_004971347.1|  PREDICTED: CBS domain-containing protein CBS...    188   2e-51    
ref|XP_008677065.1|  PREDICTED: uncharacterized protein LOC100279...    188   3e-51    
ref|XP_007159889.1|  hypothetical protein PHAVU_002G276200g             186   1e-50    
ref|XP_002450380.1|  hypothetical protein SORBIDRAFT_05g004570          185   2e-50    Sorghum bicolor [broomcorn]
ref|XP_004978808.1|  PREDICTED: CBS domain-containing protein CBS...    185   2e-50    
gb|EMT07817.1|  hypothetical protein F775_10200                         182   7e-50    
dbj|BAJ96988.1|  predicted protein                                      184   8e-50    
ref|XP_007038002.1|  CBS / octicosapeptide/Phox/Bemp1 (PB1) domai...    181   1e-49    
ref|XP_004502995.1|  PREDICTED: CBS domain-containing protein CBS...    182   3e-49    
ref|XP_009143578.1|  PREDICTED: CBS domain-containing protein CBS...    182   3e-49    
ref|XP_004502996.1|  PREDICTED: CBS domain-containing protein CBS...    182   3e-49    
ref|XP_010237896.1|  PREDICTED: CBS domain-containing protein CBS...    182   6e-49    
ref|XP_009416910.1|  PREDICTED: CBS domain-containing protein CBS...    181   6e-49    
ref|NP_001045471.2|  Os01g0961200                                       181   7e-49    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001136492.1|  hypothetical protein                               178   1e-48    Zea mays [maize]
ref|XP_008669818.1|  PREDICTED: CBS domain-containing protein CBS...    180   2e-48    
emb|CDX75033.1|  BnaA05g07790D                                          181   2e-48    
ref|XP_006646712.1|  PREDICTED: CBS domain-containing protein CBS...    179   2e-48    
ref|XP_003578839.1|  PREDICTED: CBS domain-containing protein CBS...    179   3e-48    
ref|XP_004977253.1|  PREDICTED: CBS domain-containing protein CBS...    179   3e-48    
ref|XP_008676655.1|  PREDICTED: uncharacterized protein LOC100216...    179   4e-48    
gb|EEC67752.1|  hypothetical protein OsI_35274                          179   5e-48    Oryza sativa Indica Group [Indian rice]
ref|XP_006662768.1|  PREDICTED: CBS domain-containing protein CBS...    179   8e-48    
gb|EMS50734.1|  Meiotically up-regulated gene 70 protein                179   9e-48    
ref|XP_002442890.1|  hypothetical protein SORBIDRAFT_08g004470          177   3e-47    Sorghum bicolor [broomcorn]
ref|NP_001148069.1|  CBS domain containing protein                      177   3e-47    Zea mays [maize]
emb|CDY65841.1|  BnaAnng21130D                                          177   3e-47    
ref|XP_009142106.1|  PREDICTED: CBS domain-containing protein CBS...    177   4e-47    
emb|CDY33159.1|  BnaC04g08800D                                          177   7e-47    
gb|ABA91621.2|  CBS domain-containing protein, putative, expressed      175   2e-46    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007137741.1|  hypothetical protein PHAVU_009G152100g             173   4e-46    
gb|EMS50765.1|  Meiotically up-regulated gene 70 protein                174   7e-46    
ref|XP_001753915.1|  predicted protein                                  172   9e-46    
ref|NP_001067935.1|  Os11g0496400                                       165   1e-45    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA46987.1|  TPA: hypothetical protein ZEAMMB73_412952              169   2e-44    
ref|NP_001066263.2|  Os12g0169400                                       169   2e-44    Oryza sativa Japonica Group [Japonica rice]
gb|EEC68927.1|  hypothetical protein OsI_37618                          169   3e-44    Oryza sativa Indica Group [Indian rice]
gb|EEE52835.1|  hypothetical protein OsJ_35364                          168   3e-44    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006664373.1|  PREDICTED: CBS domain-containing protein CBS...    168   4e-44    
ref|XP_008669819.1|  PREDICTED: CBS domain-containing protein CBS...    165   1e-43    
gb|KDO64394.1|  hypothetical protein CISIN_1g017586mg                   161   1e-43    
ref|XP_008669820.1|  PREDICTED: CBS domain-containing protein CBS...    166   4e-43    
ref|XP_008666750.1|  PREDICTED: CBS domain-containing protein CBS...    159   5e-43    
ref|XP_010930870.1|  PREDICTED: CBS domain-containing protein CBS...    158   6e-43    
gb|KDO64393.1|  hypothetical protein CISIN_1g017586mg                   161   8e-43    
gb|KDO64390.1|  hypothetical protein CISIN_1g017586mg                   161   1e-42    
ref|XP_010930869.1|  PREDICTED: CBS domain-containing protein CBS...    158   1e-42    
tpg|DAA50456.1|  TPA: hypothetical protein ZEAMMB73_083041              161   2e-42    
gb|AAX93000.1|  CBS domain, putative                                    162   7e-42    
gb|EMT10653.1|  hypothetical protein F775_18899                         160   2e-41    
gb|KDO64392.1|  hypothetical protein CISIN_1g017586mg                   158   2e-41    
gb|ABA93770.2|  CBS domain-containing protein, putative, expressed      152   3e-41    
ref|XP_001766672.1|  predicted protein                                  158   2e-40    
tpg|DAA39039.1|  TPA: hypothetical protein ZEAMMB73_855016              156   7e-40    
ref|XP_002970762.1|  hypothetical protein SELMODRAFT_94149              155   8e-40    
ref|XP_007048556.1|  CBS / octicosapeptide/Phox/Bemp1 domains-con...    154   3e-39    
ref|XP_002969429.1|  hypothetical protein SELMODRAFT_62607              153   3e-39    
ref|XP_001766619.1|  predicted protein                                  150   5e-38    
ref|XP_001769877.1|  predicted protein                                  150   1e-37    
gb|KDO52200.1|  hypothetical protein CISIN_1g038065mg                   142   2e-37    
ref|XP_001766794.1|  predicted protein                                  148   3e-37    
gb|EMS68129.1|  Meiotically up-regulated gene 70 protein                146   1e-36    
ref|XP_002306285.2|  hypothetical protein POPTR_0005s07150g             143   1e-35    
gb|KHN32549.1|  CBS domain-containing protein CBSCBSPB5                 142   2e-35    
ref|XP_008339146.1|  PREDICTED: CBS domain-containing protein CBS...    135   5e-35    
ref|XP_010913014.1|  PREDICTED: CBS domain-containing protein CBS...    140   2e-34    
ref|XP_008361624.1|  PREDICTED: transmembrane protein 184C-like         138   2e-33    
ref|XP_010912485.1|  PREDICTED: CBS domain-containing protein CBS...    135   9e-33    
gb|EMT02803.1|  hypothetical protein F775_03431                         129   2e-30    
ref|XP_006402083.1|  hypothetical protein EUTSA_v10016029mg             123   3e-30    
gb|EMS61876.1|  Meiotically up-regulated gene 70 protein                124   4e-28    
gb|KDO64395.1|  hypothetical protein CISIN_1g017586mg                   119   1e-27    
ref|XP_008238502.1|  PREDICTED: CBS domain-containing protein CBS...    110   7e-26    
ref|XP_008351733.1|  PREDICTED: CBS domain-containing protein CBS...    115   9e-26    
ref|XP_008351732.1|  PREDICTED: CBS domain-containing protein CBS...    115   9e-26    
ref|XP_006581793.1|  PREDICTED: CBS domain-containing protein CBS...    113   5e-25    
ref|XP_010667888.1|  PREDICTED: CBS domain-containing protein CBS...    106   8e-25    
ref|XP_002989291.1|  hypothetical protein SELMODRAFT_129621             108   2e-23    
ref|XP_002980859.1|  hypothetical protein SELMODRAFT_32029              106   1e-22    
gb|EEE56049.1|  hypothetical protein OsJ_04848                          106   1e-21    
gb|KDO33927.1|  hypothetical protein SPRG_01806                       91.7    4e-17    
gb|AFW65379.1|  hypothetical protein ZEAMMB73_586556                  89.4    6e-17    
ref|XP_009516005.1|  hypothetical protein PHYSODRAFT_349233           90.1    9e-17    
ref|XP_002456978.1|  hypothetical protein SORBIDRAFT_03g046640        89.0    1e-16    
ref|XP_002906867.1|  myosin-like protein                              85.5    3e-15    
ref|XP_008620323.1|  hypothetical protein SDRG_15915                  85.5    4e-15    
emb|CCA15731.1|  myosinlike protein putative                          85.5    4e-15    
emb|CCI42074.1|  unnamed protein product                              84.3    8e-15    
emb|CAN63699.1|  hypothetical protein VITISV_002255                   84.3    1e-14    
ref|XP_008898709.1|  hypothetical protein, variant 2                  82.4    2e-14    
ref|XP_008898711.1|  hypothetical protein PPTG_06531                  82.0    6e-14    
tpg|DAA51183.1|  TPA: hypothetical protein ZEAMMB73_821236            79.3    1e-13    
ref|XP_009824487.1|  hypothetical protein H257_02506                  80.5    1e-13    
gb|EMT27156.1|  hypothetical protein F775_22787                       80.1    2e-13    
gb|AFW86222.1|  hypothetical protein ZEAMMB73_132979                  79.7    2e-13    
gb|KFH64841.1|  hypothetical protein, variant                         79.0    4e-13    
gb|KFH64842.1|  hypothetical protein MVEG_09571                       78.2    9e-13    
emb|CEG81232.1|  Putative Cbs and pb1 domain protein                  77.4    2e-12    
ref|XP_008680389.1|  PREDICTED: CBS domain-containing protein CBS...  73.2    2e-12    
gb|EIE92454.1|  hypothetical protein RO3G_16976                       77.0    2e-12    
gb|KDO52201.1|  hypothetical protein CISIN_1g047148mg                 71.2    3e-12    
emb|CEG79267.1|  Putative Cbs and pb1 domain protein                  75.5    8e-12    
gb|EIE90046.1|  hypothetical protein RO3G_14757                       75.1    9e-12    
emb|CDH59168.1|  cbs and pb1 domain protein                           75.5    9e-12    
ref|XP_008863923.1|  hypothetical protein H310_02254                  75.1    1e-11    
emb|CEG66127.1|  Putative Genomic scaffold, msy_sf_14                 74.3    2e-11    
emb|CEG66126.1|  Putative Cbs and pb1 domain protein                  74.3    2e-11    
emb|CDS04127.1|  hypothetical protein LRAMOSA07082                    74.3    2e-11    
ref|XP_008339198.1|  PREDICTED: CBS domain-containing protein CBS...  73.2    3e-11    
emb|CDH57173.1|  cbs and pb1 domain protein                           73.2    4e-11    
gb|ERZ95725.1|  hypothetical protein GLOINDRAFT_72157                 71.6    1e-10    
emb|CDS06171.1|  hypothetical protein LRAMOSA08699                    71.2    2e-10    
gb|EXX51155.1|  hypothetical protein RirG_264390                      70.5    3e-10    
gb|EXX51156.1|  hypothetical protein RirG_264390                      70.5    4e-10    
gb|EPB87542.1|  hypothetical protein HMPREF1544_05633                 67.4    4e-09    
emb|CDS12485.1|  hypothetical protein LRAMOSA04679                    67.0    5e-09    
ref|XP_002181407.1|  predicted protein                                66.6    6e-09    
gb|KDO64396.1|  hypothetical protein CISIN_1g017586mg                 65.1    8e-09    
gb|KFH70126.1|  hypothetical protein, variant                         65.9    1e-08    
gb|EPB81381.1|  hypothetical protein HMPREF1544_11911                 65.9    1e-08    
ref|XP_007312382.1|  hypothetical protein SERLADRAFT_432066           65.9    1e-08    
ref|XP_002839512.1|  CBS/PB1 domain-containing protein                65.5    2e-08    
gb|KFH66526.1|  hypothetical protein MVEG_07051                       65.1    2e-08    
ref|XP_005756312.1|  hypothetical protein EMIHUDRAFT_108007           64.3    3e-08    
ref|XP_007325250.1|  hypothetical protein AGABI1DRAFT_81204           64.3    4e-08    
emb|CCO27785.1|  CBS domain-containing protein CBSCBSPB3              63.9    5e-08    
emb|CEL51734.1|  CBS domain-containing protein CBSCBSPB3 OS=Arabi...  63.9    5e-08    
ref|XP_001828409.2|  CBS and PB1 domain-containing protein            63.2    9e-08    
gb|KDO64397.1|  hypothetical protein CISIN_1g017586mg                 61.6    1e-07    
ref|XP_002850342.1|  CBS/PB1 domain-containing protein                63.2    1e-07    
ref|XP_006454779.1|  hypothetical protein AGABI2DRAFT_190012          62.8    1e-07    
emb|CCD28276.1|  phox domain-cointaining protein                      60.5    1e-07    
ref|XP_007696385.1|  hypothetical protein COCSADRAFT_135182           62.4    2e-07    
ref|XP_007710407.1|  hypothetical protein COCCADRAFT_91178            61.6    3e-07    
gb|EMD97506.1|  hypothetical protein COCHEDRAFT_1190356               61.6    3e-07    
ref|XP_007687119.1|  hypothetical protein COCMIDRAFT_93041            61.2    4e-07    
gb|EUC61771.1|  CBS and PB1 domain protein                            60.8    5e-07    
gb|EKV08130.1|  hypothetical protein PDIP_69880                       60.8    6e-07    
emb|CCA77926.1|  hypothetical protein PIIN_00640                      60.5    7e-07    
gb|KEP53289.1|  CBS and PB1 domain protein                            60.5    7e-07    
emb|CDS06855.1|  hypothetical protein LRAMOSA09380                    60.1    9e-07    
ref|XP_008898710.1|  hypothetical protein, variant 1                  60.1    9e-07    
ref|XP_009824488.1|  hypothetical protein, variant                    59.7    1e-06    
ref|XP_001586912.1|  CBS/PB1 domain-containing protein                59.7    1e-06    
ref|XP_007360047.1|  CBS-domain-containing protein                    59.7    1e-06    
ref|XP_002542435.1|  conserved hypothetical protein                   58.9    2e-06    
gb|KIL71038.1|  hypothetical protein M378DRAFT_65908                  58.9    2e-06    
gb|KII93420.1|  hypothetical protein PLICRDRAFT_171175                58.5    3e-06    
emb|CDM86897.1|  unnamed protein product                              57.8    4e-06    
ref|XP_007762523.1|  CBS-domain-containing protein                    58.2    4e-06    
ref|XP_009539904.1|  hypothetical protein PHYSODRAFT_362634           58.5    5e-06    
emb|CDS14267.1|  hypothetical protein LRAMOSA06437                    58.2    5e-06    
gb|EMS50548.1|  Meiotically up-regulated gene 70 protein              57.4    5e-06    
ref|XP_003013567.1|  hypothetical protein ARB_00014                   57.8    5e-06    
ref|XP_008871716.1|  hypothetical protein H310_07960                  58.2    5e-06    
ref|XP_001551082.1|  CBS/PB1 domain-containing protein                57.8    6e-06    
gb|EMR81395.1|  putative cbs pb1 domain-containing protein            57.8    6e-06    
ref|XP_003177437.1|  CBS/PB1 domain-containing protein                57.8    6e-06    
emb|CCD50252.1|  similar to CBS and PB1 domain-containing protein     57.4    7e-06    
ref|XP_003017887.1|  hypothetical protein TRV_08098                   57.4    7e-06    
ref|XP_008908818.1|  hypothetical protein PPTG_13150                  57.8    8e-06    
gb|ETP12110.1|  hypothetical protein F441_12452                       57.8    8e-06    
gb|ETL89032.1|  hypothetical protein L917_11962                       57.8    8e-06    
gb|ETL35795.1|  hypothetical protein L916_12124                       57.8    8e-06    
gb|ETK82410.1|  hypothetical protein L915_12198                       57.8    8e-06    
gb|ETO70995.1|  hypothetical protein F444_12579                       57.8    8e-06    
gb|ETI42366.1|  hypothetical protein F443_12488                       57.8    8e-06    
ref|XP_002998463.1|  myosin-like protein                              57.8    8e-06    
gb|ETP40219.1|  hypothetical protein F442_12400                       57.4    8e-06    
gb|ETM42277.1|  hypothetical protein L914_12043                       57.4    8e-06    
ref|XP_001729611.1|  hypothetical protein MGL_3155                    57.0    9e-06    
gb|KIN01095.1|  hypothetical protein OIDMADRAFT_198272                57.0    1e-05    
ref|XP_003231762.1|  CBS/PB1 domain-containing protein                57.0    1e-05    
gb|EZF26966.1|  hypothetical protein H100_00959                       56.6    1e-05    
emb|CCX33784.1|  Similar to Meiotically up-regulated gene 70 prot...  57.0    1e-05    
gb|KIK02282.1|  hypothetical protein K443DRAFT_522629                 57.0    1e-05    
ref|XP_008022817.1|  hypothetical protein SETTUDRAFT_167648           56.6    1e-05    
ref|XP_007861235.1|  CBS-domain-containing protein                    56.6    1e-05    
gb|EMD41721.1|  hypothetical protein CERSUDRAFT_110295                56.2    2e-05    
ref|XP_009835199.1|  hypothetical protein, variant                    56.6    2e-05    
ref|XP_009835200.1|  hypothetical protein H257_10371                  56.6    2e-05    
gb|KFZ18721.1|  hypothetical protein V502_03981                       56.2    2e-05    
gb|EQL33139.1|  hypothetical protein BDFG_04879                       56.2    2e-05    
gb|KFY84708.1|  hypothetical protein V500_09072                       56.2    2e-05    
ref|XP_002627879.1|  CBS/PB1 domain-containing protein                56.2    2e-05    
ref|XP_009152664.1|  hypothetical protein HMPREF1120_00418            56.2    2e-05    
gb|EGE86443.1|  CBS and PB1 domain-containing protein                 55.8    2e-05    
gb|EIE86138.1|  hypothetical protein RO3G_10849                       55.8    2e-05    
gb|KGO76561.1|  Aldolase-type TIM barrel                              55.8    3e-05    
gb|KHJ34472.1|  putative cbs pb1 domain-containing protein            54.7    5e-05    
gb|EEH08877.1|  CBS and PB1 domain-containing protein                 54.3    7e-05    
ref|XP_001933716.1|  CBS/PB1 domain-containing protein                54.3    7e-05    
ref|XP_007291922.1|  ribosomal protein subunit S4                     54.3    7e-05    
emb|CCI42332.1|  unnamed protein product                              54.7    7e-05    
gb|EHK23329.1|  hypothetical protein TRIVIDRAFT_79905                 54.3    7e-05    
gb|EST07649.1|  putative dehydrogenase                                54.3    8e-05    
gb|EER43669.1|  CBS and PB1 protein                                   54.3    8e-05    
gb|EGD96841.1|  CBS and PB1 domain-containing protein                 54.3    8e-05    
gb|EZF30576.1|  hypothetical protein H101_05800                       54.3    8e-05    
gb|EWZ47864.1|  hypothetical protein FOZG_03627                       53.9    9e-05    
gb|EXM25800.1|  hypothetical protein FOTG_07543                       53.9    9e-05    
gb|EWZ01802.1|  hypothetical protein FOYG_01293                       53.9    9e-05    
gb|EWZ92914.1|  hypothetical protein FOWG_05866                       53.9    9e-05    
gb|EHK43764.1|  hypothetical protein TRIATDRAFT_171851                54.3    9e-05    
gb|KGO38897.1|  Aldolase-type TIM barrel                              53.9    1e-04    
gb|ELR04751.1|  hypothetical protein GMDG_06979                       53.9    1e-04    
gb|KEQ97230.1|  hypothetical protein AUEXF2481DRAFT_63735             53.9    1e-04    
ref|XP_003303808.1|  CBS/PB1 domain-containing protein                53.5    1e-04    
gb|EWZ92913.1|  hypothetical protein FOWG_05866                       53.5    1e-04    
gb|EME40262.1|  hypothetical protein DOTSEDRAFT_74911                 53.5    1e-04    
ref|XP_007736973.1|  hypothetical protein A1O3_08686                  53.5    1e-04    
gb|EXM25799.1|  hypothetical protein FOTG_07543                       53.5    1e-04    
gb|EWZ47863.1|  hypothetical protein FOZG_03627                       53.5    1e-04    
ref|XP_007879370.1|  hypothetical protein PFL1_03660                  53.5    1e-04    
emb|CCA16800.1|  myosinlike protein putative                          53.9    1e-04    
gb|EGU76199.1|  hypothetical protein FOXB_13271                       53.5    1e-04    
gb|EFW20087.1|  CBS and PB1 domain-containing protein                 53.5    1e-04    
ref|XP_003068344.1|  CBS/PB1 domain-containing protein                53.5    1e-04    
gb|EPS27748.1|  hypothetical protein PDE_02692                        53.5    1e-04    
gb|KIK26542.1|  hypothetical protein PISMIDRAFT_94595                 53.5    1e-04    
gb|KFY05040.1|  hypothetical protein V491_09211                       53.1    2e-04    
gb|KFY00360.1|  hypothetical protein O988_03337                       53.1    2e-04    
gb|EWG43561.1|  hypothetical protein FVEG_04983                       52.8    2e-04    
gb|KFX89553.1|  hypothetical protein V490_06945                       53.1    2e-04    
gb|KEQ64118.1|  CBS and PB1 domain-containing protein                 52.8    2e-04    
gb|KFY56633.1|  hypothetical protein V496_06663                       52.8    3e-04    
gb|KFH45741.1|  Meiotically up-regulated gene 70 protein-like pro...  52.4    3e-04    
gb|EWG43560.1|  hypothetical protein FVEG_04983                       52.4    3e-04    
emb|CCT67340.1|  probable CBS and PB1 domain protein                  52.4    3e-04    
ref|XP_002558609.1|  Pc13g01640                                       52.4    3e-04    
gb|AFW62351.1|  hypothetical protein ZEAMMB73_157791                  51.2    3e-04    
gb|KFY39174.1|  hypothetical protein V495_06105                       52.4    3e-04    
ref|XP_008031881.1|  CBS-domain-containing protein                    52.4    3e-04    
ref|XP_007298197.1|  CBS-domain-containing protein                    52.4    3e-04    
ref|XP_006965092.1|  predicted protein                                52.0    4e-04    
ref|XP_001904859.1|  hypothetical protein                             52.0    4e-04    
gb|ETS02586.1|  hypothetical protein M419DRAFT_110107                 52.0    5e-04    
gb|KFZ07628.1|  hypothetical protein V501_06276                       51.6    6e-04    
dbj|GAA94471.1|  hypothetical protein E5Q_01123                       51.2    7e-04    
gb|EJT52892.1|  hypothetical protein A1Q1_00797                       51.2    8e-04    
ref|XP_007875245.1|  hypothetical protein PNEG_03182                  51.2    8e-04    
gb|KFY70535.1|  hypothetical protein V499_09094                       51.2    8e-04    
ref|XP_001264987.1|  CBS/PB1 domain-containing protein                50.8    9e-04    



>emb|CDP15008.1| unnamed protein product [Coffea canephora]
Length=546

 Score =   329 bits (843),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG+VVAVVDVLHIT AA++TVGNTAGV  
Sbjct  298  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGIVVAVVDVLHITHAAVATVGNTAGVTT  357

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E ANTMMQKFWDSAMA++  D+EE  SE SLK+AS+G +TG SLP+PSS++ +TF+FKI+
Sbjct  358  EAANTMMQKFWDSAMALAPDDEEETRSEGSLKMASDGADTGRSLPYPSSSMPSTFAFKIQ  417

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DRKGRMHRF  DTR++TDLIT+I+QR+G DI+  NLPQILYEDEDHD+VVLASDSDL+ A
Sbjct  418  DRKGRMHRFNCDTRSLTDLITSIIQRVGDDIDRKNLPQILYEDEDHDKVVLASDSDLVAA  477

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            V+HAR AGWKGLRLHLDYS  P  R+GSGS +++YA  D
Sbjct  478  VDHARLAGWKGLRLHLDYSGRPGHRKGSGSVSMDYAHED  516



>ref|XP_009793091.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X2 [Nicotiana sylvestris]
Length=468

 Score =   322 bits (825),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 190/219 (87%), Gaps = 0/219 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS++ PI+DALH MHDGKFLHLP+ DK+G+VVAV+DVLHIT AA++TVGNTAG+N 
Sbjct  219  NPECASIDMPIVDALHTMHDGKFLHLPVVDKEGIVVAVLDVLHITHAAVATVGNTAGINN  278

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E AN+MMQ+FWDSAMA++  DDEE  S++SLKLASEG ETG S+P+PSS+  N+FSFKIE
Sbjct  279  EAANSMMQRFWDSAMALTPDDDEETRSDSSLKLASEGAETGRSIPYPSSSQPNSFSFKIE  338

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D+KGRMHRF  D RNMTDLI AI+QR+G DI+ +NLPQILYEDEDHD+VVLASDSDL  A
Sbjct  339  DKKGRMHRFNCDIRNMTDLIAAIIQRVGDDIDRDNLPQILYEDEDHDKVVLASDSDLTAA  398

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            V+HARSAGWKGL+LHLDYS     RRGS SS+++YA T+
Sbjct  399  VDHARSAGWKGLKLHLDYSGITGHRRGSSSSSLDYAHTE  437



>ref|XP_009618967.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like, partial 
[Nicotiana tomentosiformis]
Length=508

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/219 (73%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS++ PI+DALH MHDGKFLHLP+ DK+G+VVAV+DVLHIT AA++TVGNTAG+N 
Sbjct  259  NPECASIDMPIVDALHTMHDGKFLHLPVVDKEGIVVAVLDVLHITHAAVATVGNTAGINN  318

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E AN+MMQ+FWDSAMA++  DDEE  S++SLKLASEG ETG S+P+PSS+  N+FSFKIE
Sbjct  319  EAANSMMQRFWDSAMALTPDDDEETRSDSSLKLASEGAETGRSIPYPSSSQPNSFSFKIE  378

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D+KGRMHRF  D RNMTDLI AI+QR+G DI+ +NLPQILYEDEDHD+VVLASDSDL  A
Sbjct  379  DKKGRMHRFNCDIRNMTDLIAAIIQRVGDDIDRDNLPQILYEDEDHDKVVLASDSDLTAA  438

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            V+HARSAGWKGL+LHLDYS T   RRGS SS+++YA T+
Sbjct  439  VDHARSAGWKGLKLHLDYSGTTGHRRGSSSSSLDYAHTE  477



>ref|XP_003634219.1| PREDICTED: CBS domain-containing protein CBSCBSPB5 isoform X2 
[Vitis vinifera]
 emb|CBI15683.3| unnamed protein product [Vitis vinifera]
Length=541

 Score =   323 bits (828),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 154/217 (71%), Positives = 185/217 (85%), Gaps = 0/217 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+++TPI+DALH MHDGKFLHLP+ D+DG VVAV DV+HIT AA++TVG  AGVN 
Sbjct  293  NPECATIDTPIVDALHTMHDGKFLHLPVIDRDGGVVAVADVIHITHAAVATVGGNAGVNN  352

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E A+++MQKFWDSAMA+   DDEE  SE SLKLASEG E G +LP+ SS + NTF+FKIE
Sbjct  353  EAASSLMQKFWDSAMALGTDDDEETRSEGSLKLASEGTEIGRTLPYTSSAMHNTFAFKIE  412

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D++GRMHRFT DTR++TD+IT+ILQR+G DI+ NNLPQILYEDEDHD+VVLASD+DL+ A
Sbjct  413  DKRGRMHRFTCDTRSLTDVITSILQRVGDDIDRNNLPQILYEDEDHDKVVLASDNDLVAA  472

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQ  257
            +EHAR AGWKGLRLHLDYS T  LRR SG+  +EYAQ
Sbjct  473  MEHARLAGWKGLRLHLDYSGTRPLRRDSGTGGLEYAQ  509



>ref|XP_009793090.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X1 [Nicotiana sylvestris]
Length=550

 Score =   323 bits (827),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 190/219 (87%), Gaps = 0/219 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS++ PI+DALH MHDGKFLHLP+ DK+G+VVAV+DVLHIT AA++TVGNTAG+N 
Sbjct  301  NPECASIDMPIVDALHTMHDGKFLHLPVVDKEGIVVAVLDVLHITHAAVATVGNTAGINN  360

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E AN+MMQ+FWDSAMA++  DDEE  S++SLKLASEG ETG S+P+PSS+  N+FSFKIE
Sbjct  361  EAANSMMQRFWDSAMALTPDDDEETRSDSSLKLASEGAETGRSIPYPSSSQPNSFSFKIE  420

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D+KGRMHRF  D RNMTDLI AI+QR+G DI+ +NLPQILYEDEDHD+VVLASDSDL  A
Sbjct  421  DKKGRMHRFNCDIRNMTDLIAAIIQRVGDDIDRDNLPQILYEDEDHDKVVLASDSDLTAA  480

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            V+HARSAGWKGL+LHLDYS     RRGS SS+++YA T+
Sbjct  481  VDHARSAGWKGLKLHLDYSGITGHRRGSSSSSLDYAHTE  519



>ref|XP_006351513.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Solanum 
tuberosum]
Length=551

 Score =   320 bits (819),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/216 (71%), Positives = 183/216 (85%), Gaps = 0/216 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PEC++ +TPI+DALH MHDGKFLHLP+ DK+G VVAV+DVLHIT AA+STVG  AG N 
Sbjct  302  SPECSTTDTPIVDALHTMHDGKFLHLPVVDKEGTVVAVLDVLHITHAAVSTVGQNAGPNN  361

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E ANTMMQ+FWDSAMA++  DDEE  SE SLKLASEG ETG S P+PS++L NTF+FKI+
Sbjct  362  EAANTMMQRFWDSAMALTPDDDEETRSEGSLKLASEGAETGRSNPYPSASLPNTFAFKIQ  421

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DRKGRMHRF  D R++TDLIT+I+QRLG DI+ NNLPQILYEDED D+V+LASDSDL  A
Sbjct  422  DRKGRMHRFNCDIRSVTDLITSIIQRLGNDIDRNNLPQILYEDEDQDKVILASDSDLTAA  481

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYA  260
            VEHA+ +GWKGLRLHLDYS TP  RRGS S +++YA
Sbjct  482  VEHAKLSGWKGLRLHLDYSGTPGRRRGSNSESLDYA  517



>ref|XP_010663763.1| PREDICTED: CBS domain-containing protein CBSCBSPB5 isoform X1 
[Vitis vinifera]
Length=544

 Score =   318 bits (814),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 185/220 (84%), Gaps = 3/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV---GNTAG  737
            NPECA+++TPI+DALH MHDGKFLHLP+ D+DG VVAV DV+HIT AA++TV   G  AG
Sbjct  293  NPECATIDTPIVDALHTMHDGKFLHLPVIDRDGGVVAVADVIHITHAAVATVSQVGGNAG  352

Query  736  VNEETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSF  557
            VN E A+++MQKFWDSAMA+   DDEE  SE SLKLASEG E G +LP+ SS + NTF+F
Sbjct  353  VNNEAASSLMQKFWDSAMALGTDDDEETRSEGSLKLASEGTEIGRTLPYTSSAMHNTFAF  412

Query  556  KIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDL  377
            KIED++GRMHRFT DTR++TD+IT+ILQR+G DI+ NNLPQILYEDEDHD+VVLASD+DL
Sbjct  413  KIEDKRGRMHRFTCDTRSLTDVITSILQRVGDDIDRNNLPQILYEDEDHDKVVLASDNDL  472

Query  376  ITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQ  257
            + A+EHAR AGWKGLRLHLDYS T  LRR SG+  +EYAQ
Sbjct  473  VAAMEHARLAGWKGLRLHLDYSGTRPLRRDSGTGGLEYAQ  512



>ref|XP_004234305.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Solanum 
lycopersicum]
Length=551

 Score =   315 bits (808),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 153/216 (71%), Positives = 182/216 (84%), Gaps = 0/216 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PEC++ +TPI+DALH MHDGKFLHLP+ DK+G VVAV+DVLHIT AA+STVG  AG N 
Sbjct  302  SPECSTTDTPIVDALHTMHDGKFLHLPVVDKEGTVVAVLDVLHITHAAVSTVGQNAGPNN  361

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E ANTMMQ+FWDSAMA++  DDEE  SE SLKLASEG ETG S  +PS++L NTF+FKI+
Sbjct  362  EAANTMMQRFWDSAMALTPDDDEETRSEGSLKLASEGAETGRSNLYPSASLPNTFAFKIQ  421

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DRKGRMHRF  D R++TDLIT+I+QRLG DI+ NNLPQILYEDED D+V+LASDSDL  A
Sbjct  422  DRKGRMHRFNCDIRSVTDLITSIIQRLGNDIDRNNLPQILYEDEDQDKVILASDSDLTAA  481

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYA  260
            VEHA+ +GWKGLRLHLDYS TP  RRGS S +++YA
Sbjct  482  VEHAKLSGWKGLRLHLDYSGTPGRRRGSNSESLDYA  517



>ref|XP_002511166.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51768.1| conserved hypothetical protein [Ricinus communis]
Length=545

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 160/220 (73%), Positives = 188/220 (85%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+++TPI+DALH MHDGKFLHLP+ D+DG VVAVVDV+HIT AA++TVG+TAGVN 
Sbjct  296  NPECATIDTPIVDALHTMHDGKFLHLPVLDRDGNVVAVVDVIHITHAAVATVGSTAGVNN  355

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A+TMMQKFWDSAMA+S + DD++  SE SLKL SEG ETG SLP+PS+   N+F FKI
Sbjct  356  EAASTMMQKFWDSAMALSPNEDDDDTRSEGSLKLPSEGAETGRSLPYPSAGFPNSFGFKI  415

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+KGRMHRFTSDTR++TDLITAILQRLG DI+ NNLPQILYED+DHD+VVL SDSDL+T
Sbjct  416  EDKKGRMHRFTSDTRSLTDLITAILQRLGNDIDRNNLPQILYEDDDHDKVVLESDSDLVT  475

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AVEHA+ AG+KGLRLHLDYS     R GSGS  + YAQ D
Sbjct  476  AVEHAKLAGFKGLRLHLDYSGVRSRRGGSGSGDLAYAQKD  515



>gb|ABK94323.1| unknown [Populus trichocarpa]
Length=541

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 189/220 (86%), Gaps = 2/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+++TPI+DALH MHDGKFLHLP+ D+DG +VAV+DV+HIT AA++TVGNT G N 
Sbjct  293  NPECATIDTPIVDALHTMHDGKFLHLPVVDRDGNIVAVIDVIHITHAAVATVGNTTGANN  352

Query  727  ETANTMMQKFWDSAMAISHHDDE-EMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            ETA+TMMQKFWDSAMA+S +DDE E  SE SLK+ASEG ET  SL +PSS L N FSFKI
Sbjct  353  ETASTMMQKFWDSAMAMSPNDDEDETRSEGSLKIASEGTETARSLLYPSSGLPNNFSFKI  412

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+KGRMHRFT +TR++TDLIT+ILQRLG DIN NNLPQILYEDEDHD+VVLASDSDL T
Sbjct  413  EDKKGRMHRFTCETRSLTDLITSILQRLGDDINRNNLPQILYEDEDHDKVVLASDSDLTT  472

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AVEHARSAG KGLRLHLDY+ T   RRGS S +++YAQ D
Sbjct  473  AVEHARSAGLKGLRLHLDYTGT-RRRRGSSSESLDYAQAD  511



>ref|XP_008464422.1| PREDICTED: CBS domain-containing protein CBSCBSPB5 isoform X2 
[Cucumis melo]
Length=540

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 188/220 (85%), Gaps = 3/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS++TPI+DALH MHDGKFLHLP+ D+DG VVAVVDV+HIT AA++TVGNT+GV  
Sbjct  293  NPECASIDTPIVDALHTMHDGKFLHLPVVDRDGNVVAVVDVIHITHAAVATVGNTSGVGN  352

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A++MMQKFWDSAMA+S + DD+E+ SE S+KLASE  +TG +LPFPSS L NTFSFK+
Sbjct  353  EAASSMMQKFWDSAMALSPNDDDDELRSEGSMKLASEETDTGRALPFPSSGLSNTFSFKL  412

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            EDRKGRMHRF+ DTR++TD+ITAI+QR+G DI+ N LPQILYEDEDHD+VVL SDSDL  
Sbjct  413  EDRKGRMHRFSCDTRSLTDVITAIIQRVGDDIDRNQLPQILYEDEDHDKVVLGSDSDLAA  472

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AVEHAR AGWKGLRLHL+Y  +   RR +G+  ++YAQ+D
Sbjct  473  AVEHARLAGWKGLRLHLEYPGSHGRRRDAGN--MDYAQSD  510



>ref|XP_008464421.1| PREDICTED: CBS domain-containing protein CBSCBSPB5 isoform X1 
[Cucumis melo]
Length=543

 Score =   311 bits (797),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 188/220 (85%), Gaps = 3/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS++TPI+DALH MHDGKFLHLP+ D+DG VVAVVDV+HIT AA++TVGNT+GV  
Sbjct  293  NPECASIDTPIVDALHTMHDGKFLHLPVVDRDGNVVAVVDVIHITHAAVATVGNTSGVGN  352

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A++MMQKFWDSAMA+S + DD+E+ SE S+KLASE  +TG +LPFPSS L NTFSFK+
Sbjct  353  EAASSMMQKFWDSAMALSPNDDDDELRSEGSMKLASEETDTGRALPFPSSGLSNTFSFKL  412

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            EDRKGRMHRF+ DTR++TD+ITAI+QR+G DI+ N LPQILYEDEDHD+VVL SDSDL  
Sbjct  413  EDRKGRMHRFSCDTRSLTDVITAIIQRVGDDIDRNQLPQILYEDEDHDKVVLGSDSDLAA  472

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AVEHAR AGWKGLRLHL+Y  +   RR +G+  ++YAQ+D
Sbjct  473  AVEHARLAGWKGLRLHLEYPGSHGRRRDAGN--MDYAQSD  510



>ref|XP_006376905.1| hypothetical protein POPTR_0012s10140g [Populus trichocarpa]
 gb|ERP54702.1| hypothetical protein POPTR_0012s10140g [Populus trichocarpa]
Length=541

 Score =   309 bits (792),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 162/220 (74%), Positives = 188/220 (85%), Gaps = 2/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+++TPI+DALH MHDGKFLHLP+ D+DG +VAV+DV+HIT AA++TVGN  G N 
Sbjct  293  NPECATIDTPIVDALHTMHDGKFLHLPVVDRDGNIVAVIDVIHITHAAVATVGNATGANN  352

Query  727  ETANTMMQKFWDSAMAISHHDDE-EMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            ETA+TMMQKFWDSAMA+S +DDE E  SE SLK+ASEG ET  SL +PSS L N FSFKI
Sbjct  353  ETASTMMQKFWDSAMAMSPNDDEDETRSEGSLKIASEGTETARSLLYPSSGLPNNFSFKI  412

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+KGRMHRFT +TR++TDLIT+ILQRLG DIN NNLPQILYEDEDHD+VVLASDSDL T
Sbjct  413  EDKKGRMHRFTCETRSLTDLITSILQRLGDDINRNNLPQILYEDEDHDKVVLASDSDLTT  472

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AVEHARSAG KGLRLHLDY+ T   RRGS S +++YAQ D
Sbjct  473  AVEHARSAGLKGLRLHLDYTGT-RRRRGSSSESLDYAQAD  511



>ref|XP_009773159.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Nicotiana 
sylvestris]
Length=551

 Score =   309 bits (792),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 181/219 (83%), Gaps = 0/219 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+ +TPI+DALH MHDGKFLHLP+ D+DG+VVAVVDVLHIT AA++TVGNTAGVN 
Sbjct  302  NPECATTDTPIVDALHTMHDGKFLHLPVVDRDGIVVAVVDVLHITHAAVATVGNTAGVNS  361

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E ANT MQKFWDSAM +S  ++EE  S  SLKLASEG E   S+ +PSS+L NTF+FKI+
Sbjct  362  EVANTRMQKFWDSAMELSPDEEEETRSIGSLKLASEGAELRRSISYPSSSLPNTFAFKIQ  421

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DR GRMHRF  D R+MTDLITAI+QR+G DI+  NLPQILYEDEDHD+VVLA+ SDL  A
Sbjct  422  DRAGRMHRFNCDIRSMTDLITAIIQRVGDDIDRKNLPQILYEDEDHDKVVLATKSDLTAA  481

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            V+HARSAGWKGLRLHLDYS     R+GS S+ ++YA T+
Sbjct  482  VDHARSAGWKGLRLHLDYSGKCGRRKGSSSNNLDYAHTE  520



>ref|XP_009596837.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like [Nicotiana 
tomentosiformis]
Length=551

 Score =   309 bits (791),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 182/219 (83%), Gaps = 0/219 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+ +TPI+DALH MHDGKFLHLP+ D+DG+VVAVVDVLHIT AA++TVGNTAGVN 
Sbjct  302  NPECATTDTPIVDALHTMHDGKFLHLPVVDRDGIVVAVVDVLHITHAAVATVGNTAGVNS  361

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E ANT MQKFWDSAM +S  ++EE  S  SLKLASEG E   S+ +PSS+L NTF+FKI+
Sbjct  362  EVANTRMQKFWDSAMELSPDEEEETRSIGSLKLASEGAELRRSISYPSSSLPNTFAFKIQ  421

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DR GRMHRF  D R+MTDL+TAI+QR+G DI+  NLPQILYEDEDHD+VVLA++SDL  A
Sbjct  422  DRTGRMHRFNCDIRSMTDLLTAIIQRVGDDIDRKNLPQILYEDEDHDKVVLATESDLTAA  481

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            V+HARSAGWKGLRLHLDYS     R+GS S+ ++YA T+
Sbjct  482  VDHARSAGWKGLRLHLDYSGKRGRRKGSSSNNLDYAHTE  520



>ref|XP_009772357.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Nicotiana 
sylvestris]
Length=553

 Score =   308 bits (789),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 186/216 (86%), Gaps = 0/216 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA+ +TPI+DALH MHDGKFLHLP+ DK+G VVAV+DVLHIT AA++TVGN AG N 
Sbjct  304  SPECATTDTPIVDALHTMHDGKFLHLPVVDKEGTVVAVLDVLHITHAAVATVGNAAGANN  363

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E ANTMMQKFWDSAMA++  DDEE  SE S KLASEG ETG S+P+P ++L NTF+FKI+
Sbjct  364  EAANTMMQKFWDSAMALTPDDDEETPSEGSQKLASEGAETGRSIPYPPASLPNTFAFKIQ  423

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DRKGRMHRF  D R+MTDLIT+I+QR+G DI+ NNLPQILYEDEDHD+V+LASDSDLITA
Sbjct  424  DRKGRMHRFNCDIRSMTDLITSIIQRMGDDIDRNNLPQILYEDEDHDKVILASDSDLITA  483

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYA  260
            VEHAR +GWKGLRLHLDYS TP  RRGS S +++YA
Sbjct  484  VEHARLSGWKGLRLHLDYSGTPGRRRGSQSESLDYA  519



>emb|CAN79772.1| hypothetical protein VITISV_019408 [Vitis vinifera]
Length=569

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 154/247 (62%), Positives = 185/247 (75%), Gaps = 30/247 (12%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV--------  752
            NPECA+++TPI+DALH MHDGKFLHLP+ D+DG VVAV DV+HIT AA++TV        
Sbjct  291  NPECATIDTPIVDALHTMHDGKFLHLPVIDRDGGVVAVADVIHITHAAVATVKLCLSKCC  350

Query  751  ----------------------GNTAGVNEETANTMMQKFWDSAMAISHHDDEEMHSEAS  638
                                  G  AGVN E A+++MQKFWDSAMA+   DDEE  SE S
Sbjct  351  SSQQQAAKELSCFQCFIDRMQVGGNAGVNNEAASSLMQKFWDSAMALGTDDDEETRSEGS  410

Query  637  LKLASEGQETGISLPFPSSTLQNTFSFKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGD  458
            LKLASEG E G +LP+ SS + NTF+FKIED++GRMHRFT DTR++TD+IT+ILQR+G D
Sbjct  411  LKLASEGTEIGRTLPYTSSAMHNTFAFKIEDKRGRMHRFTCDTRSLTDVITSILQRVGDD  470

Query  457  INWNNLPQILYEDEDHDQVVLASDSDLITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGS  278
            I+ NNLPQILYEDEDHD+VVLASD+DL+ A+EHAR AGWKGLRLHLDYS T  LRR SG+
Sbjct  471  IDRNNLPQILYEDEDHDKVVLASDNDLVAAMEHARLAGWKGLRLHLDYSGTRPLRRDSGT  530

Query  277  STIEYAQ  257
              +EYAQ
Sbjct  531  GGLEYAQ  537



>gb|KDP22605.1| hypothetical protein JCGZ_26436 [Jatropha curcas]
Length=544

 Score =   306 bits (785),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 158/221 (71%), Positives = 186/221 (84%), Gaps = 3/221 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG VVAVVDV+HIT AA++T G+T GVN 
Sbjct  295  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGNVVAVVDVIHITHAAVATAGSTTGVNN  354

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSST-LQNTFSFK  554
            E A+TMMQKFWDSAMA+S + DDE+  SE SLK+ SEG +TG SL +PSS+ L NTFSFK
Sbjct  355  EAASTMMQKFWDSAMALSPNEDDEDTRSEGSLKVPSEG-DTGRSLAYPSSSGLPNTFSFK  413

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            IED+KGRMHRFT DTR++TDLIT+ILQRLG DI+ NNLPQILYEDEDHD+VVL SDSDL+
Sbjct  414  IEDKKGRMHRFTCDTRSLTDLITSILQRLGDDIDRNNLPQILYEDEDHDKVVLESDSDLV  473

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            TAV+HA+SAG KGLRLHLDYS     R GS S  ++Y  TD
Sbjct  474  TAVDHAKSAGLKGLRLHLDYSGVHGRRGGSSSGDLDYTHTD  514



>ref|XP_009620985.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X2 [Nicotiana tomentosiformis]
Length=503

 Score =   304 bits (779),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 186/216 (86%), Gaps = 0/216 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA+ +TPI+DALH MHDGKFLHLP+ DK+G+VVAV+DVLHIT AA++TVGN AG N 
Sbjct  254  SPECATTDTPIVDALHTMHDGKFLHLPVVDKEGMVVAVLDVLHITHAAVATVGNAAGANN  313

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E ANTMMQKFWDSAMA++  DDEE  SE S KLASEG ETG S+P+P ++L  TF+FKI+
Sbjct  314  EAANTMMQKFWDSAMALTPDDDEETPSEGSQKLASEGAETGRSIPYPPASLPITFAFKIQ  373

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DRKGRMHRF  D R+MTDLIT+I+QR+G DI+ NNLPQILYEDEDHD+V+LASDSDLITA
Sbjct  374  DRKGRMHRFNCDIRSMTDLITSIIQRMGDDIDRNNLPQILYEDEDHDKVILASDSDLITA  433

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYA  260
            VEHAR +GWKGLRLHLDYS TP  RRGS S +++YA
Sbjct  434  VEHARLSGWKGLRLHLDYSGTPGRRRGSTSESLDYA  469



>ref|XP_006347393.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like [Solanum 
tuberosum]
Length=543

 Score =   305 bits (780),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 180/219 (82%), Gaps = 7/219 (3%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS++ PI+DALH MHDGKFLHLP+ DK+G VV+V+DVLHIT AA++TVGN AGVN 
Sbjct  301  NPECASIDMPIVDALHTMHDGKFLHLPVVDKEGTVVSVLDVLHITHAAVATVGNAAGVNN  360

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E AN+MMQ+FWDSAMA++  DD+E  SE SLKLASEG ETG S+P+PSS+   +FSFKI+
Sbjct  361  EAANSMMQRFWDSAMALTPDDDDETRSENSLKLASEGTETGRSIPYPSSSQPTSFSFKIK  420

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D+KGRMHRF  D +NMTDLI AI+QR+G DI+  NLPQILYEDEDHD+VVLASD DL  A
Sbjct  421  DKKGRMHRFNCDIQNMTDLIAAIIQRVGDDIDRTNLPQILYEDEDHDKVVLASDGDLTAA  480

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            ++HARS+GWKGL+LHLDYS       G+   +++YA T+
Sbjct  481  IDHARSSGWKGLKLHLDYS-------GTTGGSLDYAHTE  512



>ref|XP_009620984.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X1 [Nicotiana tomentosiformis]
Length=549

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 186/216 (86%), Gaps = 0/216 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA+ +TPI+DALH MHDGKFLHLP+ DK+G+VVAV+DVLHIT AA++TVGN AG N 
Sbjct  300  SPECATTDTPIVDALHTMHDGKFLHLPVVDKEGMVVAVLDVLHITHAAVATVGNAAGANN  359

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E ANTMMQKFWDSAMA++  DDEE  SE S KLASEG ETG S+P+P ++L  TF+FKI+
Sbjct  360  EAANTMMQKFWDSAMALTPDDDEETPSEGSQKLASEGAETGRSIPYPPASLPITFAFKIQ  419

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DRKGRMHRF  D R+MTDLIT+I+QR+G DI+ NNLPQILYEDEDHD+V+LASDSDLITA
Sbjct  420  DRKGRMHRFNCDIRSMTDLITSIIQRMGDDIDRNNLPQILYEDEDHDKVILASDSDLITA  479

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYA  260
            VEHAR +GWKGLRLHLDYS TP  RRGS S +++YA
Sbjct  480  VEHARLSGWKGLRLHLDYSGTPGRRRGSTSESLDYA  515



>ref|XP_010086967.1| CBS domain-containing protein [Morus notabilis]
 gb|EXB25246.1| CBS domain-containing protein [Morus notabilis]
Length=543

 Score =   305 bits (780),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 184/216 (85%), Gaps = 1/216 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG +V+VVDV+HIT AA++TVG+TAGVN 
Sbjct  295  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGNIVSVVDVIHITHAAVATVGSTAGVNN  354

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E A+TMMQKFWDSAMA S+ DD+E  SE SLKLAS+G ETG S P+  + L  +F+FKI+
Sbjct  355  EAASTMMQKFWDSAMA-SNEDDDETRSEGSLKLASDGAETGRSSPYTLAGLSTSFAFKIQ  413

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D+KGRMHRFT +TR++TDLIT+I+QR+G DI+ NNLPQILYEDEDHD+V+LASD+DL  A
Sbjct  414  DKKGRMHRFTCETRSLTDLITSIIQRVGDDIDRNNLPQILYEDEDHDKVMLASDNDLAAA  473

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYA  260
            VEHAR AGWKGL+LHLDYS     RR SGS +++YA
Sbjct  474  VEHARLAGWKGLKLHLDYSGMHDPRRHSGSGSLDYA  509



>ref|XP_004138042.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Cucumis 
sativus]
 ref|XP_004167275.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Cucumis 
sativus]
 gb|KGN63476.1| hypothetical protein Csa_1G001480 [Cucumis sativus]
Length=540

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 151/220 (69%), Positives = 185/220 (84%), Gaps = 3/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS++TPI+DALH MHDGKFLHLP+ D+DG VVAVVDV+HIT AA++TVGNT+GV  
Sbjct  293  NPECASIDTPIVDALHTMHDGKFLHLPVVDRDGNVVAVVDVIHITHAAVATVGNTSGVGN  352

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A++MMQKFWDSAMA+S + DD+E+ SE S+KLASE  +T  +LPFPS  + NTFSFK+
Sbjct  353  EAASSMMQKFWDSAMALSPNDDDDELRSEGSMKLASEETDTLRTLPFPSPGMSNTFSFKL  412

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            EDR+GRMHRF+ DTR++TD+ITAILQR+G DI+ N LPQILYEDEDHD+VVL SDSDL  
Sbjct  413  EDRRGRMHRFSCDTRSLTDVITAILQRVGDDIDRNKLPQILYEDEDHDKVVLGSDSDLAA  472

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AVEHAR AGWKGLRLHL+Y  +   RR +G+  ++YAQ D
Sbjct  473  AVEHARLAGWKGLRLHLEYPGSHGRRRDAGN--MDYAQRD  510



>ref|XP_004241489.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like [Solanum 
lycopersicum]
Length=543

 Score =   303 bits (775),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 178/216 (82%), Gaps = 7/216 (3%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS++ PI+DALH MHDGKFLHLP+ DK+G VV+V+DVLHIT AA++TVGN AGVN 
Sbjct  301  NPECASIDMPIVDALHTMHDGKFLHLPVVDKEGTVVSVLDVLHITHAAVATVGNAAGVNN  360

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E AN+MMQ+FWDSAMA++  DD+E  SE SLKLASEG ETG S+P+PSS+   +FSFKI+
Sbjct  361  EAANSMMQRFWDSAMALTPDDDDETRSENSLKLASEGTETGRSIPYPSSSQPTSFSFKIK  420

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D+KGRMHRF  D +NMTDLI AI+QR+G DI+  NLPQILYEDEDHD+VVLASD DL  A
Sbjct  421  DKKGRMHRFNCDIQNMTDLIAAIIQRVGDDIDRTNLPQILYEDEDHDKVVLASDGDLTAA  480

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYA  260
            ++HARS+GWKGL+LHLDYS       G+   +++YA
Sbjct  481  IDHARSSGWKGLKLHLDYS-------GTTGGSLDYA  509



>ref|XP_007210567.1| hypothetical protein PRUPE_ppa003833mg [Prunus persica]
 gb|EMJ11766.1| hypothetical protein PRUPE_ppa003833mg [Prunus persica]
Length=545

 Score =   302 bits (774),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 186/220 (85%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG VVAVVDV+HIT AA++TVGNTAGV+ 
Sbjct  295  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGTVVAVVDVIHITHAAVATVGNTAGVSN  354

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E AN++MQKFWDSAMA+  H +DE+  SE SLKLAS+G ETG SLPFPSS   NTF+FK+
Sbjct  355  EAANSLMQKFWDSAMALGPHEEDEDSRSEGSLKLASDGAETGRSLPFPSSNFPNTFAFKL  414

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRFT + +++TDLIT+I+QR+G DI+ NNLPQILYEDED D+V+LASD+DL+ 
Sbjct  415  QDKRGRMHRFTCNIQSLTDLITSIVQRMGDDIDRNNLPQILYEDEDRDKVILASDNDLVA  474

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AVEHA+  GWKGLRLHLDYS T   RRGS   +++YA  D
Sbjct  475  AVEHAKQVGWKGLRLHLDYSGTRGRRRGSAGGSMDYAYAD  514



>ref|XP_010037404.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW49110.1| hypothetical protein EUGRSUZ_K02712 [Eucalyptus grandis]
Length=542

 Score =   301 bits (771),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG +VAVVDV+HIT AA++TVG++AGVN 
Sbjct  294  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGNIVAVVDVIHITHAAVATVGSSAGVNN  353

Query  727  ETANTMMQKFWDSAMAISHHDDEE-MHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A+TMMQKFWD+AMA S  DDEE   SE S+KL S+G + G SL + SST  N+F+FKI
Sbjct  354  EAASTMMQKFWDTAMAASPTDDEEEARSEGSMKLTSDGGDIGRSLSY-SSTQPNSFTFKI  412

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+KGRMHRF+ D ++MTD+IT+I+QR+G DI+ NNLPQILYEDEDHD+VVLASD DL  
Sbjct  413  EDKKGRMHRFSCDAQSMTDIITSIVQRVGDDIDRNNLPQILYEDEDHDKVVLASDGDLAA  472

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AVEHARSAGWKGLRLHLDYS T    RG+    + YAQ D
Sbjct  473  AVEHARSAGWKGLRLHLDYSGTAKRSRGATGGDMAYAQAD  512



>gb|KCW49109.1| hypothetical protein EUGRSUZ_K02712 [Eucalyptus grandis]
Length=559

 Score =   301 bits (771),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG +VAVVDV+HIT AA++TVG++AGVN 
Sbjct  294  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGNIVAVVDVIHITHAAVATVGSSAGVNN  353

Query  727  ETANTMMQKFWDSAMAISHHDDEE-MHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A+TMMQKFWD+AMA S  DDEE   SE S+KL S+G + G SL + SST  N+F+FKI
Sbjct  354  EAASTMMQKFWDTAMAASPTDDEEEARSEGSMKLTSDGGDIGRSLSY-SSTQPNSFTFKI  412

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+KGRMHRF+ D ++MTD+IT+I+QR+G DI+ NNLPQILYEDEDHD+VVLASD DL  
Sbjct  413  EDKKGRMHRFSCDAQSMTDIITSIVQRVGDDIDRNNLPQILYEDEDHDKVVLASDGDLAA  472

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AVEHARSAGWKGLRLHLDYS T    RG+    + YAQ D
Sbjct  473  AVEHARSAGWKGLRLHLDYSGTAKRSRGATGGDMAYAQAD  512



>ref|XP_008346679.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X2 [Malus domestica]
Length=546

 Score =   300 bits (768),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 182/221 (82%), Gaps = 2/221 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG VVAVVDV+HIT AA++TVGNTAGV+ 
Sbjct  295  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGAVVAVVDVIHITHAAVATVGNTAGVSN  354

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A TMMQKFWDSAMA+  + DDEE  SE SLKLASE  ETG SLPFP S   NTF+FK+
Sbjct  355  EAATTMMQKFWDSAMALGPNDDDEESRSENSLKLASESAETGRSLPFPPSNFPNTFAFKL  414

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRFT + +++T+LI +I+QR+G DI+ NNLPQILYEDED D+V+LASDSDLI 
Sbjct  415  QDKRGRMHRFTCNIQSLTELIASIIQRMGDDIDRNNLPQILYEDEDRDKVILASDSDLIA  474

Query  370  AVEHARSAGWKGLRLHLDYSRT-PHLRRGSGSSTIEYAQTD  251
            AV+HA+  GWKGLRLHLDYS T    RRGS +  ++YA  D
Sbjct  475  AVDHAKQVGWKGLRLHLDYSGTHTRRRRGSATGNVDYAYAD  515



>ref|XP_008346677.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X1 [Malus domestica]
Length=548

 Score =   300 bits (768),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 182/221 (82%), Gaps = 2/221 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG VVAVVDV+HIT AA++TVGNTAGV+ 
Sbjct  297  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGAVVAVVDVIHITHAAVATVGNTAGVSN  356

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A TMMQKFWDSAMA+  + DDEE  SE SLKLASE  ETG SLPFP S   NTF+FK+
Sbjct  357  EAATTMMQKFWDSAMALGPNDDDEESRSENSLKLASESAETGRSLPFPPSNFPNTFAFKL  416

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRFT + +++T+LI +I+QR+G DI+ NNLPQILYEDED D+V+LASDSDLI 
Sbjct  417  QDKRGRMHRFTCNIQSLTELIASIIQRMGDDIDRNNLPQILYEDEDRDKVILASDSDLIA  476

Query  370  AVEHARSAGWKGLRLHLDYSRT-PHLRRGSGSSTIEYAQTD  251
            AV+HA+  GWKGLRLHLDYS T    RRGS +  ++YA  D
Sbjct  477  AVDHAKQVGWKGLRLHLDYSGTHTRRRRGSATGNVDYAYAD  517



>ref|XP_009359422.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X2 [Pyrus x bretschneideri]
Length=546

 Score =   300 bits (768),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 182/221 (82%), Gaps = 2/221 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPILDALH MHDGKFLH+P+ D+DG VVAVVDVLHIT AA++TVGNTAGV+ 
Sbjct  295  NPECATVDTPILDALHTMHDGKFLHIPVLDRDGAVVAVVDVLHITHAAVATVGNTAGVSN  354

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A  MMQKFWDSAMA+S + DD+E  SE SLKLASE   TG SLPFP S   NTF+FK+
Sbjct  355  EAATNMMQKFWDSAMALSPNDDDDESRSENSLKLASESAVTGRSLPFPPSNFPNTFAFKL  414

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRFT + +N+T+LIT+I+QR+G DI+ NNLPQILYEDED D+V+LASDSDL+ 
Sbjct  415  QDKRGRMHRFTCNIQNLTELITSIIQRMGDDIDRNNLPQILYEDEDRDKVILASDSDLVA  474

Query  370  AVEHARSAGWKGLRLHLDYSRT-PHLRRGSGSSTIEYAQTD  251
            AV+HA+  GWKGLRLHLDYS T    RRGS +  ++YA  D
Sbjct  475  AVDHAKQVGWKGLRLHLDYSGTRSRQRRGSAAGNVDYAYAD  515



>ref|XP_009359421.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X1 [Pyrus x bretschneideri]
Length=548

 Score =   300 bits (767),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 182/221 (82%), Gaps = 2/221 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPILDALH MHDGKFLH+P+ D+DG VVAVVDVLHIT AA++TVGNTAGV+ 
Sbjct  297  NPECATVDTPILDALHTMHDGKFLHIPVLDRDGAVVAVVDVLHITHAAVATVGNTAGVSN  356

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A  MMQKFWDSAMA+S + DD+E  SE SLKLASE   TG SLPFP S   NTF+FK+
Sbjct  357  EAATNMMQKFWDSAMALSPNDDDDESRSENSLKLASESAVTGRSLPFPPSNFPNTFAFKL  416

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRFT + +N+T+LIT+I+QR+G DI+ NNLPQILYEDED D+V+LASDSDL+ 
Sbjct  417  QDKRGRMHRFTCNIQNLTELITSIIQRMGDDIDRNNLPQILYEDEDRDKVILASDSDLVA  476

Query  370  AVEHARSAGWKGLRLHLDYSRT-PHLRRGSGSSTIEYAQTD  251
            AV+HA+  GWKGLRLHLDYS T    RRGS +  ++YA  D
Sbjct  477  AVDHAKQVGWKGLRLHLDYSGTRSRQRRGSAAGNVDYAYAD  517



>ref|XP_009375201.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X2 [Pyrus x bretschneideri]
Length=546

 Score =   300 bits (767),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 183/221 (83%), Gaps = 2/221 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG VVAVVDV+HIT AA++TVGNTAGV+ 
Sbjct  295  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGAVVAVVDVIHITHAAVATVGNTAGVSN  354

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A TMMQKFWDSAMA+  + DDEE  SE SLKLASE  ETG SLPFP S   NTF+FK+
Sbjct  355  EAATTMMQKFWDSAMALGPNDDDEESRSENSLKLASESAETGRSLPFPPSNFPNTFAFKL  414

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRFT + +++T+LIT+I+QR+G DI+ NNLPQILYEDED D+V+LASDSDL+ 
Sbjct  415  QDKRGRMHRFTCNIQSLTELITSIIQRMGDDIDRNNLPQILYEDEDRDKVMLASDSDLLA  474

Query  370  AVEHARSAGWKGLRLHLDYSRT-PHLRRGSGSSTIEYAQTD  251
            AV+HA+  GWKGLRLHLDYS T    RRGS +  ++YA  D
Sbjct  475  AVDHAKQVGWKGLRLHLDYSGTHTRRRRGSATGNVDYAYAD  515



>ref|XP_011044120.1| PREDICTED: LOW QUALITY PROTEIN: CBS domain-containing protein 
CBSCBSPB1-like [Populus euphratica]
Length=540

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 180/220 (82%), Gaps = 2/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+++TPI+DALH MHDGKFLHLP+ D+DG +VAV+DV+HIT AA++TVGNT G N 
Sbjct  292  NPECATIDTPIVDALHTMHDGKFLHLPVLDRDGNIVAVIDVIHITHAAVATVGNTTGANN  351

Query  727  ETANTMMQKFWDSAMAISHHDDE-EMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            ETA+TMMQKFWDSAMA+S +DDE E  SE SLK+ASEG ET  SL +PSS L N FSFKI
Sbjct  352  ETASTMMQKFWDSAMAMSPNDDEDESRSEGSLKMASEGTETARSLLYPSSGLPNNFSFKI  411

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+KGRMHRFT +TR++TDLIT+ILQRLG DIN NNLPQILYEDEDHD+VVLASDSDL T
Sbjct  412  EDKKGRMHRFTCETRSLTDLITSILQRLGDDINRNNLPQILYEDEDHDKVVLASDSDLTT  471

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AVEHARSAG K L   +     PH  R   S +++YAQ D
Sbjct  472  AVEHARSAGLKVLSAWMCPPPQPH-GRXVFSESLDYAQAD  510



>ref|XP_009375200.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X1 [Pyrus x bretschneideri]
Length=548

 Score =   299 bits (766),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 183/221 (83%), Gaps = 2/221 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG VVAVVDV+HIT AA++TVGNTAGV+ 
Sbjct  297  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGAVVAVVDVIHITHAAVATVGNTAGVSN  356

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A TMMQKFWDSAMA+  + DDEE  SE SLKLASE  ETG SLPFP S   NTF+FK+
Sbjct  357  EAATTMMQKFWDSAMALGPNDDDEESRSENSLKLASESAETGRSLPFPPSNFPNTFAFKL  416

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRFT + +++T+LIT+I+QR+G DI+ NNLPQILYEDED D+V+LASDSDL+ 
Sbjct  417  QDKRGRMHRFTCNIQSLTELITSIIQRMGDDIDRNNLPQILYEDEDRDKVMLASDSDLLA  476

Query  370  AVEHARSAGWKGLRLHLDYSRT-PHLRRGSGSSTIEYAQTD  251
            AV+HA+  GWKGLRLHLDYS T    RRGS +  ++YA  D
Sbjct  477  AVDHAKQVGWKGLRLHLDYSGTHTRRRRGSATGNVDYAYAD  517



>gb|KHG10806.1| CBS domain-containing CBSCBSPB5 -like protein [Gossypium arboreum]
Length=537

 Score =   298 bits (763),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 183/220 (83%), Gaps = 4/220 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+T I+DALH+MH GKFLHLP+ ++DG +VA+VDV+HIT AAI+TVG+T+G+N 
Sbjct  291  NPECATVDTSIVDALHQMHVGKFLHLPVLNRDGEIVAIVDVIHITHAAIATVGSTSGINN  350

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E   TMMQ+FWDSA+A+  + DD+E  SE+SLKLASE   TG  LP+PSS L NTF FKI
Sbjct  351  EATTTMMQRFWDSAIALPPNEDDDEARSESSLKLASE---TGRCLPYPSSYLPNTFGFKI  407

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +DR+GRMHRF  DTR+MTD+ITAILQRL  DI+ N +PQILYEDEDHD+VVLASD+DL  
Sbjct  408  QDRRGRMHRFICDTRSMTDVITAILQRLEDDIDRNRVPQILYEDEDHDKVVLASDNDLAA  467

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AVEHA+  GWKGL+LHLDYS   + RRGSGS +++YAQ+D
Sbjct  468  AVEHAKLLGWKGLKLHLDYSGKQNRRRGSGSGSLDYAQSD  507



>ref|XP_008239489.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like [Prunus 
mume]
 ref|XP_008239490.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like [Prunus 
mume]
Length=545

 Score =   297 bits (761),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 147/220 (67%), Positives = 186/220 (85%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG VVAVVDV+HIT AA++TVGNTAGV+ 
Sbjct  295  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGTVVAVVDVIHITHAAVATVGNTAGVSN  354

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A+++MQKFWDSAMA+  H +DE+  SE SLKLAS+G ETG SLPFPS+   NTF+FK+
Sbjct  355  EAASSLMQKFWDSAMALGPHEEDEDSRSEGSLKLASDGAETGRSLPFPSANFPNTFAFKL  414

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRFT + +++T+LIT+I+QR+G DI+ NNLPQILYEDED D+V+LASD+DL+ 
Sbjct  415  QDKRGRMHRFTCNIQSLTELITSIVQRMGDDIDRNNLPQILYEDEDRDKVILASDNDLVA  474

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AVEHA+  GWKGLRLHLDYS T   RRGS   +++YA  D
Sbjct  475  AVEHAKQVGWKGLRLHLDYSGTRGRRRGSAGGSMDYAYAD  514



>gb|EYU23085.1| hypothetical protein MIMGU_mgv1a004047mg [Erythranthe guttata]
Length=547

 Score =   297 bits (761),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 154/219 (70%), Positives = 185/219 (84%), Gaps = 0/219 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ DKDG+ VAV+DVL+IT+AAI+TVG+TAGV+ 
Sbjct  299  NPECATVDTPIVDALHTMHDGKFLHLPVIDKDGMAVAVIDVLNITQAAIATVGSTAGVST  358

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E  NTMMQKFWDSAM +   DD++  SE SLK+AS+G ETG S+P+PSSTL +TFSFKI+
Sbjct  359  EATNTMMQKFWDSAMELPPDDDDDTRSENSLKMASDGGETGRSVPYPSSTLSSTFSFKIQ  418

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DRKGRMHRF   T+++ DLITAILQR+G +I+ NNLPQILYEDED D+VVLASDSDL  A
Sbjct  419  DRKGRMHRFLCGTQSLADLITAILQRVGDEIDRNNLPQILYEDEDKDKVVLASDSDLQAA  478

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            V+HAR AGWKGL+LHLDYS T   R+GS S  +EYAQ D
Sbjct  479  VDHARLAGWKGLKLHLDYSGTSSRRKGSNSRNLEYAQAD  517



>ref|XP_007038000.1| CBS / octicosapeptide/Phox/Bemp1 domains-containing protein isoform 
1 [Theobroma cacao]
 gb|EOY22501.1| CBS / octicosapeptide/Phox/Bemp1 domains-containing protein isoform 
1 [Theobroma cacao]
Length=541

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 185/220 (84%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG +VAVVDVLHIT AA++TVG+T+G+N 
Sbjct  292  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGEIVAVVDVLHITHAAVATVGSTSGINN  351

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E   TMMQKFWDSAMA+  + DD+E  S+ SLKLAS+G ET  SLP+PSS++ NTF FKI
Sbjct  352  EATTTMMQKFWDSAMALPPNEDDDETRSDNSLKLASDGGETARSLPYPSSSMPNTFGFKI  411

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D+KGRMHRFT DTR+MTDLITAILQRL  DI+ +++PQILYEDEDHD+VVL+SD+DL  
Sbjct  412  QDKKGRMHRFTCDTRSMTDLITAILQRLEDDIDRDSVPQILYEDEDHDKVVLSSDNDLSA  471

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HA+  GWKGLRLHLDYS     RRGS S +++YA +D
Sbjct  472  AVQHAKLVGWKGLRLHLDYSGKQGRRRGSSSGSLDYAHSD  511



>ref|XP_011073082.1| PREDICTED: CBS domain-containing protein CBSCBSPB1 [Sesamum indicum]
 ref|XP_011073083.1| PREDICTED: CBS domain-containing protein CBSCBSPB1 [Sesamum indicum]
Length=552

 Score =   296 bits (758),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 150/218 (69%), Positives = 179/218 (82%), Gaps = 2/218 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ DKDG  VAVVDVLHIT+AA++TVG+TAGV+ 
Sbjct  303  NPECATVDTPIVDALHTMHDGKFLHLPVVDKDGTFVAVVDVLHITQAAVATVGSTAGVSG  362

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E ANTMMQKFWDSAM ++  DDE+  SE SLKL S+  E   SLP PSST  + F+FKI+
Sbjct  363  EAANTMMQKFWDSAMELAP-DDEDSRSENSLKLNSDAGEISQSLPCPSSTTSSNFAFKIQ  421

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DRKGRMHRF   T+++ D ITAILQR+G +I+ NNLPQILYEDED D+VV+ASD DL  A
Sbjct  422  DRKGRMHRFLCGTQHLADFITAILQRVGDEIDRNNLPQILYEDEDGDKVVIASDGDLQAA  481

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGS-GSSTIEYAQ  257
            V+HAR AGWKGL+LHLDYS TPH  RGS  SS+++YAQ
Sbjct  482  VDHARLAGWKGLKLHLDYSGTPHRLRGSTSSSSLDYAQ  519



>ref|XP_002322269.1| hypothetical protein POPTR_0015s11000g [Populus trichocarpa]
 gb|EEF06396.1| hypothetical protein POPTR_0015s11000g [Populus trichocarpa]
Length=529

 Score =   295 bits (756),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 157/220 (71%), Positives = 182/220 (83%), Gaps = 2/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+++TPI+DALH MHDGKFLHLP+ D+DG +VAV+DV+HIT AA++TVG+ A  N 
Sbjct  281  NPECATIDTPIVDALHTMHDGKFLHLPVLDRDGNIVAVIDVIHITHAAVATVGSAAAANN  340

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            ETANTMMQKFWDSAMA+S + DDEE  SE SLKLASEG E G SL +PSS   N FSFKI
Sbjct  341  ETANTMMQKFWDSAMALSPNGDDEEARSEGSLKLASEGTEGGRSLLYPSSVYPNVFSFKI  400

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED++GRMHRFT +TRN+TD+IT+ILQRLG DIN NNLPQILYEDEDHD+VVLASDSDLIT
Sbjct  401  EDKRGRMHRFTCETRNLTDIITSILQRLGDDINCNNLPQILYEDEDHDKVVLASDSDLIT  460

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AVEHARSAG K LRLHLD S     R+GS S   +Y + D
Sbjct  461  AVEHARSAGLKSLRLHLDCSGKGG-RKGSRSEGFDYGEAD  499



>ref|XP_011083659.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X4 [Sesamum indicum]
Length=467

 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 180/220 (82%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++++PI+DALH MHDGKFLHLP+ D+DG V+ VVDVL+IT AA++TVG+TAGV+ 
Sbjct  218  NPECATIDSPIVDALHIMHDGKFLHLPVVDRDGQVITVVDVLNITHAAVATVGSTAGVSS  277

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E AN MMQ FWDSAMA++   ++E  SE SLK+ S+G ETG S+P PSS   +TFSFKI+
Sbjct  278  EAANMMMQNFWDSAMALTTDYEDETRSENSLKVPSDGGETGRSVPQPSSIASDTFSFKIQ  337

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGRMHRF  +T+N+TDL+TAILQR+G DI+ NNLPQI+YEDE+HD+VVLASDSDL  A
Sbjct  338  DGKGRMHRFICETQNVTDLVTAILQRVGADIDRNNLPQIMYEDEEHDKVVLASDSDLQAA  397

Query  367  VEHARSAGWKGLRLHLDYSRTP-HLRRGSGSSTIEYAQTD  251
            + HA+ +GWKGLRLHL+Y   P  LRRGS S T+ +AQ D
Sbjct  398  IYHAKLSGWKGLRLHLEYLGAPSRLRRGSSSGTMGHAQAD  437



>ref|XP_011083651.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X3 [Sesamum indicum]
Length=549

 Score =   294 bits (752),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 180/220 (82%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++++PI+DALH MHDGKFLHLP+ D+DG V+ VVDVL+IT AA++TVG+TAGV+ 
Sbjct  300  NPECATIDSPIVDALHIMHDGKFLHLPVVDRDGQVITVVDVLNITHAAVATVGSTAGVSS  359

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E AN MMQ FWDSAMA++   ++E  SE SLK+ S+G ETG S+P PSS   +TFSFKI+
Sbjct  360  EAANMMMQNFWDSAMALTTDYEDETRSENSLKVPSDGGETGRSVPQPSSIASDTFSFKIQ  419

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGRMHRF  +T+N+TDL+TAILQR+G DI+ NNLPQI+YEDE+HD+VVLASDSDL  A
Sbjct  420  DGKGRMHRFICETQNVTDLVTAILQRVGADIDRNNLPQIMYEDEEHDKVVLASDSDLQAA  479

Query  367  VEHARSAGWKGLRLHLDYSRTP-HLRRGSGSSTIEYAQTD  251
            + HA+ +GWKGLRLHL+Y   P  LRRGS S T+ +AQ D
Sbjct  480  IYHAKLSGWKGLRLHLEYLGAPSRLRRGSSSGTMGHAQAD  519



>ref|XP_011083643.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X2 [Sesamum indicum]
Length=551

 Score =   293 bits (750),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 180/220 (82%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++++PI+DALH MHDGKFLHLP+ D+DG V+ VVDVL+IT AA++TVG+TAGV+ 
Sbjct  302  NPECATIDSPIVDALHIMHDGKFLHLPVVDRDGQVITVVDVLNITHAAVATVGSTAGVSS  361

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E AN MMQ FWDSAMA++   ++E  SE SLK+ S+G ETG S+P PSS   +TFSFKI+
Sbjct  362  EAANMMMQNFWDSAMALTTDYEDETRSENSLKVPSDGGETGRSVPQPSSIASDTFSFKIQ  421

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGRMHRF  +T+N+TDL+TAILQR+G DI+ NNLPQI+YEDE+HD+VVLASDSDL  A
Sbjct  422  DGKGRMHRFICETQNVTDLVTAILQRVGADIDRNNLPQIMYEDEEHDKVVLASDSDLQAA  481

Query  367  VEHARSAGWKGLRLHLDYSRTP-HLRRGSGSSTIEYAQTD  251
            + HA+ +GWKGLRLHL+Y   P  LRRGS S T+ +AQ D
Sbjct  482  IYHAKLSGWKGLRLHLEYLGAPSRLRRGSSSGTMGHAQAD  521



>ref|XP_011083634.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X1 [Sesamum indicum]
Length=556

 Score =   293 bits (750),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 180/220 (82%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++++PI+DALH MHDGKFLHLP+ D+DG V+ VVDVL+IT AA++TVG+TAGV+ 
Sbjct  307  NPECATIDSPIVDALHIMHDGKFLHLPVVDRDGQVITVVDVLNITHAAVATVGSTAGVSS  366

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E AN MMQ FWDSAMA++   ++E  SE SLK+ S+G ETG S+P PSS   +TFSFKI+
Sbjct  367  EAANMMMQNFWDSAMALTTDYEDETRSENSLKVPSDGGETGRSVPQPSSIASDTFSFKIQ  426

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGRMHRF  +T+N+TDL+TAILQR+G DI+ NNLPQI+YEDE+HD+VVLASDSDL  A
Sbjct  427  DGKGRMHRFICETQNVTDLVTAILQRVGADIDRNNLPQIMYEDEEHDKVVLASDSDLQAA  486

Query  367  VEHARSAGWKGLRLHLDYSRTP-HLRRGSGSSTIEYAQTD  251
            + HA+ +GWKGLRLHL+Y   P  LRRGS S T+ +AQ D
Sbjct  487  IYHAKLSGWKGLRLHLEYLGAPSRLRRGSSSGTMGHAQAD  526



>ref|XP_004297541.1| PREDICTED: CBS domain-containing protein CBSCBSPB4-like [Fragaria 
vesca subsp. vesca]
Length=554

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 184/219 (84%), Gaps = 3/219 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECASV+TPI+DALH MHDGKFLHLP+ D+DG VVAVVDV+HIT AA++TVGN+AGV+ 
Sbjct  301  NPECASVDTPIVDALHTMHDGKFLHLPVVDRDGAVVAVVDVIHITHAAVATVGNSAGVSN  360

Query  727  ETANTMMQKFWDSAMAISHHD-DEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E ANTMMQKFWDSAMA++  D DE+  SE SL+LASEG ET +S PFPS+   NTF+FK+
Sbjct  361  ENANTMMQKFWDSAMALTPTDEDEDCRSENSLRLASEGAETRVSHPFPSTVFPNTFAFKL  420

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D+KGRMHRFT + +++TDLIT+I+ R+G DI+ +NLPQILYEDEDHD+V+LASDSDL  
Sbjct  421  QDKKGRMHRFTCNIQSLTDLITSIIHRMGDDIDRHNLPQILYEDEDHDKVLLASDSDLAA  480

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSS--TIEYA  260
            AV+HAR  GWKGLRLHLD+S T   RR + ++  +++YA
Sbjct  481  AVDHARQVGWKGLRLHLDFSGTAGRRRKTTTAGGSVDYA  519



>ref|XP_011023987.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X2 [Populus euphratica]
Length=541

 Score =   291 bits (745),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 155/220 (70%), Positives = 181/220 (82%), Gaps = 2/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+++TPI+DALH MHDGKFLHLP+ D+DG +VAV+DV+ IT AA++TVG+ A  N 
Sbjct  293  NPECATIDTPIVDALHTMHDGKFLHLPVLDRDGNIVAVIDVIRITHAAVATVGSAAAANN  352

Query  727  ETANTMMQKFWDSAMAISHHDDEEMH-SEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            ETANTMMQKFWDSAMA+S +DDEE   SE SLKLASEG E G SL +PSS   N FSFKI
Sbjct  353  ETANTMMQKFWDSAMALSPNDDEEEAWSEGSLKLASEGTEAGRSLLYPSSVYPNVFSFKI  412

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED++GRMHRFT +TR++TD+IT+ILQRLG DIN NNLPQILYEDEDHD+VVLASDSDLIT
Sbjct  413  EDKRGRMHRFTCETRSLTDIITSILQRLGDDINCNNLPQILYEDEDHDKVVLASDSDLIT  472

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AVEHARSAG K LRLHLDY      R+GS S   +Y + D
Sbjct  473  AVEHARSAGLKSLRLHLDYP-GKRGRKGSRSEGFDYGEAD  511



>ref|XP_007038001.1| CBS / octicosapeptide/Phox/Bemp1 domains-containing protein isoform 
2 [Theobroma cacao]
 gb|EOY22502.1| CBS / octicosapeptide/Phox/Bemp1 domains-containing protein isoform 
2 [Theobroma cacao]
Length=544

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 185/223 (83%), Gaps = 4/223 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV---GNTAG  737
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG +VAVVDVLHIT AA++TV   G+T+G
Sbjct  292  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGEIVAVVDVLHITHAAVATVSQVGSTSG  351

Query  736  VNEETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
            +N E   TMMQKFWDSAMA+  + DD+E  S+ SLKLAS+G ET  SLP+PSS++ NTF 
Sbjct  352  INNEATTTMMQKFWDSAMALPPNEDDDETRSDNSLKLASDGGETARSLPYPSSSMPNTFG  411

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FKI+D+KGRMHRFT DTR+MTDLITAILQRL  DI+ +++PQILYEDEDHD+VVL+SD+D
Sbjct  412  FKIQDKKGRMHRFTCDTRSMTDLITAILQRLEDDIDRDSVPQILYEDEDHDKVVLSSDND  471

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            L  AV+HA+  GWKGLRLHLDYS     RRGS S +++YA +D
Sbjct  472  LSAAVQHAKLVGWKGLRLHLDYSGKQGRRRGSSSGSLDYAHSD  514



>ref|XP_006341908.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Solanum 
tuberosum]
Length=546

 Score =   290 bits (743),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 145/214 (68%), Positives = 173/214 (81%), Gaps = 0/214 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+ +T I+DALH MHDGKFLHLP+ DKDG+VVAVVDVLHIT AA++TVGNT+GVN 
Sbjct  300  NPECATTDTSIVDALHTMHDGKFLHLPVIDKDGIVVAVVDVLHITHAAVATVGNTSGVNN  359

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E ANT MQKFWDSAM +   D+EE  S +SLKLASEG E   S+ +PSS+L NTF+FKI+
Sbjct  360  EVANTRMQKFWDSAMELCPDDEEETRSISSLKLASEGAELRRSISYPSSSLPNTFAFKIQ  419

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DR G MHRF  +  +M DLITAI QR+G DI  NNLPQILYEDEDHD+VVLA++SDL  A
Sbjct  420  DRTGSMHRFNCNIGSMRDLITAIFQRVGDDIKRNNLPQILYEDEDHDKVVLATESDLTAA  479

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIE  266
            V+HAR AGWKGLRLHLDYS     R+GS S++++
Sbjct  480  VDHARCAGWKGLRLHLDYSGKHGRRKGSSSNSLD  513



>ref|XP_004252206.2| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X2 [Solanum lycopersicum]
Length=538

 Score =   288 bits (738),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/214 (67%), Positives = 171/214 (80%), Gaps = 0/214 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+ +T I+DALH MHDGKFLHLP+ DKDG++VAVVDVLHIT AA++TVGNT+GVN 
Sbjct  292  NPECATTDTSIVDALHTMHDGKFLHLPVIDKDGILVAVVDVLHITHAAVATVGNTSGVNN  351

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E ANT +QKFWDSAM +S  D EE  S  SLK ASEG E    + +PSS+L NTF+FKI+
Sbjct  352  EAANTRIQKFWDSAMELSPDDGEETRSICSLKFASEGAELRRCISYPSSSLSNTFAFKIQ  411

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DR GRMHRF  +  +M DLITAI+QR+G DI   NLPQILYEDEDHD+VVLA++SDL  A
Sbjct  412  DRTGRMHRFNCNIGSMRDLITAIIQRVGDDIKRKNLPQILYEDEDHDKVVLATESDLTAA  471

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIE  266
            VEHAR AGWKGLRLHLDYS     R+GS S++++
Sbjct  472  VEHARCAGWKGLRLHLDYSGKHGCRKGSRSNSLD  505



>gb|KHG07436.1| CBS domain-containing CBSCBSPB5 -like protein [Gossypium arboreum]
Length=540

 Score =   287 bits (734),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 178/220 (81%), Gaps = 2/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+++TPI+ ALH MHDG FLHLP+ D+DG +V++VDV+ +T AA++TVG   GVN 
Sbjct  292  NPECATLDTPIVSALHTMHDGNFLHLPVLDRDGELVSIVDVIEVTHAAVATVGKNFGVNN  351

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E A+TM+QKFWDSAMA+   +DE+  + +SLKLASE  ET  SLP+PSS    TF FKI+
Sbjct  352  EAASTMVQKFWDSAMALPPIEDED-ETRSSLKLASEAAETERSLPYPSSNFPFTFGFKIQ  410

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DR GRMHRFTSDTR++TDLITA+LQRLG D + +++PQILYEDEDHD+VVLASD+DL  A
Sbjct  411  DRMGRMHRFTSDTRSLTDLITAVLQRLGDDRDRDSVPQILYEDEDHDKVVLASDNDLQVA  470

Query  367  VEHARSAGWKGLRLHLDYSRTP-HLRRGSGSSTIEYAQTD  251
            VEHA+S G KGLRLHLDYS T  H RRGSGS  ++YA +D
Sbjct  471  VEHAKSVGLKGLRLHLDYSGTKDHRRRGSGSGCMDYANSD  510



>ref|XP_011023986.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X1 [Populus euphratica]
Length=544

 Score =   286 bits (732),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 181/223 (81%), Gaps = 5/223 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV---GNTAG  737
            NPECA+++TPI+DALH MHDGKFLHLP+ D+DG +VAV+DV+ IT AA++TV   G+ A 
Sbjct  293  NPECATIDTPIVDALHTMHDGKFLHLPVLDRDGNIVAVIDVIRITHAAVATVSQVGSAAA  352

Query  736  VNEETANTMMQKFWDSAMAISHHDDEEMH-SEASLKLASEGQETGISLPFPSSTLQNTFS  560
             N ETANTMMQKFWDSAMA+S +DDEE   SE SLKLASEG E G SL +PSS   N FS
Sbjct  353  ANNETANTMMQKFWDSAMALSPNDDEEEAWSEGSLKLASEGTEAGRSLLYPSSVYPNVFS  412

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FKIED++GRMHRFT +TR++TD+IT+ILQRLG DIN NNLPQILYEDEDHD+VVLASDSD
Sbjct  413  FKIEDKRGRMHRFTCETRSLTDIITSILQRLGDDINCNNLPQILYEDEDHDKVVLASDSD  472

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            LITAVEHARSAG K LRLHLDY      R+GS S   +Y + D
Sbjct  473  LITAVEHARSAGLKSLRLHLDYP-GKRGRKGSRSEGFDYGEAD  514



>ref|NP_001141602.1| uncharacterized protein LOC100273720 [Zea mays]
 gb|ACF86705.1| unknown [Zea mays]
 gb|AFW84128.1| hypothetical protein ZEAMMB73_744710 [Zea mays]
Length=357

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 171/220 (78%), Gaps = 5/220 (2%)
 Frame = -2

Query  904  PECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNEE  725
            PECASV+TPILDALH MHDGKFLHLP+ D+DG VV VVDVLHIT AAI+TVGN+     E
Sbjct  112  PECASVDTPILDALHTMHDGKFLHLPVLDRDGNVVTVVDVLHITHAAIATVGNSGAAGSE  171

Query  724  TANTMMQKFWDSAMAISHHDDEE--MHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            + + MMQ+FWDSAM+I   DD++    SE S K+ASE  + G S  FP+S L NTF FKI
Sbjct  172  STSAMMQRFWDSAMSIGPLDDDDDSTRSEGSTKVASEAADIGRSALFPASALSNTFGFKI  231

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRF  +T ++TDLIT+ILQR+G DI+  +LPQILYEDEDHD+V+L+SDSDLI 
Sbjct  232  QDKQGRMHRFNCETSSLTDLITSILQRVGDDIDRKHLPQILYEDEDHDKVILSSDSDLIA  291

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR  GWK LRLHLDY+R    +RG GSS  EYA  D
Sbjct  292  AVDHARQIGWKSLRLHLDYARR---KRGDGSSDFEYAGKD  328



>gb|EYU43042.1| hypothetical protein MIMGU_mgv1a003842mg [Erythranthe guttata]
Length=560

 Score =   285 bits (728),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 180/221 (81%), Gaps = 5/221 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++++PI+DALH MHDGKFLHLP+ DKDG +VAV+DVLHIT++A++TVGN+ G N 
Sbjct  312  NPECATLDSPIVDALHTMHDGKFLHLPVIDKDGTIVAVIDVLHITQSAVATVGNSGGGNS  371

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPF-PSSTLQNTFSFKI  551
            E+AN +MQ FWDSAMA++  D+EE  SE SLK+ S+  ETG S+P  PS T  NTFSFKI
Sbjct  372  ESANMLMQSFWDSAMALTPDDEEETLSENSLKMPSDVGETGRSIPQQPSLTTSNTFSFKI  431

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +DRKGRMHRF SDT+N+T+LITAILQR+G +I+ NN PQI+YEDED+D+VVLASDSDL  
Sbjct  432  QDRKGRMHRFISDTQNVTELITAILQRIGAEIDRNNPPQIVYEDEDNDKVVLASDSDLQA  491

Query  370  AVEHARSAGWKGLRLHLDY-SRTPHLRRGSGSSTIEYAQTD  251
            AV HA+ AGWKGLRLHLDY    P  R+G   S +EYA+ D
Sbjct  492  AVYHAKLAGWKGLRLHLDYLGGLPRNRKG---SKMEYAEGD  529



>ref|XP_002318739.2| hypothetical protein POPTR_0012s10140g [Populus trichocarpa]
 gb|EEE96959.2| hypothetical protein POPTR_0012s10140g [Populus trichocarpa]
Length=547

 Score =   284 bits (727),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 181/226 (80%), Gaps = 8/226 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+++TPI+DALH MHDGKFLHLP+ D+DG +VAV+DV+HIT AA++TVGN  G N 
Sbjct  293  NPECATIDTPIVDALHTMHDGKFLHLPVVDRDGNIVAVIDVIHITHAAVATVGNATGANN  352

Query  727  ETANTMMQKFWDSAMAISHHDDEE-------MHSEASLKLASEGQETGISLPFPSSTLQN  569
            ETA+TMMQKFWDSAMA+S +DDE+       +    S  L S    T  SL +PSS L N
Sbjct  353  ETASTMMQKFWDSAMAMSPNDDEDETRRLDVLVLILSKILISSTGFTYTSLLYPSSGLPN  412

Query  568  TFSFKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLAS  389
             FSFKIED+KGRMHRFT +TR++TDLIT+ILQRLG DIN NNLPQILYEDEDHD+VVLAS
Sbjct  413  NFSFKIEDKKGRMHRFTCETRSLTDLITSILQRLGDDINRNNLPQILYEDEDHDKVVLAS  472

Query  388  DSDLITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            DSDL TAVEHARSAG KGLRLHLDY+ T   RRGS S +++YAQ D
Sbjct  473  DSDLTTAVEHARSAGLKGLRLHLDYTGT-RRRRGSSSESLDYAQAD  517



>ref|XP_010314158.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X1 [Solanum lycopersicum]
Length=539

 Score =   284 bits (726),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 143/215 (67%), Positives = 171/215 (80%), Gaps = 1/215 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+ +T I+DALH MHDGKFLHLP+ DKDG++VAVVDVLHIT AA++TVGNT+GVN 
Sbjct  292  NPECATTDTSIVDALHTMHDGKFLHLPVIDKDGILVAVVDVLHITHAAVATVGNTSGVNN  351

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E ANT +QKFWDSAM +S  D EE  S  SLK ASEG E    + +PSS+L NTF+FKI+
Sbjct  352  EAANTRIQKFWDSAMELSPDDGEETRSICSLKFASEGAELRRCISYPSSSLSNTFAFKIQ  411

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DR GRMHRF  +  +M DLITAI+QR+G DI   NLPQILYEDEDHD+VVLA++SDL  A
Sbjct  412  DRTGRMHRFNCNIGSMRDLITAIIQRVGDDIKRKNLPQILYEDEDHDKVVLATESDLTAA  471

Query  367  VEHARSAGWK-GLRLHLDYSRTPHLRRGSGSSTIE  266
            VEHAR AGWK GLRLHLDYS     R+GS S++++
Sbjct  472  VEHARCAGWKQGLRLHLDYSGKHGCRKGSRSNSLD  506



>gb|KEH21022.1| CBS/octicosapeptide/phox/Bemp1 (PB1) domain protein [Medicago 
truncatula]
Length=534

 Score =   280 bits (715),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 188/226 (83%), Gaps = 11/226 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAIST---VGNTAG  737
            NPECA ++TPI+DALH MH+GKFLHLP+ D+DG+VVA VDV++IT AA++T   VGNTA 
Sbjct  284  NPECAIIDTPIVDALHIMHNGKFLHLPVVDRDGIVVATVDVINITHAAVATASQVGNTAN  343

Query  736  VNEETANTMMQKFWDSAMAISHHDDEE-MHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
            +N ETAN+M+QKFWDSAMA++ +++EE   S+ SLK+ SEG ETG S+P+ +S++Q TFS
Sbjct  344  LNNETANSMIQKFWDSAMALTSNEEEEDSQSDISLKMISEGGETGRSIPYNASSVQTTFS  403

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++D+KGR+HRFT DTR+++++IT+I+QR+G DI+ NNLP ILYEDE+HDQVVLASDSD
Sbjct  404  FKLQDKKGRLHRFTCDTRSLSEIITSIIQRVGDDIDPNNLPHILYEDEEHDQVVLASDSD  463

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSST---IEYAQTD  251
            L  AV+HA++AG KGLRLHLDYS T    RG G+     +EYA+++
Sbjct  464  LAAAVDHAKTAGLKGLRLHLDYSGT----RGYGTEANLGLEYAESE  505



>ref|XP_004503747.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X2 [Cicer arietinum]
Length=532

 Score =   280 bits (715),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 178/223 (80%), Gaps = 4/223 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAIST---VGNTAG  737
            NPECA ++TPI+DALH MH+G FLHLP+ D+DG+VVA VDV+HIT AA+ T   VGNT  
Sbjct  282  NPECAVIDTPIVDALHIMHNGNFLHLPVVDRDGIVVATVDVIHITHAAVVTASQVGNTVN  341

Query  736  VNEETANTMMQKFWDSAMAISHHDDEE-MHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
            +N E ANTMMQKFWDSAMA++ +D+EE + SE SLK+ SEG +TG S+P+  S++Q  FS
Sbjct  342  LNNEAANTMMQKFWDSAMALTANDEEEDLQSETSLKMISEGGDTGRSIPYNPSSMQTAFS  401

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++D+KGR+HRFT DTR++T++IT+I+QR G DI+  NLPQILYEDE+HDQVVLASDSD
Sbjct  402  FKLQDKKGRLHRFTCDTRSLTEVITSIVQRAGDDIDPKNLPQILYEDEEHDQVVLASDSD  461

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            L  AV+HA++ G KGLRLHLDYS T      S   ++EYA ++
Sbjct  462  LAAAVDHAKTTGLKGLRLHLDYSGTCGYGTESSLRSLEYANSE  504



>ref|XP_008654600.1| PREDICTED: uncharacterized protein LOC100273720 isoform X1 [Zea 
mays]
 gb|AFW84129.1| hypothetical protein ZEAMMB73_744710 [Zea mays]
Length=545

 Score =   280 bits (715),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 171/220 (78%), Gaps = 5/220 (2%)
 Frame = -2

Query  904  PECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNEE  725
            PECASV+TPILDALH MHDGKFLHLP+ D+DG VV VVDVLHIT AAI+TVGN+     E
Sbjct  300  PECASVDTPILDALHTMHDGKFLHLPVLDRDGNVVTVVDVLHITHAAIATVGNSGAAGSE  359

Query  724  TANTMMQKFWDSAMAISHHDDEE--MHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            + + MMQ+FWDSAM+I   DD++    SE S K+ASE  + G S  FP+S L NTF FKI
Sbjct  360  STSAMMQRFWDSAMSIGPLDDDDDSTRSEGSTKVASEAADIGRSALFPASALSNTFGFKI  419

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRF  +T ++TDLIT+ILQR+G DI+  +LPQILYEDEDHD+V+L+SDSDLI 
Sbjct  420  QDKQGRMHRFNCETSSLTDLITSILQRVGDDIDRKHLPQILYEDEDHDKVILSSDSDLIA  479

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR  GWK LRLHLDY+R    +RG GSS  EYA  D
Sbjct  480  AVDHARQIGWKSLRLHLDYARR---KRGDGSSDFEYAGKD  516



>ref|XP_004503746.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X1 [Cicer arietinum]
Length=543

 Score =   279 bits (713),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 178/223 (80%), Gaps = 4/223 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAIST---VGNTAG  737
            NPECA ++TPI+DALH MH+G FLHLP+ D+DG+VVA VDV+HIT AA+ T   VGNT  
Sbjct  293  NPECAVIDTPIVDALHIMHNGNFLHLPVVDRDGIVVATVDVIHITHAAVVTASQVGNTVN  352

Query  736  VNEETANTMMQKFWDSAMAISHHDDEE-MHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
            +N E ANTMMQKFWDSAMA++ +D+EE + SE SLK+ SEG +TG S+P+  S++Q  FS
Sbjct  353  LNNEAANTMMQKFWDSAMALTANDEEEDLQSETSLKMISEGGDTGRSIPYNPSSMQTAFS  412

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++D+KGR+HRFT DTR++T++IT+I+QR G DI+  NLPQILYEDE+HDQVVLASDSD
Sbjct  413  FKLQDKKGRLHRFTCDTRSLTEVITSIVQRAGDDIDPKNLPQILYEDEEHDQVVLASDSD  472

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            L  AV+HA++ G KGLRLHLDYS T      S   ++EYA ++
Sbjct  473  LAAAVDHAKTTGLKGLRLHLDYSGTCGYGTESSLRSLEYANSE  515



>ref|XP_010545947.1| PREDICTED: CBS domain-containing protein CBSCBSPB1 [Tarenaya 
hassleriana]
Length=542

 Score =   278 bits (711),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 175/224 (78%), Gaps = 11/224 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLPI DK+G V AVVDV+HIT AA++  G+TA +  
Sbjct  295  NPECATVDTPIVDALHIMHDGKFLHLPILDKEGEVAAVVDVIHITHAAVAMAGSTAAITN  354

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  N+MMQKFWDSAMA+S + DD++  SE SLK+ASE  +TG S PF      NTFSFKI
Sbjct  355  EATNSMMQKFWDSAMALSPNDDDDDSRSEGSLKIASEA-DTGKSFPF-----SNTFSFKI  408

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+KGRMHRF +DT+++TD+ITAILQR+G DI+ +NLPQILYEDEDHD+V+LASDSDL+ 
Sbjct  409  EDKKGRMHRFITDTQSLTDVITAILQRVGDDIDPDNLPQILYEDEDHDKVLLASDSDLLA  468

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIE----YAQTD  251
            A++HARS GWKGLRLHLDY +    RR   S   E    Y Q D
Sbjct  469  AIDHARSIGWKGLRLHLDYPKNGIRRRRRASGLEESVDYYEQPD  512



>ref|XP_010926835.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X2 [Elaeis guineensis]
Length=401

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 172/220 (78%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC +V+TPI+DALH MHDGKFLHLP+ D+DG +V+V+DV+HIT AA++TVG+  G+  
Sbjct  152  NPECGTVDTPIVDALHTMHDGKFLHLPVVDRDGHIVSVMDVIHITHAAVATVGSGGGLGN  211

Query  727  ETANTMMQKFWDSAMAISHHD-DEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  +TM+QKFWDSAMAI   D D++  SE S+K++SE  +TG +  +P+S    TF FK+
Sbjct  212  EATSTMLQKFWDSAMAIGPLDNDDDSQSEGSIKVSSEATDTGRNAFYPASGPSTTFGFKL  271

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +DRKGRMHRF  +T+++TDLIT ILQR G DI+ NNLPQILYEDEDHD+V+LASD+DL  
Sbjct  272  QDRKGRMHRFNCETQSLTDLITCILQRAGDDIDRNNLPQILYEDEDHDKVILASDNDLAA  331

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR AGWK LRLHLD+S     ++G  S  ++YAQ D
Sbjct  332  AVDHARQAGWKSLRLHLDFSGLGRRKKGGESGGLDYAQRD  371



>ref|XP_006436857.1| hypothetical protein CICLE_v10031167mg [Citrus clementina]
 ref|XP_006493214.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Citrus 
sinensis]
 gb|ESR50097.1| hypothetical protein CICLE_v10031167mg [Citrus clementina]
Length=542

 Score =   275 bits (704),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 151/222 (68%), Positives = 181/222 (82%), Gaps = 3/222 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+++TPI+DALH MHDGKFLHLP+ D+DG VV VVDV+HIT AA++TVGNTAG N 
Sbjct  291  NPECATIDTPIVDALHIMHDGKFLHLPVVDRDGDVVDVVDVIHITHAAVATVGNTAGSNN  350

Query  727  ETANTMMQKFWDSAMAISHHDDEE-MHSEASLKLASEGQETG--ISLPFPSSTLQNTFSF  557
            E A+TMMQKFWDSAMA+S +DDEE   SE SLK ASEG +T   +S P PS  + + F+F
Sbjct  351  EAASTMMQKFWDSAMALSPNDDEEDNRSEGSLKFASEGADTARYLSYPSPSPGVPSAFAF  410

Query  556  KIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDL  377
            K++D+KG MHRFT D R++T+LITAILQR+G DI+ NNLP ILYEDEDHD+VVLASDSDL
Sbjct  411  KVQDKKGLMHRFTCDIRSLTELITAILQRVGDDIDRNNLPIILYEDEDHDKVVLASDSDL  470

Query  376  ITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
              AV+HARS GWKGLRLHLDY  T   RRGSGS +++YA  D
Sbjct  471  AAAVDHARSVGWKGLRLHLDYKGTGGRRRGSGSESLDYAHQD  512



>ref|XP_010926834.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X1 [Elaeis guineensis]
Length=540

 Score =   274 bits (700),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 172/220 (78%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC +V+TPI+DALH MHDGKFLHLP+ D+DG +V+V+DV+HIT AA++TVG+  G+  
Sbjct  291  NPECGTVDTPIVDALHTMHDGKFLHLPVVDRDGHIVSVMDVIHITHAAVATVGSGGGLGN  350

Query  727  ETANTMMQKFWDSAMAISHHD-DEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  +TM+QKFWDSAMAI   D D++  SE S+K++SE  +TG +  +P+S    TF FK+
Sbjct  351  EATSTMLQKFWDSAMAIGPLDNDDDSQSEGSIKVSSEATDTGRNAFYPASGPSTTFGFKL  410

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +DRKGRMHRF  +T+++TDLIT ILQR G DI+ NNLPQILYEDEDHD+V+LASD+DL  
Sbjct  411  QDRKGRMHRFNCETQSLTDLITCILQRAGDDIDRNNLPQILYEDEDHDKVILASDNDLAA  470

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR AGWK LRLHLD+S     ++G  S  ++YAQ D
Sbjct  471  AVDHARQAGWKSLRLHLDFSGLGRRKKGGESGGLDYAQRD  510



>ref|XP_006580610.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X5 [Glycine max]
Length=519

 Score =   272 bits (696),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 180/223 (81%), Gaps = 4/223 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAIST---VGNTAG  737
            NPEC +++TPI+DALH MHDGKFLHLP+ ++ G+VVA VDV+HIT AA++T   VGNT  
Sbjct  268  NPECGTIDTPIVDALHTMHDGKFLHLPVVNRGGIVVATVDVIHITHAAVATASQVGNTPN  327

Query  736  VNEETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
             N E AN+M+QKFWDSAMA++ + +DE+  SEASLK+ SEG ETG S+ + +S++QN FS
Sbjct  328  FNNEAANSMIQKFWDSAMALAPNEEDEDSQSEASLKMISEGGETGRSISYLTSSMQNVFS  387

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++DRKGR+HRFT DTR++ ++IT+I+QR+G DI+  NLPQILYEDED+D+VVLASDSD
Sbjct  388  FKLQDRKGRLHRFTCDTRSLAEVITSIVQRVGDDIDPMNLPQILYEDEDNDKVVLASDSD  447

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            L  AV+HA++AG KGLRLHLDYS T      S S + +YA ++
Sbjct  448  LAAAVDHAKTAGLKGLRLHLDYSGTHGYGTDSSSVSWKYANSE  490



>ref|XP_010550740.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like [Tarenaya 
hassleriana]
Length=540

 Score =   272 bits (696),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 179/225 (80%), Gaps = 12/225 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDG+FLHLPI DK+G VVAVVDV+HIT AAI+T G+TA V+ 
Sbjct  292  NPECATVDTPIVDALHIMHDGRFLHLPILDKEGNVVAVVDVIHITHAAIATAGSTAAVSN  351

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  NTMMQ+FWDSAMA+  + DD+E  SE SLK+ SE  +TG    FP     NTFSFKI
Sbjct  352  EATNTMMQRFWDSAMALPPNEDDDETRSEGSLKVVSEA-DTGKPFHFP-----NTFSFKI  405

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+KGRMHRF +DT+++TD+ITAILQR+G DI+ +NLP ILYEDEDHD+V+LASDSDL  
Sbjct  406  EDKKGRMHRFITDTQSLTDVITAILQRIGDDIDPDNLPYILYEDEDHDKVLLASDSDLQA  465

Query  370  AVEHARSAGWKGLRLHLDYSR----TPHLRRGSGS-STIEYAQTD  251
            A EHAR+ GWK LRLHLDYS+        RR SGS S+++Y+Q+D
Sbjct  466  ATEHARAIGWKSLRLHLDYSKEGRGGGRGRRASGSESSVDYSQSD  510



>ref|XP_010250674.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Nelumbo 
nucifera]
Length=540

 Score =   272 bits (695),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/220 (64%), Positives = 174/220 (79%), Gaps = 3/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP++D+DG +VAV+DVLHIT AAI+TVG+  G+  
Sbjct  295  NPECATVDTPIVDALHTMHDGKFLHLPVTDRDGSIVAVIDVLHITNAAIATVGSNGGIGN  354

Query  727  ETANTMMQKFWDSAMAI-SHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  +TMMQKFWDSAMA+ S  D+EE  SE S+KL SEG + G S  + S    NTFSFKI
Sbjct  355  EATSTMMQKFWDSAMALGSVEDEEETRSEGSIKLPSEGTDLGKST-YLSYAPPNTFSFKI  413

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+KGRMHRF  +T+++TD+I  ILQR+G DI+ N++PQILYEDEDHD+V+LASDSDL  
Sbjct  414  EDKKGRMHRFNCETQSLTDVIACILQRVGDDIDRNHVPQILYEDEDHDKVMLASDSDLGA  473

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR  G KGLRL+LDYS T   RR +GS ++ YA  D
Sbjct  474  AVDHARQTGMKGLRLYLDYSGTDDHRR-AGSGSLSYAHKD  512



>ref|XP_006580609.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X4 [Glycine max]
Length=545

 Score =   272 bits (695),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 180/223 (81%), Gaps = 4/223 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAIST---VGNTAG  737
            NPEC +++TPI+DALH MHDGKFLHLP+ ++ G+VVA VDV+HIT AA++T   VGNT  
Sbjct  294  NPECGTIDTPIVDALHTMHDGKFLHLPVVNRGGIVVATVDVIHITHAAVATASQVGNTPN  353

Query  736  VNEETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
             N E AN+M+QKFWDSAMA++ + +DE+  SEASLK+ SEG ETG S+ + +S++QN FS
Sbjct  354  FNNEAANSMIQKFWDSAMALAPNEEDEDSQSEASLKMISEGGETGRSISYLTSSMQNVFS  413

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++DRKGR+HRFT DTR++ ++IT+I+QR+G DI+  NLPQILYEDED+D+VVLASDSD
Sbjct  414  FKLQDRKGRLHRFTCDTRSLAEVITSIVQRVGDDIDPMNLPQILYEDEDNDKVVLASDSD  473

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            L  AV+HA++AG KGLRLHLDYS T      S S + +YA ++
Sbjct  474  LAAAVDHAKTAGLKGLRLHLDYSGTHGYGTDSSSVSWKYANSE  516



>gb|KHN23672.1| CBS domain-containing protein CBSCBSPB5 [Glycine soja]
Length=545

 Score =   271 bits (694),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 180/223 (81%), Gaps = 4/223 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAIST---VGNTAG  737
            NPEC +++TPI+DALH MHDGKFLHLP+ ++ G+VVA VDV+HIT AA++T   VGNT  
Sbjct  294  NPECGTIDTPIVDALHTMHDGKFLHLPVVNRGGIVVATVDVIHITHAAVATASQVGNTPN  353

Query  736  VNEETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
             N E AN+M+QKFWDSAMA++ + +DE+  SEASLK+ SEG ETG S+ + +S++QN FS
Sbjct  354  FNNEAANSMIQKFWDSAMALAPNEEDEDSQSEASLKMISEGGETGRSISYLTSSMQNVFS  413

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++DRKGR+HRFT DTR++ ++IT+I+QR+G DI+  NLPQILYEDED+D+VVLASDSD
Sbjct  414  FKLQDRKGRLHRFTCDTRSLAEVITSIVQRVGDDIDPMNLPQILYEDEDNDKVVLASDSD  473

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            L  AV+HA++AG KGLRLHLDYS T      S S + +YA ++
Sbjct  474  LAAAVDHAKTAGLKGLRLHLDYSGTHGYGTDSSSVSWKYANSE  516



>dbj|BAJ87164.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=550

 Score =   271 bits (693),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 171/220 (78%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA+++TPIL+ALH MHDGKFLHLP+ D+DG VV VVDVLHIT AAI+TVGN+     
Sbjct  302  SPECATIDTPILEALHTMHDGKFLHLPVLDRDGSVVTVVDVLHITHAAIATVGNSGATGS  361

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  ++MMQ+FWDSAM+     DD++  SE S K+ASE  + G S  FP+S L NTF FKI
Sbjct  362  EATSSMMQRFWDSAMSSGPLDDDDDSRSEGSTKVASEVADMGRSAFFPASGLSNTFGFKI  421

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRF  +T ++T+LIT+ILQRLG DI+ +NLPQILYED+DHD+V+L+SD+DLI 
Sbjct  422  QDKQGRMHRFNCETSSLTELITSILQRLGDDIDKSNLPQILYEDDDHDKVILSSDTDLIA  481

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR  GWK LRLHLDY+     +RGS SS  EYA  D
Sbjct  482  AVDHARQIGWKSLRLHLDYAGVGRRKRGSVSSDFEYAGRD  521



>ref|XP_006580608.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X3 [Glycine max]
Length=586

 Score =   272 bits (695),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 180/223 (81%), Gaps = 4/223 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAIST---VGNTAG  737
            NPEC +++TPI+DALH MHDGKFLHLP+ ++ G+VVA VDV+HIT AA++T   VGNT  
Sbjct  335  NPECGTIDTPIVDALHTMHDGKFLHLPVVNRGGIVVATVDVIHITHAAVATASQVGNTPN  394

Query  736  VNEETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
             N E AN+M+QKFWDSAMA++ + +DE+  SEASLK+ SEG ETG S+ + +S++QN FS
Sbjct  395  FNNEAANSMIQKFWDSAMALAPNEEDEDSQSEASLKMISEGGETGRSISYLTSSMQNVFS  454

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++DRKGR+HRFT DTR++ ++IT+I+QR+G DI+  NLPQILYEDED+D+VVLASDSD
Sbjct  455  FKLQDRKGRLHRFTCDTRSLAEVITSIVQRVGDDIDPMNLPQILYEDEDNDKVVLASDSD  514

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            L  AV+HA++AG KGLRLHLDYS T      S S + +YA ++
Sbjct  515  LAAAVDHAKTAGLKGLRLHLDYSGTHGYGTDSSSVSWKYANSE  557



>ref|XP_006578708.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like [Glycine 
max]
 gb|KHN23976.1| CBS domain-containing protein CBSCBSPB5 [Glycine soja]
Length=619

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 139/216 (64%), Positives = 175/216 (81%), Gaps = 3/216 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC  ++TPI+DALH MHDGKFLHLP+ D+DG VVAVVDV+H+T AA++TV      N 
Sbjct  376  NPECVIIDTPIVDALHTMHDGKFLHLPVVDRDGSVVAVVDVIHVTHAAVATVSQVG--NN  433

Query  727  ETANTMMQKFWDSAMAISHHDDEE-MHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A T+MQ+FWDSAMA++ +DD++   SE SLK+ASEG ETG S+P+ SS++ NTFSFKI
Sbjct  434  EAATTLMQRFWDSAMALTPNDDDDDTRSEGSLKVASEGGETGRSIPYLSSSIANTFSFKI  493

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D+KGRMHRFT DTR+M ++IT+ILQRLG DI+ NN+PQILYEDEDHD+VVLASDSDL  
Sbjct  494  QDKKGRMHRFTCDTRSMMEVITSILQRLGDDIDPNNIPQILYEDEDHDKVVLASDSDLAA  553

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEY  263
            AV+HAR+AG KGL+LHLDY+      +GS S +  Y
Sbjct  554  AVDHARTAGLKGLKLHLDYAGPRDNVKGSRSGSYAY  589



>ref|XP_006580607.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X2 [Glycine max]
Length=594

 Score =   271 bits (694),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 180/223 (81%), Gaps = 4/223 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAIST---VGNTAG  737
            NPEC +++TPI+DALH MHDGKFLHLP+ ++ G+VVA VDV+HIT AA++T   VGNT  
Sbjct  343  NPECGTIDTPIVDALHTMHDGKFLHLPVVNRGGIVVATVDVIHITHAAVATASQVGNTPN  402

Query  736  VNEETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
             N E AN+M+QKFWDSAMA++ + +DE+  SEASLK+ SEG ETG S+ + +S++QN FS
Sbjct  403  FNNEAANSMIQKFWDSAMALAPNEEDEDSQSEASLKMISEGGETGRSISYLTSSMQNVFS  462

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++DRKGR+HRFT DTR++ ++IT+I+QR+G DI+  NLPQILYEDED+D+VVLASDSD
Sbjct  463  FKLQDRKGRLHRFTCDTRSLAEVITSIVQRVGDDIDPMNLPQILYEDEDNDKVVLASDSD  522

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            L  AV+HA++AG KGLRLHLDYS T      S S + +YA ++
Sbjct  523  LAAAVDHAKTAGLKGLRLHLDYSGTHGYGTDSSSVSWKYANSE  565



>ref|XP_006580606.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X1 [Glycine max]
Length=597

 Score =   271 bits (693),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 180/223 (81%), Gaps = 4/223 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAIST---VGNTAG  737
            NPEC +++TPI+DALH MHDGKFLHLP+ ++ G+VVA VDV+HIT AA++T   VGNT  
Sbjct  346  NPECGTIDTPIVDALHTMHDGKFLHLPVVNRGGIVVATVDVIHITHAAVATASQVGNTPN  405

Query  736  VNEETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
             N E AN+M+QKFWDSAMA++ + +DE+  SEASLK+ SEG ETG S+ + +S++QN FS
Sbjct  406  FNNEAANSMIQKFWDSAMALAPNEEDEDSQSEASLKMISEGGETGRSISYLTSSMQNVFS  465

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++DRKGR+HRFT DTR++ ++IT+I+QR+G DI+  NLPQILYEDED+D+VVLASDSD
Sbjct  466  FKLQDRKGRLHRFTCDTRSLAEVITSIVQRVGDDIDPMNLPQILYEDEDNDKVVLASDSD  525

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            L  AV+HA++AG KGLRLHLDYS T      S S + +YA ++
Sbjct  526  LAAAVDHAKTAGLKGLRLHLDYSGTHGYGTDSSSVSWKYANSE  568



>gb|EAY77028.1| hypothetical protein OsI_04983 [Oryza sativa Indica Group]
 gb|EAZ14668.1| hypothetical protein OsJ_04591 [Oryza sativa Japonica Group]
Length=497

 Score =   268 bits (686),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 161/200 (81%), Gaps = 1/200 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
             PECA+V+TPILDALH MHDGKFLHLP+ DKDG VV VVDVLHIT AAI+TVGN+AG   
Sbjct  248  TPECATVDTPILDALHTMHDGKFLHLPVLDKDGNVVTVVDVLHITHAAIATVGNSAGSGS  307

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  + MMQ+FWDSAM+I    DD++  SE S K+ASE  + G S  +P+S L NTF FKI
Sbjct  308  EATSAMMQRFWDSAMSIGPLDDDDDSRSEGSTKVASEATDVGRSAFYPASGLSNTFGFKI  367

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRF  +T ++T+LIT+ILQRLG DI+  NLPQILYEDEDHD+V+L+SDSDL+ 
Sbjct  368  QDKQGRMHRFNCETSSLTELITSILQRLGDDIDRKNLPQILYEDEDHDKVILSSDSDLVA  427

Query  370  AVEHARSAGWKGLRLHLDYS  311
            AV+HAR  GWK L+LHLDY+
Sbjct  428  AVDHARQIGWKSLKLHLDYA  447



>ref|XP_008392806.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like, partial 
[Malus domestica]
Length=355

 Score =   263 bits (671),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 167/202 (83%), Gaps = 1/202 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLH+P+ D+DG VVAVVDV+HIT AA++TVGNTA  + 
Sbjct  104  NPECATVDTPIVDALHTMHDGKFLHIPVLDRDGAVVAVVDVIHITHAAVATVGNTAXASN  163

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A  MMQKFWDSAMA+S + DD+E  S  SL  ASE   TG SLPFP S   NTF+FK+
Sbjct  164  EAATNMMQKFWDSAMALSPNDDDDESRSXXSLXXASESAVTGRSLPFPPSNFPNTFAFKL  223

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRFT + +N+T+LIT+I+QR+G DI+ NNLPQILYEDED D+V+LASDSDL+ 
Sbjct  224  QDKRGRMHRFTCNIQNLTELITSIIQRMGDDIDRNNLPQILYEDEDRDKVILASDSDLVA  283

Query  370  AVEHARSAGWKGLRLHLDYSRT  305
            AV+HA+  GWKGLRLHLDYS T
Sbjct  284  AVDHAKQVGWKGLRLHLDYSGT  305



>ref|XP_003602797.1| Meiotically up-regulated gene 70 protein [Medicago truncatula]
 gb|AES73048.1| CBS/octicosapeptide/phox/Bemp1 (PB1) domain protein [Medicago 
truncatula]
Length=528

 Score =   268 bits (685),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 178/220 (81%), Gaps = 3/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC  ++TPI+DALH MHDGKFLHLP+ D+DG+VVAVVDV+H+T AA++TV      N 
Sbjct  283  NPECVIIDTPIVDALHTMHDGKFLHLPVVDRDGIVVAVVDVIHVTHAAVATVSQVG--NN  340

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E + T+MQ+FWDSAMA+  + DD+E  SE+S K+ S+G ETG S+P+ S+++ NTFSFK+
Sbjct  341  EASTTLMQRFWDSAMALPPNDDDDETRSESSFKIGSDGGETGRSIPYISASMPNTFSFKV  400

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D+KGRMHRFT DTR+MT++I++ILQRLG DI+ NNLP ILYEDEDHD+VVLASDSDL  
Sbjct  401  QDKKGRMHRFTCDTRSMTEVISSILQRLGTDIDPNNLPHILYEDEDHDKVVLASDSDLAA  460

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR+ G KGL+L+LDY  T   R+GS S ++E A +D
Sbjct  461  AVDHARTVGLKGLKLYLDYEGTRGHRKGSRSGSLENAYSD  500



>gb|EMS59026.1| Meiotically up-regulated gene 70 protein [Triticum urartu]
Length=520

 Score =   267 bits (683),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 168/220 (76%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA+++TPIL+ALH MHDGKFLHLP+ D+DG VV VVDVLHIT AAI+TVGN+     
Sbjct  272  SPECATIDTPILEALHTMHDGKFLHLPVLDRDGSVVTVVDVLHITHAAIATVGNSGATGS  331

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  ++MMQ+FWDSAM+     DD++  SE S K+ASE  + G S  FP S L NTF FKI
Sbjct  332  EATSSMMQRFWDSAMSSGPLDDDDDSRSEGSTKVASEAADIGRSAFFPPSGLSNTFGFKI  391

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRF  +T ++ +LIT+ILQRLG DI+  NLPQILYED+DHD+V+L+SD+DLI 
Sbjct  392  QDKQGRMHRFNCETSSLAELITSILQRLGDDIDKLNLPQILYEDDDHDKVILSSDTDLIA  451

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR  GWK LRLHLDY+     +RG+ SS  EYA  D
Sbjct  452  AVDHARQIGWKSLRLHLDYAGVGRRKRGAVSSDFEYAGRD  491



>gb|AFK45149.1| unknown [Medicago truncatula]
Length=528

 Score =   268 bits (684),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 136/220 (62%), Positives = 178/220 (81%), Gaps = 3/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC  ++TPI+DALH MHDGKFLHLP+ D+DG+VVAVVDV+H+T AA++TV      N 
Sbjct  283  NPECVIIDTPIVDALHTMHDGKFLHLPVIDRDGIVVAVVDVIHVTHAAVATVSQVG--NN  340

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E + T+MQ+FWDSAMA+  + DD+E  SE+S K+ S+G ETG S+P+ S+++ NTFSFK+
Sbjct  341  EASTTLMQRFWDSAMALPPNDDDDETRSESSFKIGSDGGETGRSIPYISASMPNTFSFKV  400

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D+KGRMHRFT DTR+MT++I++ILQRLG DI+ NNLP ILYEDEDHD+VVLASDSDL  
Sbjct  401  QDKKGRMHRFTCDTRSMTEVISSILQRLGTDIDPNNLPHILYEDEDHDKVVLASDSDLAA  460

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR+ G KGL+L+LDY  T   R+GS S ++E A +D
Sbjct  461  AVDHARTVGLKGLKLYLDYEGTRGHRKGSRSGSLENAYSD  500



>ref|XP_008806421.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X4 [Phoenix dactylifera]
Length=401

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 172/220 (78%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC +V+TPI+D LH MHDGKFLHLP+ D+DG +V+V+DV+H+TRAA++TVG++ GV  
Sbjct  152  NPECGTVDTPIVDVLHTMHDGKFLHLPVVDRDGYIVSVMDVIHMTRAAVATVGSSGGVGN  211

Query  727  ETANTMMQKFWDSAMAISHHDDEEM-HSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  +TMMQKF DSAMAI   DD++   SE S+K+ASE  +TG +  +P+S     F FK+
Sbjct  212  EATSTMMQKFLDSAMAIGLLDDDDDSRSEGSIKVASEVTDTGRNTFYPASGSSTIFGFKL  271

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +DRKGRMHRF  +T+++TDLIT ILQR+G DI+ NNLPQI YEDEDHD+V+LASD+DL T
Sbjct  272  QDRKGRMHRFNCETQSLTDLITCILQRVGDDIDRNNLPQISYEDEDHDKVILASDNDLAT  331

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR AGWK LRLHL++S +   +RG  S  + +AQ D
Sbjct  332  AVDHARQAGWKSLRLHLEFSSSGRRKRGGESGGLVHAQRD  371



>ref|XP_006645249.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like [Oryza 
brachyantha]
Length=550

 Score =   267 bits (683),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 161/200 (81%), Gaps = 1/200 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA+V+TPILDALH MHDGKFLHLP+ DKDG VV VVDVLHIT AAI+TVGN+ G   
Sbjct  300  SPECATVDTPILDALHTMHDGKFLHLPVLDKDGNVVTVVDVLHITHAAIATVGNSTGTGS  359

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  + MMQ+FWDSAM+I    DD++  SE S K+ASE  + G S  +P+S L NTF FKI
Sbjct  360  EATSAMMQRFWDSAMSIGPLDDDDDSRSEGSTKVASEATDIGRSAFYPASGLSNTFGFKI  419

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRF  +T ++T+LIT+ILQRLG DI+  NLPQILYEDEDHD+V+L+SDSDL+ 
Sbjct  420  QDKQGRMHRFNCETSSLTELITSILQRLGDDIDRKNLPQILYEDEDHDKVILSSDSDLVA  479

Query  370  AVEHARSAGWKGLRLHLDYS  311
            AV+HAR  GWK LRLHLDY+
Sbjct  480  AVDHARQIGWKSLRLHLDYA  499



>ref|XP_002456864.1| hypothetical protein SORBIDRAFT_03g044210 [Sorghum bicolor]
 gb|EES01984.1| hypothetical protein SORBIDRAFT_03g044210 [Sorghum bicolor]
Length=547

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 169/220 (77%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA+V+ PILDALH MHDGKFLHLP+ D+DG VV VVDVLHIT AAI+TVGN+     
Sbjct  299  SPECATVDMPILDALHTMHDGKFLHLPVLDRDGNVVTVVDVLHITHAAIATVGNSGAAGS  358

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  + MMQ+FWDSAM+I    DD++  SE S K+ASE  + G S  FP+S L NTF FKI
Sbjct  359  EATSAMMQRFWDSAMSIGPLDDDDDSRSEGSTKVASEATDIGRSAFFPASGLSNTFGFKI  418

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRF  +T ++TDLIT+ILQR+G DI+  +LPQILYEDEDHD+V+L+SDSDLI 
Sbjct  419  QDKQGRMHRFNCETSSLTDLITSILQRVGDDIDRKHLPQILYEDEDHDKVILSSDSDLIA  478

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR  GWK LRLHLDY+     +RG GSS  EYA  D
Sbjct  479  AVDHARQIGWKSLRLHLDYAGVGRRKRGGGSSDFEYAGKD  518



>ref|XP_010913013.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X1 [Elaeis guineensis]
Length=533

 Score =   266 bits (681),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 174/220 (79%), Gaps = 3/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+T ILDALH MH+GKFLHLP+ D+DG +V++VDV+HIT AAI+TV +T GV  
Sbjct  286  NPECATVDTAILDALHTMHNGKFLHLPVVDRDGKIVSIVDVIHITHAAIATVESTGGVGN  345

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E   +MMQKFWDSAMA+    DD++  SE S+K+ASEG +  +  P PSS++  TF+FK+
Sbjct  346  EATISMMQKFWDSAMALGPSDDDDDARSEISIKIASEGTDM-VGSPDPSSSIPTTFAFKL  404

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            EDRKGRMHRF  DTR++T LIT+IL+R+G DI+ N+LPQILYEDED D+V+LASDSDL  
Sbjct  405  EDRKGRMHRFNCDTRSLTYLITSILRRVGDDIDRNHLPQILYEDEDRDKVILASDSDLAA  464

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR AGWKGLRL+LDY+     +RG  S +++YA  D
Sbjct  465  AVDHARLAGWKGLRLYLDYTGGGRKKRGR-SGSMDYANMD  503



>emb|CDM85799.1| unnamed protein product [Triticum aestivum]
Length=549

 Score =   267 bits (682),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 169/220 (77%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA+++TPIL+ALH MHDGKFLHLP+ D+DG VV VVDVLHIT AAI+TVGN+     
Sbjct  301  SPECATIDTPILEALHTMHDGKFLHLPVLDRDGSVVTVVDVLHITHAAIATVGNSGATGS  360

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  ++MMQ+FWDSAM+     DD++  SE S K+ASE  + G S  FP S L + F FKI
Sbjct  361  EATSSMMQRFWDSAMSSGPLDDDDDCRSEGSTKVASEAADIGRSAFFPPSGLSSPFGFKI  420

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRF  DT ++T+LIT+ILQRLG DI+ +NLPQILYED+DHD+V+L+SD+DLI 
Sbjct  421  QDKQGRMHRFNCDTSSLTELITSILQRLGDDIDKSNLPQILYEDDDHDKVILSSDTDLIA  480

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HA+  GWK LRLHLDY+     +RG+ SS  EYA  D
Sbjct  481  AVDHAKQIGWKSLRLHLDYAGVGRRKRGAVSSDFEYAGRD  520



>ref|XP_004501712.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Cicer 
arietinum]
Length=528

 Score =   266 bits (680),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 176/220 (80%), Gaps = 3/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA ++T I+DALH MHDGKFLHLP+ D+DG+VVAVVDV+H+T AA++TV      N 
Sbjct  283  NPECAVIDTAIVDALHTMHDGKFLHLPVVDRDGIVVAVVDVIHVTHAAVATVSQVG--NN  340

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A ++MQ+FWDSAM +    DD+E  SE+S K+ S+G +TG S+P+ S+ + NTFSFK+
Sbjct  341  EAATSLMQRFWDSAMTLPPTDDDDENRSESSCKIGSDGGDTGRSVPYISAGMPNTFSFKV  400

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D+KGRMHRFT DTR+MT++IT+ILQRLG DI+ NNLP ILYEDEDHD+VVLASDSDL  
Sbjct  401  QDKKGRMHRFTCDTRSMTEVITSILQRLGADIDPNNLPHILYEDEDHDKVVLASDSDLAA  460

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR+AG KGL+L+LDY  T   R+GS S ++E A TD
Sbjct  461  AVDHARTAGLKGLKLYLDYEGTGGHRKGSHSGSLELASTD  500



>gb|EMT21949.1| hypothetical protein F775_07841 [Aegilops tauschii]
Length=521

 Score =   266 bits (679),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 169/220 (77%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA+++TPIL+ALH MHDGKFLHLP+ D+DG VV VVDVLHIT AAI+TVGN+     
Sbjct  273  SPECATIDTPILEALHTMHDGKFLHLPVLDRDGSVVTVVDVLHITHAAIATVGNSGATGS  332

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  ++MMQ+FWDSAM+     DD++  SE S K+ASE  + G S  FP S L +TF FKI
Sbjct  333  EATSSMMQRFWDSAMSSGPLDDDDDSRSEGSTKVASEVADMGRSAFFPPSGLSSTFGFKI  392

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRF  +T ++T+LIT+ILQRLG DI+  NLPQILYED+DHD+V+L+SD+DLI 
Sbjct  393  QDKQGRMHRFNCETSSLTELITSILQRLGDDIDKLNLPQILYEDDDHDKVILSSDTDLIA  452

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR  GWK LRLHLDY+     +RG+ SS  EYA  D
Sbjct  453  AVDHARQIGWKSLRLHLDYAGVGRRKRGAVSSDFEYAGRD  492



>ref|XP_003564957.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like [Brachypodium 
distachyon]
Length=550

 Score =   266 bits (681),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 167/220 (76%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA+ +TPIL+ALH MHDGKFLHLP+ D DG VV V+DVLHIT AAI+TVGN+     
Sbjct  302  SPECATTDTPILEALHTMHDGKFLHLPVLDSDGNVVTVIDVLHITHAAIATVGNSGAAGS  361

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  ++MMQ+FWDSAM+     DD++  SE S K+ASE  + G S  +P+S L +TF FKI
Sbjct  362  EATSSMMQRFWDSAMSSGPLDDDDDSRSEGSTKVASEATDIGRSTFYPASGLSSTFGFKI  421

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRF  DT ++T+LIT+ILQRLG DI+  NLPQILYEDED D+V+L+SDSDLI 
Sbjct  422  QDKQGRMHRFNCDTSSLTELITSILQRLGDDIDKLNLPQILYEDEDRDKVILSSDSDLIA  481

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR  GWK LRLHLDY+     +R SGS+  EYA  D
Sbjct  482  AVDHARQIGWKSLRLHLDYAGVGRRKRTSGSTNFEYAGRD  521



>ref|XP_008806419.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X2 [Phoenix dactylifera]
Length=540

 Score =   265 bits (676),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 172/220 (78%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC +V+TPI+D LH MHDGKFLHLP+ D+DG +V+V+DV+H+TRAA++TVG++ GV  
Sbjct  291  NPECGTVDTPIVDVLHTMHDGKFLHLPVVDRDGYIVSVMDVIHMTRAAVATVGSSGGVGN  350

Query  727  ETANTMMQKFWDSAMAISHHDDEEM-HSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  +TMMQKF DSAMAI   DD++   SE S+K+ASE  +TG +  +P+S     F FK+
Sbjct  351  EATSTMMQKFLDSAMAIGLLDDDDDSRSEGSIKVASEVTDTGRNTFYPASGSSTIFGFKL  410

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +DRKGRMHRF  +T+++TDLIT ILQR+G DI+ NNLPQI YEDEDHD+V+LASD+DL T
Sbjct  411  QDRKGRMHRFNCETQSLTDLITCILQRVGDDIDRNNLPQISYEDEDHDKVILASDNDLAT  470

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR AGWK LRLHL++S +   +RG  S  + +AQ D
Sbjct  471  AVDHARQAGWKSLRLHLEFSSSGRRKRGGESGGLVHAQRD  510



>ref|XP_008806418.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X1 [Phoenix dactylifera]
Length=542

 Score =   265 bits (676),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 172/220 (78%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC +V+TPI+D LH MHDGKFLHLP+ D+DG +V+V+DV+H+TRAA++TVG++ GV  
Sbjct  293  NPECGTVDTPIVDVLHTMHDGKFLHLPVVDRDGYIVSVMDVIHMTRAAVATVGSSGGVGN  352

Query  727  ETANTMMQKFWDSAMAISHHDDEEM-HSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  +TMMQKF DSAMAI   DD++   SE S+K+ASE  +TG +  +P+S     F FK+
Sbjct  353  EATSTMMQKFLDSAMAIGLLDDDDDSRSEGSIKVASEVTDTGRNTFYPASGSSTIFGFKL  412

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +DRKGRMHRF  +T+++TDLIT ILQR+G DI+ NNLPQI YEDEDHD+V+LASD+DL T
Sbjct  413  QDRKGRMHRFNCETQSLTDLITCILQRVGDDIDRNNLPQISYEDEDHDKVILASDNDLAT  472

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR AGWK LRLHL++S +   +RG  S  + +AQ D
Sbjct  473  AVDHARQAGWKSLRLHLEFSSSGRRKRGGESGGLVHAQRD  512



>dbj|BAF02080.1| hypothetical protein [Arabidopsis thaliana]
Length=295

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 174/221 (79%), Gaps = 8/221 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE A+V+  I++ALH MH+GKFLHLP+ DKDG VVAV+DV+HIT AA++T G+TAG+N 
Sbjct  51   NPESATVDMAIVEALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAVTTAGSTAGINN  110

Query  727  ETANTMMQKFWDSAMAISHHDD--EEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFK  554
            ETAN+MMQKFWDSAMA+S ++D  E    E S+KL+SE + T  S  +P     NTF+FK
Sbjct  111  ETANSMMQKFWDSAMALSPNEDGDETRSEEESMKLSSEIEVTK-SFSYP-----NTFAFK  164

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            ++D+KGRMHRF  +T+++T LITAILQR+G DI  +NLPQI+YEDED+D+VVLASD+DL 
Sbjct  165  LQDKKGRMHRFMCETQSLTTLITAILQRMGDDIEPDNLPQIMYEDEDNDKVVLASDNDLG  224

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
             AVEHA+S GWKGL+LHLDY+     RRG  S  ++Y Q++
Sbjct  225  AAVEHAKSIGWKGLKLHLDYTEERGHRRGLSSEDMDYDQSN  265



>dbj|BAC42522.1| unknown protein [Arabidopsis thaliana]
Length=295

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 174/221 (79%), Gaps = 8/221 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE A+V+  I++ALH MH+GKFLHLP+ DKDG VVAV+DV+HIT AA++T G+TAG+N 
Sbjct  51   NPESATVDMAIVEALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAVTTAGSTAGINN  110

Query  727  ETANTMMQKFWDSAMAISHHDD--EEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFK  554
            ETAN+MMQKFWDSAMA+S ++D  E    E S+KL+SE + T  S  +P     NTF+FK
Sbjct  111  ETANSMMQKFWDSAMALSPNEDGDETRSEEESMKLSSEIEVTK-SFSYP-----NTFAFK  164

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            ++D+KGRMHRF  +T+++T LITAILQR+G DI  +NLPQI+YEDED+D+VVLASD+DL 
Sbjct  165  LQDKKGRMHRFMCETQSLTTLITAILQRMGDDIEPDNLPQIMYEDEDNDKVVLASDNDLG  224

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
             AVEHA+S GWKGL+LHLDY+     RRG  S  ++Y Q++
Sbjct  225  AAVEHAKSIGWKGLKLHLDYTEERGHRRGLSSEDMDYDQSN  265



>ref|NP_001145822.1| uncharacterized protein LOC100279329 [Zea mays]
 gb|ACL52656.1| unknown [Zea mays]
Length=306

 Score =   256 bits (655),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 164/220 (75%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA+V+TPILDALH MHDGKFLHLP+ D+DG VV VVDVLHIT AAI+TVGN+     
Sbjct  57   SPECATVDTPILDALHTMHDGKFLHLPVLDRDGNVVTVVDVLHITHAAIATVGNSGAAGS  116

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  + MMQ+FWDSAM+I    DD++  SE S ++ SE  + G    FP+S L NTF FKI
Sbjct  117  EATSAMMQRFWDSAMSIGPIDDDDDSRSEGSTRVVSEATDIGRPAFFPASGLSNTFGFKI  176

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRF  +T  + +LIT+ILQR+G DI+  +LPQILYEDED D+VVL+SDSDLI 
Sbjct  177  QDKQGRMHRFNCETSGLAELITSILQRVGDDIDRKHLPQILYEDEDRDKVVLSSDSDLIA  236

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR  GWK +RLHLDY+     + G G S +EYA  D
Sbjct  237  AVDHARKIGWKSIRLHLDYAGVGRRKGGGGPSDLEYAGKD  276



>gb|EPS72476.1| hypothetical protein M569_02281, partial [Genlisea aurea]
Length=384

 Score =   259 bits (661),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 160/200 (80%), Gaps = 5/200 (3%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+VET I+DALH MHDGKFLHLP+ DKDG+VVAVVDVLHI  AA++TVGN A  N 
Sbjct  149  NPECATVETSIVDALHTMHDGKFLHLPVVDKDGIVVAVVDVLHIAHAAVATVGNAAAGNN  208

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASE--GQETGISLPFPSSTLQNTFSFK  554
            ET++ MMQ+FWDSAM ++  DD+E  SE S K+     G+    +LP P  T  NTF+FK
Sbjct  209  ETSSAMMQRFWDSAMDLNPEDDDESRSEKSSKMPPSDVGEH---NLPLPPPTTSNTFAFK  265

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            I+D++GRMHRF  DT+N++DLITAI+QR+G +I+ +NLPQI YEDEDHD+VV+ASD DL 
Sbjct  266  IQDKRGRMHRFLCDTQNLSDLITAIIQRVGDEIDRHNLPQIRYEDEDHDKVVVASDGDLQ  325

Query  373  TAVEHARSAGWKGLRLHLDY  314
             AV+HAR AGWKGLRLHLDY
Sbjct  326  AAVDHARQAGWKGLRLHLDY  345



>ref|XP_008798932.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like [Phoenix 
dactylifera]
Length=531

 Score =   261 bits (667),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 174/220 (79%), Gaps = 2/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA+V+TPILDALH M +GKFLHLP+ D+DG +V++VDV+ IT AA++TV +T GV  
Sbjct  286  SPECATVDTPILDALHIMQNGKFLHLPVVDRDGKIVSMVDVICITHAAVATVESTGGVGN  345

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E   +MMQKFWDSAMA+    DD++  SE S+K+ASEG +  +    PSS+L  TF+FK+
Sbjct  346  EATISMMQKFWDSAMALGPSDDDDDARSENSIKIASEGTDI-VGSSNPSSSLPTTFAFKL  404

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            EDRKGRMHRF  DTR++T LIT+ILQR+G DI+ N+LPQILYEDEDHD+V+LASDSDL  
Sbjct  405  EDRKGRMHRFNCDTRSLTYLITSILQRVGNDIDRNHLPQILYEDEDHDKVILASDSDLSA  464

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AVEHAR  GWKGLRL+LDY+ T   ++  GS +++YA TD
Sbjct  465  AVEHARLVGWKGLRLYLDYTGTGGRKKRGGSGSMDYANTD  504



>ref|XP_010037405.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW49111.1| hypothetical protein EUGRSUZ_K02712 [Eucalyptus grandis]
 gb|KCW49112.1| hypothetical protein EUGRSUZ_K02712 [Eucalyptus grandis]
Length=479

 Score =   259 bits (662),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 158/186 (85%), Gaps = 2/186 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG +VAVVDV+HIT AA++TVG++AGVN 
Sbjct  294  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGNIVAVVDVIHITHAAVATVGSSAGVNN  353

Query  727  ETANTMMQKFWDSAMAISHHDD-EEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A+TMMQKFWD+AMA S  DD EE  SE S+KL S+G + G SL + SST  N+F+FKI
Sbjct  354  EAASTMMQKFWDTAMAASPTDDEEEARSEGSMKLTSDGGDIGRSLSY-SSTQPNSFTFKI  412

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+KGRMHRF+ D ++MTD+IT+I+QR+G DI+ NNLPQILYEDEDHD+VVLASD DL  
Sbjct  413  EDKKGRMHRFSCDAQSMTDIITSIVQRVGDDIDRNNLPQILYEDEDHDKVVLASDGDLAA  472

Query  370  AVEHAR  353
            AVEHAR
Sbjct  473  AVEHAR  478



>gb|KHN16849.1| CBS domain-containing protein CBSCBSPB5 [Glycine soja]
Length=470

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 176/223 (79%), Gaps = 4/223 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAIST---VGNTAG  737
            NPEC +++TPI+DALH MHDG FLHL + ++DG+VVA VD +HIT AA++T   VGNT  
Sbjct  219  NPECGTIDTPIIDALHTMHDGNFLHLLVVNRDGIVVATVDAIHITHAAVATASQVGNTPN  278

Query  736  VNEETANTMMQKFWDSAMAISHHDDEE-MHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
             N E AN+M+QK WDSAMA++ +++EE   SE SLK+ SEG ETG S+ + +S++QN FS
Sbjct  279  FNNEAANSMIQKIWDSAMALAPNEEEEDSQSETSLKMISEGGETGRSISYLASSMQNAFS  338

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++DRKGR+HRFT DTR++ ++IT+++QR+G DI+  +LPQILYEDE++D+VVLASDSD
Sbjct  339  FKLQDRKGRLHRFTCDTRSLAEVITSVIQRVGDDIDPMDLPQILYEDEENDKVVLASDSD  398

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            L  AV+HA++AG KGLRLHLDYS T      S S + +YA ++
Sbjct  399  LAAAVDHAKTAGLKGLRLHLDYSGTHGYGTDSSSLSWKYANSE  441



>ref|XP_009410641.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=543

 Score =   258 bits (660),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 175/222 (79%), Gaps = 3/222 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC +++TPILDALH MHDGKFLHLP+ D+DG +V VVDV+HI  AAI+T G+++G   
Sbjct  292  NPECGTIDTPILDALHTMHDGKFLHLPVVDRDGNIVTVVDVIHIAHAAIATAGSSSGAGN  351

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            ETA+ MMQKFWDSA+++    DD++  SE S+K+ASE  +T  S  +P S L  TF FK+
Sbjct  352  ETASAMMQKFWDSALSLGPLDDDDDSRSEGSMKVASEATDTVRSAFYPPSGLSTTFGFKL  411

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED++GRMHRF  +T+++TDLIT ILQR+G DI+ N+LPQILYEDEDHD+V+LASDSDL  
Sbjct  412  EDKQGRMHRFNCETQSLTDLITCILQRVGDDIDRNHLPQILYEDEDHDKVILASDSDLAA  471

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLR--RGSGSSTIEYAQTD  251
            AV+HAR AGWK LRLHLDYS + + +  RGSGS+ +E+A  D
Sbjct  472  AVDHARQAGWKSLRLHLDYSGSGYRKKGRGSGSAGLEHAHKD  513



>ref|XP_009410642.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=538

 Score =   258 bits (659),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 175/222 (79%), Gaps = 3/222 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC +++TPILDALH MHDGKFLHLP+ D+DG +V VVDV+HI  AAI+T G+++G   
Sbjct  287  NPECGTIDTPILDALHTMHDGKFLHLPVVDRDGNIVTVVDVIHIAHAAIATAGSSSGAGN  346

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            ETA+ MMQKFWDSA+++    DD++  SE S+K+ASE  +T  S  +P S L  TF FK+
Sbjct  347  ETASAMMQKFWDSALSLGPLDDDDDSRSEGSMKVASEATDTVRSAFYPPSGLSTTFGFKL  406

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED++GRMHRF  +T+++TDLIT ILQR+G DI+ N+LPQILYEDEDHD+V+LASDSDL  
Sbjct  407  EDKQGRMHRFNCETQSLTDLITCILQRVGDDIDRNHLPQILYEDEDHDKVILASDSDLAA  466

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLR--RGSGSSTIEYAQTD  251
            AV+HAR AGWK LRLHLDYS + + +  RGSGS+ +E+A  D
Sbjct  467  AVDHARQAGWKSLRLHLDYSGSGYRKKGRGSGSAGLEHAHKD  508



>ref|XP_004971094.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like [Setaria 
italica]
Length=554

 Score =   258 bits (659),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 166/223 (74%), Gaps = 4/223 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA+V+TPILDALH MH+GKFLHLP+ D+DG VV VVDVLHIT AAI+TVGNT     
Sbjct  303  SPECATVDTPILDALHTMHEGKFLHLPVLDRDGNVVTVVDVLHITHAAIATVGNTGAAGA  362

Query  727  ETANT---MMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
              +     MMQ+FWDSAM+I    DD++  SE S K+ASE  +   S  +P+S L N F 
Sbjct  363  AGSEAASAMMQRFWDSAMSIGPLDDDDDSRSEGSTKVASEATDIARSAFYPASGLSNMFG  422

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FKI+D++GRMHRF  DT ++TDLIT+ILQRLG DI+  NLPQILYEDEDHD+V+L+SDSD
Sbjct  423  FKIQDKQGRMHRFNCDTSSLTDLITSILQRLGDDIDRKNLPQILYEDEDHDKVILSSDSD  482

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            LI AV+HAR  GWK LRLHLDY      +RG GSS  EYA  D
Sbjct  483  LIAAVDHARQIGWKSLRLHLDYVGVGRRKRGGGSSDFEYAGKD  525



>ref|XP_006282310.1| hypothetical protein CARUB_v10028624mg [Capsella rubella]
 gb|EOA15208.1| hypothetical protein CARUB_v10028624mg [Capsella rubella]
Length=547

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/220 (61%), Positives = 172/220 (78%), Gaps = 8/220 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE A+V+  I++ALH MH+GKFLHLP+ DKDG VVAV+DV+HIT AA++T G+TAG+N 
Sbjct  303  NPESATVDMAIVEALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAVTTAGSTAGINN  362

Query  727  ETANTMMQKFWDSAMAISHHDD--EEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFK  554
            ETAN+MMQKFWDSAMA+S ++D  E    E SLKL+SE + T  S  +P     NTF+FK
Sbjct  363  ETANSMMQKFWDSAMALSPNEDGDETRSEEGSLKLSSEIEGTK-SFSYP-----NTFAFK  416

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            ++DRKGRMHRF  +T+++T LITAILQR+G DI  +NLPQI+YEDED+D+VVLASD+DL 
Sbjct  417  LQDRKGRMHRFMCETQSLTTLITAILQRMGDDIEPHNLPQIMYEDEDNDKVVLASDNDLG  476

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQT  254
             AVEHA+S GWKGL+LHLDY+     RRG     ++Y Q+
Sbjct  477  AAVEHAKSIGWKGLKLHLDYTEEKRHRRGRSLEDMDYDQS  516



>ref|XP_006584706.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X2 [Glycine max]
Length=590

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 176/223 (79%), Gaps = 4/223 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAIST---VGNTAG  737
            NPEC +++TPI+DALH MHDG FLHL + ++DG+VVA VD +HIT AA++T   VGNT  
Sbjct  339  NPECGTIDTPIIDALHTMHDGNFLHLLVVNRDGIVVATVDAIHITHAAVATASQVGNTPN  398

Query  736  VNEETANTMMQKFWDSAMAISHHDDEE-MHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
             N E AN+M+QK WDSAMA++ +++EE   SE SLK+ SEG ETG S+ + +S++QN FS
Sbjct  399  FNSEAANSMIQKIWDSAMALAPNEEEEDSQSETSLKMISEGGETGRSISYLASSMQNAFS  458

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++DRKGR+HRFT DTR++ ++IT+++QR+G DI+  +LPQILYEDE++D+VVLASDSD
Sbjct  459  FKLQDRKGRLHRFTCDTRSLAEVITSVIQRVGDDIDPMDLPQILYEDEENDKVVLASDSD  518

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            L  AV+HA++AG KGLRLHLDYS T      S S + +YA ++
Sbjct  519  LAAAVDHAKTAGLKGLRLHLDYSGTHGYGTDSSSLSWKYANSE  561



>ref|NP_568736.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein [Arabidopsis 
thaliana]
 ref|NP_680412.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein [Arabidopsis 
thaliana]
 sp|P0DH79.1|Y5064_ARATH RecName: Full=CBS domain-containing protein CBSCBSPB5 [Arabidopsis 
thaliana]
 sp|Q0WLC7.2|Y5053_ARATH RecName: Full=CBS domain-containing protein CBSCBSPB4 [Arabidopsis 
thaliana]
 dbj|BAA96977.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAB09138.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED95955.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein [Arabidopsis 
thaliana]
 gb|AED95971.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein [Arabidopsis 
thaliana]
Length=548

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 174/221 (79%), Gaps = 8/221 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE A+V+  I++ALH MH+GKFLHLP+ DKDG VVAV+DV+HIT AA++T G+TAG+N 
Sbjct  304  NPESATVDMAIVEALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAVTTAGSTAGINN  363

Query  727  ETANTMMQKFWDSAMAISHHDD--EEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFK  554
            ETAN+MMQKFWDSAMA+S ++D  E    E S+KL+SE + T  S  +P     NTF+FK
Sbjct  364  ETANSMMQKFWDSAMALSPNEDGDETRSEEESMKLSSEIEVTK-SFSYP-----NTFAFK  417

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            ++D+KGRMHRF  +T+++T LITAILQR+G DI  +NLPQI+YEDED+D+VVLASD+DL 
Sbjct  418  LQDKKGRMHRFMCETQSLTTLITAILQRMGDDIEPDNLPQIMYEDEDNDKVVLASDNDLG  477

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
             AVEHA+S GWKGL+LHLDY+     RRG  S  ++Y Q++
Sbjct  478  AAVEHAKSIGWKGLKLHLDYTEERGHRRGLSSEDMDYDQSN  518



>ref|XP_002865817.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42076.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=548

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 173/221 (78%), Gaps = 8/221 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE A+V+  I+DALH MH+GKFLHLP+ DKDG VVAV+DV+HIT AA++T G+TAG+N 
Sbjct  304  NPESATVDMAIVDALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAVTTAGSTAGINN  363

Query  727  ETANTMMQKFWDSAMAISHHDD--EEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFK  554
            ETAN+MMQKFWDSAMA+S  +D  E    E S+KL+SE + T  S  +P     NTF+FK
Sbjct  364  ETANSMMQKFWDSAMALSPTEDIDETRSEEESMKLSSEIEGTK-SFSYP-----NTFAFK  417

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            ++D+KGRMHRF  +T+++T LITAILQR+G DI  +NLPQI+YEDED+D+VVLASD+DL 
Sbjct  418  LQDKKGRMHRFMCETQSLTTLITAILQRMGDDIEPDNLPQIMYEDEDNDKVVLASDNDLG  477

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
             AVEHA+S GWKGL+LHLDY+     RRG  S  ++Y Q++
Sbjct  478  AAVEHAKSIGWKGLKLHLDYTEERGHRRGLSSEDMDYDQSN  518



>ref|NP_001151563.1| CBS domain containing protein [Zea mays]
 gb|ACG43343.1| CBS domain containing protein [Zea mays]
Length=550

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/220 (59%), Positives = 165/220 (75%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA+V+TPILDALH MHDGKFLHLP+ D+DG VV VVDVLHIT AAI+TVGN+     
Sbjct  301  SPECATVDTPILDALHTMHDGKFLHLPVLDRDGNVVTVVDVLHITHAAIATVGNSGAAGS  360

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  + MMQ+FWDSAM+I    DD++  SE S ++ SE  + G +  FP+S L NTF FKI
Sbjct  361  EATSAMMQRFWDSAMSIGPIDDDDDSRSEGSTRVVSEATDIGRAAFFPASGLSNTFGFKI  420

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRF  +T  + +LIT+ILQR+G DI+  +LPQILYEDED D+VVL+SDSDL+ 
Sbjct  421  QDKQGRMHRFNCETSGLAELITSILQRVGDDIDRKHLPQILYEDEDRDKVVLSSDSDLVA  480

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR  GWK +RLHLDY+     + G G S +EYA  D
Sbjct  481  AVDHARKIGWKSIRLHLDYAGVGRRKGGGGPSDLEYAGKD  520



>ref|XP_006584705.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X1 [Glycine max]
Length=601

 Score =   258 bits (659),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 176/223 (79%), Gaps = 4/223 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAIST---VGNTAG  737
            NPEC +++TPI+DALH MHDG FLHL + ++DG+VVA VD +HIT AA++T   VGNT  
Sbjct  350  NPECGTIDTPIIDALHTMHDGNFLHLLVVNRDGIVVATVDAIHITHAAVATASQVGNTPN  409

Query  736  VNEETANTMMQKFWDSAMAISHHDDEE-MHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
             N E AN+M+QK WDSAMA++ +++EE   SE SLK+ SEG ETG S+ + +S++QN FS
Sbjct  410  FNSEAANSMIQKIWDSAMALAPNEEEEDSQSETSLKMISEGGETGRSISYLASSMQNAFS  469

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++DRKGR+HRFT DTR++ ++IT+++QR+G DI+  +LPQILYEDE++D+VVLASDSD
Sbjct  470  FKLQDRKGRLHRFTCDTRSLAEVITSVIQRVGDDIDPMDLPQILYEDEENDKVVLASDSD  529

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            L  AV+HA++AG KGLRLHLDYS T      S S + +YA ++
Sbjct  530  LAAAVDHAKTAGLKGLRLHLDYSGTHGYGTDSSSLSWKYANSE  572



>gb|ACN34655.1| unknown [Zea mays]
 tpg|DAA56075.1| TPA: CBS domain containing protein [Zea mays]
Length=550

 Score =   257 bits (656),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 164/220 (75%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA+V+TPILDALH MHDGKFLHLP+ D+DG VV VVDVLHIT AAI+TVGN+     
Sbjct  301  SPECATVDTPILDALHTMHDGKFLHLPVLDRDGNVVTVVDVLHITHAAIATVGNSGAAGS  360

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  + MMQ+FWDSAM+I    DD++  SE S ++ SE  + G    FP+S L NTF FKI
Sbjct  361  EATSAMMQRFWDSAMSIGPIDDDDDSRSEGSTRVVSEATDIGRPAFFPASGLSNTFGFKI  420

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRF  +T  + +LIT+ILQR+G DI+  +LPQILYEDED D+VVL+SDSDLI 
Sbjct  421  QDKQGRMHRFNCETSGLAELITSILQRVGDDIDRKHLPQILYEDEDRDKVVLSSDSDLIA  480

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR  GWK +RLHLDY+     + G G S +EYA  D
Sbjct  481  AVDHARKIGWKSIRLHLDYAGVGRRKGGGGPSDLEYAGKD  520



>ref|XP_010442542.1| PREDICTED: CBS domain-containing protein CBSCBSPB5 [Camelina 
sativa]
Length=546

 Score =   255 bits (652),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 173/221 (78%), Gaps = 8/221 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE A+V+  I+DALH MH+GKFLHLP+ DKDG VVAV+DV+HIT AA++T G+TAG+N 
Sbjct  302  NPESATVDMAIVDALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITNAAVTTAGSTAGINN  361

Query  727  ETANTMMQKFWDSAMAISHHDD--EEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFK  554
            ETAN+MMQKFWDSAMA+S ++D  E    E SLKL+SE + T  S  +P     NTF+FK
Sbjct  362  ETANSMMQKFWDSAMALSPNEDGDETRSEEESLKLSSEIEGTK-SFSYP-----NTFAFK  415

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            ++D+KGRMHRF  +T+++T LITAILQR+G DI  +NLPQI+YEDED+D+VVLASD+DL 
Sbjct  416  LQDKKGRMHRFMCETQSLTTLITAILQRMGDDIEPDNLPQIMYEDEDNDKVVLASDNDLG  475

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
             AVEHA+S GWKGL+LHLDY+      RG  +  ++Y Q++
Sbjct  476  AAVEHAKSIGWKGLKLHLDYTEGRGHMRGLSAVDMDYDQSN  516



>ref|XP_010555551.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Tarenaya 
hassleriana]
 ref|XP_010555552.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Tarenaya 
hassleriana]
 ref|XP_010555553.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Tarenaya 
hassleriana]
 ref|XP_010555554.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Tarenaya 
hassleriana]
 ref|XP_010555555.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Tarenaya 
hassleriana]
Length=545

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 170/217 (78%), Gaps = 8/217 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE  +V+T I+DALH MHDGKFLHLP+ DKDG V+AV+DV+HIT+AA++T G+ AG++ 
Sbjct  301  NPESVTVDTSIVDALHIMHDGKFLHLPVVDKDGDVIAVIDVIHITQAAVTTAGSMAGISN  360

Query  727  ETANTMMQKFWDSAMAISHHDDEE--MHSEASLKLASEGQETGISLPFPSSTLQNTFSFK  554
            ETAN+MMQKFWDSAMA+  +DDE+     E S+KL+SE  + G S  +       TF+FK
Sbjct  361  ETANSMMQKFWDSAMALPPNDDEDESRSEEGSMKLSSE-IDAGKSFSY-----SKTFTFK  414

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            I+D+KGRMHRF  +T+++T+LITAILQR+G DI+ + LPQI+YEDEDHDQV+LASDSDL 
Sbjct  415  IQDKKGRMHRFMCETQSLTNLITAILQRMGDDIDPDRLPQIMYEDEDHDQVMLASDSDLS  474

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEY  263
             AVEHA++ GWKGL+LHLDY++     R S S T+ Y
Sbjct  475  AAVEHAKAIGWKGLKLHLDYTKRRGDERVSSSETMGY  511



>ref|XP_007137901.1| hypothetical protein PHAVU_009G1653000g, partial [Phaseolus vulgaris]
 gb|ESW09895.1| hypothetical protein PHAVU_009G1653000g, partial [Phaseolus vulgaris]
Length=526

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 175/216 (81%), Gaps = 3/216 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC  ++TPI+DALH MHDGKFLHLP+ D+DG VVAVVDV+H+T AA++TV      N 
Sbjct  283  NPECVVIDTPIVDALHTMHDGKFLHLPVIDRDGSVVAVVDVIHVTHAAVATVSQVG--NN  340

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A T+MQ+FWDSAMA++ + DD++  S++SLKLAS+G +TG S+P+ SS++ NTFSFKI
Sbjct  341  EAATTLMQRFWDSAMALTPNDDDDDTRSDSSLKLASDGGDTGRSIPYLSSSMANTFSFKI  400

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D+KGRMHRFT DTR++ ++IT+ILQRLG DI+  N+PQILYEDEDHD+VVLASDSDL  
Sbjct  401  QDKKGRMHRFTCDTRSIKEVITSILQRLGDDIDPKNIPQILYEDEDHDKVVLASDSDLAV  460

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEY  263
            AV+HA++AG KGL+LHLDY+  P   + S S +  Y
Sbjct  461  AVDHAKTAGLKGLKLHLDYAGPPGNVKTSRSGSYAY  496



>ref|XP_008672690.1| PREDICTED: uncharacterized protein LOC100279329 isoform X1 [Zea 
mays]
Length=681

 Score =   256 bits (655),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 164/220 (75%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA+V+TPILDALH MHDGKFLHLP+ D+DG VV VVDVLHIT AAI+TVGN+     
Sbjct  432  SPECATVDTPILDALHTMHDGKFLHLPVLDRDGNVVTVVDVLHITHAAIATVGNSGAAGS  491

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  + MMQ+FWDSAM+I    DD++  SE S ++ SE  + G    FP+S L NTF FKI
Sbjct  492  EATSAMMQRFWDSAMSIGPIDDDDDSRSEGSTRVVSEATDIGRPAFFPASGLSNTFGFKI  551

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D++GRMHRF  +T  + +LIT+ILQR+G DI+  +LPQILYEDED D+VVL+SDSDLI 
Sbjct  552  QDKQGRMHRFNCETSGLAELITSILQRVGDDIDRKHLPQILYEDEDRDKVVLSSDSDLIA  611

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR  GWK +RLHLDY+     + G G S +EYA  D
Sbjct  612  AVDHARKIGWKSIRLHLDYAGVGRRKGGGGPSDLEYAGKD  651



>ref|XP_010695379.1| PREDICTED: CBS domain-containing protein CBSCBSPB1 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=533

 Score =   253 bits (645),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 136/215 (63%), Positives = 166/215 (77%), Gaps = 3/215 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG VVAVVDV+HIT AA++TVGNT  +N 
Sbjct  289  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGDVVAVVDVIHITHAAVATVGNTGAMNS  348

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E    MMQKFW+        DDE+  SE SLK+ASE  +T  S    SS   ++FSFKIE
Sbjct  349  EATTNMMQKFWEQLGPAD--DDEDTRSEGSLKMASESGDTTKSY-LTSSVQPSSFSFKIE  405

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D++GRMHRF  DT+N+TDLIT ILQR+G DI+ N+LP ILYEDED D+VVLA+D DL  A
Sbjct  406  DKRGRMHRFICDTQNLTDLITCILQRVGDDIDRNHLPLILYEDEDGDKVVLATDCDLAAA  465

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEY  263
            V+HA+ AGWKGLRLHLDYS +   RR SGS+++EY
Sbjct  466  VDHAKLAGWKGLRLHLDYSGSRGRRRASGSTSLEY  500



>ref|XP_010442213.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Camelina 
sativa]
Length=548

 Score =   253 bits (646),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 173/221 (78%), Gaps = 8/221 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE A+V+  I+DALH MH+GKFLHLP+ DKDG VVAV+DV+HIT AA++T G+TAG+N 
Sbjct  304  NPESATVDMAIVDALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITNAAVTTAGSTAGINN  363

Query  727  ETANTMMQKFWDSAMAISHHDD--EEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFK  554
            ETAN+MMQKFWDSAMA+S ++D  E    E SLKL+SE + T  S  +P     NTF+FK
Sbjct  364  ETANSMMQKFWDSAMALSPNEDGDETRSEEESLKLSSEIEGTK-SFSYP-----NTFAFK  417

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            ++D+KGRMHRF  +T+++T LITAILQR+G DI  +NLPQI+YEDED+D+VVLASD+DL 
Sbjct  418  LQDKKGRMHRFMCETQSLTTLITAILQRMGDDIEPDNLPQIMYEDEDNDKVVLASDNDLG  477

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
             AVEHA+S GWKGL+LHLD++      RG  +  ++Y Q++
Sbjct  478  AAVEHAKSIGWKGLKLHLDHTEERGHMRGLSAVDMDYDQSN  518



>ref|XP_006402080.1| hypothetical protein EUTSA_v10013164mg [Eutrema salsugineum]
 gb|ESQ43533.1| hypothetical protein EUTSA_v10013164mg [Eutrema salsugineum]
Length=550

 Score =   253 bits (646),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 172/222 (77%), Gaps = 9/222 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE A+V+  I+DALH MH+GKFLHLP+ DKDG VVAV+DV+HIT AA++T G+TAG+N 
Sbjct  305  NPESATVDMAIVDALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAVTTAGSTAGINN  364

Query  727  ETANTMMQKFWDSAMAISHHDD--EEMHSEA-SLKLASEGQETGISLPFPSSTLQNTFSF  557
            ETAN+MMQKFWDSAMA+S ++D  E   SE  S+KL+SE + T  S  +P     NTF+F
Sbjct  365  ETANSMMQKFWDSAMALSPNEDGDETTRSEEESMKLSSEIEGTK-SFSYP-----NTFAF  418

Query  556  KIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDL  377
            K++D+KGRMHRF  +T+++T LITAILQR+G DI   NLP I+YEDED+D+V+LASD DL
Sbjct  419  KLQDKKGRMHRFMCETQSLTTLITAILQRMGDDIEPENLPHIMYEDEDNDKVILASDGDL  478

Query  376  ITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            + AVEHA+S GWKGL+LHLD+      RRG  S  ++Y Q++
Sbjct  479  VAAVEHAKSIGWKGLKLHLDFIEERGHRRGLSSEGMDYEQSN  520



>ref|XP_010482366.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Camelina 
sativa]
Length=548

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 172/221 (78%), Gaps = 8/221 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE A+V+  I+DALH MH+GKFLHLP+ DKDG VVAV+DV+HIT AA++T G+TAG+N 
Sbjct  304  NPESATVDMAIVDALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITNAAVTTAGSTAGINN  363

Query  727  ETANTMMQKFWDSAMAISHHDD--EEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFK  554
            ETAN+MMQKFWDSAMA+S ++D  E    E SLKL+SE + T  S  +P     NTF+FK
Sbjct  364  ETANSMMQKFWDSAMALSPNEDGDETRSEEESLKLSSEIEGTK-SFSYP-----NTFAFK  417

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            ++D+KGRMHRF  +T+++T LITAILQR+G DI  +NLPQI+YEDED+D+VVLASD+DL 
Sbjct  418  LQDKKGRMHRFMCETQSLTTLITAILQRMGDDIEPDNLPQIMYEDEDNDKVVLASDNDLG  477

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
             AVEHA+S GWKGL+LHLDY+       G  +  ++Y Q++
Sbjct  478  AAVEHAKSIGWKGLKLHLDYTEERGHMGGLSTVDMDYNQSN  518



>emb|CDX84421.1| BnaC03g50790D [Brassica napus]
Length=600

 Score =   251 bits (640),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 141/222 (64%), Positives = 174/222 (78%), Gaps = 9/222 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPIS-DKDGvvvavvdVLHITRAAISTVGNTAGVN  731
            NPE  +V+TPI++ALH MH+GKFLHLP++ DKDG VVAVVDV+HIT AA++T G T G+ 
Sbjct  355  NPESTTVDTPIVEALHIMHEGKFLHLPVTTDKDGDVVAVVDVIHITHAAVATAGTTPGIG  414

Query  730  EETANTMMQKFWDSAMAISHHD-DEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFK  554
             E  +TMMQKFWDSAMA+S +D D++  SE+SLK+ASE  +TG SLPF        FSFK
Sbjct  415  NEATHTMMQKFWDSAMALSPNDEDDDTRSESSLKVASEA-DTGRSLPF-----AYMFSFK  468

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            IED+K RMHRF SDTR++T++ITAILQR+G DI+ +NLPQILYEDEDHD+V+LASDSDL 
Sbjct  469  IEDKKHRMHRFISDTRSLTEVITAILQRIGNDIDPDNLPQILYEDEDHDKVLLASDSDLQ  528

Query  373  TAVEHARSAGWKGLRLHLDYSRTPH-LRRGSGSSTIEYAQTD  251
             A++HA+S GWK LRLHLD SR     RR SGS   EY + D
Sbjct  529  AAIDHAKSIGWKSLRLHLDDSREGKGRRRASGSEATEYVERD  570



>ref|XP_006848282.1| hypothetical protein AMTR_s00013p00090250 [Amborella trichopoda]
 gb|ERN09863.1| hypothetical protein AMTR_s00013p00090250 [Amborella trichopoda]
Length=536

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/221 (56%), Positives = 173/221 (78%), Gaps = 4/221 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ DK G +VAV+DV+ +T AA++TVG+   V  
Sbjct  288  NPECATVDTPIVDALHIMHDGKFLHLPVVDKGGFIVAVIDVIQVTHAAVATVGSVGAVGN  347

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEAS-LKLASEGQETGISLPFPSSTLQNTFSFK  554
            ET +TMMQKFWD+AM++    DD++  SE S  ++AS+G ETG SL +PS+ L + F+FK
Sbjct  348  ETTSTMMQKFWDTAMSLGPPEDDDDTQSEGSATRVASDGTETGRSL-YPSTGLASAFTFK  406

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            +ED+KGRMHRF   T ++++L+T+I+QR+G DI+ N+LPQILYEDE+ D+V+LA+DSDL 
Sbjct  407  LEDKKGRMHRFNCGTGSLSELLTSIVQRMGDDIDRNHLPQILYEDEERDKVLLATDSDLT  466

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
             AV+HAR AGWKGL+L+LDYS +    +  G  ++++A  D
Sbjct  467  AAVDHARQAGWKGLKLYLDYSDSGSY-QSIGPGSMDFAHKD  506



>ref|XP_009127349.1| PREDICTED: CBS domain-containing protein CBSCBSPB5 isoform X2 
[Brassica rapa]
Length=546

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 168/219 (77%), Gaps = 10/219 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE A+V+  I+DALH MH+GKFLHLP+ DKDG VVAV+DV+HIT AA++T G+TAG+N 
Sbjct  300  NPESATVDMAIVDALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAVTTAGSTAGINN  359

Query  727  ETANTMMQKFWDSAMAISHHDD--EEMHSE--ASLKLASEGQETGISLPFPSSTLQNTFS  560
            ETAN+MMQ FWD+AMA+S ++D  E   SE  +S+KL SE + T  S  +P     NTF+
Sbjct  360  ETANSMMQNFWDAAMALSPNEDGDETTRSEDESSIKLPSEIEGTK-SFSYP-----NTFT  413

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++D+KGRMHRF  +T ++  LITAILQR+G DI  +NLPQI+YEDED+D+V+LASDSD
Sbjct  414  FKLQDKKGRMHRFMCETHSLATLITAILQRMGDDIEPDNLPQIMYEDEDNDKVILASDSD  473

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEY  263
            L+ AVEHA+S  WKGL+LHLDY      RRG  +  +EY
Sbjct  474  LVAAVEHAKSIDWKGLKLHLDYVEARGHRRGVSTEDMEY  512



>ref|XP_009127348.1| PREDICTED: CBS domain-containing protein CBSCBSPB5 isoform X1 
[Brassica rapa]
Length=547

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 168/219 (77%), Gaps = 10/219 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE A+V+  I+DALH MH+GKFLHLP+ DKDG VVAV+DV+HIT AA++T G+TAG+N 
Sbjct  301  NPESATVDMAIVDALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAVTTAGSTAGINN  360

Query  727  ETANTMMQKFWDSAMAISHHDD--EEMHSE--ASLKLASEGQETGISLPFPSSTLQNTFS  560
            ETAN+MMQ FWD+AMA+S ++D  E   SE  +S+KL SE + T  S  +P     NTF+
Sbjct  361  ETANSMMQNFWDAAMALSPNEDGDETTRSEDESSIKLPSEIEGTK-SFSYP-----NTFT  414

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++D+KGRMHRF  +T ++  LITAILQR+G DI  +NLPQI+YEDED+D+V+LASDSD
Sbjct  415  FKLQDKKGRMHRFMCETHSLATLITAILQRMGDDIEPDNLPQIMYEDEDNDKVILASDSD  474

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEY  263
            L+ AVEHA+S  WKGL+LHLDY      RRG  +  +EY
Sbjct  475  LVAAVEHAKSIDWKGLKLHLDYVEARGHRRGVSTEDMEY  513



>ref|XP_009381338.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=532

 Score =   247 bits (630),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 164/220 (75%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC +V+TPILDALH MHD KFLHLP+ D+DG +V+VVDV+ +  AAI+T G+ AG   
Sbjct  283  NPECGTVDTPILDALHTMHDRKFLHLPVVDRDGFIVSVVDVIRVAHAAIATAGSNAGARN  342

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            +TA++MMQKFWDS +++    DD++  SE S ++ SE  E       PSS+L  +F FK+
Sbjct  343  QTASSMMQKFWDSFLSLGPLDDDDDFRSEGSTRVTSEATERIKYALHPSSSLSTSFGFKL  402

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+ GRMHRF  +T+++TDLIT ILQR+G DI+ ++LPQILYEDEDHD+V+LASD DL+ 
Sbjct  403  EDKHGRMHRFNCETQSLTDLITCILQRVGDDIDKSHLPQILYEDEDHDKVILASDGDLVA  462

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR AG K LRLHLD+S     ++G  S ++EYA  D
Sbjct  463  AVDHARQAGLKSLRLHLDHSGLGRRKKGRESGSLEYAHKD  502



>emb|CDY16356.1| BnaA02g11600D [Brassica napus]
Length=547

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 167/219 (76%), Gaps = 10/219 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE A+V+  I+DALH MH+GKFLHLP+ DKDG VVAV+DV+HIT AA++T G+TAG+N 
Sbjct  301  NPESATVDMAIVDALHIMHNGKFLHLPVLDKDGDVVAVIDVIHITHAAVTTAGSTAGINN  360

Query  727  ETANTMMQKFWDSAMAISHHDD--EEMHSE--ASLKLASEGQETGISLPFPSSTLQNTFS  560
            ETAN+MMQ FWD+AMA+S ++D  E   SE  +S+KL SE + T  S  +P     NTF+
Sbjct  361  ETANSMMQNFWDAAMALSPNEDGDETTRSEDESSIKLPSEIEGTK-SFSYP-----NTFA  414

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++D+KGRMHRF  +T ++  LITAILQR+G DI  +NLPQI+YEDED+D+V+LASD D
Sbjct  415  FKLQDKKGRMHRFMCETHSLATLITAILQRMGDDIEPDNLPQIMYEDEDNDKVILASDGD  474

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEY  263
            L+ AVEHA+S  WKGL+LHLDY      RRG  +  +EY
Sbjct  475  LVAAVEHAKSIDWKGLKLHLDYVEARGHRRGVSTEDMEY  513



>ref|XP_009381337.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=541

 Score =   247 bits (630),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 164/220 (75%), Gaps = 1/220 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC +V+TPILDALH MHD KFLHLP+ D+DG +V+VVDV+ +  AAI+T G+ AG   
Sbjct  292  NPECGTVDTPILDALHTMHDRKFLHLPVVDRDGFIVSVVDVIRVAHAAIATAGSNAGARN  351

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            +TA++MMQKFWDS +++    DD++  SE S ++ SE  E       PSS+L  +F FK+
Sbjct  352  QTASSMMQKFWDSFLSLGPLDDDDDFRSEGSTRVTSEATERIKYALHPSSSLSTSFGFKL  411

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+ GRMHRF  +T+++TDLIT ILQR+G DI+ ++LPQILYEDEDHD+V+LASD DL+ 
Sbjct  412  EDKHGRMHRFNCETQSLTDLITCILQRVGDDIDKSHLPQILYEDEDHDKVILASDGDLVA  471

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR AG K LRLHLD+S     ++G  S ++EYA  D
Sbjct  472  AVDHARQAGLKSLRLHLDHSGLGRRKKGRESGSLEYAHKD  511



>ref|XP_009387683.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Musa 
acuminata subsp. malaccensis]
Length=538

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 168/220 (76%), Gaps = 2/220 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC S++T ILDALH M  GKFLHLP++D++G++V+V+DVL+IT AA++T  ++A V  
Sbjct  290  NPECRSIDTSILDALHTMRAGKFLHLPLTDRNGIIVSVIDVLNITHAALATFESSAAVGN  349

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A ++MQKFWDSAMA     +D+E  SE S+K+ SE  +  ++  +PSS L + FSFK+
Sbjct  350  EAAISLMQKFWDSAMATGPSEEDDETRSEGSMKMTSEVTDV-VASAYPSSNLPDMFSFKL  408

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED++GRMHRF  +TR++T LIT+ILQR+G DI+ N+LP ILYEDED D+V+LASDSDL+ 
Sbjct  409  EDKQGRMHRFHCETRSLTYLITSILQRVGDDIDRNHLPHILYEDEDGDKVILASDSDLVA  468

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR  GWKGLRLHLDYS     ++G GS  +E A  D
Sbjct  469  AVDHARLVGWKGLRLHLDYSANGCGKKGRGSGRMELANID  508



>ref|XP_010695378.1| PREDICTED: CBS domain-containing protein CBSCBSPB1 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=539

 Score =   246 bits (629),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 136/222 (61%), Positives = 167/222 (75%), Gaps = 11/222 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG VVAVVDV+HIT AA++TVGNT  +N 
Sbjct  289  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGDVVAVVDVIHITHAAVATVGNTGAMNS  348

Query  727  ETANTMMQKFWDSAMAISHHDDEE-------MHSEASLKLASEGQETGISLPFPSSTLQN  569
            E    MMQKFW+    +   DD+E         SE SLK+ASE  +T  S    SS   +
Sbjct  349  EATTNMMQKFWEQ---LGPADDDEDTRSSTSNLSEGSLKMASESGDTTKSY-LTSSVQPS  404

Query  568  TFSFKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLAS  389
            +FSFKIED++GRMHRF  DT+N+TDLIT ILQR+G DI+ N+LP ILYEDED D+VVLA+
Sbjct  405  SFSFKIEDKRGRMHRFICDTQNLTDLITCILQRVGDDIDRNHLPLILYEDEDGDKVVLAT  464

Query  388  DSDLITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEY  263
            D DL  AV+HA+ AGWKGLRLHLDYS +   RR SGS+++EY
Sbjct  465  DCDLAAAVDHAKLAGWKGLRLHLDYSGSRGRRRASGSTSLEY  506



>ref|XP_010536618.1| PREDICTED: CBS domain-containing protein CBSCBSPB5 [Tarenaya 
hassleriana]
Length=542

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 162/202 (80%), Gaps = 8/202 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE A+++TPI+DALH MHDGKFLHLP+ DKDG VVAV+D++HIT AA++T G+TAG++ 
Sbjct  301  NPEFATIDTPIVDALHIMHDGKFLHLPVVDKDGDVVAVIDIIHITHAAVTTAGSTAGISN  360

Query  727  ETANTMMQKFWDSAMAISHHDDE-EMHS-EASLKLASEGQETGISLPFPSSTLQNTFSFK  554
            ETAN+MMQKFWDSAMA+   DDE E  S E S+KL+ E  E G S  +       TF+FK
Sbjct  361  ETANSMMQKFWDSAMALPPSDDEVETRSKEGSMKLSPE-VEMGKSFSY-----IKTFAFK  414

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            I+D+KGRMHRF  +T+++T LITAILQR+G DI+  +LPQI+YEDED+DQV+LAS+SDL 
Sbjct  415  IQDKKGRMHRFMCETQSLTTLITAILQRMGDDIDPYHLPQIMYEDEDNDQVMLASNSDLS  474

Query  373  TAVEHARSAGWKGLRLHLDYSR  308
             AVEHA+S GWKGL+L LDY +
Sbjct  475  AAVEHAKSIGWKGLKLQLDYKK  496



>ref|XP_007160025.1| hypothetical protein PHAVU_002G286300g [Phaseolus vulgaris]
 gb|ESW32019.1| hypothetical protein PHAVU_002G286300g [Phaseolus vulgaris]
Length=504

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 165/203 (81%), Gaps = 5/203 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAIST---VGNTAG  737
            NPECA ++TPI+DALH MHDGKFLHLP+ D+DG VVA VDV+HIT AA++T   VGN+A 
Sbjct  254  NPECAIIDTPIVDALHTMHDGKFLHLPVVDRDGTVVATVDVIHITHAAVATASQVGNSAS  313

Query  736  VNEETANTMMQKFWDSAMA-ISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
            +N E AN+M+QKFWDSAM+ + + +D++  SE SLK+ SEG ETG SL +  S + N FS
Sbjct  314  LNNEAANSMIQKFWDSAMSLVPNGEDDDNQSETSLKMISEGGETGRSLSYLGS-MPNAFS  372

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++DRKGR+HRFT DTR + ++IT IL R+G +I+  NLPQILYEDE++D+VVLASDSD
Sbjct  373  FKVQDRKGRLHRFTCDTRCLAEVITCILHRVGDEIDPTNLPQILYEDEENDKVVLASDSD  432

Query  379  LITAVEHARSAGWKGLRLHLDYS  311
            L  AV+HA++AG KGLRLHLDYS
Sbjct  433  LAAAVDHAKAAGLKGLRLHLDYS  455



>ref|XP_007160024.1| hypothetical protein PHAVU_002G286300g [Phaseolus vulgaris]
 gb|ESW32018.1| hypothetical protein PHAVU_002G286300g [Phaseolus vulgaris]
Length=542

 Score =   244 bits (622),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 165/203 (81%), Gaps = 5/203 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAIST---VGNTAG  737
            NPECA ++TPI+DALH MHDGKFLHLP+ D+DG VVA VDV+HIT AA++T   VGN+A 
Sbjct  292  NPECAIIDTPIVDALHTMHDGKFLHLPVVDRDGTVVATVDVIHITHAAVATASQVGNSAS  351

Query  736  VNEETANTMMQKFWDSAMA-ISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
            +N E AN+M+QKFWDSAM+ + + +D++  SE SLK+ SEG ETG SL +  S + N FS
Sbjct  352  LNNEAANSMIQKFWDSAMSLVPNGEDDDNQSETSLKMISEGGETGRSLSYLGS-MPNAFS  410

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++DRKGR+HRFT DTR + ++IT IL R+G +I+  NLPQILYEDE++D+VVLASDSD
Sbjct  411  FKVQDRKGRLHRFTCDTRCLAEVITCILHRVGDEIDPTNLPQILYEDEENDKVVLASDSD  470

Query  379  LITAVEHARSAGWKGLRLHLDYS  311
            L  AV+HA++AG KGLRLHLDYS
Sbjct  471  LAAAVDHAKAAGLKGLRLHLDYS  493



>emb|CDY66379.1| BnaCnng50610D [Brassica napus]
Length=547

 Score =   244 bits (622),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 166/219 (76%), Gaps = 10/219 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE A+V+  I++ALH MH+GKFLHLP+ DK+G VV V+DV+HIT AA++T G+TAG+N 
Sbjct  301  NPESATVDMAIVEALHIMHNGKFLHLPVLDKEGDVVTVIDVIHITHAAVTTAGSTAGINN  360

Query  727  ETANTMMQKFWDSAMAISHHDD--EEMHSE--ASLKLASEGQETGISLPFPSSTLQNTFS  560
            ETAN+MMQ FWD+AMA+S ++D  E   SE  +S+KL SE + T  S  +P     NTF+
Sbjct  361  ETANSMMQNFWDAAMALSPNEDGDETTRSEDESSIKLPSEIEGTK-SFSYP-----NTFT  414

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++D+KGRMHRF  +T ++  LITAILQR+G DI  +NLPQI+YEDED+D+V+LASD D
Sbjct  415  FKLQDKKGRMHRFMCETHSLATLITAILQRMGDDIEPDNLPQIMYEDEDNDKVILASDGD  474

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEY  263
            L+ AVEHA+S  WKGL+LHLDY      RRG  +  +EY
Sbjct  475  LVAAVEHAKSIDWKGLKLHLDYVEARGHRRGVSTEDMEY  513



>gb|EPS71553.1| hypothetical protein M569_03205, partial [Genlisea aurea]
Length=527

 Score =   238 bits (608),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 160/207 (77%), Gaps = 12/207 (6%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NP+CA++++PI+DALH MH+G+FLHLP+ DKDG++V+VVDVL +T AA+ TVGNT+G   
Sbjct  299  NPKCATMDSPIVDALHIMHEGRFLHLPVVDKDGIIVSVVDVLRVTHAALQTVGNTSG---  355

Query  727  ETANTMMQKFWDSAMAIS---HHDDEEMHSEASLKLASEGQETGISL--PFPSSTLQNTF  563
            E  NT++QKFWDSAM+++     DD+  HS+ S KL SEG ET   L  P P++     F
Sbjct  356  EVGNTLVQKFWDSAMSLTPEEEDDDDCSHSQNSFKLISEGGETMGQLLSPVPNAG----F  411

Query  562  SFKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDS  383
            +FK +D+KG MHRF  DT N+TDL+TAILQR GG+I+ +N+PQILYEDE++D+VV+ASD 
Sbjct  412  AFKFQDKKGSMHRFICDTDNITDLMTAILQRAGGEIDRSNIPQILYEDEENDKVVIASDG  471

Query  382  DLITAVEHARSAGWKGLRLHLDYSRTP  302
            DL  AV HAR AGWKGLRLHL YS  P
Sbjct  472  DLQAAVCHARLAGWKGLRLHLAYSAGP  498



>ref|XP_010444246.1| PREDICTED: CBS domain-containing protein CBSCBSPB1 [Camelina 
sativa]
 ref|XP_010444247.1| PREDICTED: CBS domain-containing protein CBSCBSPB1 [Camelina 
sativa]
Length=543

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 176/223 (79%), Gaps = 10/223 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE   V+TPI++ALH MH+GKFLHLP++DK+G VVAVVDV+H+T AA++T G TAG++ 
Sbjct  297  NPESTIVDTPIVEALHIMHEGKFLHLPVTDKEGDVVAVVDVIHVTHAAVATAGTTAGIDN  356

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  NTMMQKFWDSAMA+S + DDE+  SE+S+K+ASE  ETG S PF      NTFSFKI
Sbjct  357  EATNTMMQKFWDSAMALSPNEDDEDSRSESSMKVASE-TETGKSFPF-----ANTFSFKI  410

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+K R HRF SDTR++T++ITAI+QR+G DI+ +NLPQILYEDED+D+V+LASDSDL  
Sbjct  411  EDKKHRKHRFISDTRSLTEVITAIIQRVGDDIDPDNLPQILYEDEDNDKVLLASDSDLQA  470

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRR---GSGSSTIEYAQTD  251
            A+EHA+S GWK LRLHLD SR    RR      + ++EY ++D
Sbjct  471  AIEHAKSIGWKSLRLHLDDSREGKGRRRRAAVSAESMEYVESD  513



>ref|XP_010460513.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like [Camelina 
sativa]
Length=544

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 137/223 (61%), Positives = 176/223 (79%), Gaps = 10/223 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE   V+TPI++ALH MH+GKFLHLP++DK+G VVAVVDV+H+T AA++T G TAG++ 
Sbjct  298  NPESTVVDTPIVEALHIMHEGKFLHLPVTDKEGDVVAVVDVIHVTHAAVATAGTTAGIDS  357

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  NTMMQKFWDSAMA+S + DDE+  SE+S+K+ASE  ETG S PF      NTFSFKI
Sbjct  358  EATNTMMQKFWDSAMALSPNEDDEDSRSESSMKVASE-TETGKSFPF-----ANTFSFKI  411

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED++ R HRF SDTR++T++ITAI+QR+G DI+ +NLPQILYEDED+D+V+LASDSDL  
Sbjct  412  EDKRHRKHRFISDTRSLTEVITAIIQRVGDDIDPDNLPQILYEDEDNDKVLLASDSDLQA  471

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRR---GSGSSTIEYAQTD  251
            A+EHA+S GWK LRLHLD SR    RR      + ++EY ++D
Sbjct  472  AIEHAKSIGWKSLRLHLDDSREGKGRRRRAAVSAESMEYVESD  514



>ref|XP_006281875.1| hypothetical protein CARUB_v10028072mg [Capsella rubella]
 gb|EOA14773.1| hypothetical protein CARUB_v10028072mg [Capsella rubella]
Length=544

 Score =   236 bits (603),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 139/229 (61%), Positives = 175/229 (76%), Gaps = 21/229 (9%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE   V+TPI++ALH MH+GKFLHLP++DK+G VVAVVDV+++T AA++T G TAG+  
Sbjct  297  NPESTIVDTPIVEALHIMHEGKFLHLPVTDKEGDVVAVVDVINVTHAAVATAGTTAGIGN  356

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  NTMMQKFWDSAMA+S + DDE+  SE+S+K+ASE  ETG S PF      NTFSFKI
Sbjct  357  EATNTMMQKFWDSAMALSPNEDDEDSRSESSMKVASEA-ETGKSFPF-----ANTFSFKI  410

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+K R HRF SDTR++T++ITAI+QR+G DI+ +NLPQILYEDEDHD+V+LASDSDL  
Sbjct  411  EDKKHRKHRFISDTRSLTEVITAIIQRVGDDIDPDNLPQILYEDEDHDKVLLASDSDLQA  470

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSG---------SSTIEYAQTD  251
            A+EHA+S GWK LRLHLD S     R G G         + ++EY +TD
Sbjct  471  AIEHAKSIGWKSLRLHLDDS-----REGKGRRRRRATVSAESMEYVETD  514



>dbj|BAF01754.1| hypothetical protein [Arabidopsis thaliana]
Length=280

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 171/224 (76%), Gaps = 11/224 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE   V+TPI++ALH MH+GKFLHLP++DK+G VVAVVDV+H+T AA++T G TAG+  
Sbjct  33   NPESTIVDTPIVEALHIMHEGKFLHLPVTDKEGDVVAVVDVIHVTHAAVATAGTTAGIGN  92

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  NTMMQKFWDSAMA+S + DDE+  SE+S+K+ASE  ETG S PF      NTFSFKI
Sbjct  93   EATNTMMQKFWDSAMALSPNEDDEDSRSESSMKVASEA-ETGKSFPF-----ANTFSFKI  146

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+K R HRF SDTR++T++ITAI+QR+G DI+ +N PQILYEDEDHD+V+LASDSDL  
Sbjct  147  EDKKHRKHRFISDTRSLTEVITAIIQRVGDDIDPDNFPQILYEDEDHDKVLLASDSDLQA  206

Query  370  AVEHARSAGWKGLRLHLD----YSRTPHLRRGSGSSTIEYAQTD  251
            A+EHA+S GWK LRLHLD           R    + ++EY +TD
Sbjct  207  AIEHAKSIGWKSLRLHLDDSREGKGRRRRRASGSAESMEYVETD  250



>ref|XP_009150401.1| PREDICTED: CBS domain-containing protein CBSCBSPB1 [Brassica 
rapa]
Length=540

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 143/222 (64%), Positives = 175/222 (79%), Gaps = 9/222 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPIS-DKDGvvvavvdVLHITRAAISTVGNTAGVN  731
            NPE  +V+TPI++ALH MH+GKFLHLP++ DKDG VVAVVDV+HIT AA++T G TAG+ 
Sbjct  295  NPESTTVDTPIVEALHIMHEGKFLHLPVTTDKDGDVVAVVDVIHITHAAVATAGTTAGIG  354

Query  730  EETANTMMQKFWDSAMAISHHD-DEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFK  554
             E  NTMMQKFWDSAMA+S +D D++  SE+SLK+ASE  +TG SLPF        FSFK
Sbjct  355  NEATNTMMQKFWDSAMALSPNDEDDDTRSESSLKVASEA-DTGKSLPF-----GYMFSFK  408

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            IED+K RMHRF SDTR++T++ITAILQR+G DI+ +NLPQILYEDEDHD+V+LASDSDL 
Sbjct  409  IEDKKHRMHRFISDTRSLTEVITAILQRIGNDIDPDNLPQILYEDEDHDKVLLASDSDLQ  468

Query  373  TAVEHARSAGWKGLRLHLDYSRTPH-LRRGSGSSTIEYAQTD  251
             A++HA+S GWK LRLHLD SR     RR SGS   EY + D
Sbjct  469  AAIDHAKSIGWKSLRLHLDGSREGKGRRRASGSEATEYVERD  510



>gb|KHG27053.1| CBS domain-containing CBSCBSPB5 -like protein [Gossypium arboreum]
Length=549

 Score =   234 bits (598),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 159/226 (70%), Gaps = 17/226 (8%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAIST---VGNTAG  737
            NPECA+++TPI+DALH MHDGKFLHLP+ D+DG +VAV DV+HIT AA++T   VG+T+G
Sbjct  304  NPECATIDTPIVDALHTMHDGKFLHLPVVDRDGEIVAVFDVIHITHAAVATLSQVGSTSG  363

Query  736  VNEETANTMMQKFWDSAMAI--SHHDDEEMHSEASLKLASEGQETGISLPF--PSSTLQN  569
            VN E   TMMQKFWDSAMA+  +  DDE   S+ S+      Q  G   P   P   +  
Sbjct  364  VNNEATTTMMQKFWDSAMALPPTEEDDETSRSDVSVM----EQRQGDLFPILHPICQIHL  419

Query  568  TFSFKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLAS  389
               +KI+  +        +TR++TDLITAILQRL  DI+ NNLPQILYEDEDHD+VVLAS
Sbjct  420  ALKYKIKGAE------CIETRSLTDLITAILQRLEDDIDRNNLPQILYEDEDHDKVVLAS  473

Query  388  DSDLITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            D DL  AVEHA+  GWKGL+LHLDYS T   RRGS S +++YA +D
Sbjct  474  DGDLAAAVEHAKLVGWKGLKLHLDYSGTKTRRRGSDSGSMDYANSD  519



>ref|XP_010484082.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like [Camelina 
sativa]
Length=544

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 136/223 (61%), Positives = 176/223 (79%), Gaps = 10/223 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE   V+TPI++ALH MH+GKFLHLP++DK+G VVAVVDV+H+T AA++T G TAG++ 
Sbjct  298  NPESTIVDTPIVEALHIMHEGKFLHLPVTDKEGDVVAVVDVIHVTHAAVATAGTTAGIDN  357

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  NTMMQKFWDSAMA+S + DDE+  SE+S+K+ASE  ETG S PF      NTFSFKI
Sbjct  358  EATNTMMQKFWDSAMALSPNEDDEDSRSESSMKVASE-TETGKSFPF-----ANTFSFKI  411

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            E+++ R HRF SDTR++T++ITAI+QR+G DI+ +NLPQILYEDED+D+V+LASDSDL  
Sbjct  412  EEKRHRKHRFISDTRSLTEVITAIIQRVGDDIDPDNLPQILYEDEDNDKVLLASDSDLQA  471

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRR---GSGSSTIEYAQTD  251
            A+EHA+S GWK LRLHLD SR    RR      + ++EY ++D
Sbjct  472  AIEHAKSIGWKSLRLHLDDSREGKGRRRRAAVSAESMEYVESD  514



>emb|CDY66666.1| BnaAnng22680D, partial [Brassica napus]
Length=586

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 143/222 (64%), Positives = 175/222 (79%), Gaps = 9/222 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPIS-DKDGvvvavvdVLHITRAAISTVGNTAGVN  731
            NPE  +V+TPI++ALH MH+GKFLHLP++ DKDG VVAVVDV+HIT AA++T G TAG+ 
Sbjct  341  NPESTTVDTPIVEALHIMHEGKFLHLPVTTDKDGDVVAVVDVIHITHAAVATAGTTAGIG  400

Query  730  EETANTMMQKFWDSAMAISHHD-DEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFK  554
             E  NTMMQKFWDSAMA+S +D D++  SE+SLK+ASE  +TG SLPF        FSFK
Sbjct  401  NEATNTMMQKFWDSAMALSPNDEDDDTRSESSLKVASEA-DTGKSLPF-----GYMFSFK  454

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            IED+K RMHRF SDTR++T++ITAILQR+G DI+ +NLPQILYEDEDHD+V+LASDSDL 
Sbjct  455  IEDKKHRMHRFISDTRSLTEVITAILQRIGNDIDPDNLPQILYEDEDHDKVLLASDSDLQ  514

Query  373  TAVEHARSAGWKGLRLHLDYSRTPH-LRRGSGSSTIEYAQTD  251
             A++HA+S GWK LRLHLD SR     RR SGS   EY + D
Sbjct  515  AAIDHAKSIGWKSLRLHLDGSREGKGRRRASGSEATEYVERD  556



>ref|XP_002866558.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42817.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=544

 Score =   232 bits (592),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 163/198 (82%), Gaps = 7/198 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE   V+TPI++ALH MH+GKFLHLP++DK+G VVAVVDV+H+T AA++T G TAG+  
Sbjct  297  NPESTIVDTPIVEALHIMHEGKFLHLPVTDKEGDVVAVVDVIHVTHAAVATAGTTAGIGN  356

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  NTMMQKFWDSAMA+S + DDE+  SE+S+K+ASE  ETG S PF      NTFSFKI
Sbjct  357  EATNTMMQKFWDSAMALSPNEDDEDSRSESSMKVASEA-ETGKSFPF-----ANTFSFKI  410

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+K R HRF SDTR++T++ITAI+QR+G DI+ +NLPQILYEDEDHD+V+LASDSDL  
Sbjct  411  EDKKHRKHRFISDTRSLTEVITAIIQRVGDDIDPDNLPQILYEDEDHDKVLLASDSDLQA  470

Query  370  AVEHARSAGWKGLRLHLD  317
            A+EHA+S GWK LRLHLD
Sbjct  471  AIEHAKSIGWKSLRLHLD  488



>ref|XP_009130255.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like [Brassica 
rapa]
Length=544

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 173/224 (77%), Gaps = 11/224 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE  SV+TPI++ALH MH+GKFLHLP++DK+G VVAVVDV+H+T AA++T G TAG+  
Sbjct  297  NPESTSVDTPIVEALHIMHEGKFLHLPVTDKEGDVVAVVDVIHVTHAAVATAGTTAGIGN  356

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  NTMMQKFWDSAM +S + +DE+  SE+SLK+ASE  ETG SLP     L NTFSFKI
Sbjct  357  EETNTMMQKFWDSAMELSPNEEDEDTRSESSLKVASEA-ETGRSLP-----LANTFSFKI  410

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+  RMHRF SDTR++T+++TAILQR+G DI+ +NLPQILYEDEDHD+V+LASDSDL  
Sbjct  411  EDKNHRMHRFISDTRSLTEVVTAILQRVGSDIDPDNLPQILYEDEDHDKVLLASDSDLQA  470

Query  370  AVEHARSAGWKGLRLHLDYSR----TPHLRRGSGSSTIEYAQTD  251
            A++HA+S GWK LRL+LD S+    +   R       +EY  TD
Sbjct  471  AIDHAKSIGWKSLRLYLDDSKGGKGSRRRRAIVSGEAMEYVHTD  514



>emb|CDY31370.1| BnaA02g33710D [Brassica napus]
Length=544

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 173/224 (77%), Gaps = 11/224 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE  SV+TPI++ALH MH+GKFLHLP++DK+G VVAVVDV+H+T AA++T G TAG+  
Sbjct  297  NPESTSVDTPIVEALHIMHEGKFLHLPVTDKEGDVVAVVDVIHVTHAAVATAGTTAGIGN  356

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  NTMMQKFWDSAM +S + +DE+  SE+SLK+ASE  ETG SLP     L NTFSFKI
Sbjct  357  EETNTMMQKFWDSAMELSPNEEDEDTRSESSLKVASEA-ETGRSLP-----LANTFSFKI  410

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+  RMHRF SDTR++T+++TAILQR+G DI+ +NLPQILYEDEDHD+V+LASDSDL  
Sbjct  411  EDKNHRMHRFISDTRSLTEVVTAILQRVGSDIDPDNLPQILYEDEDHDKVLLASDSDLQA  470

Query  370  AVEHARSAGWKGLRLHLDYSR----TPHLRRGSGSSTIEYAQTD  251
            A++HA+S GWK LRL+LD S+    +   R       +EY  TD
Sbjct  471  AIDHAKSIGWKSLRLYLDDSKGGKGSRRRRAIVSGEAMEYVHTD  514



>emb|CDY16721.1| BnaA09g06610D [Brassica napus]
Length=659

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 165/201 (82%), Gaps = 8/201 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE  SV+TPI++ALH MH+GKFLHLP++DK+G VVAV+DV+H T AA++T G TAG+  
Sbjct  412  NPESTSVDTPIVEALHIMHEGKFLHLPVTDKEGDVVAVIDVIHATHAAVATAGTTAGIGN  471

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  NTMMQKFWDSAMA+S + +DE+  SE+SLK+ASE  ETG SLP P     NTFSFKI
Sbjct  472  EATNTMMQKFWDSAMALSPNEEDEDTRSESSLKVASEA-ETGKSLPLP-----NTFSFKI  525

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWN-NLPQILYEDEDHDQVVLASDSDLI  374
            ED+K RMHRF SDTR++T+++TAILQRLG DI+ + N+PQI YEDEDHD+V+LASDSDL 
Sbjct  526  EDKKHRMHRFISDTRSLTEVVTAILQRLGDDIDPDHNIPQIFYEDEDHDEVLLASDSDLQ  585

Query  373  TAVEHARSAGWKGLRLHLDYS  311
             A++HA+S GWK LRLHLD S
Sbjct  586  AAIDHAKSIGWKSLRLHLDDS  606



>ref|NP_201154.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein [Arabidopsis 
thaliana]
 sp|Q9FMV3.1|Y5349_ARATH RecName: Full=CBS domain-containing protein CBSCBSPB1 [Arabidopsis 
thaliana]
 dbj|BAB08814.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAF00733.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED97758.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein [Arabidopsis 
thaliana]
Length=543

 Score =   231 bits (588),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 162/198 (82%), Gaps = 7/198 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE   V+TPI++ALH MH+GKFLHLP++DK+G VVAVVDV+H+T AA++T G TAG+  
Sbjct  296  NPESTIVDTPIVEALHIMHEGKFLHLPVTDKEGDVVAVVDVIHVTHAAVATAGTTAGIGN  355

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  NTMMQKFWDSAMA+S + DDE+  SE+S+K+ASE  ETG S PF      NTFSFKI
Sbjct  356  EATNTMMQKFWDSAMALSPNEDDEDSRSESSMKVASEA-ETGKSFPF-----ANTFSFKI  409

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+K R HRF SDTR++T++ITAI+QR+G DI+ +N PQILYEDEDHD+V+LASDSDL  
Sbjct  410  EDKKHRKHRFISDTRSLTEVITAIIQRVGDDIDPDNFPQILYEDEDHDKVLLASDSDLQA  469

Query  370  AVEHARSAGWKGLRLHLD  317
            A+EHA+S GWK LRLHLD
Sbjct  470  AIEHAKSIGWKSLRLHLD  487



>emb|CDY39865.1| BnaC02g42530D [Brassica napus]
Length=699

 Score =   234 bits (596),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 139/225 (62%), Positives = 174/225 (77%), Gaps = 12/225 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE  SV+TPI++ALH MH+GKFLHLP++DK+G VVAVVDV+H+T AA++T G TAG+  
Sbjct  297  NPESTSVDTPIVEALHIMHEGKFLHLPVTDKEGDVVAVVDVIHVTHAAVATAGTTAGIGN  356

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  NTMMQKFWDSAM +S + +DE+  SE+SLK+ASE  ETG SLP     L NTFSFKI
Sbjct  357  EETNTMMQKFWDSAMELSPNEEDEDTRSESSLKVASEA-ETGRSLP-----LANTFSFKI  410

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+  RMHRF SDTR++T++ITAILQR+G DI+ +NLPQILYEDEDHD+V+LASDSDL  
Sbjct  411  EDKNHRMHRFISDTRSLTEVITAILQRVGSDIDPDNLPQILYEDEDHDKVLLASDSDLQA  470

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTI-----EYAQTD  251
            A++HA+S GWK LRL+LD S+     R    +T+     EY  TD
Sbjct  471  AIDHAKSIGWKSLRLYLDDSKGGKGARRRKRATVSGEAMEYVHTD  515



>ref|XP_009112082.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like [Brassica 
rapa]
Length=544

 Score =   230 bits (587),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 166/201 (83%), Gaps = 8/201 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE AS +TPI++ALH MH+GKFLHLP++DK+G VVAVVDV+H+T AA++T G TAG+  
Sbjct  297  NPESASADTPIVEALHIMHEGKFLHLPVTDKEGDVVAVVDVIHVTHAAVATAGTTAGIGN  356

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            +  NTMMQKFWDSAMA+S + +DE+  SE+SLK+ASE  ETG SLP P     NTFSFKI
Sbjct  357  DATNTMMQKFWDSAMALSPNEEDEDTRSESSLKVASEA-ETGKSLPLP-----NTFSFKI  410

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWN-NLPQILYEDEDHDQVVLASDSDLI  374
            ED+K RMHRF SDTR++T+++TAILQRLG DI+ + N+PQI YEDEDHD+V+LASDSDL 
Sbjct  411  EDKKHRMHRFISDTRSLTEVVTAILQRLGDDIDPDHNIPQIFYEDEDHDKVLLASDSDLQ  470

Query  373  TAVEHARSAGWKGLRLHLDYS  311
             A++HA+S GWK LRLHLD S
Sbjct  471  AAIDHAKSIGWKSLRLHLDDS  491



>ref|XP_006394271.1| hypothetical protein EUTSA_v10003950mg [Eutrema salsugineum]
 ref|XP_006394272.1| hypothetical protein EUTSA_v10003950mg [Eutrema salsugineum]
 gb|ESQ31557.1| hypothetical protein EUTSA_v10003950mg [Eutrema salsugineum]
 gb|ESQ31558.1| hypothetical protein EUTSA_v10003950mg [Eutrema salsugineum]
Length=544

 Score =   227 bits (579),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 165/198 (83%), Gaps = 7/198 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE  +V+TPI++ALH MH+GKFLHLP++DKDG VVAVVDV+H+T AA++T G TAG+  
Sbjct  297  NPESTTVDTPIVEALHIMHEGKFLHLPVTDKDGDVVAVVDVIHVTHAAVATAGTTAGIGN  356

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  NTMMQKFWDSAMA+S + +DE+  SE+SLK+ASE  ETG S PF      NTFSFKI
Sbjct  357  EATNTMMQKFWDSAMALSPNEEDEDTRSESSLKVASEA-ETGKSFPF-----ANTFSFKI  410

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+K RMHRF SDTR++T++ITAILQR+G DI+ +NLPQILYEDEDHD+V+LASDSDL  
Sbjct  411  EDKKHRMHRFISDTRSLTEVITAILQRVGNDIDPDNLPQILYEDEDHDKVLLASDSDLQA  470

Query  370  AVEHARSAGWKGLRLHLD  317
            A++HA+S GWK LRLHLD
Sbjct  471  AIDHAKSIGWKSLRLHLD  488



>emb|CDY66237.1| BnaCnng50100D [Brassica napus]
Length=640

 Score =   229 bits (584),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 164/200 (82%), Gaps = 7/200 (4%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE  SV+TPI++ALH MH+GKFLHLP++DK+G VVAVVDV+H+T AA++T G TAG+  
Sbjct  394  NPESTSVDTPIVEALHIMHEGKFLHLPVTDKEGDVVAVVDVIHVTHAAVATAGTTAGIGN  453

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  NTMMQ FWDSAMA+S + +DE+  SE+SLK+ASE  ETG SLP P     N FSFKI
Sbjct  454  EATNTMMQTFWDSAMALSPNEEDEDTRSESSLKVASEA-ETGKSLPLP-----NKFSFKI  507

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+K RMHRF SDTR++T+++TAILQRLG DI+ +++PQI YEDEDHD+V+LASDSDL  
Sbjct  508  EDKKHRMHRFISDTRSLTEVVTAILQRLGDDIDPDHIPQIFYEDEDHDKVLLASDSDLQA  567

Query  370  AVEHARSAGWKGLRLHLDYS  311
            A++HA+S GWK LRLHLD S
Sbjct  568  AIDHAKSIGWKSLRLHLDDS  587



>ref|XP_008806420.1| PREDICTED: CBS domain-containing protein CBSCBSPB1-like isoform 
X3 [Phoenix dactylifera]
Length=520

 Score =   224 bits (571),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/220 (54%), Positives = 158/220 (72%), Gaps = 23/220 (10%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC +V+TPI+D LH MHDGKFLHLP+ D+DG +V+V+DV+H+TRAA++TVG++ GV  
Sbjct  293  NPECGTVDTPIVDVLHTMHDGKFLHLPVVDRDGYIVSVMDVIHMTRAAVATVGSSGGVGN  352

Query  727  ETANTMMQKFWDSAMAISHHDDEEM-HSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E  +TMMQKF DSAMAI   DD++   SE S+K+ASE  +TG +  +P+S          
Sbjct  353  EATSTMMQKFLDSAMAIGLLDDDDDSRSEGSIKVASEVTDTGRNTFYPAS----------  402

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
                        +T+++TDLIT ILQR+G DI+ NNLPQI YEDEDHD+V+LASD+DL T
Sbjct  403  ------------ETQSLTDLITCILQRVGDDIDRNNLPQISYEDEDHDKVILASDNDLAT  450

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV+HAR AGWK LRLHL++S +   +RG  S  + +AQ D
Sbjct  451  AVDHARQAGWKSLRLHLEFSSSGRRKRGGESGGLVHAQRD  490



>ref|XP_009415889.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=535

 Score =   224 bits (572),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 151/200 (76%), Gaps = 2/200 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NP+C  ++T ILDALH M  GKFLHLP++D++G VVAV+DVLHI  AA++T  +T+ V  
Sbjct  287  NPDCRGIDTSILDALHTMRAGKFLHLPLTDRNGNVVAVIDVLHIMHAALATFESTSAVGN  346

Query  727  ETANTMMQKFWDSAMAISH-HDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E A ++MQKFW SAMA     +D+   SE S KL SE  +  +   +PSS L + FSFK+
Sbjct  347  EAAISVMQKFWGSAMATGPLEEDDNTRSEGSTKLTSEVTDM-VGSSYPSSNLPDMFSFKL  405

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED KGRMHRF  +T+++T LIT+IL+R+G DIN N+L QILYEDED D+V+LASDSDL  
Sbjct  406  EDNKGRMHRFHCETQSLTYLITSILERVGDDINKNHLAQILYEDEDGDKVILASDSDLAE  465

Query  370  AVEHARSAGWKGLRLHLDYS  311
            AV+HAR AGWKGLRLHLDYS
Sbjct  466  AVDHARLAGWKGLRLHLDYS  485



>ref|XP_007048555.1| CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein 
isoform 1 [Theobroma cacao]
 gb|EOX92712.1| CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein 
isoform 1 [Theobroma cacao]
Length=532

 Score =   224 bits (570),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 118/212 (56%), Positives = 150/212 (71%), Gaps = 1/212 (0%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++ET ILDALH MHDGKFLHLP+ DKDG V A VDVL IT AAIS V N++G   
Sbjct  288  NPECATIETTILDALHIMHDGKFLHLPVLDKDGTVAACVDVLQITHAAISMVENSSGAVN  347

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E ANTMMQKFWDSA+A+   DD +  SE S  +AS+G + G    +PS  L N+F+FK E
Sbjct  348  EMANTMMQKFWDSALALEPPDDYDTQSEMSAIMASDGGDAGKLSSYPSLGLGNSFAFKFE  407

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGR+HRF   T N+ +L++AI+ R+    N +  PQ+LYED++ D+V+LA+DSDLI A
Sbjct  408  DLKGRVHRFNCGTENLDELLSAIMPRIASS-NDHGRPQLLYEDDEGDKVLLATDSDLIVA  466

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSST  272
            V HARS G K LRLHLD + +   ++   S T
Sbjct  467  VNHARSRGLKVLRLHLDSADSDQQKKSQSSIT  498



>ref|XP_011031088.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like isoform 
X1 [Populus euphratica]
Length=555

 Score =   224 bits (570),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC ++ET ILDALH MHDGKFLHLP+ DKDG V A +DVL IT AAIS V N++G   
Sbjct  311  NPECVTLETTILDALHVMHDGKFLHLPVVDKDGSVAACLDVLQITHAAISLVENSSGAVN  370

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  +AS+  E G    +PS  L N+F+FK +
Sbjct  371  DVANTMMQKFWDSALALEPADDYDTQSEMSALMASDATELG---RYPSLGLGNSFAFKFQ  427

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGR+HR    T N+ +L++ +LQR+G D N  + PQ+LYED++ D+V+LA+D DLI+A
Sbjct  428  DLKGRVHRLNCGTENLNELLSTVLQRIGAD-NEQDRPQLLYEDDEGDKVLLATDGDLISA  486

Query  367  VEHARSAGWKGLRLHLDY  314
            V HARS G K LRLHLDY
Sbjct  487  VNHARSGGLKVLRLHLDY  504



>ref|XP_002306284.2| hypothetical protein POPTR_0005s07150g [Populus trichocarpa]
 gb|ABK96353.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE93280.2| hypothetical protein POPTR_0005s07150g [Populus trichocarpa]
Length=555

 Score =   222 bits (565),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 145/203 (71%), Gaps = 4/203 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC ++ET ILDALH MHDGKFLHLP+ DKDG V A +DVL IT AAIS V +++G   
Sbjct  311  NPECVTLETTILDALHVMHDGKFLHLPVVDKDGSVAACLDVLQITHAAISLVESSSGAVN  370

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  +AS+  E G    +PS  L N+F+FK +
Sbjct  371  DVANTMMQKFWDSALALEPADDYDTQSEMSALMASDATELG---RYPSLGLGNSFAFKFQ  427

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGR+HR    T N+ +L++ +LQR+G D N  + PQ+LYED++ D+V+LA+D DLI+A
Sbjct  428  DLKGRVHRLNCGTENLNELLSTVLQRIGAD-NEQDRPQLLYEDDEGDKVLLATDGDLISA  486

Query  367  VEHARSAGWKGLRLHLDYSRTPH  299
            V HARS G K LRLHLDY    H
Sbjct  487  VNHARSGGLKVLRLHLDYYDPSH  509



>emb|CDY13325.1| BnaC06g14320D [Brassica napus]
Length=584

 Score =   222 bits (566),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 145/202 (72%), Gaps = 3/202 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS+ET ILDALH MHDGKFLHLPI+DKDG   A VDVL IT AAIS V N++G   
Sbjct  330  NPECASLETTILDALHIMHDGKFLHLPITDKDGSAAACVDVLQITHAAISMVENSSGAVN  389

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  +     E G    +PS  L N+FSFK+E
Sbjct  390  DMANTMMQKFWDSALALDPPDDSDTQSEMSAMM--HHSELGKLTSYPSLGLGNSFSFKLE  447

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDIN-WNNLPQILYEDEDHDQVVLASDSDLIT  371
            D KGR+HRFTS   N+ +L+  ++QR+G DIN     PQI+YED++ D+V++ SDSDL+ 
Sbjct  448  DLKGRVHRFTSSAENLEELMGIVMQRIGCDINDVEQRPQIIYEDDEGDKVLITSDSDLVG  507

Query  370  AVEHARSAGWKGLRLHLDYSRT  305
            AV  ARSAG K LRLHLD++ T
Sbjct  508  AVTLARSAGQKVLRLHLDFTET  529



>ref|XP_011022844.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Populus 
euphratica]
Length=550

 Score =   221 bits (564),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 142/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC ++ET +LDALH MHDGKFLHLP+ DKDG   A VDVL IT AAIS V N++G   
Sbjct  307  NPECVTLETTVLDALHVMHDGKFLHLPVLDKDGSAAACVDVLQITHAAISMVENSSGAVN  366

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + A+TMMQKFWDSA+A+   DD +  SE S  +AS+G E G    +PS  L N+F+FK E
Sbjct  367  DAASTMMQKFWDSALALEPADDYDTQSEISALMASDGAELG---RYPSLGLGNSFAFKFE  423

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGR+HR    T N+ +L++ +LQR+G + N    PQ+LYED+D D+V+LA+D DLI A
Sbjct  424  DLKGRIHRLNCCTENLDELLSTVLQRIGAE-NEQVRPQLLYEDDDGDKVLLATDGDLIGA  482

Query  367  VEHARSAGWKGLRLHLDY  314
            V HARS G K LRLHLDY
Sbjct  483  VSHARSVGLKVLRLHLDY  500



>ref|XP_004309727.1| PREDICTED: LOW QUALITY PROTEIN: CBS domain-containing protein 
CBSCBSPB3-like [Fragaria vesca subsp. vesca]
Length=541

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 149/203 (73%), Gaps = 2/203 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++ET ILDALH MH+GKFLHLP+ D+D  V A VDVL IT AAIS V +++G   
Sbjct  297  NPECATLETTILDALHIMHEGKFLHLPVLDRDESVAACVDVLQITHAAISMVESSSGTVN  356

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  +AS+  E      +PS  L N+F+FK E
Sbjct  357  DMANTMMQKFWDSALALEPPDDTDTQSEMSAMMASDAGEQA-KFTYPSLGLGNSFAFKFE  415

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DRKGR+HR  S T N+ +L++A++QR GG  + N+ PQILYED++ D+V+LASD DL++A
Sbjct  416  DRKGRVHRLNSGTENLDELVSAVMQRTGGAKD-NDRPQILYEDDEGDRVLLASDDDLVSA  474

Query  367  VEHARSAGWKGLRLHLDYSRTPH  299
            V HAR+ G K LRLHLD+S + H
Sbjct  475  VSHARAVGQKVLRLHLDFSDSGH  497



>ref|XP_002272502.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Vitis vinifera]
 ref|XP_010652950.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Vitis vinifera]
Length=539

 Score =   220 bits (561),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 148/201 (74%), Gaps = 2/201 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++ET ILDALH MHDGKFLHLP+ DKDG + A VDVL IT AAIS V N++G   
Sbjct  294  NPECATLETTILDALHIMHDGKFLHLPVVDKDGGIAACVDVLQITHAAISMVENSSGAVN  353

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E  NT+MQKFWDS +A+   DD +  SE S  +A++G E G ++ +PS  L N+F+FK E
Sbjct  354  EVTNTIMQKFWDSTLALEPPDDYDTQSELSAVMAADGAEPGRNM-YPSLGLGNSFAFKFE  412

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGR+HRF   T ++ +L++A++QR+G   + +  PQILYED++ D+V+L++DSDL++A
Sbjct  413  DIKGRVHRFNCGTESLDELVSAVMQRIGASTDQDR-PQILYEDDEGDKVLLSTDSDLVSA  471

Query  367  VEHARSAGWKGLRLHLDYSRT  305
            V HAR  G K LRL LDYS +
Sbjct  472  VSHARVVGQKVLRLQLDYSES  492



>emb|CBI21626.3| unnamed protein product [Vitis vinifera]
Length=556

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 148/201 (74%), Gaps = 2/201 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++ET ILDALH MHDGKFLHLP+ DKDG + A VDVL IT AAIS V N++G   
Sbjct  311  NPECATLETTILDALHIMHDGKFLHLPVVDKDGGIAACVDVLQITHAAISMVENSSGAVN  370

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            E  NT+MQKFWDS +A+   DD +  SE S  +A++G E G ++ +PS  L N+F+FK E
Sbjct  371  EVTNTIMQKFWDSTLALEPPDDYDTQSELSAVMAADGAEPGRNM-YPSLGLGNSFAFKFE  429

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGR+HRF   T ++ +L++A++QR+G   + +  PQILYED++ D+V+L++DSDL++A
Sbjct  430  DIKGRVHRFNCGTESLDELVSAVMQRIGASTDQDR-PQILYEDDEGDKVLLSTDSDLVSA  488

Query  367  VEHARSAGWKGLRLHLDYSRT  305
            V HAR  G K LRL LDYS +
Sbjct  489  VSHARVVGQKVLRLQLDYSES  509



>ref|XP_009125245.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Brassica 
rapa]
Length=554

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 144/202 (71%), Gaps = 3/202 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS+ET ILDALH MHDGKFLHLPI DKDG   A VDVL IT AAIS V N++G   
Sbjct  300  NPECASLETTILDALHIMHDGKFLHLPIMDKDGSAAACVDVLQITHAAISMVENSSGAVN  359

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   +D +  SE S  +     E G    +PS  L N+FSFK+E
Sbjct  360  DMANTMMQKFWDSALALDPPEDSDTQSEMSAMM--HHSELGKLTSYPSLGLGNSFSFKLE  417

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDIN-WNNLPQILYEDEDHDQVVLASDSDLIT  371
            D KGR+HRFTS   N+ +L+  ++QR+G DIN     PQI+YED++ D+V++ SDSDL+ 
Sbjct  418  DLKGRVHRFTSSAENLEELMGIVMQRIGSDINDVEQRPQIIYEDDEGDKVLITSDSDLVG  477

Query  370  AVEHARSAGWKGLRLHLDYSRT  305
            AV  ARSAG K LRLHLD++ T
Sbjct  478  AVTLARSAGQKVLRLHLDFTET  499



>ref|XP_009415888.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=543

 Score =   219 bits (559),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 152/208 (73%), Gaps = 10/208 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NP+C  ++T ILDALH M  GKFLHLP++D++G VVAV+DVLHI  AA++T  +T+ V  
Sbjct  287  NPDCRGIDTSILDALHTMRAGKFLHLPLTDRNGNVVAVIDVLHIMHAALATFESTSAVGN  346

Query  727  ETANTMMQKFWDSAMA---ISHHDDEEMH------SEASLKLASEGQETGISLPFPSSTL  575
            E A ++MQKFW SAMA   +   D+   H      SE S KL SE  +  +   +PSS L
Sbjct  347  EAAISVMQKFWGSAMATGPLEEDDNTRSHQLWLCSSEGSTKLTSEVTDM-VGSSYPSSNL  405

Query  574  QNTFSFKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVL  395
             + FSFK+ED KGRMHRF  +T+++T LIT+IL+R+G DIN N+L QILYEDED D+V+L
Sbjct  406  PDMFSFKLEDNKGRMHRFHCETQSLTYLITSILERVGDDINKNHLAQILYEDEDGDKVIL  465

Query  394  ASDSDLITAVEHARSAGWKGLRLHLDYS  311
            ASDSDL  AV+HAR AGWKGLRLHLDYS
Sbjct  466  ASDSDLAEAVDHARLAGWKGLRLHLDYS  493



>emb|CDX67553.1| BnaA07g15930D [Brassica napus]
Length=562

 Score =   219 bits (559),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 144/202 (71%), Gaps = 3/202 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS+ET ILDALH MHDGKFLHLPI DKDG   A VDVL IT AAIS V N++G   
Sbjct  308  NPECASLETTILDALHIMHDGKFLHLPIMDKDGSAAACVDVLQITHAAISMVENSSGAVN  367

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  +     E G    +PS  L N+FSFK+E
Sbjct  368  DMANTMMQKFWDSALALDPPDDSDTQSEMSAMM--HHSELGKLTSYPSLGLGNSFSFKLE  425

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDI-NWNNLPQILYEDEDHDQVVLASDSDLIT  371
            D KGR+HRFTS   N+ +L+  ++QR+G DI +    PQI+YED++ D+V++ SDSDL+ 
Sbjct  426  DLKGRVHRFTSSAENLEELMGIVMQRIGSDISDVEQRPQIIYEDDEGDKVLITSDSDLVG  485

Query  370  AVEHARSAGWKGLRLHLDYSRT  305
            AV  ARSAG K LRLHLD++ T
Sbjct  486  AVTLARSAGQKVLRLHLDFTET  507



>ref|XP_010237711.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Brachypodium 
distachyon]
Length=544

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 121/232 (52%), Positives = 160/232 (69%), Gaps = 19/232 (8%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAG--V  734
            +P+CA+V+TPILDAL  M + KFLHLP+ D+DG +V +VDV+ IT AAIS V ++ G   
Sbjct  290  DPDCATVDTPILDALRTMQERKFLHLPVMDRDGSIVCIVDVIDITHAAISIVESSGGGVS  349

Query  733  NEETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQ--------ETGISLPFPSST  578
            N++ A +M+Q+FWDSAMA+   DDE   S++ +  AS  Q          G   P+P+  
Sbjct  350  NDDAAISMIQRFWDSAMALEPLDDET-DSQSQMSEASRSQIMSEVNHEAAGAEPPYPA--  406

Query  577  LQNTFSFKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVV  398
                FSFK++DR+G MHRF+ + +++T L+T+ILQRLG DI+ + LPQILYEDED D+VV
Sbjct  407  ---LFSFKLQDRRGWMHRFSCEVQSLTPLVTSILQRLGADIDHDRLPQILYEDEDQDKVV  463

Query  397  LASDSDLITAVEHARSAGWKGLRLHLDYSRTPHLRRG---SGSSTIEYAQTD  251
            LASD DLI AV+HAR AGWKGLRL LDYS T   RR    SG +T+  A  D
Sbjct  464  LASDDDLIAAVDHARLAGWKGLRLFLDYSGTTGRRRSLATSGGATMALANRD  515



>ref|XP_006432072.1| hypothetical protein CICLE_v10000793mg [Citrus clementina]
 ref|XP_006464944.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Citrus 
sinensis]
 gb|ESR45312.1| hypothetical protein CICLE_v10000793mg [Citrus clementina]
Length=540

 Score =   219 bits (558),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 146/199 (73%), Gaps = 2/199 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA++ET ILDALH MHDGKFLHLP+ DKDG V A +DVL IT AAIS V + +G   
Sbjct  294  SPECATMETTILDALHIMHDGKFLHLPVIDKDGGVAACLDVLQITHAAISMVESGSGAVN  353

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   +D + HSE S  + SEG E G    +PS  L N+F+FK E
Sbjct  354  DMANTMMQKFWDSALALEPPEDYDTHSEMSGLMTSEGTEQG-KFTYPSLGLGNSFAFKFE  412

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DRKGR+HRF   T N+ +L++ ++QR+G   N  + PQ+LYED++ D+V+LA+D+DL+ A
Sbjct  413  DRKGRVHRFNCGTENVDELLSTVMQRIGAG-NDGDRPQLLYEDDEGDKVLLATDADLVGA  471

Query  367  VEHARSAGWKGLRLHLDYS  311
            + HARS G K LRLHLD S
Sbjct  472  ISHARSVGLKVLRLHLDNS  490



>gb|KDP23089.1| hypothetical protein JCGZ_00502 [Jatropha curcas]
Length=533

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 110/199 (55%), Positives = 147/199 (74%), Gaps = 2/199 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++ET ILDALH MHDGKFLHLP+ DK+G + A +DVLHIT AAIS V +++G   
Sbjct  289  NPECATLETTILDALHIMHDGKFLHLPVVDKEGSLAACIDVLHITHAAISMVESSSGAVN  348

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  + S+G + G    +PS  L N+F+FK  
Sbjct  349  DVANTMMQKFWDSALALDPPDDYDTQSEMSAIMTSDGTDVG-KYAYPSLGLGNSFAFKFV  407

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGR+HRF   T N+ +L +A+LQR+ G +N  + PQ++YED++ D+V+LA++ DLI A
Sbjct  408  DLKGRVHRFNFGTENLGELTSAVLQRI-GILNGQDHPQLMYEDDEGDKVLLATEGDLIGA  466

Query  367  VEHARSAGWKGLRLHLDYS  311
            V HAR+AG K LRLHLD+S
Sbjct  467  VNHARTAGLKALRLHLDFS  485



>ref|XP_009769594.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Nicotiana 
sylvestris]
Length=544

 Score =   218 bits (556),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA++ET IL ALH MHDGKFLHLP+ D+DG  VA +DVL IT AAIS V + +G   
Sbjct  296  SPECATLETTILQALHIMHDGKFLHLPVLDRDGCAVACIDVLQITHAAISMVESGSGAVN  355

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLK--LASEGQETGISLPFPSSTLQNTFSFK  554
            E ANT+MQKFWDSA+ +   DD +  SE S+   + SEG E G S  +PS  L NTF+FK
Sbjct  356  EVANTVMQKFWDSALNLEPPDDYDTLSEMSMSQLMMSEGTEAGKS-GYPSLGLGNTFAFK  414

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
             ED KGR+HRF+  + N+ +L+T ++QRLG  ++ +N PQ+LYED++ D+V+L +DSDL+
Sbjct  415  FEDLKGRVHRFSFGSENLVELVTVVMQRLGA-VDEHNRPQLLYEDDEGDKVLLTTDSDLV  473

Query  373  TAVEHARSAGWKGLRLHLDYS  311
             AV HARS G K LRLHLDYS
Sbjct  474  AAVNHARSVGLKALRLHLDYS  494



>ref|XP_009624290.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Nicotiana 
tomentosiformis]
Length=542

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 147/200 (74%), Gaps = 4/200 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECA++ET IL+ALH MHDGKFLHLP+ D+DG  VA +DVL IT AAIS V +++G   
Sbjct  294  SPECATLETTILEALHIMHDGKFLHLPVLDRDGCAVACIDVLQITHAAISMVESSSGAVN  353

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLK--LASEGQETGISLPFPSSTLQNTFSFK  554
            E ANT+MQKFWDSA+ +   DD +  SE S+   + SEG E G S  +PS  L NTF+FK
Sbjct  354  EVANTVMQKFWDSALNLEPPDDFDTLSEMSMSQLMMSEGTEAGKS-GYPSLGLGNTFAFK  412

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
             ED KGR+HRF+  + N+ +L+T ++QRLG  ++  N PQ+LYED++ D+V+L +DSDL+
Sbjct  413  FEDLKGRVHRFSFGSENLVELVTVVMQRLGA-VDEQNRPQLLYEDDEGDKVLLTTDSDLV  471

Query  373  TAVEHARSAGWKGLRLHLDY  314
             AV HARS G K LRLHLDY
Sbjct  472  GAVNHARSVGLKALRLHLDY  491



>ref|XP_002309952.2| hypothetical protein POPTR_0007s04880g [Populus trichocarpa]
 gb|EEE90402.2| hypothetical protein POPTR_0007s04880g [Populus trichocarpa]
Length=551

 Score =   218 bits (555),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 143/198 (72%), Gaps = 4/198 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC ++ET +LDALH MHDGKFLHLP+ DKDG   A VDVL IT AAIS V +++G   
Sbjct  307  NPECVTLETTVLDALHVMHDGKFLHLPVLDKDGSAAACVDVLQITHAAISMVESSSGAVN  366

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + A+TMMQKFWDSA+A+   DD +  SE S  +AS+G E G    +PS  L N+F+FK E
Sbjct  367  DAASTMMQKFWDSALALEPPDDYDTQSEMSALMASDGAELG---RYPSLGLGNSFAFKFE  423

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGR+HR    T N+ +L++ +LQR+G + +  + PQ+LYED+D D+V+LA+D DLI A
Sbjct  424  DLKGRIHRLNCCTENLDELLSTVLQRIGAE-SEQDRPQLLYEDDDGDKVLLATDGDLIGA  482

Query  367  VEHARSAGWKGLRLHLDY  314
            V HARS G K LRLHLDY
Sbjct  483  VSHARSVGLKVLRLHLDY  500



>ref|XP_010530693.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Tarenaya 
hassleriana]
Length=553

 Score =   217 bits (552),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 149/209 (71%), Gaps = 2/209 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++ET ILDALH MHDGKFLHLP+ DKDG   A VDVL IT AAIS V N+ G   
Sbjct  303  NPECAALETTILDALHIMHDGKFLHLPVLDKDGSPAACVDVLQITHAAISMVENSTGAVN  362

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD + HSE S  + S+G ETG    F S  L N+F+FK E
Sbjct  363  DMANTMMQKFWDSALALEPQDDFDTHSEMSAMMHSDGAETG-KQSFLSVGLGNSFAFKFE  421

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLG-GDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            D KGR+HR TS   N+ +L+T ++QR+G GD N    PQ+LYED++ D+V++ +D DL +
Sbjct  422  DLKGRVHRVTSAPENLEELMTMVMQRIGNGDDNNLERPQLLYEDDEGDKVLITADGDLTS  481

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGS  284
            AV  A+SAG K LRLHLD++ +   ++G+
Sbjct  482  AVTAAKSAGKKVLRLHLDFTESTDGQKGN  510



>ref|XP_010025715.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Eucalyptus 
grandis]
 gb|KCW62433.1| hypothetical protein EUGRSUZ_H05076 [Eucalyptus grandis]
Length=551

 Score =   216 bits (550),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 113/214 (53%), Positives = 150/214 (70%), Gaps = 2/214 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC  +ET ILDALH MHDGKFLHLP+ DK+G + A VDVL IT AAIS V N +G   
Sbjct  305  NPECVMLETTILDALHIMHDGKFLHLPVLDKEGCIAACVDVLQITHAAISMVENGSGSVN  364

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD + HS+ S  + SEG E+  S  +PS  L N+F+FK E
Sbjct  365  DMANTMMQKFWDSALALEPPDDYDTHSDMSAAMPSEGLESNKS-AYPSLGLGNSFAFKFE  423

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGRMH+    T N+ +L++A+LQR+G   +    P +LYED++ D+V+LA+D+DL+ A
Sbjct  424  DLKGRMHKLNCGTENLDELLSAVLQRIGVGHDSQR-PHLLYEDDEGDKVLLATDADLVGA  482

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIE  266
            V HARS+G K +RLHLD+S T    R   ++ +E
Sbjct  483  VGHARSSGQKAVRLHLDFSETSQQLRSPAATDME  516



>ref|XP_006341904.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Solanum 
tuberosum]
Length=540

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 146/201 (73%), Gaps = 4/201 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++ET IL+ALH MHDGKFLHLPI D+DG V A +DVL IT AAIS V N++G   
Sbjct  295  NPECATLETTILEALHIMHDGKFLHLPIIDRDGCVAACIDVLQITHAAISMVENSSGAVN  354

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLK--LASEGQETGISLPFPSSTLQNTFSFK  554
            E ANTMMQKFWDSA+ +   DD +  SE S+   + SEG E G S  +PS  L NTF+FK
Sbjct  355  EMANTMMQKFWDSALNLEPPDDYDTLSEMSMSQLMMSEGAEAGKS-GYPSLGLGNTFAFK  413

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
              D KGR++RF   + ++ +L+TA++QRLG  ++  N P +LYED++ D+V+L +DSDL+
Sbjct  414  FVDLKGRVNRFNFGSESLLELVTAVMQRLGA-VDEQNRPHLLYEDDEGDKVLLTTDSDLV  472

Query  373  TAVEHARSAGWKGLRLHLDYS  311
             AV HARS G K LRLHLDYS
Sbjct  473  GAVSHARSLGLKVLRLHLDYS  493



>ref|XP_008378756.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Malus 
domestica]
Length=542

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 147/203 (72%), Gaps = 3/203 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++ET ILDALH MH+GKFLHLP+ D+DG V A VDVL IT AAIS V N++G   
Sbjct  299  NPECATLETTILDALHIMHEGKFLHLPVLDRDGCVAACVDVLQITHAAISMVENSSGTVN  358

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  +AS+G +   S  +PS  L N+F+FK E
Sbjct  359  DMANTMMQKFWDSALALEPPDDCDTQSEMSALMASDGADGKFS--YPSLGLGNSFAFKFE  416

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D +GR+HR      N+ +L++AI++R+G   N ++ P IL+EDED D+V+LA+D DLI+A
Sbjct  417  DLRGRVHRINCGMENLDELVSAIMKRIGA-ANDHDRPHILFEDEDGDRVLLATDDDLISA  475

Query  367  VEHARSAGWKGLRLHLDYSRTPH  299
            V HAR  G K LRLHLD+S + H
Sbjct  476  VSHARGVGLKVLRLHLDFSDSGH  498



>ref|XP_002528012.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34368.1| conserved hypothetical protein [Ricinus communis]
Length=546

 Score =   215 bits (548),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 143/199 (72%), Gaps = 2/199 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++ET ILDALH MHDGKFLHLP+ DKDG   A VDVL IT AAIS V N++G   
Sbjct  302  NPECATLETTILDALHIMHDGKFLHLPVVDKDGSATACVDVLQITHAAISMVENSSGAAN  361

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  + S+G + G    +P   L N+F+FK  
Sbjct  362  DVANTMMQKFWDSALALEPPDDYDTQSEMSAIMTSDGTDLG-KYAYPPVGLGNSFAFKFV  420

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGR+HRF   T N+ +L +A+LQR+G  +   + PQ+LYED++ D+V+L +D DLI+A
Sbjct  421  DLKGRVHRFNCGTENLDELTSALLQRIGVSLGQEH-PQLLYEDDEGDKVLLVTDGDLISA  479

Query  367  VEHARSAGWKGLRLHLDYS  311
            + HA++AG K L+LHLD+S
Sbjct  480  INHAKTAGLKVLKLHLDFS  498



>gb|AAM91587.1| putative protein [Arabidopsis thaliana]
 gb|AAN15439.1| putative protein [Arabidopsis thaliana]
Length=469

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 145/216 (67%), Gaps = 11/216 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS+ET ILDALH MHDGKFLHLPI DKDG   A VDVL IT AAIS V N++G   
Sbjct  218  NPECASLETTILDALHTMHDGKFLHLPIIDKDGSAAACVDVLQITHAAISMVENSSGAVN  277

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  +     + G    +PS  L N+FSFK E
Sbjct  278  DMANTMMQKFWDSALALEPPDDSDTQSEMSAMM--HHSDIGKLSSYPSLGLGNSFSFKFE  335

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGD-INWNNLPQILYEDEDHDQVVLASDSDLIT  371
            D KGR+HRFTS   N+ +L+  ++QR+G D  N    PQI+YED++ D+V++ SDSDL+ 
Sbjct  336  DLKGRVHRFTSGAENLEELMGIVMQRIGSDNNNVEQRPQIIYEDDEGDKVLITSDSDLVG  395

Query  370  AVEHARSAGWKGLRLHLDY--------SRTPHLRRG  287
            AV  ARS G K LRLHLD+        S T  L++G
Sbjct  396  AVTLARSTGQKVLRLHLDFTESTRSLSSETTQLKKG  431



>ref|XP_004252207.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Solanum lycopersicum]
Length=543

 Score =   214 bits (545),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 154/216 (71%), Gaps = 5/216 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++ET IL+ALH MHDGKFLHLPI D+DG VVA +DVL IT AAIS V N++G   
Sbjct  298  NPECATLETTILEALHIMHDGKFLHLPIIDRDGCVVACIDVLQITHAAISMVENSSGAVN  357

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLK--LASEGQETGISLPFPSSTLQNTFSFK  554
            E ANTMMQKFWDSA+ +   DD +  SE S+   + SEG E G S  +P   L NTF+FK
Sbjct  358  EMANTMMQKFWDSALNLEPPDDYDSLSEMSMSQLMMSEGAEAGKS-GYPLLGLGNTFAFK  416

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
              D KGR++RF   + ++ +L+TA++QRLG  ++  N PQ+LYED++ D+V+L +DSDL+
Sbjct  417  FVDLKGRVNRFNFGSESLLELVTAVVQRLGA-VDEQNRPQLLYEDDEGDKVLLTTDSDLV  475

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIE  266
             A+ HARS G K LRLHLDYS    + +G  S ++E
Sbjct  476  GAISHARSLGLKVLRLHLDYSDVKAV-QGLSSPSVE  510



>ref|XP_006290839.1| hypothetical protein CARUB_v10016950mg [Capsella rubella]
 gb|EOA23737.1| hypothetical protein CARUB_v10016950mg [Capsella rubella]
Length=557

 Score =   214 bits (546),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 148/220 (67%), Gaps = 6/220 (3%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS+ET ILDALH MHDGKFLHLPI DKDG   A VDVL IT AAIS V N++G   
Sbjct  306  NPECASLETTILDALHIMHDGKFLHLPIIDKDGSAAACVDVLQITHAAISMVENSSGAVN  365

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  +  +  + G    +PS  L N+FSFK E
Sbjct  366  DMANTMMQKFWDSALALEPPDDSDTQSEMSAMM--QQSDIGKLSSYPSLGLGNSFSFKFE  423

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGD-INWNNLPQILYEDEDHDQVVLASDSDLIT  371
            D KGR+HRFTS   N+ +L+  ++QR+G D  N    PQI+YED++ D+V++ SDSDL+ 
Sbjct  424  DLKGRVHRFTSAAENLEELMGIVMQRIGSDNNNVEQRPQIIYEDDEGDKVLITSDSDLVG  483

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV  ARS G K LRLHLD++ +    R   S T +  + D
Sbjct  484  AVTLARSTGQKVLRLHLDFTES---TRSLSSETTQLKKAD  520



>ref|XP_008244974.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Prunus mume]
Length=540

 Score =   214 bits (544),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 147/203 (72%), Gaps = 3/203 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++ET ILDALH MH+GKFLHLP+ D+DG V A VDVL IT AAIS V +++G   
Sbjct  297  NPECATLETTILDALHIMHEGKFLHLPVLDRDGSVAACVDVLQITHAAISMVESSSGTAN  356

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
              ANTMMQKFWDSA+A+   DD +  SE S  +AS+G +     P+PS  L N+F+FK E
Sbjct  357  TMANTMMQKFWDSALALEPPDDCDTQSELSALMASDGTDG--KFPYPSLGLGNSFAFKFE  414

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D +GRMHR      N+ +L++A++QR+G   N ++ P IL+ED++ D+V+LA+D DL++A
Sbjct  415  DIRGRMHRINCGMENLDELLSAVMQRIGA-ANDHDRPHILFEDDEGDRVLLATDDDLVSA  473

Query  367  VEHARSAGWKGLRLHLDYSRTPH  299
            V HAR AG K LRLHLD+S + H
Sbjct  474  VSHARGAGLKVLRLHLDFSDSGH  496



>ref|XP_009420329.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=496

 Score =   212 bits (540),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 164/221 (74%), Gaps = 5/221 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC +++TPI DALH MHD KFLHLP+ D+DG VVAVVDV+HI  AAI+ VG+  G   
Sbjct  249  NPECGTIDTPIADALHTMHDRKFLHLPVVDRDGDVVAVVDVIHIAHAAIAAVGSRTGGGI  308

Query  727  ETANTMMQKFWDSAMAIS--HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFK  554
            ETA++MMQ F DSA+++   +HDD+   SE S ++ ++ + +  S  +P S L  +F FK
Sbjct  309  ETASSMMQNFLDSALSLQPLYHDDD-CQSEGSTQVTADTERS--SAFYPPSDLSASFGFK  365

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            +ED++ RMHRF  +T ++ DLIT ILQ +G DI+ N+LPQILYEDEDHD+V+LASDSDL+
Sbjct  366  LEDKQQRMHRFNCETHSLADLITCILQGVGDDIDRNHLPQILYEDEDHDKVILASDSDLV  425

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
             AV+HAR +GWK LRLHLD+S   H ++G GS  +E A TD
Sbjct  426  AAVDHARQSGWKSLRLHLDFSGLGHKKKGHGSGDLECADTD  466



>ref|NP_190863.3| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein [Arabidopsis 
thaliana]
 ref|NP_001190074.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein [Arabidopsis 
thaliana]
 sp|Q9LF97.1|Y3295_ARATH RecName: Full=CBS domain-containing protein CBSCBSPB3 [Arabidopsis 
thaliana]
 emb|CAB86899.1| putative protein [Arabidopsis thaliana]
 gb|AEE79016.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE79017.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein [Arabidopsis 
thaliana]
Length=556

 Score =   213 bits (543),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/216 (54%), Positives = 145/216 (67%), Gaps = 11/216 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS+ET ILDALH MHDGKFLHLPI DKDG   A VDVL IT AAIS V N++G   
Sbjct  305  NPECASLETTILDALHTMHDGKFLHLPIIDKDGSAAACVDVLQITHAAISMVENSSGAVN  364

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  +     + G    +PS  L N+FSFK E
Sbjct  365  DMANTMMQKFWDSALALEPPDDSDTQSEMSAMM--HHSDIGKLSSYPSLGLGNSFSFKFE  422

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGD-INWNNLPQILYEDEDHDQVVLASDSDLIT  371
            D KGR+HRFTS   N+ +L+  ++QR+G D  N    PQI+YED++ D+V++ SDSDL+ 
Sbjct  423  DLKGRVHRFTSGAENLEELMGIVMQRIGSDNNNVEQRPQIIYEDDEGDKVLITSDSDLVG  482

Query  370  AVEHARSAGWKGLRLHLDY--------SRTPHLRRG  287
            AV  ARS G K LRLHLD+        S T  L++G
Sbjct  483  AVTLARSTGQKVLRLHLDFTESTRSLSSETTQLKKG  518



>gb|EEE52132.1| hypothetical protein OsJ_33959 [Oryza sativa Japonica Group]
Length=542

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 114/210 (54%), Positives = 155/210 (74%), Gaps = 13/210 (6%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV-GNTAG-V  734
            +PECA+V+ PILDAL  M + KFLHLP+ D+DG +V+++DV+ IT AA S V GN  G V
Sbjct  282  DPECATVDMPILDALRIMQERKFLHLPVMDRDGSIVSILDVIDITHAAFSIVEGNGDGAV  341

Query  733  NEETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQN--TFS  560
            N++ A +M+Q+FWDSAMA+   DDE + S++ +  AS  Q          S + N  +FS
Sbjct  342  NDDAAISMVQRFWDSAMALGPLDDE-IESQSQISEASRSQMM--------SDIHNEQSFS  392

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++DR+GRMHRF+ + +++T LIT ILQRLG D++ ++LPQILYEDED D+VVLASD D
Sbjct  393  FKLQDRRGRMHRFSCEVQSLTPLITCILQRLGPDLDRDHLPQILYEDEDRDKVVLASDDD  452

Query  379  LITAVEHARSAGWKGLRLHLDYSRTPHLRR  290
            L  AV+HAR AGWKGL+L+LDYS +  +RR
Sbjct  453  LTAAVDHARLAGWKGLKLYLDYSGSSGVRR  482



>ref|XP_009420328.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=534

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 123/221 (56%), Positives = 164/221 (74%), Gaps = 5/221 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC +++TPI DALH MHD KFLHLP+ D+DG VVAVVDV+HI  AAI+ VG+  G   
Sbjct  287  NPECGTIDTPIADALHTMHDRKFLHLPVVDRDGDVVAVVDVIHIAHAAIAAVGSRTGGGI  346

Query  727  ETANTMMQKFWDSAMAIS--HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFK  554
            ETA++MMQ F DSA+++   +HDD+   SE S ++ ++ + +  S  +P S L  +F FK
Sbjct  347  ETASSMMQNFLDSALSLQPLYHDDD-CQSEGSTQVTADTERS--SAFYPPSDLSASFGFK  403

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            +ED++ RMHRF  +T ++ DLIT ILQ +G DI+ N+LPQILYEDEDHD+V+LASDSDL+
Sbjct  404  LEDKQQRMHRFNCETHSLADLITCILQGVGDDIDRNHLPQILYEDEDHDKVILASDSDLV  463

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
             AV+HAR +GWK LRLHLD+S   H ++G GS  +E A TD
Sbjct  464  AAVDHARQSGWKSLRLHLDFSGLGHKKKGHGSGDLECADTD  504



>ref|XP_006847013.1| hypothetical protein AMTR_s00017p00156440 [Amborella trichopoda]
 gb|ERN08594.1| hypothetical protein AMTR_s00017p00156440 [Amborella trichopoda]
Length=542

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/218 (54%), Positives = 149/218 (68%), Gaps = 6/218 (3%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+++  ILDALH MHDGKFLHLP+ D+DG + A VDVL IT+AAIS V    G   
Sbjct  295  NPECATLDHTILDALHIMHDGKFLHLPVLDRDGNIAACVDVLQITQAAISMVEGGTGAVN  354

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            + ANTMMQKFWDSA+A+    DD +  S+ S  + ++G E+G S  +PS  L NTFSFK 
Sbjct  355  DVANTMMQKFWDSALALEPPEDDYDTQSDVSALMVADGMESGRS-AYPSLGLGNTFSFKF  413

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            EDRKGR+HRF   T N+ +L  A+LQR+G     +  PQ+LY D++ D+V+L+SDSDL+ 
Sbjct  414  EDRKGRVHRFNFGTENLGELSNAVLQRIGHS-EEDRPPQLLYLDDEGDKVLLSSDSDLVA  472

Query  370  AVEHARSAGWKGLRLHLDYS---RTPHLRRGSGSSTIE  266
            A  HAR AGWK LRLHLDYS      H +  SG   +E
Sbjct  473  ATNHARIAGWKVLRLHLDYSDHQEKSHSKSTSGVEVME  510



>ref|XP_009379458.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Pyrus 
x bretschneideri]
Length=546

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 144/203 (71%), Gaps = 3/203 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC ++ET ILDALH MH+GKFLHLP+ D+DG V A VDVL IT AAIS V N++G   
Sbjct  303  NPECGTLETTILDALHIMHEGKFLHLPVLDRDGCVAACVDVLQITHAAISMVENSSGTVN  362

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  +ASEG +   S  +PS  L N+F+FK E
Sbjct  363  DMANTMMQKFWDSALALEPPDDCDTQSEMSALMASEGADGKFS--YPSLGLGNSFAFKFE  420

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D +GR+HR      N+ +L++AI++R+G   N  + P IL+EDED D+V+LA+D DLI+ 
Sbjct  421  DLRGRVHRINCGMENLDELVSAIMKRIGA-ANDLDRPHILFEDEDGDRVLLATDDDLIST  479

Query  367  VEHARSAGWKGLRLHLDYSRTPH  299
            V HAR  G K LRLHLD+S + H
Sbjct  480  VSHARGVGLKVLRLHLDFSDSGH  502



>ref|XP_010426927.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Camelina 
sativa]
Length=556

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 148/220 (67%), Gaps = 6/220 (3%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS+ET ILDALH MHDGKFLHLPI DKDG   A VDVL IT AAIS V N++G   
Sbjct  305  NPECASLETTILDALHIMHDGKFLHLPIIDKDGTAAACVDVLQITHAAISMVENSSGAVN  364

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  +     + G    +PS  L N+FSFK E
Sbjct  365  DMANTMMQKFWDSALALEPPDDSDTQSEMSAMM--HHSDIGKLSSYPSLGLGNSFSFKFE  422

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDIN-WNNLPQILYEDEDHDQVVLASDSDLIT  371
            D KGR+HRFTS   N+ +L+  ++QR+G + N     PQI+YED++ D+V++ SDSDL+ 
Sbjct  423  DLKGRVHRFTSAAENLEELMGIVMQRIGSENNSVEQRPQIIYEDDEGDKVLITSDSDLVG  482

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQTD  251
            AV  ARS G K LRLHLD++ +    R   S TI+  + D
Sbjct  483  AVTLARSTGQKVLRLHLDFTES---SRSLSSETIQLKKED  519



>ref|XP_010504047.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Camelina 
sativa]
 ref|XP_010504048.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Camelina 
sativa]
Length=557

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 141/202 (70%), Gaps = 3/202 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS+ET ILDALH MHDGKFLHLPI DKDG   A VDVL IT AAIS V N++G   
Sbjct  306  NPECASLETTILDALHIMHDGKFLHLPIIDKDGTAAACVDVLQITHAAISMVENSSGAVN  365

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  +     + G    +PS  L N+FSFK E
Sbjct  366  DMANTMMQKFWDSALALEPPDDSDTQSEMSAMM--HHSDIGKLGSYPSLGLGNSFSFKFE  423

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDIN-WNNLPQILYEDEDHDQVVLASDSDLIT  371
            D KGR+HRFTS   N+ +L+  ++QR+G D N     PQI+YED++ D+V++ SDSDL+ 
Sbjct  424  DLKGRVHRFTSAAENLEELMGVVMQRIGSDNNSVEQRPQIIYEDDEGDKVLITSDSDLVG  483

Query  370  AVEHARSAGWKGLRLHLDYSRT  305
            AV  ARS G K LRLHLD++ +
Sbjct  484  AVTLARSTGQKVLRLHLDFTES  505



>ref|XP_010515774.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Camelina 
sativa]
 ref|XP_010515775.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Camelina 
sativa]
Length=558

 Score =   212 bits (540),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 143/204 (70%), Gaps = 7/204 (3%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS+ET ILDALH MHDGKFLHLPI DKDG   A VDVL IT AAIS V N++G   
Sbjct  307  NPECASLETTILDALHIMHDGKFLHLPIIDKDGTAAACVDVLQITHAAISMVENSSGAVN  366

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKL--ASEGQETGISLPFPSSTLQNTFSFK  554
            + ANTMMQKFWDSA+A+   DD +  SE S  +  A  G+ +     +PS  L N+FSFK
Sbjct  367  DMANTMMQKFWDSALALEPPDDSDTQSEMSAMMHHADIGKLSS----YPSLGLGNSFSFK  422

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDIN-WNNLPQILYEDEDHDQVVLASDSDL  377
             ED KGR+HRFTS   N+ +L+  ++QR+G D N     PQI+YED++ D+V++ SDSDL
Sbjct  423  FEDLKGRVHRFTSAAENLEELMGIVMQRIGSDNNSVEQRPQIIYEDDEGDKVLITSDSDL  482

Query  376  ITAVEHARSAGWKGLRLHLDYSRT  305
            + AV  ARS G K LRLHLD++ +
Sbjct  483  VGAVTLARSTGQKVLRLHLDFTES  506



>ref|XP_004979306.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like [Setaria 
italica]
Length=534

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 148/219 (68%), Gaps = 13/219 (6%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PECASV+ PILDAL  M + KFLHLP+  +DG +++++DV+ IT AAIS V NT   ++
Sbjct  280  DPECASVDMPILDALRTMQEHKFLHLPVMGRDGSIISILDVIDITHAAISIVENTGEGSD  339

Query  727  ETANTMMQKFWDSAMAISHHDDE--------EMHSEASLKLASEGQETGISLPFPSSTLQ  572
            + A +M+Q+FWDSAMA+S  DDE        EM     +  A      G    +PS    
Sbjct  340  DAAASMIQRFWDSAMALSPLDDETETQSQMSEMSRSQMMSDAHHESVGGSEAAYPS----  395

Query  571  NTFSFKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLA  392
              FSFK++DR+GRMHRF+ + +++T L+T IL+RLG DI+   LPQILYEDED D+VVLA
Sbjct  396  -LFSFKLQDRRGRMHRFSCEVQSLTPLVTCILRRLGADIDPERLPQILYEDEDGDKVVLA  454

Query  391  SDSDLITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSS  275
            SD DL  AV+HAR AGWKGL+L LDYS T   R+   SS
Sbjct  455  SDDDLAAAVDHARMAGWKGLKLFLDYSGTSGRRKAVASS  493



>ref|XP_006403747.1| hypothetical protein EUTSA_v10010265mg [Eutrema salsugineum]
 gb|ESQ45200.1| hypothetical protein EUTSA_v10010265mg [Eutrema salsugineum]
Length=547

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 141/203 (69%), Gaps = 4/203 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS+ET ILDALH MHDGKFLHLPI DKDG   A VDVL IT AAIS V N++G   
Sbjct  299  NPECASLETTILDALHIMHDGKFLHLPILDKDGSAAACVDVLQITHAAISMVENSSGAVN  358

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  +     + G    +PS  L N+FSFK E
Sbjct  359  DMANTMMQKFWDSALALEPPDDSDTQSEMSAMM--HHSDIGKLASYPSLGLGNSFSFKFE  416

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNN--LPQILYEDEDHDQVVLASDSDLI  374
            D KGR+HRFT    N+ +L+  ++QR+GG  N +    PQI+YED++ D+V++ SDSDL+
Sbjct  417  DLKGRVHRFTCAAENLDELMGIVMQRIGGSDNNDKEQRPQIIYEDDEGDKVLITSDSDLV  476

Query  373  TAVEHARSAGWKGLRLHLDYSRT  305
             AV  ARS G K LRLHLD++ T
Sbjct  477  GAVTLARSTGQKVLRLHLDFTET  499



>ref|XP_010099759.1| CBS domain-containing protein [Morus notabilis]
 gb|EXB80377.1| CBS domain-containing protein [Morus notabilis]
Length=537

 Score =   211 bits (538),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 146/199 (73%), Gaps = 4/199 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PEC +VET ILDALH MHDGKFLHLP+ DKDG VVA VDVL IT A+IS V + +G   
Sbjct  295  SPECVTVETTILDALHIMHDGKFLHLPVLDKDGYVVACVDVLQITHASISMVESGSGAVN  354

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            +  +T MQKFWDSA+A+   DD + HSE S  + S+G E G    +PS  L NTFSFK E
Sbjct  355  DVVSTTMQKFWDSALALEPPDDCDTHSEMSAFMTSDGTEIG---KYPSLGLGNTFSFKFE  411

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGR+HR    T ++ +L++ ++QR+G + + ++ PQILYED++ D+V+LA+DSDL++A
Sbjct  412  DFKGRVHRLNCGTESLDELLSTVMQRIGAE-SGSDHPQILYEDDEGDKVLLATDSDLVSA  470

Query  367  VEHARSAGWKGLRLHLDYS  311
            V HARS G K LRLHLD+S
Sbjct  471  VTHARSIGLKVLRLHLDFS  489



>gb|KHG09902.1| CBS domain-containing CBSCBSPB3 -like protein [Gossypium arboreum]
Length=530

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 141/198 (71%), Gaps = 1/198 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NP+CA VET ILDALH MHDGKFLHLP+ DKDG V A VDVL IT AAIS V +++G   
Sbjct  286  NPKCAKVETSILDALHIMHDGKFLHLPVLDKDGTVAACVDVLQITHAAISMVESSSGAVN  345

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + A+TMMQKFWDSA+++   DD +  SE S  L SEG + G    +PS  L N+F FK E
Sbjct  346  DIASTMMQKFWDSALSLQPPDDYDTQSEMSAILTSEGADAGRLSSYPSLGLGNSFCFKFE  405

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DRKGR+HRF     N+ +L +A++QR+G   N ++ PQ+LYED++ D+V+L +D DLI A
Sbjct  406  DRKGRVHRFNFGIENLDELSSAVMQRIGSS-NDHSHPQLLYEDDEGDKVLLITDCDLIAA  464

Query  367  VEHARSAGWKGLRLHLDY  314
            V H RS G K LRL+LD+
Sbjct  465  VNHTRSRGLKVLRLYLDF  482



>ref|XP_002973475.1| hypothetical protein SELMODRAFT_149040 [Selaginella moellendorffii]
 gb|EFJ25849.1| hypothetical protein SELMODRAFT_149040 [Selaginella moellendorffii]
Length=545

 Score =   211 bits (538),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 144/201 (72%), Gaps = 3/201 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAG-VN  731
            NPEC ++ET I+DALH MHDGKFLHLP+ D++  +VA +DVL +T  A++TVGN  G   
Sbjct  284  NPECVTLETTIVDALHTMHDGKFLHLPVVDQENCIVACLDVLQLTHGAVATVGNVGGGTP  343

Query  730  EETANTMMQKFWDSAMAI-SHHDDEEMHSEASLKLASEGQETGIS-LPFPSSTLQNTFSF  557
             ET +TMMQKFWDSA A+ +  DD++  S  S  L SE   T +  L +PS    N F F
Sbjct  344  SETGSTMMQKFWDSAFALDAPEDDDDTQSNLSATLTSEAFHTEVGRLGYPSGGPGNVFGF  403

Query  556  KIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDL  377
            K++DR GR+HRF   T ++T+L++A++QRLG DI+ N  PQILYED++ D+V+L+SD DL
Sbjct  404  KLKDRNGRVHRFNCGTESLTELVSAVVQRLGDDIDRNKPPQILYEDDERDRVLLSSDGDL  463

Query  376  ITAVEHARSAGWKGLRLHLDY  314
            + AV  A++ G KGL+LH+DY
Sbjct  464  VAAVNFAKATGLKGLKLHVDY  484



>ref|XP_002876175.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52434.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=556

 Score =   211 bits (538),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 141/202 (70%), Gaps = 3/202 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS+ET ILDALH MHDGKFLHLPI DKDG   A VDVL IT AAIS V N++G   
Sbjct  305  NPECASLETTILDALHIMHDGKFLHLPIIDKDGSAAACVDVLQITHAAISMVENSSGAVN  364

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  +     + G    +PS  L N+FSFK E
Sbjct  365  DMANTMMQKFWDSALALEPPDDSDTQSEMSAMM--HHSDIGKLSSYPSLGLGNSFSFKFE  422

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDIN-WNNLPQILYEDEDHDQVVLASDSDLIT  371
            D KGR+HRFTS   N+ +L+  ++QR+G D N     PQI+YED++ D+V++ SDSDL+ 
Sbjct  423  DLKGRVHRFTSAAENLEELMGIVMQRIGSDNNDVEQRPQIIYEDDEGDKVLITSDSDLVG  482

Query  370  AVEHARSAGWKGLRLHLDYSRT  305
            AV  ARS G K LRLHLD++ +
Sbjct  483  AVTLARSTGQKVLRLHLDFTES  504



>ref|XP_007221791.1| hypothetical protein PRUPE_ppa003919mg [Prunus persica]
 gb|EMJ22990.1| hypothetical protein PRUPE_ppa003919mg [Prunus persica]
Length=540

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 145/203 (71%), Gaps = 3/203 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA +ET ILDALH MH+GKFLHLP+ D+DG V A VDVL IT AAIS V +++G   
Sbjct  297  NPECAMLETTILDALHIMHEGKFLHLPVLDRDGSVAACVDVLQITHAAISMVESSSGTAN  356

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
              ANTMMQKFWDSA+A+   DD +  SE S  +AS+G +     P+PS  L N+F+FK E
Sbjct  357  TMANTMMQKFWDSALALEPPDDCDTQSELSALMASDGTDG--KFPYPSLGLGNSFAFKFE  414

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D +GRMHR      N+ +L++A++QR+G   N ++ P IL+ED++ D+V+LA+D DL++A
Sbjct  415  DLRGRMHRINCGMENLDELLSAVMQRIGA-ANDHDRPHILFEDDEGDRVLLATDDDLVSA  473

Query  367  VEHARSAGWKGLRLHLDYSRTPH  299
            V HAR  G K LRLHLD++ + H
Sbjct  474  VSHARGVGLKVLRLHLDFTDSGH  496



>ref|XP_011031089.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like isoform 
X2 [Populus euphratica]
Length=503

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 137/190 (72%), Gaps = 4/190 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC ++ET ILDALH MHDGKFLHLP+ DKDG V A +DVL IT AAIS V N++G   
Sbjct  311  NPECVTLETTILDALHVMHDGKFLHLPVVDKDGSVAACLDVLQITHAAISLVENSSGAVN  370

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  +AS+  E G    +PS  L N+F+FK +
Sbjct  371  DVANTMMQKFWDSALALEPADDYDTQSEMSALMASDATELG---RYPSLGLGNSFAFKFQ  427

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGR+HR    T N+ +L++ +LQR+G D N  + PQ+LYED++ D+V+LA+D DLI+A
Sbjct  428  DLKGRVHRLNCGTENLNELLSTVLQRIGAD-NEQDRPQLLYEDDEGDKVLLATDGDLISA  486

Query  367  VEHARSAGWK  338
            V HARS G K
Sbjct  487  VNHARSGGLK  496



>ref|XP_002986681.1| hypothetical protein SELMODRAFT_446714 [Selaginella moellendorffii]
 gb|EFJ12244.1| hypothetical protein SELMODRAFT_446714 [Selaginella moellendorffii]
Length=545

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 143/201 (71%), Gaps = 3/201 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAG-VN  731
            NPEC ++ET I+DALH MHDGKFLHLP+ D++  +VA +DVL +T  A++TVGN  G   
Sbjct  284  NPECVTLETTIVDALHTMHDGKFLHLPVVDQENCIVACLDVLQLTHGAVATVGNVGGGTP  343

Query  730  EETANTMMQKFWDSAMAI-SHHDDEEMHSEASLKLASEGQETGIS-LPFPSSTLQNTFSF  557
             ET +TMMQKFWDSA A+ +  DD+E  S  S  L SE   T +  L +PS    N F F
Sbjct  344  SETGSTMMQKFWDSAFALDAPEDDDETQSNLSATLTSEAFHTEVGRLGYPSGGPGNVFGF  403

Query  556  KIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDL  377
            K++DR GR+HRF   T ++T+L++A++QRLG  I+ N  PQILYED++ D+V+L+SD DL
Sbjct  404  KLKDRNGRVHRFNCGTESLTELVSAVVQRLGDYIDRNKPPQILYEDDERDRVLLSSDGDL  463

Query  376  ITAVEHARSAGWKGLRLHLDY  314
            + AV  A++ G KGL+LH+DY
Sbjct  464  VAAVNFAKATGLKGLKLHVDY  484



>gb|KHG09657.1| CBS domain-containing CBSCBSPB3 -like protein [Gossypium arboreum]
Length=528

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 146/202 (72%), Gaps = 2/202 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVN-  731
            NPEC +VET ILDALH MHDGKFLHLP+ DKDG V A +DVL IT AAIS V +++GV  
Sbjct  282  NPECVTVETTILDALHLMHDGKFLHLPVLDKDGNVAACLDVLDITHAAISMVESSSGVAL  341

Query  730  EETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
             E ++TMMQKFWDSA+A+    D + HSE S  +AS+G +TG   P  S    N+FSFK+
Sbjct  342  NEVSSTMMQKFWDSALALDPPGDYDTHSEMSAVMASDGADTGKLSPHHSLGHGNSFSFKL  401

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED KGR+HRF+  T N+ +L++A++QR     N N  PQ+LY+D++ D+V+L +D+DL+ 
Sbjct  402  EDLKGRLHRFSFGTENLNELLSAVMQRTASS-NDNRRPQLLYKDDEGDKVLLTNDTDLVA  460

Query  370  AVEHARSAGWKGLRLHLDYSRT  305
            AV  ARS G K LRLHLD+S +
Sbjct  461  AVNSARSIGKKVLRLHLDFSES  482



>ref|XP_002450774.1| hypothetical protein SORBIDRAFT_05g017490 [Sorghum bicolor]
 gb|EES09762.1| hypothetical protein SORBIDRAFT_05g017490 [Sorghum bicolor]
Length=511

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 113/227 (50%), Positives = 155/227 (68%), Gaps = 24/227 (11%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAG---  737
            +PECA+V+ PILDAL  M + KFLHLP+ D+DG +++++DV+ I  AAIS V ++ G   
Sbjct  253  DPECATVDMPILDALRTMQERKFLHLPVMDRDGSIISIIDVIDIAHAAISVVESSGGDGM  312

Query  736  VNEETANTMMQKFWDSAMAISHHDDE-----EMHSEASLKLASE-------GQETGISLP  593
             +++ A +M+Q+FWDSAMA+   DDE     +M      ++ S+       G E G    
Sbjct  313  GSDDAAASMIQRFWDSAMALGPLDDETDTQSQMSEATRSQMMSDVHHDSVGGSEAG----  368

Query  592  FPSSTLQNTFSFKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDED  413
            FPS      FSFK++DR+GRMHRF+ + +++T L+T IL+RLGGDI+ + LPQILYEDED
Sbjct  369  FPS-----CFSFKLQDRRGRMHRFSCEVQSLTPLVTCILRRLGGDIDPDRLPQILYEDED  423

Query  412  HDQVVLASDSDLITAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSST  272
             D+VVLASD DL  AV+HAR AGWKGL+L LDYS T   R+   SS+
Sbjct  424  QDKVVLASDDDLAAAVDHARLAGWKGLKLFLDYSGTTGRRKAVASSS  470



>ref|XP_008781501.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Phoenix dactylifera]
Length=546

 Score =   207 bits (526),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/200 (54%), Positives = 146/200 (73%), Gaps = 3/200 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+++T ILDALH MHDGKFLHLP+ D+DG + A +DVL +T AAIS V    GV  
Sbjct  300  NPECATLDTTILDALHIMHDGKFLHLPVLDRDGQIAACLDVLQLTHAAISMVEGGGGVVN  359

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            + ANTMMQKFWDSA+A+   +++ + HSE S  +ASE  E G  + +P   L N+F+FK 
Sbjct  360  DVANTMMQKFWDSALALEPPYEEFDTHSEMSALMASECTENGKYM-YPPLGLGNSFAFKF  418

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            EDRKGR+HRF   T ++ +L +A++QR+G   + + + Q+LYED++ D+V+L +D DLI 
Sbjct  419  EDRKGRLHRFDCGTESLAELASAVMQRMGLVSDTDKI-QLLYEDDEGDRVLLVTDKDLIG  477

Query  370  AVEHARSAGWKGLRLHLDYS  311
            AV HARSAGWK LRLH++ S
Sbjct  478  AVNHARSAGWKILRLHIEDS  497



>gb|EYU20625.1| hypothetical protein MIMGU_mgv1a004155mg [Erythranthe guttata]
Length=541

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 151/219 (69%), Gaps = 4/219 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +P+CA+VET IL+ALH M DGKFLHLP+ DKDG V + +DVL IT AAIS V N +G   
Sbjct  293  DPQCATVETTILEALHIMRDGKFLHLPVIDKDGSVASCLDVLQITHAAISMVENGSGTVN  352

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLK--LASEGQETGISLPFPSSTLQNTFSFK  554
            + ANT+MQ FWDSA+ +   DD + HSE S+   +AS+G E   S  +PS  L N+FSFK
Sbjct  353  DVANTVMQNFWDSALNLEAPDDYDTHSEISMSQYVASDGTEHAKS-AYPSLGLGNSFSFK  411

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
             +D  GR+HRF     N+++L++A++QR+G   +    PQ+LYED++ D+V+L +D DLI
Sbjct  412  FKDNNGRVHRFNYGMENLSELVSAVMQRVGASEDQKQ-PQLLYEDDEGDKVLLTTDGDLI  470

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQ  257
            +AV HARSAG K LRLHL+Y  +    R   S T++ A+
Sbjct  471  SAVTHARSAGLKVLRLHLEYYESIQETRELLSDTVKKAE  509



>ref|XP_009362444.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Pyrus 
x bretschneideri]
Length=539

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 150/212 (71%), Gaps = 4/212 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS+ET ILDALH MH+GKFLHLP+ D+DG + A +DVL IT AA+S V +++G   
Sbjct  296  NPECASLETTILDALHIMHEGKFLHLPVLDRDGCIAACLDVLQITHAAVSMVESSSGTVN  355

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANTMMQKFWDSA+A+   DD +  SE S  +AS+G +   S  +PS  L ++F+FK E
Sbjct  356  DMANTMMQKFWDSALALEPPDDCDTQSELSTVMASDGADGKFS--YPSLGLGDSFAFKFE  413

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D +GR+HR      N+ +L++AI++R+    + ++ P IL+EDED D+V+LA+D DLI+A
Sbjct  414  DLRGRVHRINCGMENLDELVSAIMKRIRVADDHDH-PHILFEDEDGDRVLLATDDDLISA  472

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSST  272
            V HAR  G K LRLHLD S + H R  SGS T
Sbjct  473  VSHARGMGLKVLRLHLDLSDSSH-RSVSGSGT  503



>ref|XP_004146397.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Cucumis 
sativus]
 gb|KGN54780.1| hypothetical protein Csa_4G495220 [Cucumis sativus]
Length=539

 Score =   205 bits (521),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 142/198 (72%), Gaps = 6/198 (3%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+VET ILDALH MHDGKFLHLP+ D++G+VVA VDVL IT AAIS V + +    
Sbjct  299  NPECATVETTILDALHIMHDGKFLHLPVLDREGLVVACVDVLQITHAAISMVESGSSSVN  358

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + A+TMMQKFWDSA+A+   DD + HSE S  +ASEG     +L +PS  L N+F+FK E
Sbjct  359  DVASTMMQKFWDSALALEPPDDIDTHSEMSAFMASEG-----TLNYPSLGLGNSFAFKFE  413

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGR+HR    T  + +L++ ++QR+G   +  N P +LYED++ D+VVLA+D DL  A
Sbjct  414  DLKGRVHRVNCGTETLDELVSVVMQRIGAT-DSANRPLLLYEDDEGDKVVLATDGDLSGA  472

Query  367  VEHARSAGWKGLRLHLDY  314
            V HARS G K LRLHLD+
Sbjct  473  VNHARSIGLKVLRLHLDF  490



>ref|XP_008442154.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Cucumis melo]
Length=539

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 142/198 (72%), Gaps = 6/198 (3%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+VET ILDALH MHDGKFLHLP+ D++G+VVA VDVL IT AAIS V + +    
Sbjct  299  NPECATVETTILDALHIMHDGKFLHLPVLDREGLVVACVDVLQITHAAISMVESGSSSVN  358

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + A+TMMQKFWDSA+A+   DD + HSE S  +ASEG     +L +PS  L N+F+FK E
Sbjct  359  DVASTMMQKFWDSALALEPPDDIDTHSEMSAFMASEG-----TLNYPSLGLGNSFAFKFE  413

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGR+HR    T  + +L++ ++QR+G   N  + P +LYED++ D+VVLA+D DL  A
Sbjct  414  DLKGRVHRVNCGTETLDELVSVVMQRIGAT-NSASRPLLLYEDDEGDKVVLATDGDLSGA  472

Query  367  VEHARSAGWKGLRLHLDY  314
            V HARS G K LRLHLD+
Sbjct  473  VNHARSIGLKVLRLHLDF  490



>ref|XP_006663464.1| PREDICTED: CBS domain-containing protein CBSCBSPB5-like, partial 
[Oryza brachyantha]
Length=503

 Score =   204 bits (518),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 146/201 (73%), Gaps = 4/201 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTA--GV  734
            +PECA+++ PILDAL  M + KFLHLP+ D+DG +V+++DV+ IT AA S V  T     
Sbjct  238  DPECATLDMPILDALRTMQERKFLHLPVMDRDGSIVSILDVIDITHAAFSIVEGTGDGAA  297

Query  733  NEETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGIS-LPFPSSTLQNTFSF  557
            N++ A +M+Q+FWDSAMA+   DDE   S++ +  AS  Q   +S +   ++    +FSF
Sbjct  298  NDDVAISMVQRFWDSAMALGPLDDET-ESQSQMSEASRSQMMSMSDIHHEAAGGNQSFSF  356

Query  556  KIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDL  377
            K++D++GRMHRF+ + +++T LIT ILQRLG D++ + LPQILYEDED D+VVLASD DL
Sbjct  357  KLQDKRGRMHRFSCEVQSLTPLITCILQRLGPDLDRDRLPQILYEDEDRDKVVLASDDDL  416

Query  376  ITAVEHARSAGWKGLRLHLDY  314
              AV+HAR AGWKGL+L LDY
Sbjct  417  TAAVDHARLAGWKGLKLFLDY  437



>ref|XP_010912484.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like isoform 
X3 [Elaeis guineensis]
Length=519

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 143/202 (71%), Gaps = 3/202 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC +V+T ILDALH MHDGKFLHLP+ D+DG + A +DVL +T AAIS V   A V  
Sbjct  273  NPECVTVDTTILDALHIMHDGKFLHLPVLDRDGQIAACLDVLQLTHAAISMVEGGAEVVN  332

Query  727  ETANTMMQKFWDSAMAISHHDDE-EMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
              A+TMMQKFW+SA A+   D+E +  SE S  + SE  E G   P+P   L N+F+FK 
Sbjct  333  GVASTMMQKFWNSAFALEPQDEESDKKSELSAWMTSECMENG-KHPYPPLGLGNSFAFKF  391

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            EDRKGR+HRF   T ++ +L++AI+QR+G D +   + Q+LYED++ D+V++ +D+DLI 
Sbjct  392  EDRKGRVHRFNCGTESLAELVSAIMQRIGLDTDAEKI-QLLYEDDEGDRVLMDTDNDLIG  450

Query  370  AVEHARSAGWKGLRLHLDYSRT  305
            AV HAR AGWK LRLH+D S T
Sbjct  451  AVNHARLAGWKVLRLHIDDSDT  472



>ref|XP_010912483.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like isoform 
X2 [Elaeis guineensis]
Length=546

 Score =   204 bits (519),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 143/202 (71%), Gaps = 3/202 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC +V+T ILDALH MHDGKFLHLP+ D+DG + A +DVL +T AAIS V   A V  
Sbjct  300  NPECVTVDTTILDALHIMHDGKFLHLPVLDRDGQIAACLDVLQLTHAAISMVEGGAEVVN  359

Query  727  ETANTMMQKFWDSAMAISHHDDE-EMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
              A+TMMQKFW+SA A+   D+E +  SE S  + SE  E G   P+P   L N+F+FK 
Sbjct  360  GVASTMMQKFWNSAFALEPQDEESDKKSELSAWMTSECMENG-KHPYPPLGLGNSFAFKF  418

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            EDRKGR+HRF   T ++ +L++AI+QR+G D +   + Q+LYED++ D+V++ +D+DLI 
Sbjct  419  EDRKGRVHRFNCGTESLAELVSAIMQRIGLDTDAEKI-QLLYEDDEGDRVLMDTDNDLIG  477

Query  370  AVEHARSAGWKGLRLHLDYSRT  305
            AV HAR AGWK LRLH+D S T
Sbjct  478  AVNHARLAGWKVLRLHIDDSDT  499



>ref|XP_002879614.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55873.1| CBS domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=536

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 144/203 (71%), Gaps = 11/203 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV-GNTAGVN  731
            NPECAS+ET ILDALH MHDGKFLHLP+ DKDG  VA +DVL IT AAISTV  N++G  
Sbjct  298  NPECASIETTILDALHIMHDGKFLHLPVLDKDGFAVACLDVLQITHAAISTVENNSSGAV  357

Query  730  EETANTMMQKFWDSAMAISHHDDEEMHSEASLKLA-SEGQETGISLPFPSSTLQNTFSFK  554
             E ANTMMQKFWDSA+A+   +D E HS+ S  L  SEG+++      PS  L ++F+FK
Sbjct  358  NEMANTMMQKFWDSALALDPPEDYETHSDMSAMLINSEGKQS-----CPSQGLVSSFAFK  412

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
             EDRKGR+HRF S   ++ +L++ ++QR   D       QI+Y+D++ D+V+++ DSDL+
Sbjct  413  FEDRKGRVHRFNSTGESLEELMSVVMQRCEADSGL----QIMYQDDEGDKVLISRDSDLV  468

Query  373  TAVEHARSAGWKGLRLHLDYSRT  305
             AV  ARS G K LRLHLD++ T
Sbjct  469  AAVTFARSLGQKVLRLHLDFTET  491



>ref|XP_010912482.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like isoform 
X1 [Elaeis guineensis]
Length=549

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 108/202 (53%), Positives = 143/202 (71%), Gaps = 3/202 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC +V+T ILDALH MHDGKFLHLP+ D+DG + A +DVL +T AAIS V   A V  
Sbjct  303  NPECVTVDTTILDALHIMHDGKFLHLPVLDRDGQIAACLDVLQLTHAAISMVEGGAEVVN  362

Query  727  ETANTMMQKFWDSAMAISHHDDE-EMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
              A+TMMQKFW+SA A+   D+E +  SE S  + SE  E G   P+P   L N+F+FK 
Sbjct  363  GVASTMMQKFWNSAFALEPQDEESDKKSELSAWMTSECMENG-KHPYPPLGLGNSFAFKF  421

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            EDRKGR+HRF   T ++ +L++AI+QR+G D +   + Q+LYED++ D+V++ +D+DLI 
Sbjct  422  EDRKGRVHRFNCGTESLAELVSAIMQRIGLDTDAEKI-QLLYEDDEGDRVLMDTDNDLIG  480

Query  370  AVEHARSAGWKGLRLHLDYSRT  305
            AV HAR AGWK LRLH+D S T
Sbjct  481  AVNHARLAGWKVLRLHIDDSDT  502



>ref|XP_003532113.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Glycine 
max]
 gb|KHN16928.1| CBS domain-containing protein CBSCBSPB3 [Glycine soja]
Length=535

 Score =   203 bits (516),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NP+CAS++T ILDALH MHDGKFLHLP+ DKDG VVA +DVL IT AAIS V +++G   
Sbjct  292  NPDCASIDTTILDALHMMHDGKFLHLPVVDKDGYVVACMDVLQITHAAISMVESSSGAVN  351

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANT+MQKFWDSA  +   +D + HSE S  + S+G +T  S  + S    N+F+FK +
Sbjct  352  DVANTIMQKFWDSAFNLEPPEDSDTHSELSGLVMSDGADTSKS-GYQSVGFGNSFAFKFK  410

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D  GR+HRF   T ++ +L++ I+QRL  D+N    P ILYED++ D++VLA++SDL++A
Sbjct  411  DLSGRVHRFNCGTEHLDELVSTIMQRL--DVNDGERPIILYEDDEGDKIVLATNSDLVSA  468

Query  367  VEHARSAGWKGLRLHLDY  314
            V +ARSAG K L+LHLD+
Sbjct  469  VSYARSAGVKALKLHLDF  486



>emb|CDP04583.1| unnamed protein product [Coffea canephora]
Length=555

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 145/203 (71%), Gaps = 4/203 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+++T IL+ALH MHDGKFLHLP+ D+DG V+A VDVL IT AAIS V + +    
Sbjct  308  NPECATLDTTILEALHIMHDGKFLHLPVVDRDGHVIACVDVLQITHAAISMVESGSESVN  367

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKL--ASEGQETGISLPFPSSTLQNTFSFK  554
            + A T+MQKFWDSA+ +   DD +  SE S+     S+G E G S P+P   L N+F+FK
Sbjct  368  DVATTVMQKFWDSALNMEPLDDYDTQSELSMSALNMSDGTENGKS-PYPCLGLGNSFAFK  426

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
             ED KGR+HRF   T N+ +L++A++QR+G   + N  PQ+LYED++ D+V+L +D+DLI
Sbjct  427  FEDLKGRVHRFNFGTENLGELVSAVMQRIGAADDQNR-PQLLYEDDEGDKVLLTADTDLI  485

Query  373  TAVEHARSAGWKGLRLHLDYSRT  305
             AV HARSAG K LRLHLD S T
Sbjct  486  AAVSHARSAGLKVLRLHLDDSDT  508



>ref|XP_004166825.1| PREDICTED: LOW QUALITY PROTEIN: CBS domain-containing protein 
CBSCBSPB3-like [Cucumis sativus]
Length=539

 Score =   203 bits (516),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 109/198 (55%), Positives = 142/198 (72%), Gaps = 6/198 (3%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+VET ILDALH MHDGKFLHLP+ D++G+VVA VDVL IT AAIS V + +    
Sbjct  299  NPECATVETTILDALHIMHDGKFLHLPVLDREGLVVACVDVLQITHAAISMVESGSSSVN  358

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + A+TMMQKFWDSA+A+   DD + HSE S  +ASEG     +L +PS  L N+F+FK E
Sbjct  359  DVASTMMQKFWDSALALEPPDDIDTHSEMSAFMASEG-----TLNYPSLGLGNSFAFKFE  413

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGR+HR    T  + +L++ ++QR+G   +  + P +LYED++ D+VVLA+D DL  A
Sbjct  414  DLKGRVHRVNCGTETLDELVSVVMQRIGAT-DSASRPLLLYEDDEGDKVVLATDGDLSGA  472

Query  367  VEHARSAGWKGLRLHLDY  314
            V HARS G K LRLHLD+
Sbjct  473  VNHARSIGLKVLRLHLDF  490



>ref|XP_003525140.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Glycine 
max]
Length=535

 Score =   202 bits (515),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 143/198 (72%), Gaps = 3/198 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NP+CASV+T ILD+LH MHDGKFLHLP+ DKDG VVA +DVL IT AAIS V +++G   
Sbjct  292  NPDCASVDTTILDSLHMMHDGKFLHLPVVDKDGYVVACMDVLQITHAAISMVESSSGAVN  351

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANT+MQKFWDSA  +   +D + HSE S  + S+G +T  S  + S    N+F+FK +
Sbjct  352  DVANTIMQKFWDSAFNLEPPEDSDTHSEISGLMTSDGADTSKS-AYQSVGFGNSFAFKFK  410

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D  GR+HRF   T ++ +L++ I+QRL  D+N    P ILYED++ D++VLA+DSDL++A
Sbjct  411  DLSGRVHRFNCGTEHIDELVSTIMQRL--DVNDVERPMILYEDDEGDKIVLATDSDLVSA  468

Query  367  VEHARSAGWKGLRLHLDY  314
            V +A SAG K L+LHLD+
Sbjct  469  VSYATSAGMKALKLHLDF  486



>ref|XP_011099699.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Sesamum indicum]
Length=545

 Score =   203 bits (516),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 146/200 (73%), Gaps = 4/200 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPE A++ET IL+ALH MHDGKFLHLP+ DKDG + A +DVL IT AAIS V +++G   
Sbjct  298  NPESAALETTILEALHIMHDGKFLHLPVVDKDGGIAACLDVLQITHAAISMVESSSGTGN  357

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLK--LASEGQETGISLPFPSSTLQNTFSFK  554
            + ANT++Q FWDSA+ +   DD + HSE S+     SEG E   S  +PS  L N+FSFK
Sbjct  358  DIANTVLQNFWDSALNLEPPDDFDTHSEMSMPQYATSEGVEQAKS-AYPSLGLGNSFSFK  416

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
             +D+KGR+HRF   T ++++L++A++QR+G   +  + PQ+LYED++ D+V+L +D DL+
Sbjct  417  FKDQKGRVHRFNFGTDSLSELVSAVMQRVGASSD-QSCPQLLYEDDEGDKVLLTTDGDLL  475

Query  373  TAVEHARSAGWKGLRLHLDY  314
            +AV HARSAG K LRLHL+Y
Sbjct  476  SAVTHARSAGQKILRLHLEY  495



>gb|EEC68207.1| hypothetical protein OsI_36187 [Oryza sativa Indica Group]
Length=575

 Score =   203 bits (517),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 113/222 (51%), Positives = 154/222 (69%), Gaps = 25/222 (11%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV-GNTAG-V  734
            +PECA+V+ PILDAL  M + KFLHLP+ D+DG +V+++DV+ IT AA S V GN  G +
Sbjct  303  DPECATVDMPILDALRTMQERKFLHLPVMDRDGSIVSILDVIDITHAAFSIVEGNGEGAM  362

Query  733  NEETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQN--TFS  560
            N++ A +M+Q+FWDSAMA+   DDE + S++ +  AS  Q          S + N  +FS
Sbjct  363  NDDAAISMVQRFWDSAMALGPLDDE-IESQSQISEASRSQMM--------SDIHNEQSFS  413

Query  559  FKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSD  380
            FK++DR+GRMHRF+ + +++T LIT ILQRLG D++ + LPQILYEDED D+VVLASD D
Sbjct  414  FKLQDRRGRMHRFSCEVQSLTPLITCILQRLGPDLDRDRLPQILYEDEDRDKVVLASDDD  473

Query  379  LITAVEHARSAGWK------------GLRLHLDYSRTPHLRR  290
            L  AV+HAR AGWK            GL+L+LDYS +  +RR
Sbjct  474  LTAAVDHARLAGWKACTNNTADRSLNGLKLYLDYSGSSGVRR  515



>gb|EPS59555.1| hypothetical protein M569_15250, partial [Genlisea aurea]
Length=495

 Score =   201 bits (511),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 145/203 (71%), Gaps = 4/203 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++ET IL+ALH MHD +FLHLP+ DKDG  VA +DVL +T AAI+ V N++    
Sbjct  246  NPECATLETTILEALHIMHDARFLHLPVVDKDGCPVACLDVLQLTHAAITMVDNSSETVN  305

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLK--LASEGQETGISLPFPSSTLQNTFSFK  554
            + ANT+MQKFWDSA+ +   DD + HSE S+   +AS+  E   S  +PS  L  +FSFK
Sbjct  306  DVANTVMQKFWDSALNLEPPDDFDTHSEMSMSQYMASDAAEHAKS-SYPSLGLGTSFSFK  364

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
             ED KGR+HRF S T N+ +L++A++QR+ GD +    PQ+LYED++ D+V+L++D DL 
Sbjct  365  FEDHKGRVHRFNSGTENLFELVSAVVQRV-GDADLEIRPQLLYEDDEGDKVLLSTDGDLT  423

Query  373  TAVEHARSAGWKGLRLHLDYSRT  305
            +AV +ARSAG K LRLHL Y  T
Sbjct  424  SAVSNARSAGLKILRLHLYYPST  446



>gb|KHN17410.1| CBS domain-containing protein CBSCBSPB3 [Glycine soja]
Length=535

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 105/198 (53%), Positives = 143/198 (72%), Gaps = 3/198 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NP+CASV+T ILD+LH MHDGKFLHLP+ DKDG VVA +DVL IT AAIS V +++G   
Sbjct  292  NPDCASVDTTILDSLHMMHDGKFLHLPVVDKDGHVVACMDVLQITHAAISMVESSSGAVN  351

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANT+MQKFWDSA  +   +D + HSE S  + S+G +T  S  + S    N+F+FK +
Sbjct  352  DVANTIMQKFWDSAFNLEPPEDSDTHSEISGLMTSDGADTSKS-AYQSVGFGNSFAFKFK  410

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D  GR+HRF   T ++ +L++ I+QRL  D+N    P ILYED++ D++VLA+DSDL++A
Sbjct  411  DLSGRVHRFNCGTEHIDELVSTIMQRL--DVNDVERPMILYEDDEGDKIVLATDSDLVSA  468

Query  367  VEHARSAGWKGLRLHLDY  314
            V +A SAG K L+LHLD+
Sbjct  469  VSYATSAGMKALKLHLDF  486



>gb|AIZ68176.1| CBS domain-containing protein CBSCBSPB3 [Ornithogalum saundersiae]
Length=540

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 146/202 (72%), Gaps = 4/202 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA++ET ILDALH MHDGKFLHLP+ DKDG + A +DVL IT AAIS V   AG   
Sbjct  295  NPECATLETTILDALHIMHDGKFLHLPVVDKDGQIAACLDVLQITHAAISMVDGGAGAVN  354

Query  727  ETANTMMQKFWDSAMAISHHDDE-EMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            + ANTMMQKFWDSA+A+   D+E +  SE S  + SE  +T  S+  P   L N+FSFK 
Sbjct  355  DMANTMMQKFWDSALALEPADEEYDSRSEISGMVPSEYTDTVKSIYPP--LLGNSFSFKF  412

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED+KGR+HRF S T ++ +L++A+ QRLG + N   + Q+LY D++ D+V+LA+D+DL++
Sbjct  413  EDQKGRVHRFNSGTESLEELVSAVSQRLGLEDNKEKI-QLLYLDDEGDKVLLATDNDLVS  471

Query  370  AVEHARSAGWKGLRLHLDYSRT  305
            AV +A+ AGWK LRL +D S T
Sbjct  472  AVSNAKLAGWKVLRLQVDSSDT  493



>ref|XP_010243860.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Nelumbo 
nucifera]
Length=538

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 145/212 (68%), Gaps = 6/212 (3%)
 Frame = -2

Query  904  PECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNEE  725
            PECA++ET ILDALH MHDGKFL+LP+ DK+G + A VDVL IT AAIS V   +G   +
Sbjct  297  PECATLETTILDALHMMHDGKFLNLPVLDKEGCIAACVDVLQITHAAISMVDGGSGAVND  356

Query  724  TANTMMQKFWDSAMAISHHDDE-EMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
             A+TMMQKFWDSA+A+   DDE + HSE S  + +E  E       P   L N+FSFK+E
Sbjct  357  MASTMMQKFWDSALALEPPDDEYDTHSELSALMTTEATEKY----HPLIGLGNSFSFKLE  412

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D KGR+HRFT  T  + +L TA++QR+G   +    P++LYED++ D+V+L +D+DLI A
Sbjct  413  DIKGRIHRFTCGTEKLDELFTAVMQRIGTTSDQER-PELLYEDDEGDKVLLTTDNDLIGA  471

Query  367  VEHARSAGWKGLRLHLDYSRTPHLRRGSGSST  272
            V HARSAG K LRLH++Y  +  L   S  +T
Sbjct  472  VNHARSAGLKILRLHINYDSSKKLVGASFDTT  503



>gb|EYU20613.1| hypothetical protein MIMGU_mgv1a004020mg [Erythranthe guttata]
Length=548

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/199 (53%), Positives = 139/199 (70%), Gaps = 4/199 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+++T IL+ALH MHDGKFLHLP+ DK+G V A VDVL IT AA S V +  G   
Sbjct  300  NPECATIDTTILEALHLMHDGKFLHLPVVDKEGCVAACVDVLQITHAAFSMVESGPGTAN  359

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLK--LASEGQETGISLPFPSSTLQNTFSFK  554
            + A T+MQ FWDSA+ +   DD +  SE S+   +ASEG E   S  +PS  L NTFSFK
Sbjct  360  DMATTVMQNFWDSALNLEAPDDFDTRSEISMSQYVASEGTEHAKS-AYPSLGLGNTFSFK  418

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
             +D  GR+HRF   + N+++L++A+ QR+G   N  N PQ+LYED++ D+V+L +D DL+
Sbjct  419  FKDNNGRVHRFNYGSENLSELVSAVTQRVGAS-NDQNCPQLLYEDDEGDKVLLTTDEDLV  477

Query  373  TAVEHARSAGWKGLRLHLD  317
            +AV HARS G K LRLHL+
Sbjct  478  SAVNHARSVGLKVLRLHLE  496



>ref|XP_010509462.1| PREDICTED: CBS domain-containing protein CBSCBSPB2-like [Camelina 
sativa]
Length=538

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 148/221 (67%), Gaps = 17/221 (8%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV-GNTAGVN  731
            NPECASVET ILDALH MHDGKFLHLP+ DKDG  VA +DVL I+ AAISTV  N++G  
Sbjct  298  NPECASVETTILDALHIMHDGKFLHLPVVDKDGFPVACLDVLQISHAAISTVEKNSSGAV  357

Query  730  EETANTMMQKFWDSAMAISHHDDEEMHSEASLKLA-SEGQETGISLPFPSSTLQNTFSFK  554
             +  NTMMQKFWDSA+A+   +D E HS+ S  L  SEG+++      PS  L ++F+FK
Sbjct  358  NDMTNTMMQKFWDSALALDPPEDYETHSDMSAMLINSEGKQS-----CPSQGLVSSFAFK  412

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
             EDRKGR+HRF S   +  +++ A++QR   D       QI+Y+D++ D+V+++ DSDL+
Sbjct  413  FEDRKGRVHRFNSAGESFEEVMGAVMQRCDADTGL----QIMYQDDEGDKVLISRDSDLV  468

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLR------RGSGSSTI  269
             AV  ARS G K LRLHLD++ T  L        G+GS  +
Sbjct  469  AAVAFARSLGQKVLRLHLDFTETTALETITDLSEGNGSGCV  509



>gb|AAO64148.1| unknown protein [Arabidopsis thaliana]
Length=536

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 142/203 (70%), Gaps = 11/203 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV-GNTAGVN  731
            NPECAS+ET ILDALH MHDGKFLHLP+ DKDG  VA +DVL IT AAISTV  N++G  
Sbjct  298  NPECASIETTILDALHIMHDGKFLHLPVFDKDGFAVACLDVLQITHAAISTVENNSSGAV  357

Query  730  EETANTMMQKFWDSAMAISHHDDEEMHSEASLKLA-SEGQETGISLPFPSSTLQNTFSFK  554
             + ANTMMQKFWDSA+A+   +D E HS+ S  L  SEG+++      PS  L ++F+FK
Sbjct  358  NDMANTMMQKFWDSALALEPPEDYETHSDMSAMLINSEGKQSC-----PSQGLVSSFAFK  412

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
             EDRKGR+ RF S   +  +L++ ++QR   D       QI+Y+D++ D+V+++ DSDL+
Sbjct  413  FEDRKGRVQRFNSTGESFEELMSVVMQRCEADSGL----QIMYQDDEGDKVLISRDSDLV  468

Query  373  TAVEHARSAGWKGLRLHLDYSRT  305
             AV  ARS G K LRLHLD++ T
Sbjct  469  AAVTFARSLGQKVLRLHLDFTET  491



>ref|XP_010674377.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Beta 
vulgaris subsp. vulgaris]
Length=541

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 142/199 (71%), Gaps = 5/199 (3%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPEC +V++ IL+ALH MHDGKFLHLP+ +KDG + A VDVL +T AAIS V +++G   
Sbjct  297  NPECVNVDSTILEALHIMHDGKFLHLPVMEKDGSIAACVDVLMLTHAAISMVESSSGTMN  356

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLA-SEGQETGISLPFPSSTLQNTFSFKI  551
            E ANTMMQ+FWDSA+A+   DD + HSE S  L  SEG + G    +PS  L ++FSFK 
Sbjct  357  EMANTMMQRFWDSALALEPPDDSDTHSEMSAALMNSEGTDLG---KYPSLGLGSSFSFKF  413

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED KGR+HRF   T N+ +L++A++QR+G   + +N PQ+LYED++ D+++L  DSDLI 
Sbjct  414  EDPKGRVHRFNFATENLDELVSAVMQRIGSS-DSSNRPQLLYEDDEGDKILLTCDSDLIG  472

Query  370  AVEHARSAGWKGLRLHLDY  314
            A  HARS   K +RL L++
Sbjct  473  AALHARSVDQKVIRLFLEF  491



>ref|NP_181191.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein [Arabidopsis 
thaliana]
 sp|Q9SJQ5.1|Y2650_ARATH RecName: Full=CBS domain-containing protein CBSCBSPB2 [Arabidopsis 
thaliana]
 gb|AAD24634.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09264.1| CBS / octicosapeptide/Phox/Bemp1 domain-containing protein [Arabidopsis 
thaliana]
Length=536

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 142/203 (70%), Gaps = 11/203 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV-GNTAGVN  731
            NPECAS+ET ILDALH MHDGKFLHLP+ DKDG  VA +DVL IT AAISTV  N++G  
Sbjct  298  NPECASIETTILDALHIMHDGKFLHLPVFDKDGFAVACLDVLQITHAAISTVENNSSGAV  357

Query  730  EETANTMMQKFWDSAMAISHHDDEEMHSEASLKLA-SEGQETGISLPFPSSTLQNTFSFK  554
             + ANTMMQKFWDSA+A+   +D E HS+ S  L  SEG+++      PS  L ++F+FK
Sbjct  358  NDMANTMMQKFWDSALALEPPEDYETHSDMSAMLINSEGKQSC-----PSQGLVSSFAFK  412

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
             EDRKGR+ RF S   +  +L++ ++QR   D       QI+Y+D++ D+V+++ DSDL+
Sbjct  413  FEDRKGRVQRFNSTGESFEELMSVVMQRCEADSGL----QIMYQDDEGDKVLISRDSDLV  468

Query  373  TAVEHARSAGWKGLRLHLDYSRT  305
             AV  ARS G K LRLHLD++ T
Sbjct  469  AAVTFARSLGQKVLRLHLDFTET  491



>ref|XP_003602694.1| Octicosapeptide/Phox/Bem1p domain-containing protein [Medicago 
truncatula]
Length=293

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 151/206 (73%), Gaps = 3/206 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV-GNTAGVN  731
            NP+CA++ET I+DALH MHDGKFLHLP+ DKDG VVA VDVL IT AAIS V  +++G  
Sbjct  49   NPQCATLETTIIDALHMMHDGKFLHLPVVDKDGNVVACVDVLQITHAAISLVESSSSGNV  108

Query  730  EETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
             + A+T+MQKFWDSA A+   +D + +SE S +L  +G +T  S  + S+   N+F+FK 
Sbjct  109  NDVASTIMQKFWDSAFALEPPEDYDTNSEVSGQLTLDGADTTKS-TYQSAGFGNSFTFKF  167

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED  G++HRFTS + N  +L++A++QR+ G +N    P++LYED++ D++++A+++DL  
Sbjct  168  EDLNGQVHRFTSGSENQDELVSAVMQRI-GPVNDGERPRLLYEDDEGDKIIIATNNDLAA  226

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLR  293
            AV +ARSAG K L+L+L+++ +  L+
Sbjct  227  AVSYARSAGLKALKLNLEFADSTKLK  252



>emb|CDX73591.1| BnaC08g24120D [Brassica napus]
Length=545

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 143/203 (70%), Gaps = 3/203 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PEC S+ET ILDALH MHDG+FLHLP+ DKDG V A VDVL IT AAIS V N++G   
Sbjct  289  SPECVSLETTILDALHTMHDGRFLHLPVLDKDGSVAACVDVLQITHAAISMVENSSGAVN  348

Query  727  ETANTMMQKFWDSAMAISHHD-DEEMHSEAS-LKLASEGQETGISLPFPSSTLQNTFSFK  554
            + ANTMMQKFWDSA+A+   D D + HSE S + +     + G     PS  L+N+FSFK
Sbjct  349  DVANTMMQKFWDSALALDPVDHDSDGHSEMSGMMMMHRHSDIGKLTSCPSLELENSFSFK  408

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            ++D KGR+HRF+S   ++ +L+  ++QR+G D+     PQI+YED++ D+V++ SDSDL+
Sbjct  409  VKDLKGRVHRFSSGGESLEELMGVVMQRIGIDVEEQR-PQIVYEDDEGDKVLITSDSDLV  467

Query  373  TAVEHARSAGWKGLRLHLDYSRT  305
             AV  ARS G K LRL LD++ T
Sbjct  468  GAVALARSTGQKVLRLFLDFTET  490



>ref|XP_010242795.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Nelumbo 
nucifera]
Length=542

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 107/198 (54%), Positives = 143/198 (72%), Gaps = 6/198 (3%)
 Frame = -2

Query  904  PECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNEE  725
            P+CA++ET ILDALH MHDGKFLHLP+ DKDG + A +DVL IT AAIS V  ++G   +
Sbjct  297  PDCATLETTILDALHMMHDGKFLHLPVLDKDGCIAACLDVLQITHAAISMVEGSSGAVND  356

Query  724  TANTMMQKFWDSAMAISHHDDE--EMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
             A+TMM KFWDSA+ +   DDE     SE S  +ASEG + G    +PS  L NTF+FK+
Sbjct  357  MASTMMHKFWDSALTLEPPDDEYDTQSSELSALMASEGGDPGKY--YPSLGLGNTFAFKL  414

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED KG +HRF S T  + +L++AI+QR+G + N  + P++LYED++ D+V+L++DSDLI 
Sbjct  415  EDTKGHIHRFNSGTEKLDELVSAIVQRIGTE-NGEH-PELLYEDDEGDKVLLSTDSDLIG  472

Query  370  AVEHARSAGWKGLRLHLD  317
            AV HARS G K LRLH++
Sbjct  473  AVSHARSIGLKVLRLHIN  490



>emb|CDX78137.1| BnaA09g33320D [Brassica napus]
Length=539

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 107/203 (53%), Positives = 143/203 (70%), Gaps = 3/203 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PEC S+ET ILDALH MHDGKFLHLP+ DKDG V A VDVL IT AAIS V N++G   
Sbjct  283  SPECVSLETTILDALHTMHDGKFLHLPVLDKDGSVAACVDVLQITHAAISMVENSSGAVN  342

Query  727  ETANTMMQKFWDSAMAISHHD-DEEMHSEAS-LKLASEGQETGISLPFPSSTLQNTFSFK  554
            + ANTMMQKFWDSA+A+   D D + HSE S + +     + G      S  L+N+FSFK
Sbjct  343  DVANTMMQKFWDSALALDPVDHDSDGHSEMSGMMMMHRHSDIGKLTSCASLELENSFSFK  402

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            ++D KGR+HRF+S   ++ +L+  ++QR+G D+     PQI+YED++ D+V++ SDSDL+
Sbjct  403  VKDLKGRVHRFSSGGESLEELMGVVMQRIGIDVEEQR-PQIMYEDDEGDKVLITSDSDLV  461

Query  373  TAVEHARSAGWKGLRLHLDYSRT  305
             AV  ARS G K LRL+LD++ T
Sbjct  462  GAVALARSTGQKVLRLYLDFTET  484



>ref|XP_003630364.1| Meiotically up-regulated gene 70 protein [Medicago truncatula]
 gb|AET04840.1| CBS/octicosapeptide/phox/Bemp1 (PB1) domain protein [Medicago 
truncatula]
Length=534

 Score =   197 bits (502),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 142/198 (72%), Gaps = 3/198 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NP+CA+++T ILDALH MHDGKFLHLP+ D+ G V A VDVL IT AAIS V +++G   
Sbjct  292  NPDCATLDTTILDALHMMHDGKFLHLPVVDRHGYVAACVDVLQITHAAISLVESSSGAVN  351

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANT+MQKFWDSA A+   +D + HSE S  + S+G +T  S  + S    N+F FK E
Sbjct  352  DVANTIMQKFWDSAFALEPPEDSDSHSEVSALMTSDGADTTKS-AYHSMGFGNSFPFKFE  410

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D  GR+HRF   T ++ +L++A++QR+  DIN    P I+YED++ D++VL +D+DL++A
Sbjct  411  DLNGRVHRFNCGTEHLDELVSAVMQRV--DINDRERPAIVYEDDEGDRIVLGTDNDLVSA  468

Query  367  VEHARSAGWKGLRLHLDY  314
            V +ARSAG K L+L+LD+
Sbjct  469  VSYARSAGVKALKLYLDF  486



>ref|XP_010516875.1| PREDICTED: CBS domain-containing protein CBSCBSPB2-like isoform 
X1 [Camelina sativa]
 ref|XP_010516876.1| PREDICTED: CBS domain-containing protein CBSCBSPB2-like isoform 
X2 [Camelina sativa]
 ref|XP_010516878.1| PREDICTED: CBS domain-containing protein CBSCBSPB2-like isoform 
X3 [Camelina sativa]
Length=537

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 142/206 (69%), Gaps = 11/206 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV-GNTAGVN  731
            NPECASVET ILDALH MHDGKFLHLP+ DKDG  VA +DVL I+ AAISTV  N++G  
Sbjct  298  NPECASVETTILDALHIMHDGKFLHLPVVDKDGFPVACLDVLQISHAAISTVENNSSGAV  357

Query  730  EETANTMMQKFWDSAMAISHHDDEEMHSEASLKLA-SEGQETGISLPFPSSTLQNTFSFK  554
             +  NTMMQKFWDSA+A+   +D E HS+ S  L  SEG+++      PS  L ++F+FK
Sbjct  358  NDMTNTMMQKFWDSALALDPPEDYETHSDMSAMLINSEGKQS-----CPSQGLVSSFAFK  412

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
             EDRKGR+HRF S   +  +++  ++QR   D       QI+Y+D++ D+V+++ DSDL+
Sbjct  413  FEDRKGRVHRFNSAGESFEEVMGLVMQRCDADTGL----QIMYQDDEGDKVLISRDSDLV  468

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHL  296
             AV  ARS G K LRLHLD++ T  L
Sbjct  469  AAVAFARSLGQKVLRLHLDFTETTAL  494



>ref|XP_004503889.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Cicer 
arietinum]
Length=532

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/198 (50%), Positives = 143/198 (72%), Gaps = 3/198 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NP+CA+++T ILDALH MH GKFLHLP+ D+DG + A +DVL IT AAIS V +++G   
Sbjct  290  NPDCATLDTTILDALHMMHHGKFLHLPVVDRDGHLAACIDVLQITHAAISLVESSSGAVN  349

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANT+MQKFWDSA A+   +D + HSE S  + S+G +T  S  + S    N+F+FK E
Sbjct  350  DVANTIMQKFWDSAFALEPPEDSDTHSEVSGLMTSDGADTAKS-AYHSMGFGNSFTFKFE  408

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D  GR+HRF   T ++ +L++A++QR+  ++N    P ILYED++ D++VL +DSDL++A
Sbjct  409  DPNGRVHRFNCGTEHVDELVSAVMQRV--NVNDGEHPVILYEDDEGDRIVLGTDSDLVSA  466

Query  367  VEHARSAGWKGLRLHLDY  314
            V +ARSAG K L+LHL++
Sbjct  467  VSYARSAGVKALKLHLEF  484



>ref|XP_010505198.1| PREDICTED: CBS domain-containing protein CBSCBSPB2 [Camelina 
sativa]
Length=537

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 142/206 (69%), Gaps = 11/206 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV-GNTAGVN  731
            NPECASVET ILDALH MHDGKFLHLP+ DKDG  VA +DVL I+ AAISTV  N++G  
Sbjct  298  NPECASVETTILDALHIMHDGKFLHLPVVDKDGFPVACLDVLQISHAAISTVENNSSGAV  357

Query  730  EETANTMMQKFWDSAMAISHHDDEEMHSEASLKLA-SEGQETGISLPFPSSTLQNTFSFK  554
             +  NTMMQKFWDSA+A+   +D E HS+ S  L  SEG+++      PS  L ++F+FK
Sbjct  358  NDMTNTMMQKFWDSALALDPPEDYETHSDMSAMLINSEGKQSC-----PSQGLVSSFAFK  412

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
             EDRKGR+HRF S   +  +++  ++QR   D       QI+Y+D++ D+V+++ DSDL+
Sbjct  413  FEDRKGRVHRFNSAGESFEEVMGLVMQRCDADTGL----QIMYQDDEGDKVLISRDSDLV  468

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHL  296
             AV  ARS G K LRLHLD++ T  L
Sbjct  469  AAVAFARSLGQKVLRLHLDFTETMAL  494



>ref|XP_006410827.1| hypothetical protein EUTSA_v10016477mg [Eutrema salsugineum]
 gb|ESQ52280.1| hypothetical protein EUTSA_v10016477mg [Eutrema salsugineum]
Length=544

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/205 (52%), Positives = 139/205 (68%), Gaps = 6/205 (3%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS+ET ILDALH MHDGKFLHLP+ DKDG   A VDVL IT AA+ST  N++G   
Sbjct  300  NPECASMETTILDALHIMHDGKFLHLPVLDKDGFAAACVDVLQITHAALSTFENSSGAVN  359

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLA-SEGQETGISLPFPSSTLQNTFSFKI  551
            + ANTMMQKFWDSA+ +   +D E HSE S  L  S+G +TG      S  L ++F+FK 
Sbjct  360  DMANTMMQKFWDSALTLDPPEDYETHSEMSTMLINSDGADTG-KQSCQSQGLLSSFAFKF  418

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +DRKGR+HRF S   +  +L+  ++QR   D       QI+Y+D++ D+V+++ DSDL+ 
Sbjct  419  QDRKGRVHRFNSTGESFEELMCVVMQRCEVDSGL----QIMYQDDEGDKVLISRDSDLVA  474

Query  370  AVEHARSAGWKGLRLHLDYSRTPHL  296
            AV  ARS G K LRLHLD++ T  L
Sbjct  475  AVAFARSLGQKVLRLHLDFTETMCL  499



>ref|XP_006578764.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like isoform 
X2 [Glycine max]
Length=521

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 152/219 (69%), Gaps = 3/219 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NP+CAS+ET ILDALH MH+GKFLHLP+ D+DG V A +DVL IT AAIS V ++ G + 
Sbjct  277  NPQCASLETTILDALHMMHNGKFLHLPVVDRDGNVTACLDVLQITHAAISLVESSPGASN  336

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANT+MQKFWDSA A+   +D + HSEAS +L  +G +T  S  + S    N+F+FK +
Sbjct  337  DAANTVMQKFWDSAFALEPPEDFDTHSEASGQLTLDGADTTKS-TYQSVGFGNSFAFKFD  395

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D  G +HRF     +  +L++A++QR+ GD+N    P +LY+D+D D++++A+D+DL+ A
Sbjct  396  DHNGHVHRFYCGAEHQEELLSAVMQRI-GDVNDGEHPTMLYKDDDGDKIIIATDNDLVAA  454

Query  367  VEHARSAGWKGLRLHLDY-SRTPHLRRGSGSSTIEYAQT  254
            V +ARSAG K L+L L++ + T   +   G++TI+   T
Sbjct  455  VSYARSAGLKALKLDLEFPNSTKPTKLQPGTATIQKTST  493



>ref|XP_006578763.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like isoform 
X1 [Glycine max]
Length=523

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 152/219 (69%), Gaps = 3/219 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NP+CAS+ET ILDALH MH+GKFLHLP+ D+DG V A +DVL IT AAIS V ++ G + 
Sbjct  279  NPQCASLETTILDALHMMHNGKFLHLPVVDRDGNVTACLDVLQITHAAISLVESSPGASN  338

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANT+MQKFWDSA A+   +D + HSEAS +L  +G +T  S  + S    N+F+FK +
Sbjct  339  DAANTVMQKFWDSAFALEPPEDFDTHSEASGQLTLDGADTTKS-TYQSVGFGNSFAFKFD  397

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D  G +HRF     +  +L++A++QR+ GD+N    P +LY+D+D D++++A+D+DL+ A
Sbjct  398  DHNGHVHRFYCGAEHQEELLSAVMQRI-GDVNDGEHPTMLYKDDDGDKIIIATDNDLVAA  456

Query  367  VEHARSAGWKGLRLHLDY-SRTPHLRRGSGSSTIEYAQT  254
            V +ARSAG K L+L L++ + T   +   G++TI+   T
Sbjct  457  VSYARSAGLKALKLDLEFPNSTKPTKLQPGTATIQKTST  495



>gb|KHN31200.1| CBS domain-containing protein CBSCBSPB3 [Glycine soja]
Length=521

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 151/219 (69%), Gaps = 3/219 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NP+CAS+ET ILDALH MH+GKFLHLP+ D+DG V A +DVL IT AAIS V ++ G + 
Sbjct  277  NPQCASLETTILDALHMMHNGKFLHLPVVDRDGNVTACLDVLQITHAAISLVESSPGASN  336

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANT+MQKFWDSA A+   +D + HSEAS +L  +G +T  S  + S    N+F+FK +
Sbjct  337  DAANTVMQKFWDSAFALEPPEDFDTHSEASGQLTLDGADTTKS-TYQSVGFGNSFAFKFD  395

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D  G +HRF     +  +L++A++QR+ GD+N    P +LY+D+D D++++A+D+DL+ A
Sbjct  396  DHNGHVHRFYCGAEHQEELLSAVMQRI-GDVNDGEHPTMLYKDDDGDKIIIATDNDLVAA  454

Query  367  VEHARSAGWKGLRLHLDYS-RTPHLRRGSGSSTIEYAQT  254
            V +ARSAG K L+L L++   T   +   G++TI+   T
Sbjct  455  VSYARSAGLKALKLDLEFPDSTKPTKLQPGTATIQKTST  493



>ref|XP_009115994.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Brassica 
rapa]
 ref|XP_009115995.1| PREDICTED: CBS domain-containing protein CBSCBSPB3 [Brassica 
rapa]
Length=538

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 148/220 (67%), Gaps = 6/220 (3%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PEC S+ET ILDALH MHDGKFLHLP+ DKDG V A VDVL IT AAIS V N++G   
Sbjct  283  SPECVSLETTILDALHTMHDGKFLHLPVLDKDGSVAACVDVLQITHAAISMVENSSGAVN  342

Query  727  ETANTMMQKFWDSAMAISHHD-DEEMHSEAS-LKLASEGQETGISLPFPSSTLQNTFSFK  554
            + ANTMMQKFWDSA+A+   D D + HSE S + +     + G      S  L+N+FSFK
Sbjct  343  DVANTMMQKFWDSALALDPVDHDSDGHSEMSGMMMMHRHSDIGKLTSCASLELENSFSFK  402

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
            ++D KGR+HRF+S   ++ +L+  ++QR+G D+     PQI+YED++ D+V++ SDSDL+
Sbjct  403  VKDLKGRVHRFSSGGESLEELMGVVMQRIGVDVEQR--PQIVYEDDEGDKVLITSDSDLV  460

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHLRRGSGSSTIEYAQT  254
             AV  ARS G K LRL+L +  T    RG G  T ++ + 
Sbjct  461  GAVALARSTGQKVLRLYLAF--TEAATRGLGLETGQFKKV  498



>gb|AFW60740.1| hypothetical protein ZEAMMB73_016218 [Zea mays]
Length=551

 Score =   195 bits (495),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 113/232 (49%), Positives = 150/232 (65%), Gaps = 33/232 (14%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV------GN  746
            +PE A+V+ PILDAL  M + KFLHLP+ D+DG +++++DV+ I  AAIS V      G+
Sbjct  283  DPEFATVDMPILDALRTMQERKFLHLPVMDRDGSIISIIDVIDIAHAAISIVESSGGGGD  342

Query  745  TAGVNEETANTMMQKFWDSAMAISHHDDE----EMHSEASLKL---------------AS  623
             +  ++E A++M Q+FWDSAMA+   DDE       SEAS                  A 
Sbjct  343  GSAGSDEAASSMFQRFWDSAMALGPLDDETDTQSQMSEASRSQMMMSDVHHHHHHHDSAG  402

Query  622  EGQETGISLPFPSSTLQNTFSFKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNN  443
             G E G SL        ++FSFK++DR+GRMHRF+ + +++T L+T IL+RLG DI+ + 
Sbjct  403  GGSEAGFSL--------SSFSFKLQDRRGRMHRFSCEVQSLTPLVTCILRRLGADIDPDR  454

Query  442  LPQILYEDEDHDQVVLASDSDLITAVEHARSAGWKGLRLHLDYSRTPHLRRG  287
            LPQILYEDED D+VVLASD DL  AVEHAR AGWKGL+L LDYS T   R+ 
Sbjct  455  LPQILYEDEDRDKVVLASDDDLAAAVEHARLAGWKGLKLFLDYSGTTGRRKA  506



>ref|NP_001145716.1| uncharacterized protein LOC100279220 [Zea mays]
 gb|ACL52445.1| unknown [Zea mays]
Length=551

 Score =   195 bits (495),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 150/231 (65%), Gaps = 33/231 (14%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV------GN  746
            +PE A+V+ PILDAL  M + KFLHLP+ D+DG +++++DV+ I  AAIS V      G+
Sbjct  283  DPEFATVDMPILDALRTMQERKFLHLPVMDRDGSIISIIDVIDIAHAAISIVESSGGGGD  342

Query  745  TAGVNEETANTMMQKFWDSAMAISHHDDE----EMHSEASLKL---------------AS  623
             +  ++E A++M Q+FWDSAMA+   DDE       SEAS                  A 
Sbjct  343  GSAGSDEAASSMFQRFWDSAMALGPLDDETDTQSQMSEASRSQMMMSDVHHHHHHHDSAG  402

Query  622  EGQETGISLPFPSSTLQNTFSFKIEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNN  443
             G E G SL        ++FSFK++DR+GRMHRF+ + +++T L+T IL+RLG DI+ + 
Sbjct  403  GGSEAGFSL--------SSFSFKLQDRRGRMHRFSCEVQSLTPLVTCILRRLGADIDPDR  454

Query  442  LPQILYEDEDHDQVVLASDSDLITAVEHARSAGWKGLRLHLDYSRTPHLRR  290
            LPQILYEDED D+VVLASD DL  AVEHAR AGWKGL+L LDYS T   R+
Sbjct  455  LPQILYEDEDRDKVVLASDDDLAAAVEHARLAGWKGLKLFLDYSGTTGRRK  505



>gb|KEH35628.1| CBS/octicosapeptide/phox/Bemp1 (PB1) domain protein [Medicago 
truncatula]
Length=458

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 151/206 (73%), Gaps = 3/206 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV-GNTAGVN  731
            NP+CA++ET I+DALH MHDGKFLHLP+ DKDG VVA VDVL IT AAIS V  +++G  
Sbjct  214  NPQCATLETTIIDALHMMHDGKFLHLPVVDKDGNVVACVDVLQITHAAISLVESSSSGNV  273

Query  730  EETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
             + A+T+MQKFWDSA A+   +D + +SE S +L  +G +T  S  + S+   N+F+FK 
Sbjct  274  NDVASTIMQKFWDSAFALEPPEDYDTNSEVSGQLTLDGADTTKS-TYQSAGFGNSFTFKF  332

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED  G++HRFTS + N  +L++A++QR+ G +N    P++LYED++ D++++A+++DL  
Sbjct  333  EDLNGQVHRFTSGSENQDELVSAVMQRI-GPVNDGERPRLLYEDDEGDKIIIATNNDLAA  391

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLR  293
            AV +ARSAG K L+L+L+++ +  L+
Sbjct  392  AVSYARSAGLKALKLNLEFADSTKLK  417



>gb|AES72945.2| CBS/octicosapeptide/phox/Bemp1 (PB1) domain protein [Medicago 
truncatula]
Length=481

 Score =   192 bits (489),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 151/206 (73%), Gaps = 3/206 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV-GNTAGVN  731
            NP+CA++ET I+DALH MHDGKFLHLP+ DKDG VVA VDVL IT AAIS V  +++G  
Sbjct  237  NPQCATLETTIIDALHMMHDGKFLHLPVVDKDGNVVACVDVLQITHAAISLVESSSSGNV  296

Query  730  EETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
             + A+T+MQKFWDSA A+   +D + +SE S +L  +G +T  S  + S+   N+F+FK 
Sbjct  297  NDVASTIMQKFWDSAFALEPPEDYDTNSEVSGQLTLDGADTTKST-YQSAGFGNSFTFKF  355

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED  G++HRFTS + N  +L++A++QR+ G +N    P++LYED++ D++++A+++DL  
Sbjct  356  EDLNGQVHRFTSGSENQDELVSAVMQRI-GPVNDGERPRLLYEDDEGDKIIIATNNDLAA  414

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLR  293
            AV +ARSAG K L+L+L+++ +  L+
Sbjct  415  AVSYARSAGLKALKLNLEFADSTKLK  440



>ref|XP_003602693.1| Octicosapeptide/Phox/Bem1p domain-containing protein [Medicago 
truncatula]
 gb|AES72944.1| CBS/octicosapeptide/phox/Bemp1 (PB1) domain protein [Medicago 
truncatula]
Length=519

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 151/206 (73%), Gaps = 3/206 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV-GNTAGVN  731
            NP+CA++ET I+DALH MHDGKFLHLP+ DKDG VVA VDVL IT AAIS V  +++G  
Sbjct  275  NPQCATLETTIIDALHMMHDGKFLHLPVVDKDGNVVACVDVLQITHAAISLVESSSSGNV  334

Query  730  EETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
             + A+T+MQKFWDSA A+   +D + +SE S +L  +G +T  S  + S+   N+F+FK 
Sbjct  335  NDVASTIMQKFWDSAFALEPPEDYDTNSEVSGQLTLDGADTTKST-YQSAGFGNSFTFKF  393

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED  G++HRFTS + N  +L++A++QR+ G +N    P++LYED++ D++++A+++DL  
Sbjct  394  EDLNGQVHRFTSGSENQDELVSAVMQRI-GPVNDGERPRLLYEDDEGDKIIIATNNDLAA  452

Query  370  AVEHARSAGWKGLRLHLDYSRTPHLR  293
            AV +ARSAG K L+L+L+++ +  L+
Sbjct  453  AVSYARSAGLKALKLNLEFADSTKLK  478



>ref|XP_009389510.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Musa 
acuminata subsp. malaccensis]
Length=543

 Score =   192 bits (488),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 143/202 (71%), Gaps = 4/202 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            +PE A+++TPILDALH MHDGKFLHLP+ D+DG +VA +DVL +T AAIS V   A    
Sbjct  299  DPESATLDTPILDALHIMHDGKFLHLPVLDRDGHIVACLDVLQLTHAAISMVEGGADTVN  358

Query  727  ETANTMMQKFWDSAMAISHHDDE-EMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            + A+TMMQKFWDSA+A+   D+E + HSE S  + SE  ETG  +  P   + N+F FK 
Sbjct  359  DMASTMMQKFWDSALALEPADEEFDTHSELSALMTSEYAETGKYMYPP--LVGNSFVFKF  416

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +DRKGR+HRF   T  + +L  A+ QR+G   + + L Q+LYED++ D+V+L +D+D++ 
Sbjct  417  KDRKGRVHRFNCGTEVLDELEVAVRQRMGLASDCDKL-QLLYEDDEGDRVLLITDNDVVG  475

Query  370  AVEHARSAGWKGLRLHLDYSRT  305
            AV HARSAGWK LRLH+D S T
Sbjct  476  AVNHARSAGWKVLRLHIDESET  497



>ref|XP_006293975.1| hypothetical protein CARUB_v10022966mg [Capsella rubella]
 gb|EOA26873.1| hypothetical protein CARUB_v10022966mg [Capsella rubella]
Length=536

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 139/206 (67%), Gaps = 11/206 (5%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV-GNTAGVN  731
            NPECAS+ET ILDALH MHDGKFLHLP+ DKDG  VA +DVL I+  AISTV  N++G  
Sbjct  298  NPECASMETTILDALHIMHDGKFLHLPVVDKDGFAVACLDVLQISHGAISTVENNSSGAV  357

Query  730  EETANTMMQKFWDSAMAISHHDDEEMHSEASLKLA-SEGQETGISLPFPSSTLQNTFSFK  554
             +  NTMMQKFWDSA+A+   +D E HS+ S  L  S+G+++      PS  L N+F+FK
Sbjct  358  NDMTNTMMQKFWDSALALDPPEDYETHSDMSAMLINSDGKQS-----CPSQGLVNSFAFK  412

Query  553  IEDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLI  374
             EDRKGR+HRF S   ++ +L+  ++QR   D       QI+Y+D++ D+V+++ DSDL+
Sbjct  413  FEDRKGRVHRFNSAGESLEELMGVVMQRCDADSGL----QIMYQDDEGDKVLISRDSDLV  468

Query  373  TAVEHARSAGWKGLRLHLDYSRTPHL  296
             AV   RS G   LRLHLD++    L
Sbjct  469  AAVTFVRSLGQNVLRLHLDFTEAMAL  494



>gb|KHN09655.1| CBS domain-containing protein CBSCBSPB3, partial [Glycine soja]
Length=469

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 152/220 (69%), Gaps = 5/220 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS+ET ILDALH MH+GKFLHLP+ D+DG  +A +DVL IT AAIS V ++ G + 
Sbjct  225  NPECASLETTILDALHMMHNGKFLHLPVVDRDGNAIACLDVLQITHAAISLVESSPGASN  284

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            + ANT+MQKFWDSA A+    +D + HSEAS +L  +G +T  S  + S    N+F+FK 
Sbjct  285  DAANTVMQKFWDSAFALEPPPEDFDTHSEASGRLTLDGADTTKS-TYQSVGFGNSFAFKF  343

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D  G +HRF     +  +L++A++QR+ GDIN    P +LY+D+D D++++A+D+DL+ 
Sbjct  344  DDHNGHVHRFYCGAEHQ-ELLSAVMQRI-GDINDGEHPTMLYKDDDGDKIIIATDNDLVA  401

Query  370  AVEHARSAGWKGLRLHLDY-SRTPHLRRGSGSSTIEYAQT  254
            AV +ARSAG K L+L L++ + T   +   G++TI+   T
Sbjct  402  AVSYARSAGLKALKLDLEFPNSTKPTKLQPGTATIQKTST  441



>ref|XP_006581792.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like isoform 
X1 [Glycine max]
Length=521

 Score =   189 bits (480),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 152/220 (69%), Gaps = 5/220 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECAS+ET ILDALH MH+GKFLHLP+ D+DG  +A +DVL IT AAIS V ++ G + 
Sbjct  277  NPECASLETTILDALHMMHNGKFLHLPVVDRDGNAIACLDVLQITHAAISLVESSPGASN  336

Query  727  ETANTMMQKFWDSAMAIS-HHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            + ANT+MQKFWDSA A+    +D + HSEAS +L  +G +T  S  + S    N+F+FK 
Sbjct  337  DAANTVMQKFWDSAFALEPPPEDFDTHSEASGRLTLDGADTTKST-YQSVGFGNSFAFKF  395

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +D  G +HRF     +  +L++A++QR+ GDIN    P +LY+D+D D++++A+D+DL+ 
Sbjct  396  DDHNGHVHRFYCGAEHQ-ELLSAVMQRI-GDINDGEHPTMLYKDDDGDKIIIATDNDLVA  453

Query  370  AVEHARSAGWKGLRLHLDY-SRTPHLRRGSGSSTIEYAQT  254
            AV +ARSAG K L+L L++ + T   +   G++TI+   T
Sbjct  454  AVSYARSAGLKALKLDLEFPNSTKPTKLQPGTATIQKTST  493



>ref|XP_007038003.1| CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein 
isoform 4 [Theobroma cacao]
 gb|EOY22504.1| CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein 
isoform 4 [Theobroma cacao]
Length=423

 Score =   187 bits (474),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG +VAVVDVLHIT AA++TVG+T+G+N 
Sbjct  292  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGEIVAVVDVLHITHAAVATVGSTSGINN  351

Query  727  ETANTMMQKFWDSAMAI-SHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            E   TMMQKFWDSAMA+  + DD+E  S+ SLKLAS+G ET  SLP+PSS++ NTF FKI
Sbjct  352  EATTTMMQKFWDSAMALPPNEDDDETRSDNSLKLASDGGETARSLPYPSSSMPNTFGFKI  411

Query  550  EDRKGRMHRFT  518
            +D++GRMHRFT
Sbjct  412  QDKRGRMHRFT  422



>dbj|BAK00651.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=559

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = -2

Query  904  PECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNEE  725
            P+CA+++T ILDALH MHDGKFLH+P+ D DG VVA +DVL +T+AAIS     +G   +
Sbjct  315  PDCATLDTSILDALHIMHDGKFLHIPVVDGDGRVVACLDVLQLTQAAISMAEGGSGAAND  374

Query  724  TANTMMQKFWDSAMAISHHDDE-EMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
             ANTMMQKFWDSA+A+   D+E + HSE SL + SE  + G S  +P + + N+F+FK++
Sbjct  375  VANTMMQKFWDSALALEPSDEEFDSHSEMSLVMPSEVGD-GRSSIYP-AVVGNSFAFKLQ  432

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D+KGRMHRFT  + ++ +L+++I QRL G +    L Q+LY+D++ D+V+L +DSDL  A
Sbjct  433  DKKGRMHRFTCGSESLDELVSSITQRL-GTVVEKGLIQLLYDDDEGDRVLLTTDSDLAGA  491

Query  367  VEHARSAGWKGLRLHLDYSRT  305
            V +A+S+G K LRLH+D S +
Sbjct  492  VLNAKSSGLKVLRLHIDDSES  512



>ref|XP_004971347.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Setaria 
italica]
Length=532

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 142/197 (72%), Gaps = 5/197 (3%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NPECA+++T ILDALH M DGKFLH+P+ DK+G ++A +D L +T A IS V   +G N 
Sbjct  288  NPECATLDTSILDALHSMQDGKFLHIPVIDKNGHIIACLDALQLTHATISMVEGASGAN-  346

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + AN+MMQKFWDSA+A+   ++ +  S+ S  +AS+  +    LP     + ++F FKIE
Sbjct  347  DVANSMMQKFWDSALAMHPAEESDARSDESRMVASDSADGKHILP---PHVNSSFCFKIE  403

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            DRKGRMHRF+  + ++ +L++A+  R+G D + +N+ ++LY D++ D+V+L +DSDL  A
Sbjct  404  DRKGRMHRFSCVSESLDELVSAVACRIGTDNDKSNI-KLLYNDDEGDRVILTTDSDLTAA  462

Query  367  VEHARSAGWKGLRLHLD  317
            +EHA+SAGWK LRLH+D
Sbjct  463  IEHAKSAGWKVLRLHMD  479



>ref|XP_008677065.1| PREDICTED: uncharacterized protein LOC100279220 isoform X1 [Zea 
mays]
 gb|AFW60739.1| hypothetical protein ZEAMMB73_016218 [Zea mays]
Length=564

 Score =   188 bits (478),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 112/245 (46%), Positives = 149/245 (61%), Gaps = 46/245 (19%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV--------  752
            +PE A+V+ PILDAL  M + KFLHLP+ D+DG +++++DV+ I  AAIS          
Sbjct  283  DPEFATVDMPILDALRTMQERKFLHLPVMDRDGSIISIIDVIDIAHAAISICVCAQRACD  342

Query  751  -----------GNTAGVNEETANTMMQKFWDSAMAISHHDDE----EMHSEASLKL----  629
                       G+ +  ++E A++M Q+FWDSAMA+   DDE       SEAS       
Sbjct  343  GTLQVESSGGGGDGSAGSDEAASSMFQRFWDSAMALGPLDDETDTQSQMSEASRSQMMMS  402

Query  628  -----------ASEGQETGISLPFPSSTLQNTFSFKIEDRKGRMHRFTSDTRNMTDLITA  482
                       A  G E G SL        ++FSFK++DR+GRMHRF+ + +++T L+T 
Sbjct  403  DVHHHHHHHDSAGGGSEAGFSL--------SSFSFKLQDRRGRMHRFSCEVQSLTPLVTC  454

Query  481  ILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITAVEHARSAGWKGLRLHLDYSRTP  302
            IL+RLG DI+ + LPQILYEDED D+VVLASD DL  AVEHAR AGWKGL+L LDYS T 
Sbjct  455  ILRRLGADIDPDRLPQILYEDEDRDKVVLASDDDLAAAVEHARLAGWKGLKLFLDYSGTT  514

Query  301  HLRRG  287
              R+ 
Sbjct  515  GRRKA  519



>ref|XP_007159889.1| hypothetical protein PHAVU_002G276200g [Phaseolus vulgaris]
 gb|ESW31883.1| hypothetical protein PHAVU_002G276200g [Phaseolus vulgaris]
Length=527

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 141/200 (71%), Gaps = 11/200 (6%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NP+CASV+T ILDALH MHDGKFL+LP+ DKDG VVA +DVL IT AAIS V  ++ VN 
Sbjct  292  NPDCASVDTTILDALHMMHDGKFLNLPVIDKDGYVVACIDVLQITHAAISMV-ESSSVN-  349

Query  727  ETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
            + ANT+MQKFWDSA+ +   +D + HSE S      G +T  S+   S    N+F+FK+E
Sbjct  350  DMANTIMQKFWDSALNLEPPEDSDTHSELS------GADTAKSVS-QSVGYANSFAFKLE  402

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D  GR+HRF   T  + +L++A++QR+  D+     P I+Y+D++ D++VLA+D+DL TA
Sbjct  403  DLNGRVHRFNCGTERLDELVSAVMQRV--DVKDGERPIIMYDDDEGDKIVLATDNDLGTA  460

Query  367  VEHARSAGWKGLRLHLDYSR  308
            V  ARSAG K L+LHLD+ R
Sbjct  461  VSCARSAGVKALKLHLDFGR  480



>ref|XP_002450380.1| hypothetical protein SORBIDRAFT_05g004570 [Sorghum bicolor]
 gb|EES09368.1| hypothetical protein SORBIDRAFT_05g004570 [Sorghum bicolor]
Length=511

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 146/200 (73%), Gaps = 6/200 (3%)
 Frame = -2

Query  904  PECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNEE  725
            P+CA+++T ILDALH MHDGKFLH+P+ D DG V A +DVL IT AAIS V    G   +
Sbjct  266  PDCATLDTTILDALHIMHDGKFLHIPVLDGDGQVAACLDVLQITHAAISMVEGGPGAAND  325

Query  724  TANTMMQKFWDSAMAISHHD-DEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
             ANT+MQKFWDSA+A+   D D + HSE SL + S+ ++ G S  +P + + N+F FK++
Sbjct  326  VANTIMQKFWDSALALEPPDEDFDSHSELSLVMPSDARD-GRSSIYPPA-VDNSFVFKLQ  383

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLG-GDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            D+KGRMHRFT  + ++ +L+++++QRLG GD    ++ Q+LYED++ D+V+L ++SDL  
Sbjct  384  DKKGRMHRFTCGSESLDELMSSVIQRLGMGD--EKSVIQLLYEDDEGDKVLLTTNSDLTG  441

Query  370  AVEHARSAGWKGLRLHLDYS  311
            AV +A+S+G K LRLH+D S
Sbjct  442  AVLYAKSSGLKALRLHMDDS  461



>ref|XP_004978808.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like [Setaria 
italica]
Length=546

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 144/199 (72%), Gaps = 4/199 (2%)
 Frame = -2

Query  904  PECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNEE  725
            P+CA+++T ILDALH MHDGKFLH+P+ D DG V A +DVL +T AAIS V    G   +
Sbjct  302  PDCATLDTTILDALHIMHDGKFLHIPVLDGDGRVAACLDVLQLTHAAISMVEGGPGTAND  361

Query  724  TANTMMQKFWDSAMAISHHD-DEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKIE  548
             ANT+MQKFWDSA+A+   D D + HSE SL + SE  + G S  +P + + N+F+FK++
Sbjct  362  AANTIMQKFWDSALALEPPDEDFDSHSELSLVMPSEAGD-GRSSIYPPA-VGNSFAFKLQ  419

Query  547  DRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLITA  368
            D+KGRMHRFT  + ++ +LI++++QRLG     + + Q+LYED++ D+V+L +DSDL  A
Sbjct  420  DQKGRMHRFTCGSESLDELISSVMQRLGIGSEKSTV-QLLYEDDEGDKVLLTTDSDLAGA  478

Query  367  VEHARSAGWKGLRLHLDYS  311
            V +A+S+G K LRLH+D S
Sbjct  479  VFNAKSSGLKALRLHIDDS  497



>gb|EMT07817.1| hypothetical protein F775_10200 [Aegilops tauschii]
Length=451

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 145/204 (71%), Gaps = 4/204 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NP+CA+++T ILDALH MHDGKFLH+P+ D++G + A +DVL +T AAI  V    G   
Sbjct  218  NPDCATLDTTILDALHIMHDGKFLHIPVLDREGQIAACLDVLQLTHAAIQLVEGGNGTAN  277

Query  727  ETANTMMQKFWDSAMAISHHDDE-EMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            + AN++MQ+FWDSA+A+   DDE +  SEASL +ASE  + G S  +P   + N+F FK+
Sbjct  278  DMANSVMQRFWDSALALEPPDDELDSRSEASLLMASEAGD-GRSSIYP-PIIGNSFPFKL  335

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +DRKGR+HRFT  + ++ +L++++ QRL   I+  ++ QILYED++ D+V+L +D+DL  
Sbjct  336  QDRKGRVHRFTCGSESLNELVSSVRQRL-SIIDEKDIIQILYEDDEGDRVLLTTDTDLAG  394

Query  370  AVEHARSAGWKGLRLHLDYSRTPH  299
            AV HA+S+G K L+LH+     P+
Sbjct  395  AVLHAKSSGLKVLKLHIVDESNPN  418



>dbj|BAJ96988.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=553

 Score =   184 bits (467),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 146/204 (72%), Gaps = 4/204 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTVGNTAGVNE  728
            NP+CA+++T ILDALH MHDGKFLH+P+ D++G + A +DVL +T AAI  V    G   
Sbjct  307  NPDCATLDTTILDALHIMHDGKFLHIPVLDREGQIAACLDVLQLTHAAIQLVEGGNGTAN  366

Query  727  ETANTMMQKFWDSAMAISHHDDE-EMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
            + AN++MQ+FWDSA+A+   DDE +  SEASL +ASE  + G S  +P   + N+F FK+
Sbjct  367  DVANSVMQRFWDSALALEAPDDEFDSRSEASLLMASEAGD-GRSSIYP-PIIGNSFPFKL  424

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            +DRKGR+HRFT  + ++ +L++++ QRL   I+  ++ QILYED++ D+V+L +D+DL  
Sbjct  425  QDRKGRVHRFTCGSESLDELVSSVRQRL-SIIDEKDIIQILYEDDEGDRVLLTTDTDLAG  483

Query  370  AVEHARSAGWKGLRLHLDYSRTPH  299
            AV HA+S+G K L+LH++    P+
Sbjct  484  AVLHAKSSGLKVLKLHIEDESNPN  507



>ref|XP_007038002.1| CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein 
isoform 3 [Theobroma cacao]
 gb|EOY22503.1| CBS / octicosapeptide/Phox/Bemp1 (PB1) domains-containing protein 
isoform 3 [Theobroma cacao]
Length=426

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 112/134 (84%), Gaps = 4/134 (3%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAIST---VGNTAG  737
            NPECA+V+TPI+DALH MHDGKFLHLP+ D+DG +VAVVDVLHIT AA++T   VG+T+G
Sbjct  292  NPECATVDTPIVDALHTMHDGKFLHLPVVDRDGEIVAVVDVLHITHAAVATVSQVGSTSG  351

Query  736  VNEETANTMMQKFWDSAMAI-SHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFS  560
            +N E   TMMQKFWDSAMA+  + DD+E  S+ SLKLAS+G ET  SLP+PSS++ NTF 
Sbjct  352  INNEATTTMMQKFWDSAMALPPNEDDDETRSDNSLKLASDGGETARSLPYPSSSMPNTFG  411

Query  559  FKIEDRKGRMHRFT  518
            FKI+D++GRMHRFT
Sbjct  412  FKIQDKRGRMHRFT  425



>ref|XP_004502995.1| PREDICTED: CBS domain-containing protein CBSCBSPB3-like isoform 
X1 [Cicer arietinum]
Length=520

 Score =   182 bits (462),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 142/200 (71%), Gaps = 3/200 (2%)
 Frame = -2

Query  907  NPECASVETPILDALHRMHDGKFLHLPISDKDGvvvavvdVLHITRAAISTV-GNTAGVN  731
            NPECASVET ILDALH MHDGKFL+LP+ DKDG  VA VDVL IT AAIS V  +++G  
Sbjct  275  NPECASVETTILDALHMMHDGKFLNLPVVDKDGNAVACVDVLQITHAAISLVESSSSGNV  334

Query  730  EETANTMMQKFWDSAMAISHHDDEEMHSEASLKLASEGQETGISLPFPSSTLQNTFSFKI  551
             + A T+MQKFWDSA A+   +D + +SE S +L  +G +T  S+ + S+   N+F+FK 
Sbjct  335  NDVAGTIMQKFWDSAFALEPPEDYDTNSEISGQLTLDGADTTKSM-YQSAGFGNSFTFKF  393

Query  550  EDRKGRMHRFTSDTRNMTDLITAILQRLGGDINWNNLPQILYEDEDHDQVVLASDSDLIT  371
            ED  G++HRF   + +  +L++A++Q++ G +N    P +LYED++ D++++++++DL  
Sbjct  394  EDLNGQVHRFNCGSEHQDELVSAVMQKI-GPVNDGERPTLLYEDDEGDKIIISTNNDLAA  452

Query  370  AVEHARSAGWKGLRLHLDYS  311
            AV +ARSAG K L+L L ++
Sbjct  453  AVSYARSAGLKALKLDLVFA  472



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1919675704716