BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16499_g1_i2 len=2268 path=[2480:0-1582 @118@!:1583-2088
4567:2089-2267]

Length=2268
                                                                      Score     E

gb|AAC27795.1|  feedback-insensitive anthranilate synthase alpha-...    875   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009612779.1|  PREDICTED: anthranilate synthase alpha subun...    873   0.0      
ref|XP_009780336.1|  PREDICTED: anthranilate synthase alpha subun...    857   0.0      
ref|XP_011084924.1|  PREDICTED: LOW QUALITY PROTEIN: anthranilate...    855   0.0      
ref|XP_010543741.1|  PREDICTED: anthranilate synthase alpha subun...    849   0.0      
gb|KHG03962.1|  Anthranilate synthase component I-1, chloroplasti...    848   0.0      
ref|XP_010067517.1|  PREDICTED: anthranilate synthase alpha subun...    846   0.0      
gb|AAU84988.1|  anthranilate synthase alpha 1                           845   0.0      Camptotheca acuminata
ref|XP_010272678.1|  PREDICTED: anthranilate synthase alpha subun...    842   0.0      
ref|XP_002526888.1|  anthranilate synthase component I, putative        838   0.0      Ricinus communis
ref|XP_006425048.1|  hypothetical protein CICLE_v10028065mg             838   0.0      
ref|XP_007009041.1|  Anthranilate synthase alpha subunit 1              838   0.0      
ref|XP_009612780.1|  PREDICTED: anthranilate synthase alpha subun...    836   0.0      
ref|XP_009606071.1|  PREDICTED: anthranilate synthase alpha subun...    835   0.0      
ref|XP_002316223.2|  hypothetical protein POPTR_0010s19790g             833   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006435705.1|  hypothetical protein CICLE_v10031010mg             833   0.0      
ref|XP_010685584.1|  PREDICTED: anthranilate synthase alpha subun...    833   0.0      
ref|XP_006486337.1|  PREDICTED: LOW QUALITY PROTEIN: anthranilate...    833   0.0      
ref|XP_006488497.1|  PREDICTED: anthranilate synthase component I...    833   0.0      
gb|KHN36387.1|  Anthranilate synthase component I-1, chloroplastic      832   0.0      
ref|XP_009802665.1|  PREDICTED: anthranilate synthase alpha subun...    831   0.0      
ref|XP_011035977.1|  PREDICTED: anthranilate synthase alpha subun...    830   0.0      
ref|XP_009606063.1|  PREDICTED: anthranilate synthase alpha subun...    830   0.0      
gb|AAU84989.1|  anthranilate synthase alpha 2                           828   0.0      Camptotheca acuminata
ref|XP_009802664.1|  PREDICTED: anthranilate synthase alpha subun...    825   0.0      
gb|AAA74901.1|  anthranilate synthase alpha subunit                     825   0.0      Ruta graveolens
emb|CDX98861.1|  BnaC09g49740D                                          823   0.0      
ref|XP_009416627.1|  PREDICTED: anthranilate synthase alpha subun...    823   0.0      
ref|XP_006344046.1|  PREDICTED: anthranilate synthase component I...    822   0.0      
ref|XP_010273416.1|  PREDICTED: anthranilate synthase alpha subun...    820   0.0      
ref|XP_004240399.1|  PREDICTED: anthranilate synthase alpha subun...    820   0.0      
gb|KFK25012.1|  hypothetical protein AALP_AA8G055100                    819   0.0      
ref|XP_009122172.1|  PREDICTED: anthranilate synthase alpha subun...    819   0.0      
ref|NP_196192.1|  anthranilate synthase component I-1                   819   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EYU45742.1|  hypothetical protein MIMGU_mgv1a003752mg                817   0.0      
ref|XP_006399030.1|  hypothetical protein EUTSA_v10013041mg             817   0.0      
ref|XP_008392945.1|  PREDICTED: anthranilate synthase alpha subun...    816   0.0      
ref|XP_007218949.1|  hypothetical protein PRUPE_ppa003426mg             816   0.0      
dbj|BAD90675.1|  anthranilate synthetase alpha subunit                  816   0.0      
emb|CDX80970.1|  BnaC03g02240D                                          815   0.0      
ref|XP_010256590.1|  PREDICTED: anthranilate synthase alpha subun...    815   0.0      
ref|XP_006601954.1|  PREDICTED: anthranilate synthase component I...    813   0.0      
ref|XP_003555838.1|  PREDICTED: anthranilate synthase component I...    812   0.0      
ref|XP_004497238.1|  PREDICTED: anthranilate synthase component I...    812   0.0      
emb|CDY11333.1|  BnaA03g01690D                                          812   0.0      
ref|XP_010452479.1|  PREDICTED: anthranilate synthase alpha subun...    812   0.0      
gb|KHN36388.1|  Anthranilate synthase component I-1, chloroplastic      812   0.0      
ref|XP_010534810.1|  PREDICTED: anthranilate synthase alpha subun...    811   0.0      
gb|KHN23104.1|  Anthranilate synthase component I-2, chloroplastic      810   0.0      
ref|XP_008368076.1|  PREDICTED: anthranilate synthase alpha subun...    810   0.0      
ref|XP_010423436.1|  PREDICTED: anthranilate synthase alpha subun...    810   0.0      
ref|XP_010650923.1|  PREDICTED: anthranilate synthase alpha subun...    810   0.0      
emb|CDX70133.1|  BnaA10g24820D                                          809   0.0      
ref|XP_009350798.1|  PREDICTED: anthranilate synthase alpha subun...    808   0.0      
gb|AFL91702.1|  anthranilate synthase alpha-subunit 1                   810   0.0      
ref|XP_009780337.1|  PREDICTED: anthranilate synthase alpha subun...    808   0.0      
ref|XP_007142762.1|  hypothetical protein PHAVU_007G014800g             807   0.0      
ref|XP_009344662.1|  PREDICTED: anthranilate synthase alpha subun...    806   0.0      
emb|CAN83610.1|  hypothetical protein VITISV_035611                     807   0.0      Vitis vinifera
ref|XP_009130895.1|  PREDICTED: anthranilate synthase alpha subun...    806   0.0      
ref|XP_008233737.1|  PREDICTED: anthranilate synthase alpha subun...    805   0.0      
ref|XP_010104658.1|  Anthranilate synthase component I-2                810   0.0      
ref|XP_002873221.1|  hypothetical protein ARALYDRAFT_487374             805   0.0      
ref|XP_010650922.1|  PREDICTED: anthranilate synthase alpha subun...    805   0.0      
ref|XP_006287339.1|  hypothetical protein CARUB_v10000538mg             804   0.0      
ref|XP_010491108.1|  PREDICTED: anthranilate synthase alpha subun...    803   0.0      
ref|XP_010095088.1|  Anthranilate synthase component I-1                803   0.0      
ref|XP_010256592.1|  PREDICTED: anthranilate synthase alpha subun...    800   0.0      
ref|NP_001190231.1|  anthranilate synthase component I-1                802   0.0      
emb|CDP14042.1|  unnamed protein product                                802   0.0      
gb|AFL91701.1|  anthranilate synthase alpha-subunit 2                   800   0.0      
gb|KFK23180.1|  hypothetical protein AALP_AAs58904U000100               801   0.0      
gb|AGJ70266.1|  anthranilate synthase A                                 800   0.0      
emb|CBI15979.3|  unnamed protein product                                799   0.0      
gb|AAA74900.1|  anthranilate synthase alpha subunit                     800   0.0      Ruta graveolens
gb|AGJ70267.1|  anthranilate synthase A                                 800   0.0      
gb|EPS68997.1|  anthranilate synthase alpha 1                           796   0.0      
ref|XP_010504458.1|  PREDICTED: anthranilate synthase alpha subun...    798   0.0      
emb|CDX83311.1|  BnaA03g21950D                                          799   0.0      
ref|XP_008442227.1|  PREDICTED: anthranilate synthase alpha subun...    796   0.0      
ref|XP_003600871.1|  Anthranilate synthase alpha                        797   0.0      
ref|XP_004144668.1|  PREDICTED: anthranilate synthase component I...    795   0.0      
gb|KHG13037.1|  Anthranilate synthase component I-2, chloroplasti...    794   0.0      
ref|XP_010534737.1|  PREDICTED: anthranilate synthase alpha subun...    795   0.0      
ref|XP_011082384.1|  PREDICTED: anthranilate synthase alpha subun...    792   0.0      
ref|XP_010414346.1|  PREDICTED: anthranilate synthase alpha subun...    794   0.0      
ref|XP_011082385.1|  PREDICTED: anthranilate synthase alpha subun...    791   0.0      
ref|XP_010510457.1|  PREDICTED: anthranilate synthase alpha subun...    794   0.0      
gb|KEH34470.1|  anthranilate synthase alpha 1                           793   0.0      
ref|XP_007016132.1|  Anthranilate synthase 2 isoform 1                  792   0.0      
ref|XP_009374261.1|  PREDICTED: anthranilate synthase alpha subun...    792   0.0      
ref|XP_010414347.1|  PREDICTED: anthranilate synthase alpha subun...    793   0.0      
emb|CAC29060.1|  anthranilate synthase alpha subunit                    792   0.0      Catharanthus roseus [chatas]
ref|XP_008220596.1|  PREDICTED: anthranilate synthase alpha subun...    791   0.0      
ref|XP_011032135.1|  PREDICTED: anthranilate synthase alpha subun...    792   0.0      
ref|XP_006410032.1|  hypothetical protein EUTSA_v10016377mg             792   0.0      
emb|CDX95746.1|  BnaC03g26270D                                          792   0.0      
ref|XP_009133845.1|  PREDICTED: anthranilate synthase alpha subun...    792   0.0      
ref|XP_010469929.1|  PREDICTED: anthranilate synthase alpha subun...    791   0.0      
ref|XP_002879228.1|  hypothetical protein ARALYDRAFT_481885             790   0.0      
ref|XP_009130894.1|  PREDICTED: anthranilate synthase alpha subun...    790   0.0      
ref|XP_010046381.1|  PREDICTED: anthranilate synthase alpha subun...    794   0.0      
ref|XP_004500675.1|  PREDICTED: anthranilate synthase component I...    789   0.0      
ref|XP_009133842.1|  PREDICTED: anthranilate synthase alpha subun...    788   0.0      
ref|XP_009133844.1|  PREDICTED: anthranilate synthase alpha subun...    788   0.0      
ref|XP_009371532.1|  PREDICTED: anthranilate synthase alpha subun...    786   0.0      
ref|XP_009371533.1|  PREDICTED: anthranilate synthase alpha subun...    786   0.0      
ref|XP_002314114.2|  hypothetical protein POPTR_0009s04890g             785   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002525623.1|  anthranilate synthase component I, putative        785   0.0      Ricinus communis
emb|CDP09175.1|  unnamed protein product                                783   0.0      
ref|XP_011032136.1|  PREDICTED: anthranilate synthase alpha subun...    783   0.0      
ref|XP_010905354.1|  PREDICTED: anthranilate synthase alpha subun...    782   0.0      
ref|XP_009371515.1|  PREDICTED: anthranilate synthase alpha subun...    781   0.0      
ref|XP_007163528.1|  hypothetical protein PHAVU_001G241700g             781   0.0      
ref|XP_009371516.1|  PREDICTED: anthranilate synthase alpha subun...    781   0.0      
ref|XP_007163527.1|  hypothetical protein PHAVU_001G241600g             780   0.0      
ref|XP_004295746.1|  PREDICTED: anthranilate synthase component I...    780   0.0      
ref|XP_006848166.1|  hypothetical protein AMTR_s00029p00234880          778   0.0      
ref|XP_010414345.1|  PREDICTED: anthranilate synthase alpha subun...    780   0.0      
ref|NP_180530.1|  anthranilate synthase component I-2                   778   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAD95154.1|  anthranilate synthase, alpha subunit                   777   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004981203.1|  PREDICTED: anthranilate synthase component I...    773   0.0      
gb|EMT21623.1|  Anthranilate synthase component I-1, chloroplastic      777   0.0      
ref|XP_006651978.1|  PREDICTED: anthranilate synthase component I...    772   0.0      
ref|XP_003559222.1|  PREDICTED: anthranilate synthase alpha subun...    775   0.0      
gb|KDP46514.1|  hypothetical protein JCGZ_08486                         774   0.0      
ref|XP_010905357.1|  PREDICTED: anthranilate synthase alpha subun...    772   0.0      
dbj|BAK01731.1|  predicted protein                                      768   0.0      
sp|A2XNK3.1|ASA1_ORYSI  RecName: Full=Anthranilate synthase alpha...    767   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010256591.1|  PREDICTED: anthranilate synthase alpha subun...    764   0.0      
ref|NP_001051764.1|  Os03g0826500                                       764   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|AFR69324.1|  anthranilate synthase alpha 1                           764   0.0      
ref|XP_002876339.1|  hypothetical protein ARALYDRAFT_348673             762   0.0      
gb|AFR69323.1|  anthranilate synthase alpha 1                           763   0.0      
ref|XP_004308927.1|  PREDICTED: anthranilate synthase component I...    763   0.0      
dbj|BAA82094.1|  anthranilate synthase alpha 1 subunit                  762   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CAB87841.1|  anthranilate synthase alpha-1 chain-like protein       759   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002463603.1|  hypothetical protein SORBIDRAFT_01g002760          759   0.0      Sorghum bicolor [broomcorn]
ref|XP_010923079.1|  PREDICTED: anthranilate synthase alpha subun...    759   0.0      
ref|NP_001049641.1|  Os03g0264400                                       760   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010521932.1|  PREDICTED: anthranilate synthase alpha subun...    760   0.0      
gb|EPS60768.1|  hypothetical protein M569_14029                         756   0.0      
ref|NP_001266525.1|  anthranilate synthase component I-1                758   0.0      
ref|XP_004984692.1|  PREDICTED: anthranilate synthase component I...    756   0.0      
ref|XP_008644366.1|  PREDICTED: anthranilate synthase alpha subun...    755   0.0      
gb|AES62987.2|  anthranilate synthase alpha 1                           754   0.0      
ref|XP_003558289.1|  PREDICTED: anthranilate synthase alpha subun...    756   0.0      
ref|NP_001105813.1|  LOC606722                                          754   0.0      Zea mays [maize]
ref|XP_006651238.1|  PREDICTED: anthranilate synthase component I...    751   0.0      
gb|EMT13435.1|  Anthranilate synthase component I-2, chloroplastic      754   0.0      
gb|EEE58750.1|  hypothetical protein OsJ_10240                          758   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ABF95120.1|  anthranilate synthase component I family protein,...    750   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAF30814.1|  anthranilate synthase alpha 2 subunit                  753   0.0      Avena sativa [cultivated oat]
dbj|BAF30812.1|  anthranilate synthase alpha 2 subunit                  752   0.0      Avena sativa [cultivated oat]
dbj|BAF30813.1|  anthranilate synthase alpha 2 subunit                  752   0.0      Avena sativa [cultivated oat]
gb|AAP06828.1|  putative anthraniliate synthase alpha 2 subunit         751   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009371549.1|  PREDICTED: anthranilate synthase alpha subun...    746   0.0      
ref|XP_004138565.1|  PREDICTED: anthranilate synthase component I...    746   0.0      
gb|EMS66757.1|  Anthranilate synthase component I-1, chloroplastic      764   0.0      
gb|AEX10582.1|  anthranilate synthase alpha 1 subunit                   747   0.0      
ref|XP_004160746.1|  PREDICTED: anthranilate synthase component I...    744   0.0      
ref|XP_008665704.1|  PREDICTED: LOW QUALITY PROTEIN: anthranilate...    748   0.0      
ref|XP_008441460.1|  PREDICTED: anthranilate synthase alpha subun...    743   0.0      
gb|KGN45787.1|  hypothetical protein Csa_6G011620                       749   0.0      
ref|XP_003635982.1|  Anthranilate synthase alpha                        769   0.0      
ref|XP_003601171.1|  Anthranilate synthase alpha                        743   0.0      
ref|XP_006287444.1|  hypothetical protein CARUB_v10000652mg             736   0.0      
ref|XP_003592736.1|  Anthranilate synthase alpha                        737   0.0      
gb|KFK34824.1|  hypothetical protein AALP_AA5G197700                    730   0.0      
gb|ABF95123.1|  anthranilate synthase component I family protein,...    731   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ABF95124.1|  anthranilate synthase component I family protein,...    728   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009606078.1|  PREDICTED: anthranilate synthase alpha subun...    722   0.0      
ref|XP_009802666.1|  PREDICTED: anthranilate synthase alpha subun...    721   0.0      
emb|CBI25503.3|  unnamed protein product                                721   0.0      
ref|XP_010685585.1|  PREDICTED: anthranilate synthase alpha subun...    716   0.0      
ref|XP_001772721.1|  predicted protein                                  716   0.0      
ref|XP_006344111.1|  PREDICTED: anthranilate synthase component I...    716   0.0      
ref|XP_001772772.1|  predicted protein                                  712   0.0      
gb|KCW65661.1|  hypothetical protein EUGRSUZ_G03047                     709   0.0      
ref|XP_008349676.1|  PREDICTED: anthranilate synthase alpha subun...    704   0.0      
ref|XP_004240395.1|  PREDICTED: anthranilate synthase alpha subun...    707   0.0      
gb|EMS47524.1|  Anthranilate synthase component I-1, chloroplastic      700   0.0      
ref|XP_001765555.1|  predicted protein                                  700   0.0      
ref|XP_010427388.1|  PREDICTED: anthranilate synthase alpha subun...    697   0.0      
dbj|BAJ88369.1|  predicted protein                                      694   0.0      
ref|XP_002974247.1|  hypothetical protein SELMODRAFT_414586             697   0.0      
ref|XP_002985617.1|  hypothetical protein SELMODRAFT_122876             693   0.0      
ref|XP_010504459.1|  PREDICTED: anthranilate synthase alpha subun...    692   0.0      
gb|ACF36172.1|  anthranilate synthase alpha subunit 2                   692   0.0      Hordeum vulgare subsp. vulgare [barley]
ref|XP_006292844.1|  hypothetical protein CARUB_v10019104mg             690   0.0      
ref|XP_002271164.2|  PREDICTED: LOW QUALITY PROTEIN: anthranilate...    693   0.0      Vitis vinifera
ref|XP_011032137.1|  PREDICTED: anthranilate synthase alpha subun...    686   0.0      
gb|ABF95121.1|  anthranilate synthase component I family protein,...    680   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009371534.1|  PREDICTED: anthranilate synthase alpha subun...    678   0.0      
ref|NP_567028.1|  anthranilate synthase component I-like protein        678   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAL11605.1|AF424611_1  AT3g55870/F27K19_50                           677   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009371517.1|  PREDICTED: anthranilate synthase alpha subun...    677   0.0      
ref|XP_011082386.1|  PREDICTED: anthranilate synthase alpha subun...    676   0.0      
ref|XP_008220602.1|  PREDICTED: anthranilate synthase alpha subun...    676   0.0      
ref|XP_010650924.1|  PREDICTED: anthranilate synthase alpha subun...    672   0.0      
ref|XP_007016135.1|  Anthranilate synthase component I-2 isoform 4      667   0.0      
gb|KCW85459.1|  hypothetical protein EUGRSUZ_B02267                     661   0.0      
ref|XP_010321741.1|  PREDICTED: anthranilate synthase alpha subun...    664   0.0      
ref|XP_007205190.1|  hypothetical protein PRUPE_ppa005650mg             658   0.0      
ref|XP_010412791.1|  PREDICTED: anthranilate synthase alpha subun...    648   0.0      
ref|XP_007016134.1|  Anthranilate synthase component I-2 isoform 3      614   0.0      
ref|XP_007016133.1|  Anthranilate synthase component I-2 isoform 2      613   0.0      
gb|EYU41273.1|  hypothetical protein MIMGU_mgv1a005722mg                611   0.0      
ref|XP_006379042.1|  hypothetical protein POPTR_0009s04890g             605   0.0      
ref|XP_005845858.1|  hypothetical protein CHLNCDRAFT_25481              603   0.0      
ref|XP_001418632.1|  predicted protein                                  597   0.0      Ostreococcus lucimarinus CCE9901
ref|XP_005644806.1|  anthranilate synthase component                    596   0.0      
ref|XP_008385064.1|  PREDICTED: LOW QUALITY PROTEIN: anthranilate...    597   0.0      
ref|XP_002500014.1|  predicted protein                                  587   0.0      Micromonas commoda
ref|XP_003080205.1|  anthranilate synthase alpha subunit (ISS)          585   0.0      
emb|CEF98618.1|  Anthranilate synthase component I, PabB-like           585   0.0      
ref|XP_007016137.1|  Anthranilate synthase component I-2 isoform 6      577   0.0      
ref|XP_007514975.1|  anthranilate synthase component I                  575   0.0      
gb|KFM26929.1|  Anthranilate synthase component I-1, chloroplastic      566   0.0      
ref|XP_003057912.1|  predicted protein                                  561   0.0      
ref|XP_010685581.1|  PREDICTED: anthranilate synthase alpha subun...    545   0.0      
ref|XP_005537357.1|  anthranilate synthase component I                  520   1e-171   
gb|KDO66849.1|  hypothetical protein CISIN_1g020099mg                   505   3e-170   
ref|XP_008349576.1|  PREDICTED: anthranilate synthase alpha subun...    500   4e-168   
gb|KHN37366.1|  Anthranilate synthase component I-2, chloroplastic      498   1e-166   
ref|XP_005714208.1|  anthranilate synthase component I                  498   2e-163   
ref|XP_008779452.1|  PREDICTED: anthranilate synthase alpha subun...    488   1e-162   
ref|WP_029756683.1|  hypothetical protein                               490   1e-161   
gb|KDO69029.1|  hypothetical protein CISIN_1g0076992mg                  480   6e-161   
tpg|DAA44527.1|  TPA: hypothetical protein ZEAMMB73_369527              474   3e-158   
ref|XP_005707689.1|  anthranilate synthase component I                  470   2e-152   
ref|XP_001691378.1|  anthranilate synthase, alpha subunit               466   1e-151   Chlamydomonas reinhardtii
ref|XP_002946825.1|  hypothetical protein VOLCADRAFT_103239             459   2e-150   
tpg|DAA52290.1|  TPA: hypothetical protein ZEAMMB73_012998              456   3e-150   
gb|KDP44800.1|  hypothetical protein JCGZ_01300                         450   2e-149   
ref|WP_014435663.1|  anthranilate synthase component I                  430   4e-138   
ref|WP_020475120.1|  hypothetical protein                               413   4e-132   
ref|WP_010034549.1|  anthranilate synthase subunit I                    410   4e-131   
ref|WP_010587941.1|  anthranilate synthase subunit I                    410   8e-131   
gb|AIU64772.1|  anthranilate synthase alpha-subunit 2-like protein      400   3e-130   
gb|AIU64771.1|  anthranilate synthase alpha-subunit 2-like protein      400   3e-130   
ref|XP_006403405.1|  hypothetical protein EUTSA_v10011120mg             391   3e-126   
ref|WP_013629736.1|  anthranilate synthase subunit I                    396   2e-125   
ref|WP_002646958.1|  anthranilate synthase subunit I                    396   2e-125   
ref|XP_008349680.1|  PREDICTED: anthranilate synthase alpha subun...    389   3e-125   
ref|WP_008691647.1|  anthranilate synthase component I                  394   1e-124   
ref|WP_002651708.1|  anthranilate synthase subunit I                    388   2e-122   
ref|WP_022812490.1|  anthranilate synthase subunit I                    385   2e-121   
ref|WP_008675689.1|  anthranilate synthase component I                  384   1e-120   
ref|WP_013109037.1|  anthranilate synthase subunit I                    382   2e-119   
ref|WP_012912743.1|  anthranilate synthase subunit I                    379   4e-119   
ref|WP_012546555.1|  MULTISPECIES: anthranilate synthase subunit I      377   3e-118   
ref|WP_020383337.1|  hypothetical protein                               375   2e-117   
ref|WP_012470593.1|  anthranilate synthase subunit I                    374   2e-117   
ref|WP_028951272.1|  anthranilate synthase                              374   5e-117   
ref|WP_018199412.1|  hypothetical protein                               373   1e-116   
ref|WP_011121650.1|  anthranilate synthase subunit I                    374   2e-116   
ref|WP_015249581.1|  anthranilate synthase subunit I                    372   3e-116   
ref|WP_007328434.1|  anthranilate synthase subunit I                    374   4e-116   
ref|WP_007334153.1|  anthranilate synthase subunit I                    373   4e-116   
gb|KHE90958.1|  anthranilate synthase component I                       372   4e-116   
ref|WP_009102047.1|  anthranilate synthase, component I                 372   5e-116   
ref|WP_007339186.1|  anthranilate synthase component I                  373   6e-116   
ref|WP_018249152.1|  hypothetical protein                               371   6e-116   
ref|WP_008666729.1|  anthranilate synthase, component I                 373   6e-116   
ref|WP_008661726.1|  anthranilate synthase component I                  372   1e-115   
ref|WP_012673939.1|  anthranilate synthase subunit I                    370   2e-115   
gb|KDO66852.1|  hypothetical protein CISIN_1g020099mg                   360   2e-115   
ref|WP_034409123.1|  anthranilate synthase                              368   7e-115   
ref|WP_014255757.1|  anthranilate synthase subunit I [                  368   8e-115   
ref|WP_015326110.1|  anthranilate synthase component I                  368   1e-114   
emb|CAJ72621.1|  strongly similar to anthranilate synthase compon...    368   1e-114   Candidatus Kuenenia stuttgartiensis
ref|WP_016482288.1|  anthranilate synthase, component I                 368   1e-114   
ref|WP_029475097.1|  anthranilate synthase                              366   3e-114   
ref|WP_007220516.1|  anthranilate synthase subunit I                    366   5e-114   
ref|WP_010252519.1|  anthranilate synthase subunit I                    365   8e-114   
ref|WP_013706781.1|  anthranilate synthase subunit I                    365   1e-113   
ref|WP_012675821.1|  anthranilate synthase subunit I                    364   3e-113   
ref|WP_003517208.1|  anthranilate synthase subunit I                    363   7e-113   
ref|WP_020676963.1|  hypothetical protein                               363   9e-113   
ref|WP_027084946.1|  anthranilate synthase                              363   1e-112   
ref|WP_013248582.1|  anthranilate synthase subunit I                    362   2e-112   
ref|WP_029193022.1|  anthranilate synthase                              361   9e-112   
ref|WP_011417726.1|  anthranilate synthase subunit I                    360   9e-112   
ref|WP_013278818.1|  anthranilate synthase subunit I                    360   1e-111   
ref|WP_028845575.1|  anthranilate synthase                              360   1e-111   
ref|WP_015940864.1|  anthranilate synthase subunit I                    360   2e-111   
ref|WP_029520484.1|  anthranilate synthase                              358   8e-111   
ref|WP_028554296.1|  anthranilate synthase                              358   1e-110   
ref|WP_012257292.1|  MULTISPECIES: anthranilate synthase subunit I      357   1e-110   
ref|WP_019005462.1|  anthranilate synthase subunit I                    358   2e-110   
ref|WP_013780165.1|  anthranilate synthase subunit I                    357   2e-110   
ref|WP_027093643.1|  anthranilate synthase                              357   3e-110   
ref|WP_022816428.1|  anthranilate synthase subunit I                    356   3e-110   
gb|KDO66851.1|  hypothetical protein CISIN_1g020099mg                   348   3e-110   
ref|WP_010273838.1|  anthranilate synthase subunit I                    356   5e-110   
ref|WP_011938631.1|  anthranilate synthase subunit I                    355   6e-110   
ref|WP_028540639.1|  anthranilate synthase                              356   8e-110   
ref|WP_013310717.1|  anthranilate synthase subunit I                    355   9e-110   
ref|WP_025723077.1|  anthranilate synthase                              355   9e-110   
ref|WP_012459918.1|  anthranilate synthase subunit I                    355   9e-110   
ref|WP_022050730.1|  anthranilate synthase component I                  355   1e-109   
ref|WP_031458261.1|  anthranilate synthase                              355   1e-109   
ref|WP_013916513.1|  anthranilate synthase subunit I                    355   2e-109   
gb|AIG26243.1|  anthranilate synthase component 1                       354   3e-109   
ref|WP_023989166.1|  anthranilate synthase subunit I                    354   3e-109   
ref|WP_018048496.1|  hypothetical protein                               353   4e-109   
ref|WP_011524919.1|  anthranilate synthase subunit I                    353   4e-109   
ref|WP_007145395.1|  anthranilate synthase subunit I                    353   5e-109   
ref|WP_029523214.1|  anthranilate synthase                              352   8e-109   
ref|WP_009671978.1|  MULTISPECIES: anthranilate synthase subunit I      353   1e-108   
ref|WP_028458241.1|  anthranilate synthase                              352   1e-108   
ref|WP_029517340.1|  anthranilate synthase                              352   2e-108   
ref|WP_026342495.1|  anthranilate synthase                              352   2e-108   
gb|KDO69031.1|  hypothetical protein CISIN_1g0076991mg                  343   2e-108   
ref|WP_026369332.1|  hypothetical protein                               351   2e-108   
ref|WP_011735487.1|  anthranilate synthase subunit I                    351   2e-108   
ref|WP_012648511.1|  anthranilate synthase subunit I                    351   2e-108   
ref|WP_031414531.1|  anthranilate synthase                              352   3e-108   
ref|WP_025682234.1|  anthranilate synthase                              352   3e-108   
ref|WP_007430823.1|  anthranilate synthase subunit I                    352   3e-108   
ref|WP_016822204.1|  MULTISPECIES: anthranilate synthase subunit I      352   3e-108   
ref|WP_022583867.1|  anthranilate synthase subunit I                    351   4e-108   
ref|WP_015837103.1|  anthranilate synthase subunit I                    350   4e-108   
ref|WP_025718922.1|  anthranilate synthase                              351   4e-108   
ref|WP_012120664.1|  anthranilate synthase subunit I                    351   6e-108   
ref|WP_027340085.1|  anthranilate synthase                              350   7e-108   
ref|WP_039271084.1|  anthranilate synthase                              350   8e-108   
ref|WP_018670101.1|  anthranilate synthase subunit I                    351   8e-108   
ref|WP_003341693.1|  anthranilate synthase subunit I                    350   9e-108   
ref|WP_026840316.1|  anthranilate synthase                              349   1e-107   
ref|WP_025675659.1|  anthranilate synthase                              350   1e-107   
ref|WP_018047069.1|  hypothetical protein                               350   1e-107   
ref|WP_005010740.1|  Anthranilate synthase, component I                 350   1e-107   
ref|WP_013371669.1|  anthranilate synthase subunit I                    350   2e-107   
ref|WP_022427771.1|  anthranilate synthase component I                  348   2e-107   
ref|WP_019534054.1|  anthranilate synthase subunit I                    349   2e-107   
ref|WP_039743454.1|  anthranilate synthase                              348   3e-107   
ref|WP_027330272.1|  anthranilate synthase component I                  348   3e-107   
ref|WP_010345773.1|  anthranilate synthase subunit I                    349   3e-107   
ref|WP_018751399.1|  anthranilate synthase subunit I                    349   4e-107   
ref|WP_012530845.1|  anthranilate synthase subunit I                    348   4e-107   
ref|WP_027720049.1|  anthranilate synthase                              348   6e-107   
ref|WP_011956202.1|  anthranilate synthase subunit I                    348   6e-107   
ref|WP_023482656.1|  anthranilate synthase component 1-like protein     348   6e-107   
ref|WP_014706870.1|  anthranilate synthase subunit I                    347   7e-107   
ref|WP_020402896.1|  hypothetical protein                               347   1e-106   
ref|WP_014282087.1|  anthranilate synthase subunit I                    348   1e-106   
ref|WP_015844016.1|  anthranilate synthase subunit I                    348   1e-106   
ref|WP_036946601.1|  anthranilate synthase                              346   3e-106   
ref|WP_039643611.1|  anthranilate synthase                              345   3e-106   
ref|WP_013907466.1|  anthranilate synthase subunit I                    345   4e-106   
ref|WP_009265337.1|  anthranilate synthase subunit I                    345   6e-106   
ref|WP_006001492.1|  anthranilate synthase subunit I                    345   8e-106   
ref|WP_017952218.1|  hypothetical protein                               345   8e-106   
ref|WP_005831284.1|  MULTISPECIES: anthranilate synthase subunit I      345   9e-106   
ref|WP_015254727.1|  anthranilate synthase subunit I                    345   1e-105   
dbj|GAM11438.1|  anthranilate synthase component 1                      344   1e-105   
ref|WP_017687710.1|  anthranilate synthase subunit I                    345   2e-105   
ref|WP_036680646.1|  anthranilate synthase                              344   2e-105   
ref|WP_022230162.1|  putative uncharacterized protein                   343   2e-105   
ref|WP_036607674.1|  MULTISPECIES: anthranilate synthase                344   3e-105   
ref|WP_007716570.1|  anthranilate synthase subunit I                    343   3e-105   
ref|WP_009726461.1|  anthranilate synthase component I                  343   3e-105   
ref|WP_015724111.1|  anthranilate synthase subunit I                    343   4e-105   
ref|WP_008390657.1|  anthranilate synthase subunit I                    343   4e-105   
ref|WP_015530753.1|  anthranilate synthase, component I                 342   4e-105   
ref|WP_010943019.1|  anthranilate synthase subunit I                    343   4e-105   
ref|WP_028548660.1|  anthranilate synthase                              343   4e-105   
ref|WP_008289960.1|  anthranilate synthase subunit I                    343   4e-105   
ref|WP_024630656.1|  MULTISPECIES: anthranilate synthase                343   4e-105   
ref|WP_021683454.1|  anthranilate synthase component I                  342   4e-105   
ref|WP_009204003.1|  anthranilate synthase component I                  342   6e-105   
ref|WP_020616671.1|  anthranilate synthase subunit I                    343   6e-105   
ref|WP_036313530.1|  anthranilate synthase component I                  342   6e-105   
ref|WP_015956498.1|  anthranilate synthase                              342   7e-105   
ref|WP_029099611.1|  anthranilate synthase                              342   8e-105   
ref|WP_023554419.1|  anthranilate synthase subunit I                    342   9e-105   
ref|WP_027714673.1|  anthranilate synthase                              342   9e-105   
ref|WP_014811873.1|  anthranilate synthase subunit I                    342   1e-104   
ref|WP_009290682.1|  MULTISPECIES: anthranilate synthase subunit I      341   1e-104   
ref|WP_024460966.1|  anthranilate synthase component I                  342   1e-104   
ref|WP_028539874.1|  anthranilate synthase                              342   1e-104   
ref|WP_004514649.1|  anthranilate synthase subunit I                    341   1e-104   
ref|WP_022852948.1|  anthranilate synthase subunit I                    341   1e-104   
ref|WP_019823121.1|  anthranilate synthase component I                  341   1e-104   
ref|WP_006565660.1|  anthranilate synthase subunit I                    341   2e-104   
ref|WP_015405134.1|  anthranilate synthase component I                  341   2e-104   
ref|WP_010234739.1|  anthranilate synthase subunit I                    340   2e-104   
ref|WP_010495129.1|  anthranilate synthase subunit I                    342   2e-104   
ref|WP_025846349.1|  anthranilate synthase                              342   2e-104   
ref|WP_038040815.1|  anthranilate synthase                              342   2e-104   
ref|WP_028561286.1|  anthranilate synthase                              342   2e-104   
ref|WP_013536761.1|  anthranilate synthase subunit I                    341   2e-104   
ref|WP_018886233.1|  anthranilate synthase subunit I                    341   2e-104   
ref|WP_022091239.1|  anthranilate synthase component I                  340   2e-104   
ref|WP_034342092.1|  anthranilate synthase                              340   2e-104   
ref|WP_025677779.1|  anthranilate synthase                              341   3e-104   
ref|WP_030001916.1|  hypothetical protein                               340   3e-104   
ref|WP_016782412.1|  anthranilate synthase subunit I                    340   3e-104   
ref|WP_014702842.1|  anthranilate synthase subunit I                    340   3e-104   
ref|WP_015179254.1|  anthranilate synthase component I                  341   3e-104   
ref|WP_006561570.1|  anthranilate synthase subunit I                    340   3e-104   
ref|WP_017248122.1|  anthranilate synthase subunit I                    340   4e-104   
ref|WP_007228107.1|  anthranilate synthase subunit I                    340   5e-104   
ref|WP_028509407.1|  anthranilate synthase                              340   5e-104   
ref|WP_013646555.1|  anthranilate synthase subunit I                    340   6e-104   
ref|WP_013149244.1|  anthranilate synthase subunit I                    340   7e-104   
ref|WP_017814400.1|  anthranilate synthase subunit I                    340   7e-104   
ref|WP_036650104.1|  anthranilate synthase                              340   8e-104   
ref|WP_028589088.1|  anthranilate synthase                              340   8e-104   
ref|WP_003177711.1|  anthranilate synthase subunit I                    339   9e-104   
ref|WP_015221703.1|  anthranilate synthase, component I                 340   1e-103   
gb|KEI72791.1|  anthranilate synthase component I                       340   1e-103   
ref|WP_035297816.1|  anthranilate synthase                              339   1e-103   
ref|WP_027709768.1|  anthranilate synthase component I                  339   1e-103   
ref|WP_009225890.1|  anthranilate synthase subunit I                    340   1e-103   
ref|WP_013179278.1|  anthranilate synthase subunit I                    338   1e-103   
ref|WP_038671779.1|  anthranilate synthase                              338   2e-103   
gb|AIQ48169.1|  anthranilate synthase                                   339   2e-103   
gb|EKD27289.1|  hypothetical protein ACD_79C00770G0003                  338   2e-103   
ref|WP_016740027.1|  anthranilate synthase subunit I                    339   2e-103   
ref|WP_024726627.1|  anthranilate synthase                              338   2e-103   
ref|WP_016311802.1|  anthranilate synthase component I                  339   2e-103   
ref|WP_012843546.1|  anthranilate synthase subunit I                    338   2e-103   
ref|WP_028992315.1|  anthranilate synthase subunit I                    337   2e-103   
ref|WP_018126578.1|  hypothetical protein                               338   2e-103   
ref|WP_015219761.1|  anthranilate synthase, component I                 338   3e-103   
ref|WP_022410715.1|  anthranilate synthase component I                  338   3e-103   
ref|WP_015159833.1|  anthranilate/para-aminobenzoate synthase com...    338   3e-103   
ref|WP_015720581.1|  anthranilate synthase subunit I                    338   3e-103   
ref|WP_008514406.1|  anthranilate synthase subunit I                    337   3e-103   
ref|WP_014067393.1|  anthranilate synthase subunit I                    338   3e-103   
ref|WP_036621943.1|  anthranilate synthase                              338   4e-103   
ref|WP_009633577.1|  anthranilate synthase component I                  338   4e-103   
ref|WP_036727293.1|  anthranilate synthase                              338   4e-103   
ref|WP_012062331.1|  anthranilate synthase subunit I                    338   4e-103   
ref|WP_027610732.1|  anthranilate synthase component I                  337   5e-103   
gb|EZP33844.1|  anthranilate synthase component I                       337   5e-103   
ref|WP_013323037.1|  anthranilate synthase                              338   5e-103   
ref|WP_038363362.1|  anthranilate synthase component I                  337   5e-103   
ref|WP_008067450.1|  anthranilate synthase subunit I                    337   6e-103   
ref|WP_008365257.1|  anthranilate synthase subunit I                    337   6e-103   
ref|WP_020302182.1|  MULTISPECIES: anthranilate synthase component I    337   6e-103   
ref|WP_007906889.1|  anthranilate synthase subunit I                    337   6e-103   
ref|WP_003869620.1|  anthranilate synthase subunit I                    336   7e-103   
ref|WP_034155099.1|  anthranilate synthase component I                  337   7e-103   
ref|WP_034133894.1|  anthranilate synthase component I                  337   7e-103   
ref|WP_028304855.1|  anthranilate synthase component I                  337   8e-103   
gb|AIQ42397.1|  anthranilate synthase                                   337   9e-103   
ref|WP_016985239.1|  anthranilate synthase subunit I                    337   9e-103   
gb|AHL36270.1|  anthranilate synthase component I                       337   9e-103   
ref|WP_039301833.1|  anthranilate synthase                              337   9e-103   
ref|WP_016972403.1|  anthranilate synthase subunit I                    337   9e-103   
ref|WP_036301122.1|  anthranilate synthase component I                  336   1e-102   
ref|WP_003444478.1|  MULTISPECIES: anthranilate synthase subunit I      337   1e-102   
gb|EMJ92773.1|  anthranilate synthase component I                       336   1e-102   
gb|AIQ53648.1|  anthranilate synthase                                   337   1e-102   
ref|WP_017739616.1|  anthranilate synthase subunit I                    336   1e-102   
ref|WP_025995963.1|  anthranilate synthase component I                  336   1e-102   
gb|AIQ59542.1|  anthranilate synthase                                   337   1e-102   
emb|CCK74571.1|  Anthranilate synthase component I, N terminal re...    336   1e-102   
ref|WP_012872357.1|  anthranilate synthase subunit I                    337   1e-102   
ref|WP_027457669.1|  anthranilate synthase component I                  336   1e-102   
ref|WP_003194700.1|  MULTISPECIES: anthranilate synthase subunit I      336   1e-102   
ref|WP_015441832.1|  anthranilate synthase component I                  337   1e-102   
ref|WP_019817793.1|  anthranilate synthase component I                  336   1e-102   
ref|WP_030130021.1|  anthranilate synthase component I                  336   1e-102   
ref|WP_025857058.1|  MULTISPECIES: anthranilate synthase component I    336   1e-102   
ref|WP_014235341.1|  anthranilate synthase subunit I                    336   1e-102   
ref|WP_012686157.1|  anthranilate synthase subunit I                    336   1e-102   
ref|WP_028306440.1|  anthranilate synthase                              336   1e-102   
emb|CDF96015.1|  Anthranilate synthase, aminase component               336   1e-102   
ref|WP_014340496.1|  anthranilate synthase subunit I                    336   1e-102   
ref|WP_014720171.1|  anthranilate synthase subunit I                    336   1e-102   
ref|WP_019409868.1|  anthranilate synthase subunit I                    336   1e-102   
ref|WP_037019184.1|  anthranilate synthase component I                  336   2e-102   
ref|WP_024616720.1|  anthranilate synthase component I                  336   2e-102   
gb|EMK05204.1|  anthranilate synthase component I                       335   2e-102   
ref|WP_013694348.1|  MULTISPECIES: anthranilate synthase subunit I      336   2e-102   
ref|WP_034109623.1|  anthranilate synthase component I                  336   2e-102   
ref|WP_016546700.1|  anthranilate synthase component I                  335   2e-102   
ref|WP_024777429.1|  anthranilate synthase component I                  336   2e-102   
ref|WP_034421953.1|  anthranilate synthase                              336   2e-102   
dbj|GAK54146.1|  anthranilate synthase component I                      335   2e-102   
ref|WP_018928867.1|  MULTISPECIES: anthranilate synthase subunit I      335   2e-102   
ref|WP_012034193.1|  anthranilate synthase subunit I                    335   2e-102   
ref|WP_030139210.1|  anthranilate synthase component I                  335   2e-102   
ref|WP_015407944.1|  anthranilate synthase, aminase subunit             335   2e-102   
ref|WP_007918809.1|  MULTISPECIES: anthranilate synthase subunit I      335   2e-102   
ref|WP_015407255.1|  anthranilate synthase, aminase subunit             335   2e-102   
ref|WP_004885377.1|  anthranilate synthase component I                  335   2e-102   
ref|WP_008008339.1|  anthranilate synthase subunit I                    335   2e-102   
ref|WP_015282431.1|  anthranilate synthase component I                  335   3e-102   
ref|WP_003206140.1|  MULTISPECIES: anthranilate synthase subunit I      335   3e-102   
ref|WP_034549047.1|  anthranilate synthase subunit I                    335   3e-102   
ref|WP_007966440.1|  anthranilate synthase subunit I                    335   3e-102   
ref|WP_036676243.1|  anthranilate synthase                              336   3e-102   
ref|WP_022288428.1|  anthranilate synthase component I                  335   3e-102   
gb|EJO70159.1|  anthranilate synthase component I                       335   3e-102   



>gb|AAC27795.1| feedback-insensitive anthranilate synthase alpha-2 chain [Nicotiana 
tabacum]
Length=616

 Score =   875 bits (2261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/598 (76%), Positives = 505/598 (84%), Gaps = 19/598 (3%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             MQ++    RL P +H    LP  +++S RSS  A +LRVRTLQ +C  S           
Sbjct  1     MQSLPISYRLFPATHR-KVLPF-AVISSRSSTSALALRVRTLQCRCLHS-----------  47

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
               SL  +E +FIEASK+ NLIPLHK IFSDHLTPVLAYRCLV EDDRE PSFLFESVEPG
Sbjct  48    -SSLVMDEDRFIEASKSGNLIPLHKTIFSDHLTPVLAYRCLVKEDDREAPSFLFESVEPG  106

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
              R S+VGRYSVVGAQP+MEI+AKE+ VTILDH +GKLT+K V+DPMT+ RSISE WKP+L
Sbjct  107   FRGSSVGRYSVVGAQPSMEIVAKEHNVTILDHHTGKLTQKTVQDPMTIPRSISEGWKPRL  166

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               +LPD FCGGWVGYFSYDTVRYVE +KLPF  AP+DDRNL DI LGLY++VIVFDHV+K
Sbjct  167   IDELPDTFCGGWVGYFSYDTVRYVENRKLPFLRAPEDDRNLADIQLGLYEDVIVFDHVEK  226

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             KA +IHWV+LD YSS  +AY +GKK+LE LVS+VQ ++ PRLS  SVDF T  FGPSL K
Sbjct  227   KAHVIHWVQLDQYSSLPEAYLDGKKRLEILVSRVQGIESPRLSPGSVDFCTHAFGPSLTK  286

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
             GNMTS EYKNAVL+AKEHI AGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+
Sbjct  287   GNMTSEEYKNAVLQAKEHIAAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYI  346

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEILTRVKK R+VNRPLAGT++RGKTP+EDVMLEM +L DEK+RAEH M
Sbjct  347   QARGCILVASSPEILTRVKKRRIVNRPLAGTSRRGKTPDEDVMLEMQMLKDEKQRAEHIM  406

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVGKVSK GSVNVE+LM++ERYSHVMHISSTV+GELLDHLTCWDALRAALPVG
Sbjct  407   LVDLGRNDVGKVSKPGSVNVEKLMSVERYSHVMHISSTVSGELLDHLTCWDALRAALPVG  466

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL--  1738
             TVSGAPKVKAMELIDQLE  RRGPYSGGFGGISF GDMDIALALRT+VFLN    DT+  
Sbjct  467   TVSGAPKVKAMELIDQLEVARRGPYSGGFGGISFSGDMDIALALRTMVFLNGARYDTMYS  526

Query  1739  ---SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKTKRKP  1903
                +S+R+EW+AHLQSGAGIVADSNPD EQ ECENKVAGL RAIDLAESAFVK + KP
Sbjct  527   YTDASKRQEWVAHLQSGAGIVADSNPDEEQIECENKVAGLCRAIDLAESAFVKGRHKP  584



>ref|XP_009612779.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=616

 Score =   873 bits (2256),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/598 (75%), Positives = 504/598 (84%), Gaps = 19/598 (3%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             MQ++    RL P +H    LP  +++S RSS  A +LRV TLQ +C  S           
Sbjct  1     MQSLPISHRLFPATHR-KVLPF-AVISSRSSTSALALRVCTLQCRCLHS-----------  47

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
               SL  +E +FIEASK+ NLIPLHK IFSDHLTPVLAYRCLV EDDRE PSFLFESVEPG
Sbjct  48    -SSLVMDEDRFIEASKSGNLIPLHKTIFSDHLTPVLAYRCLVKEDDREAPSFLFESVEPG  106

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
              R S+VGRYSVVGAQP+MEI+AKE+ VTILDH +GKLT+K V+DPMT+ RSISE WKP+L
Sbjct  107   FRGSSVGRYSVVGAQPSMEIVAKEHNVTILDHHTGKLTQKTVQDPMTIPRSISEGWKPRL  166

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               +LPD FCGGWVGYFSYDTVRYVE +KLPF  AP+DDRNL DI LGLY++VIVFDHV+K
Sbjct  167   IDELPDTFCGGWVGYFSYDTVRYVENRKLPFLRAPEDDRNLADIQLGLYEDVIVFDHVEK  226

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             KA ++HWVRLD YSS  +AY +GKK+LE LVS+VQ ++ PRLS  SVDF T  FGPSL K
Sbjct  227   KAHVVHWVRLDQYSSLPEAYLDGKKRLEILVSRVQGIESPRLSPGSVDFCTHAFGPSLTK  286

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
             GNMTS EYKNAVL+AKEHI AGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+
Sbjct  287   GNMTSEEYKNAVLQAKEHIAAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYI  346

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEILTRVKK R+VNRPLAGT++RGKTP+EDVMLEM +L DEK+RAEH M
Sbjct  347   QARGCILVASSPEILTRVKKRRIVNRPLAGTSRRGKTPDEDVMLEMQMLKDEKQRAEHIM  406

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVGKVSK GSVNVE+LM++ERYSHVMHISSTV+GELLDHLTCWDALRAALPVG
Sbjct  407   LVDLGRNDVGKVSKPGSVNVEKLMSVERYSHVMHISSTVSGELLDHLTCWDALRAALPVG  466

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL--  1738
             TVSGAPKVKAMELIDQLE  RRGPYSGGFGGISF GDMDIALALRT+VFLN    DT+  
Sbjct  467   TVSGAPKVKAMELIDQLEVARRGPYSGGFGGISFSGDMDIALALRTMVFLNGARYDTMYS  526

Query  1739  ---SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKTKRKP  1903
                +S+R+EW+AHLQSGAGIVADSNPD EQ ECENKVAGL RAIDLAESAFVK + KP
Sbjct  527   YTGASKRQEWVAHLQSGAGIVADSNPDEEQIECENKVAGLCRAIDLAESAFVKGRHKP  584



>ref|XP_009780336.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=616

 Score =   857 bits (2214),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/598 (75%), Positives = 504/598 (84%), Gaps = 19/598 (3%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             MQ++    RL P +H    LP+ ++ S RSS  + SLRVRTLQ +C  S           
Sbjct  1     MQSLPISHRLFPATHR-KVLPL-AVFSCRSSTSSLSLRVRTLQCRCLHS-----------  47

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
               SL  +E +FIEASK+ NLIPL K IFSDHLTPVLAYRCLV EDDRE PSFLFESVEPG
Sbjct  48    -SSLVMDEDRFIEASKSGNLIPLQKTIFSDHLTPVLAYRCLVKEDDREAPSFLFESVEPG  106

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
              R S+VGRYSVVGAQP+MEI+AKE+ VTILDH +GKLT+K V+DPMT+ R ISEEWKP+L
Sbjct  107   FRGSSVGRYSVVGAQPSMEIVAKEHNVTILDHHTGKLTQKTVQDPMTIPRCISEEWKPRL  166

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               +LPD FCGGWVGYFSYDTVRYVE +KLPF  AP+DDRNL DI LGLY++V+VFDHV+K
Sbjct  167   VDELPDTFCGGWVGYFSYDTVRYVENRKLPFLRAPEDDRNLADIQLGLYEDVVVFDHVEK  226

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             KA +IHWVRLD YSS  +AY +GKK+LE LVS+VQ ++ PRLS  SVDF T  FGPSL K
Sbjct  227   KAHVIHWVRLDQYSSLPEAYLDGKKRLEILVSRVQGIESPRLSPGSVDFCTHTFGPSLTK  286

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
             GNMTS EYKNAVL+AKEHI AGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+
Sbjct  287   GNMTSEEYKNAVLQAKEHIAAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYI  346

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEILTRVKK R+VNRPLAGT++RGKTP+EDVMLEM +L DEK+ AEH M
Sbjct  347   QARGCILVASSPEILTRVKKRRIVNRPLAGTSRRGKTPDEDVMLEMQMLKDEKQCAEHIM  406

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVGKVSK GSVNVE+LM++ERYSHVMHISSTV+GELLDHLTCWDALRAALPVG
Sbjct  407   LVDLGRNDVGKVSKPGSVNVEKLMSVERYSHVMHISSTVSGELLDHLTCWDALRAALPVG  466

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL--  1738
             TVSGAPKVKAMELIDQLE TRRGPYSGGFGGISF GDMDIALALRT+VFLN    DT+  
Sbjct  467   TVSGAPKVKAMELIDQLEVTRRGPYSGGFGGISFSGDMDIALALRTMVFLNGARYDTMYS  526

Query  1739  ---SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKTKRKP  1903
                +S+R+EW+AHLQSGAGIVADSNPD EQ ECENKVAGL RAID+AESAFVK + KP
Sbjct  527   YTDASKRQEWVAHLQSGAGIVADSNPDEEQIECENKVAGLCRAIDVAESAFVKGRHKP  584



>ref|XP_011084924.1| PREDICTED: LOW QUALITY PROTEIN: anthranilate synthase alpha subunit 
1, chloroplastic [Sesamum indicum]
Length=644

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 436/632 (69%), Positives = 494/632 (78%), Gaps = 50/632 (8%)
 Frame = +2

Query  122   KMQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPY  301
             +MQA+   QR  P +  +S   ++ I +R    ++ S++ R    +C +           
Sbjct  2     QMQALTFSQRPFPTTRSVSSASVSGIFAR---NWSSSVKFRLRTFRCRA----------L  48

Query  302   SPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEP  481
               PSL+ +E +F+EAS+  NLIPL+KCIFSDHLTPVLAYRCLV EDDR+ PSFLFESVEP
Sbjct  49    KSPSLEMDEKRFLEASQNGNLIPLYKCIFSDHLTPVLAYRCLVKEDDRDAPSFLFESVEP  108

Query  482   GSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQ  661
             G R+S+VGRYSVVGAQP +E++AKENKVTILDHDSGK+ EK+VEDPMT+ + ISE W+PQ
Sbjct  109   GFRASSVGRYSVVGAQPAVEVVAKENKVTILDHDSGKIIEKLVEDPMTIPKDISEGWRPQ  168

Query  662   LTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVD  841
                DLPDAFCGGWVG+FSYDTVRYVEKKKLPF+SAP+DDRNL DIHLGLYD+VIVFDHVD
Sbjct  169   QIQDLPDAFCGGWVGFFSYDTVRYVEKKKLPFSSAPKDDRNLADIHLGLYDDVIVFDHVD  228

Query  842   KKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLA  1021
             KKA++IHWVRLD +SSA KAY +G K+LE LVSKVQD+DPPRLS   +DF TR+FG  L 
Sbjct  229   KKAYVIHWVRLDRFSSAKKAYDDGMKRLETLVSKVQDIDPPRLSPGCIDFCTRDFGLCLN  288

Query  1022  KGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTY  1201
             K NMTS EY  AV++AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+VNPSPYM Y
Sbjct  289   KSNMTSEEYMKAVIQAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRVVNPSPYMAY  348

Query  1202  MQ-------------------------------ARGCILVASSPEILTRVKKNRVVNRPL  1288
             +Q                               ARGCILVASSPEILTRVKK  +VNRPL
Sbjct  349   LQVVSSIXLSXLLYFLTQFEXAKRSFFSLASCQARGCILVASSPEILTRVKKKTIVNRPL  408

Query  1289  AGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIER  1468
             AGTA+RGKT  ED MLE  LL DEK+ AEH MLVDLGRNDVGKVSKSGSV VE+LM +ER
Sbjct  409   AGTARRGKTLHEDEMLERKLLKDEKQCAEHIMLVDLGRNDVGKVSKSGSVKVEKLMTVER  468

Query  1469  YSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGG  1648
             YSHVMHISSTVTGELLDHLT WDALRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGG
Sbjct  469   YSHVMHISSTVTGELLDHLTGWDALRAALPVGTVSGAPKVKAMELIDQLEPTRRGPYSGG  528

Query  1649  FGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDS  1813
             FGG+SF+GDMDIALALRTIVF      DT+ S     +R+EW+AHLQSGAGIVADS PD 
Sbjct  529   FGGVSFLGDMDIALALRTIVFPTGVRYDTMYSYKDGNKRREWVAHLQSGAGIVADSLPDD  588

Query  1814  EQKECENKVAGLSRAIDLAESAFVKTKRKPQP  1909
             EQ ECE K AGL+RAIDLAESAFV  K   QP
Sbjct  589   EQTECERKAAGLARAIDLAESAFV-NKGSAQP  619



>ref|XP_010543741.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic 
[Tarenaya hassleriana]
Length=597

 Score =   849 bits (2193),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/602 (70%), Positives = 493/602 (82%), Gaps = 21/602 (3%)
 Frame = +2

Query  104   AVNNLPKMQAIANCQRLLPPSHLISELPIT-SIVSRRSSGYAPSLRVRTLQLKCSSSLQI  280
             ++N    MQ+++  +RL P S  IS  P+T S VS R SG  PS R     +KC      
Sbjct  7     SMNAAAAMQSLSFSRRLAPSSRRISSPPVTVSGVSGRISGKVPSFR----SIKC------  56

Query  281   PVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSF  460
              VT S  S  S+  +  +F EAS  +NL+P+++CIFSD LTPVLAYRCLV EDDRE PSF
Sbjct  57    -VTVS--SEASIVSDAKRFAEASNCTNLVPIYRCIFSDQLTPVLAYRCLVKEDDREAPSF  113

Query  461   LFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSI  640
             LFESVEPGS+ S+VGRYSVVGAQP MEI+AKENKV ++DH +  LTE+ VEDPMT+ ++I
Sbjct  114   LFESVEPGSQMSSVGRYSVVGAQPAMEIVAKENKVIVMDHKNETLTEEYVEDPMTIPKTI  173

Query  641   SEEWKP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYD  814
             S+ WKP  QL  DLPDAFCGGWVG+FSYDT+RYVEK+KLPF+ AP+DDRNLPDIHLGLYD
Sbjct  174   SDSWKPDPQLVQDLPDAFCGGWVGFFSYDTIRYVEKRKLPFSKAPEDDRNLPDIHLGLYD  233

Query  815   NVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFN  994
             +VIVFDHV+KKA++IHW+RLD  SS  KAY +G + LE LV+K+QD+D PRL + SV+  
Sbjct  234   DVIVFDHVEKKAYVIHWIRLDGKSSFEKAYSDGTQHLEKLVAKLQDIDLPRLPAGSVNLQ  293

Query  995   TREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRI  1174
             TR+FGPSL K NMT  EYK AV+KAKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+
Sbjct  294   TRQFGPSLKKSNMTCEEYKEAVVKAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRV  353

Query  1175  VNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLN  1354
             VNPSPYM Y+QARGCI+VASSPEILTRVKKN++VNRPLAGT++RGKT  ED M E  LLN
Sbjct  354   VNPSPYMGYLQARGCIMVASSPEILTRVKKNKIVNRPLAGTSRRGKTATEDEMFEKELLN  413

Query  1355  DEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCW  1534
             +EK+ AEH MLVDLGRNDVGKV+K GSV VE+LMNIERYSHVMHISSTVTGEL D LTCW
Sbjct  414   NEKQCAEHIMLVDLGRNDVGKVAKYGSVKVEKLMNIERYSHVMHISSTVTGELQDDLTCW  473

Query  1535  DALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFL  1714
             D LRAALPVGTVSGAPKVKAMELID+ EATRRGPYSGGFGG+SF GDMDIALALRTIVF 
Sbjct  474   DTLRAALPVGTVSGAPKVKAMELIDEFEATRRGPYSGGFGGVSFTGDMDIALALRTIVFP  533

Query  1715  NDGMNDTL-----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESA  1879
                  +T+     S++R+EW+A+LQ+GAGIVADS+PD E +EC+NK AGL+RAIDLAESA
Sbjct  534   TGTQYNTMYSYKDSNKRREWVAYLQAGAGIVADSDPDDEHRECQNKAAGLARAIDLAESA  593

Query  1880  FV  1885
             FV
Sbjct  594   FV  595



>gb|KHG03962.1| Anthranilate synthase component I-1, chloroplastic -like protein 
[Gossypium arboreum]
Length=591

 Score =   848 bits (2190),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/595 (71%), Positives = 482/595 (81%), Gaps = 26/595 (4%)
 Frame = +2

Query  116   LPKMQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRS  295
             +P   ++    R LP SH  S+LPIT         ++P+       LKC  SL       
Sbjct  16    MPMQSSLGFSHRFLPSSHRFSQLPITR--------FSPA----PTSLKCRGSL-------  56

Query  296   PYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESV  475
               S   L  +E KF+EA+K +NL+PL++CIFSD LTPVLAYRCLV EDDRE PSFLFESV
Sbjct  57    --SSFPLVNDEKKFVEAAKKANLVPLYRCIFSDQLTPVLAYRCLVKEDDREAPSFLFESV  114

Query  476   EPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWK  655
             EPGSR S+VGRYSVVGAQPTMEI+AKENKV I+DH++G LTE+VVEDPM + + ISE WK
Sbjct  115   EPGSRVSSVGRYSVVGAQPTMEIVAKENKVMIIDHEAGNLTEEVVEDPMCIPKRISETWK  174

Query  656   PQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDH  835
             P+L  DLPDAFCGGWVGYFSYDTVRYVEKKKLPF  AP+DDRNLPDIHLGLY++VIVFDH
Sbjct  175   PRLVEDLPDAFCGGWVGYFSYDTVRYVEKKKLPFTKAPRDDRNLPDIHLGLYNDVIVFDH  234

Query  836   VDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPS  1015
             V+KKA+IIHWVRLD +SS  KAY EG   LE LV++VQDV+ P+LS  SV   T+ FGPS
Sbjct  235   VEKKAYIIHWVRLDKHSSVEKAYNEGVDHLEKLVARVQDVELPKLSPGSVALQTQHFGPS  294

Query  1016  LAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYM  1195
             L   NM   E+K AVLKAKEHILAGDIFQIVLSQRFERRT ADPFE+YRALR+VNPSPYM
Sbjct  295   LKNSNMEKEEFKKAVLKAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYM  354

Query  1196  TYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAE  1375
              Y+QARG ILVASSPEILTRVKKN++VNRPLAGT +RGKT  ED + E LLL++EKE AE
Sbjct  355   AYLQARGSILVASSPEILTRVKKNKIVNRPLAGTTRRGKTQAEDELAEKLLLSNEKECAE  414

Query  1376  HTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAAL  1555
             H MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGEL DHLT WD LRAAL
Sbjct  415   HIMLVDLGRNDVGKVSKYGSVKVEKLMNIERYSHVMHISSTVTGELQDHLTSWDVLRAAL  474

Query  1556  PVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDT  1735
             PVGTVSGAPKVKAMELID+LE +RRGPYSGGFGGISF GDMDIALALRT+VF      DT
Sbjct  475   PVGTVSGAPKVKAMELIDELEVSRRGPYSGGFGGISFTGDMDIALALRTMVFPTGSRYDT  534

Query  1736  L-----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             +     SSRR+EW+A+LQ+GAG+VADS+PD+E  EC+NK AGL+R+IDLAE+AFV
Sbjct  535   MYSYKGSSRRQEWVAYLQAGAGVVADSDPDAEHLECQNKAAGLARSIDLAEAAFV  589



>ref|XP_010067517.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic 
[Eucalyptus grandis]
Length=584

 Score =   846 bits (2185),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 424/592 (72%), Positives = 479/592 (81%), Gaps = 17/592 (3%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             MQ +A  + L+P SH +   P       RS     +  VRT   KC S           S
Sbjct  3     MQTLAYSRSLVPASHRLPPAPGPPGGGGRSWSSCSARGVRTF--KCLS----------IS  50

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
              P L  +  KF EASK  NLIPLH+CIFSD LTPV+AYRCLV EDDRE PSFL+ESV+PG
Sbjct  51    SPPLADDAVKFKEASKNGNLIPLHRCIFSDQLTPVIAYRCLVKEDDREAPSFLYESVQPG  110

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
              +SSTVGRYSVVGAQP +E++AKENKVT++DH+ G+LTE+VV+DPM + R ISE WKPQL
Sbjct  111   FQSSTVGRYSVVGAQPAIEVVAKENKVTVVDHEKGRLTEEVVDDPMMIPRRISESWKPQL  170

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               DLPDAFCGGWVGYFSYDTVRYVEKKKL F+SAPQDDRNL D+HLGLYD+VIVFDHV+K
Sbjct  171   IDDLPDAFCGGWVGYFSYDTVRYVEKKKLAFSSAPQDDRNLADLHLGLYDDVIVFDHVEK  230

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             KA+ IHWVRLD +SS   AY +G K+LE LVSKVQD  PP+LS  SV  NT  FGP+L K
Sbjct  231   KAYAIHWVRLDQHSSVENAYNDGMKRLELLVSKVQDFAPPKLSPGSVVLNTNHFGPALNK  290

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
              NMTS  YK AVL+AKEHI AGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+
Sbjct  291   SNMTSDAYKKAVLQAKEHIQAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYL  350

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCI+VASSPEILTRVK+ ++VNRPLAGT +RGKT EED +L++ LLND K+RAEH M
Sbjct  351   QARGCIMVASSPEILTRVKQKKIVNRPLAGTVRRGKTFEEDEILKVQLLNDAKQRAEHIM  410

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVGKVSK GSVNVERLM++ERYSHVMHISSTVTGEL D  TCWDAL+AALPVG
Sbjct  411   LVDLGRNDVGKVSKYGSVNVERLMDVERYSHVMHISSTVTGELDDQFTCWDALKAALPVG  470

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS  1744
             TVSGAPKV+AMELIDQLE TRRGPYSGGFGGISF GDMDIALALRTIVF      DT+ S
Sbjct  471   TVSGAPKVRAMELIDQLEVTRRGPYSGGFGGISFQGDMDIALALRTIVFPTGMRYDTMYS  530

Query  1745  -----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                   R+EW+A+LQ+GAGIVADS+PD E +EC+NK AGL+RAIDLAESAFV
Sbjct  531   YKDANTRREWVAYLQAGAGIVADSDPDDEHQECQNKAAGLARAIDLAESAFV  582



>gb|AAU84988.1| anthranilate synthase alpha 1 [Camptotheca acuminata]
Length=581

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/592 (73%), Positives = 492/592 (83%), Gaps = 18/592 (3%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             MQ ++N   L P    +S +P+T+I SR     A    VRT+++KC S            
Sbjct  1     MQTLSNSHCLCPTRRRLSPVPVTAISSRSFGSLAC---VRTIKIKCCS----------LK  47

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
              PSL  +E KF EAS+  NLIPL+KCI SDHLTPVLAYRCLV EDDRE PSFL+ESVEPG
Sbjct  48    SPSLATDETKFFEASRKGNLIPLYKCILSDHLTPVLAYRCLVKEDDREAPSFLYESVEPG  107

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
              ++S VGRYSVVGAQP MEI+AKENKVTI+DH +G LTEK+V+DPMTV R+ISE W+PQL
Sbjct  108   FQASNVGRYSVVGAQPAMEIVAKENKVTIVDHRNGCLTEKIVDDPMTVPRNISESWQPQL  167

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               +LPDAFCGGWVG+FSYDTVRYVEKKKLPF  APQDDRNL DIHLGLYD+V+VFDHV+K
Sbjct  168   IDELPDAFCGGWVGFFSYDTVRYVEKKKLPFLRAPQDDRNLADIHLGLYDDVLVFDHVEK  227

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             K ++IHWVRLD Y S  KAY +G K+LE L SKV D++PPRLS  SV+  T+ +GP L K
Sbjct  228   KVYVIHWVRLDQYLSVEKAYMDGMKRLEMLASKVLDINPPRLSPGSVELCTQHYGPPLKK  287

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
              NMTS +YKNAVL+AK+HILAGDIFQIVLSQRFERRT ADPFEVYRALR+VNPSPYM Y+
Sbjct  288   SNMTSEQYKNAVLQAKDHILAGDIFQIVLSQRFERRTFADPFEVYRALRVVNPSPYMAYL  347

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QA+GCILVASSPEILTRV K ++VNRPLAGT +RG+TP ED ML+  LLND+K+ AEH M
Sbjct  348   QAKGCILVASSPEILTRVNKRKIVNRPLAGTTRRGRTPHEDEMLKKQLLNDKKQCAEHIM  407

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVGKVSKSGSVNVERLMN+ERYSHVMHISSTVTGELLDHLTCWDALRAALPVG
Sbjct  408   LVDLGRNDVGKVSKSGSVNVERLMNVERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  467

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS  1744
             TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISF GD+DIALALRTIVF      DT+ S
Sbjct  468   TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFSGDLDIALALRTIVFPTGARYDTMYS  527

Query  1745  -----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                  +R+EW+A+LQ+GAGIVADS+PD EQ+ECENK AGL+RAIDLAESAFV
Sbjct  528   YKNANKRQEWVAYLQAGAGIVADSDPDDEQRECENKAAGLARAIDLAESAFV  579



>ref|XP_010272678.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
[Nelumbo nucifera]
Length=596

 Score =   842 bits (2176),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/601 (70%), Positives = 485/601 (81%), Gaps = 22/601 (4%)
 Frame = +2

Query  122   KMQAIANCQRLLPPS-HLISELPITSIVSRRSSGYAP------SLRVRTLQLKCSSSLQI  280
             KM+ +      LP   HL  ++ + SI SRRS+G           + R L L CS+    
Sbjct  5     KMETLVVSPHFLPSRRHLSPKVSVVSICSRRSTGSLSFPVSHSRTQFRQLTLNCSA----  60

Query  281   PVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSF  460
                   +S  SL +E+AKF EASK  NLIPL++CIFSDHLTPVLAYRCLV EDDRE PSF
Sbjct  61    ------FSYSSLAEEDAKFAEASKNGNLIPLYRCIFSDHLTPVLAYRCLVKEDDREAPSF  114

Query  461   LFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSI  640
             LFESV+ G R++ VGRYSV+GAQPTME++AK+N VTI+DH+ G  TE+ V+DPM + R I
Sbjct  115   LFESVKQGFRATNVGRYSVIGAQPTMEVVAKDNFVTIMDHEEGSRTEEYVDDPMVIPRRI  174

Query  641   SEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNV  820
              + WKPQ   +LPD FCGGWVGYFSYDTVRYVEKKKLPF+SAP+DDRNL D+HLGLYD+V
Sbjct  175   MKNWKPQRIDELPDVFCGGWVGYFSYDTVRYVEKKKLPFSSAPEDDRNLADVHLGLYDDV  234

Query  821   IVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTR  1000
             IVFDHV+K+A++IHWVRLD YSS  +AY +GK +LE LVSKV ++ PPRLS+ SV   TR
Sbjct  235   IVFDHVEKRAYVIHWVRLDQYSSIDEAYADGKNRLEVLVSKVHNIVPPRLSAGSVKLYTR  294

Query  1001  EFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVN  1180
              FG SL K NMT   YKNAV+KAKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVN
Sbjct  295   HFGSSLKKSNMTREAYKNAVMKAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVN  354

Query  1181  PSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDE  1360
             PSPYMTY+QARGCILVASSPEILTRVKK +++NRPLAGT +RGKT +ED MLE  LLNDE
Sbjct  355   PSPYMTYLQARGCILVASSPEILTRVKKGKIINRPLAGTIRRGKTDKEDDMLEKQLLNDE  414

Query  1361  KERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDA  1540
             K+ AEH MLVDLGRNDVGKVSKSGSV VE+LMNIERYSHVMHISSTVTGELL+ LTCWDA
Sbjct  415   KQCAEHIMLVDLGRNDVGKVSKSGSVKVEKLMNIERYSHVMHISSTVTGELLNDLTCWDA  474

Query  1541  LRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLND  1720
             LRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFG ISF GDMDIALALRT+VF   
Sbjct  475   LRAALPVGTVSGAPKVKAMELIDKLEVTRRGPYSGGFGCISFYGDMDIALALRTMVFPTG  534

Query  1721  GMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                DT+ S     +R+EW+AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAES F+
Sbjct  535   TRYDTIYSYKDVNKRREWVAHLQAGAGIVADSDPGDEQRECENKAAALARAIDLAESTFI  594

Query  1886  K  1888
             +
Sbjct  595   E  595



>ref|XP_002526888.1| anthranilate synthase component I, putative [Ricinus communis]
 gb|EEF35519.1| anthranilate synthase component I, putative [Ricinus communis]
Length=574

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/549 (74%), Positives = 464/549 (85%), Gaps = 13/549 (2%)
 Frame = +2

Query  278   IPVTRSPYSP--------PSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVD  433
             IP TRS + P         SL  + AKF EA+K  NL+PLH CIFSD LTPV AYRCLV 
Sbjct  24    IPPTRSSFRPGNCMSSLNSSLVSDGAKFTEAAKQGNLVPLHSCIFSDQLTPVTAYRCLVK  83

Query  434   EDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVE  613
             EDDRE PSFLFESVEPGSR S+VGRYSV+GAQP +EI+AKENKVTI+DH+ G LTE   E
Sbjct  84    EDDREAPSFLFESVEPGSRDSSVGRYSVIGAQPAIEIVAKENKVTIMDHEEGSLTEDFAE  143

Query  614   DPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPD  793
             DPMT+ R ISE WKPQL ++LP+AFCGGWVGYFSYDTVRYVEKKKLPF+SAP+DDRNL D
Sbjct  144   DPMTIPRRISEGWKPQLISELPEAFCGGWVGYFSYDTVRYVEKKKLPFSSAPEDDRNLAD  203

Query  794   IHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLS  973
             IHLGLYDNVIVFDHV+KK  +IHWVRLD YSS   AY +G K+LE L+++VQD+DPPRLS
Sbjct  204   IHLGLYDNVIVFDHVEKKVHVIHWVRLDRYSSVENAYSDGIKRLENLLARVQDIDPPRLS  263

Query  974   SASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFE  1153
             + +V+  TR FGPSL   NMTS EYK  VLKAKEHILAGDIFQ+VLSQRFERRT ADPFE
Sbjct  264   AGAVNLQTRHFGPSLTNSNMTSDEYKGIVLKAKEHILAGDIFQMVLSQRFERRTFADPFE  323

Query  1154  VYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVM  1333
             +YRALRIVNPSPYMTY+QARGCILVASSPEILTRVKKN++VNRPLAGT +RGKT EED +
Sbjct  324   IYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKNKIVNRPLAGTIRRGKTAEEDEI  383

Query  1334  LEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGEL  1513
             LE  LL D K+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGEL
Sbjct  384   LEAQLLKDPKQCAEHIMLVDLGRNDVGKVSKYGSVTVEKLMNIERYSHVMHISSTVTGEL  443

Query  1514  LDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALA  1693
              D+L+CWDALRAALPVGTVSGAPKVKAMELID+ E +RRGPYSGGFGG+SF+GDMDIAL 
Sbjct  444   QDNLSCWDALRAALPVGTVSGAPKVKAMELIDKYEVSRRGPYSGGFGGVSFMGDMDIALG  503

Query  1694  LRTIVFLNDGMNDTLS-----SRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRA  1858
             LRT+VF     +DT+       +R+EWIA+LQ+GAGIVA+S+P+ E +EC+NK AGL+RA
Sbjct  504   LRTMVFPTGARHDTMYMYKDIDKRREWIAYLQAGAGIVAESDPEDEHRECQNKAAGLARA  563

Query  1859  IDLAESAFV  1885
             IDLAESAF+
Sbjct  564   IDLAESAFI  572



>ref|XP_006425048.1| hypothetical protein CICLE_v10028065mg [Citrus clementina]
 gb|ESR38288.1| hypothetical protein CICLE_v10028065mg [Citrus clementina]
Length=596

 Score =   838 bits (2165),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/606 (70%), Positives = 483/606 (80%), Gaps = 31/606 (5%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRR------SSGYAP--------SLRVRTLQLKC  262
             M A+      L PS L S +  +S VS        SS + P        S R RTL    
Sbjct  1     MNALHMETLALTPSQLPSTVGFSSTVSVNFNYRVASSKWRPKSLSFTSSSYRARTLTCAA  60

Query  263   SSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDD  442
             S+SL                + AKF EASKT NLIPL++CIFSDHLTPVLAYRCLV EDD
Sbjct  61    SASLLFV------------DQLAKFQEASKTGNLIPLYRCIFSDHLTPVLAYRCLVKEDD  108

Query  443   RETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPM  622
             R+ PSFLFESVEPGS++S++GRYSVVGAQP +EI+AKEN VTILDH  G+ TE++V+DPM
Sbjct  109   RDAPSFLFESVEPGSQASSIGRYSVVGAQPAIEIVAKENMVTILDHKDGQRTEEIVDDPM  168

Query  623   TVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHL  802
              V R I E WKPQL  +LP+AFCGGWVGYFSYDTVRY E KKLPF+SAP+DDRNLPD+HL
Sbjct  169   VVPRRIMEGWKPQLIDELPEAFCGGWVGYFSYDTVRYAETKKLPFSSAPEDDRNLPDVHL  228

Query  803   GLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSAS  982
             GLYD+VIVFDHV+KKA++IHWVRLD YSS  +A+ +G  +LE LVS+V D+ PPRL   S
Sbjct  229   GLYDDVIVFDHVEKKAYVIHWVRLDRYSSVQEAFNDGMNRLENLVSRVHDIVPPRLRKGS  288

Query  983   VDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYR  1162
             +  +TR FGP L   +MTS  YK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YR
Sbjct  289   IKLHTRHFGPKLESSSMTSEAYKEAVLQAKEHILAGDIFQIVLSQRFERRTFADPFEIYR  348

Query  1163  ALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEM  1342
             ALRIVNPSPYMTY+QARGCILVASSPEILTRVKK ++ NRPLAGT +RGKTP+ED++ E 
Sbjct  349   ALRIVNPSPYMTYLQARGCILVASSPEILTRVKKRKITNRPLAGTVRRGKTPKEDLVFEK  408

Query  1343  LLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDH  1522
              LLNDEK+ AEH MLVDLGRNDVGKVSKSGSV VE+LMNIE YSHVMHISSTVTGELLDH
Sbjct  409   ELLNDEKQCAEHIMLVDLGRNDVGKVSKSGSVKVEKLMNIEHYSHVMHISSTVTGELLDH  468

Query  1523  LTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRT  1702
             LT WDALRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF GDMDIALALRT
Sbjct  469   LTSWDALRAALPVGTVSGAPKVKAMELIDELEVTRRGPYSGGFGGISFTGDMDIALALRT  528

Query  1703  IVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDL  1867
             IVF      DT+ S     +R+EWIAHLQ+GAGIVADS+P+ EQKECENK AG++RAIDL
Sbjct  529   IVFPTATRYDTMYSYKDVDKRREWIAHLQAGAGIVADSDPNDEQKECENKAAGIARAIDL  588

Query  1868  AESAFV  1885
             AES+FV
Sbjct  589   AESSFV  594



>ref|XP_007009041.1| Anthranilate synthase alpha subunit 1 [Theobroma cacao]
 gb|EOY17851.1| Anthranilate synthase alpha subunit 1 [Theobroma cacao]
Length=643

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/590 (71%), Positives = 483/590 (82%), Gaps = 22/590 (4%)
 Frame = +2

Query  131   AIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPP  310
             ++A   RL+P S+ +S++P+  +         P+       LKC         RS  S  
Sbjct  69    SLAFSHRLVPSSNRLSQVPVIRM--------PPAPTCFRTSLKC---------RSSLSSS  111

Query  311   SLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSR  490
             SL  +E KF EA+K  NL+PL++CIFSD LTPVLAYRCLV EDDR+ PSFLFESVEPGSR
Sbjct  112   SLVADETKFAEAAKKGNLVPLYRCIFSDQLTPVLAYRCLVKEDDRDAPSFLFESVEPGSR  171

Query  491   SSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTA  670
              ++VGRYSVVGAQPTMEI+AKENKV ++DH+ G LTE VVEDPM +   ISE WKPQL  
Sbjct  172   VTSVGRYSVVGAQPTMEIVAKENKVMVMDHEEGCLTEDVVEDPMLIPMRISENWKPQLID  231

Query  671   DLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKA  850
             DLPDAFCGGW+GYFSYDTVRYVEKKKLPF+ APQDDRNLPDIHLGLY++VIVFDHV+KKA
Sbjct  232   DLPDAFCGGWIGYFSYDTVRYVEKKKLPFSKAPQDDRNLPDIHLGLYNDVIVFDHVEKKA  291

Query  851   FIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGN  1030
             ++IHWVRLD +SS  KAY  G + LE LVS+VQ+VDPP+LS  S+D  T  FGPSL K N
Sbjct  292   YVIHWVRLDRHSSVEKAYSVGVEHLEKLVSRVQNVDPPKLSPGSIDLQTHHFGPSLKKSN  351

Query  1031  MTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQA  1210
             M S E+K AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALR+VNPSPYM Y+QA
Sbjct  352   MESEEFKGAVLQAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMAYLQA  411

Query  1211  RGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLV  1390
             RGCILVASSPEILTRVKKN++VNRPLAGTA+RGKTP ED + E  LL++EKE AEH MLV
Sbjct  412   RGCILVASSPEILTRVKKNKIVNRPLAGTARRGKTPAEDELAEKQLLSNEKECAEHIMLV  471

Query  1391  DLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTV  1570
             DLGRNDVGKVSK GSV VE+LMNIERYSHVMH+SSTV GEL DHL+ WDALRAALPVGTV
Sbjct  472   DLGRNDVGKVSKYGSVKVEKLMNIERYSHVMHLSSTVIGELHDHLSSWDALRAALPVGTV  531

Query  1571  SGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS--  1744
             SGAPKVKAMELID+LE TRRGPYSGGFGGISF GD+DIALALRT+VF      DT+ S  
Sbjct  532   SGAPKVKAMELIDELEVTRRGPYSGGFGGISFTGDLDIALALRTMVFTTGTRYDTMYSYK  591

Query  1745  ---RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                RR+EW+AHLQ+GAGIVADS+PD+E +EC++K AGL+R+IDLAESAFV
Sbjct  592   DAGRRQEWVAHLQAGAGIVADSDPDAEHRECQSKAAGLARSIDLAESAFV  641



>ref|XP_009612780.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=589

 Score =   836 bits (2159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/593 (72%), Positives = 481/593 (81%), Gaps = 36/593 (6%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             MQ++    RL P +H    LP  +++S RSS  A +LRV TLQ +C  S           
Sbjct  1     MQSLPISHRLFPATHR-KVLPF-AVISSRSSTSALALRVCTLQCRCLHS-----------  47

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
               SL  +E +FIEASK+ NLIPLHK IFSDHLTPVLAYRCLV EDDRE PSFLFESVEPG
Sbjct  48    -SSLVMDEDRFIEASKSGNLIPLHKTIFSDHLTPVLAYRCLVKEDDREAPSFLFESVEPG  106

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
              R S+VGRYSVVGAQP+MEI+AKE+ VTILDH +GKLT+K V+DPMT+ RSISE WKP+L
Sbjct  107   FRGSSVGRYSVVGAQPSMEIVAKEHNVTILDHHTGKLTQKTVQDPMTIPRSISEGWKPRL  166

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               +LPD FCGGWVGYFSYDTVRYVE +KLPF  AP+DDRNL DI LGLY++VIVFDHV+K
Sbjct  167   IDELPDTFCGGWVGYFSYDTVRYVENRKLPFLRAPEDDRNLADIQLGLYEDVIVFDHVEK  226

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             KA ++HWVRLD YSS  +AY +GKK+LE LVS+VQ ++ PRLS  SVDF T  FGPSL K
Sbjct  227   KAHVVHWVRLDQYSSLPEAYLDGKKRLEILVSRVQGIESPRLSPGSVDFCTHAFGPSLTK  286

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
             GNMTS EYKNAVL+AKEHI AGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+
Sbjct  287   GNMTSEEYKNAVLQAKEHIAAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYI  346

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEILTRVKK R+VNRPLAGT++RGKTP+EDVMLEM +L DEK+RAEH M
Sbjct  347   QARGCILVASSPEILTRVKKRRIVNRPLAGTSRRGKTPDEDVMLEMQMLKDEKQRAEHIM  406

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVGKVSK GSVNVE+LM++ERYSHVMHISSTV+GELLDHLTCWDALRAALPVG
Sbjct  407   LVDLGRNDVGKVSKPGSVNVEKLMSVERYSHVMHISSTVSGELLDHLTCWDALRAALPVG  466

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS  1744
             TVSGAPKVKAMELIDQLE  RRGPYS                          G++ + +S
Sbjct  467   TVSGAPKVKAMELIDQLEVARRGPYS----------------------GGFGGISFSGAS  504

Query  1745  RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKTKRKP  1903
             +R+EW+AHLQSGAGIVADSNPD EQ ECENKVAGL RAIDLAESAFVK + KP
Sbjct  505   KRQEWVAHLQSGAGIVADSNPDEEQIECENKVAGLCRAIDLAESAFVKGRHKP  557



>ref|XP_009606071.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=592

 Score =   835 bits (2157),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/584 (72%), Positives = 475/584 (81%), Gaps = 13/584 (2%)
 Frame = +2

Query  173   ISELPITSIVSRRSSGY--------APSLRVRTLQLKCSSSLQIPVTRSPYSPPSLDKEE  328
             +S  P+ ++  +RSS +        A SL   +  +  +S ++I    +   PPSL    
Sbjct  6     LSHRPVPTVSGQRSSIFSGHSAASTATSLSFSSFPVAAASRVRILKCSAVSPPPSLVDNS  65

Query  329   AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGR  508
              KF EA+K  NLIPL++ IFSDHLTPVLAYRCLV EDDRE PSFLFESVEPG + S VGR
Sbjct  66    VKFKEAAKHGNLIPLYRSIFSDHLTPVLAYRCLVKEDDREAPSFLFESVEPGLKVSNVGR  125

Query  509   YSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAF  688
             YSV+GAQPTMEI+AKEN VTI+DH  G+ TE+ VEDPM V R I E WKPQ   +LP+AF
Sbjct  126   YSVIGAQPTMEIVAKENMVTIMDHQEGRRTEEFVEDPMIVPRRIMERWKPQCIDELPEAF  185

Query  689   CGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWV  868
             CGGWVGYFSYDTVRYVEKKKLPF++AP DDRNLPD+HLGLYD+VIVFDHV+KKAF+IHWV
Sbjct  186   CGGWVGYFSYDTVRYVEKKKLPFSNAPVDDRNLPDLHLGLYDDVIVFDHVEKKAFVIHWV  245

Query  869   RLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEY  1048
             RLD ++S  +AY +G  +LEAL+S+V D+ PPRL+S S+  +T  FG SL K  MTS +Y
Sbjct  246   RLDRFASVEEAYNDGMTRLEALMSRVHDIVPPRLASGSIKLHTSLFGTSLKKSTMTSEDY  305

Query  1049  KNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILV  1228
             + AVL AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+QARGCILV
Sbjct  306   QKAVLNAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYLQARGCILV  365

Query  1229  ASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRND  1408
             ASSPEILTRVKK  V NRPLAGT +RGKTPEED MLE  LL+DEK+ AEH MLVDLGRND
Sbjct  366   ASSPEILTRVKKKTVTNRPLAGTIRRGKTPEEDYMLENQLLHDEKQCAEHIMLVDLGRND  425

Query  1409  vgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKV  1588
             VGKVSK GSV VE+LMN+ERYSHVMHISSTVTGELLDHL+ WDALRAALPVGTVSGAPKV
Sbjct  426   VGKVSKPGSVKVEKLMNVERYSHVMHISSTVTGELLDHLSSWDALRAALPVGTVSGAPKV  485

Query  1589  KAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRK  1753
             KAMELIDQLE TRRGPYSGGFGGISF G+MDIALALRTIVF      DT+ S     RR+
Sbjct  486   KAMELIDQLEVTRRGPYSGGFGGISFTGEMDIALALRTIVFPTGTRYDTMYSYKDVNRRR  545

Query  1754  EWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             +WIAHLQSGAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  546   DWIAHLQSGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  589



>ref|XP_002316223.2| hypothetical protein POPTR_0010s19790g [Populus trichocarpa]
 gb|EEF02394.2| hypothetical protein POPTR_0010s19790g [Populus trichocarpa]
Length=580

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/589 (71%), Positives = 476/589 (81%), Gaps = 22/589 (4%)
 Frame = +2

Query  134   IANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPPS  313
              +NC  L   SH +  +P+T I +RRSS  +    VR L  KC S           S  S
Sbjct  6     FSNCLSL--ASHRLCPVPVTGISTRRSSSVSC---VRPL--KCIS----------LSSDS  48

Query  314   LDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRS  493
             L  +  KF EA+K  NL+PLH CIFSD LTPV AYRCLV EDDR+ PSFLFESVEPGSR 
Sbjct  49    LVVDATKFKEAAKNGNLVPLHTCIFSDQLTPVTAYRCLVKEDDRDAPSFLFESVEPGSRV  108

Query  494   STVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTAD  673
             S+VGRYSVVGAQP +EI+AKE+KV+++DH++G L E++VED M V R ISE WKPQL   
Sbjct  109   SSVGRYSVVGAQPAIEIVAKEDKVSLMDHEAGTLIEEIVEDAMVVPRRISEAWKPQLIDG  168

Query  674   LPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAF  853
             LPDAFCGGWVGYFSYDTVRY EKKKLPF+ AP+DDRNLPDIHLGLYD+VIVFDHV+KKA+
Sbjct  169   LPDAFCGGWVGYFSYDTVRYTEKKKLPFSRAPKDDRNLPDIHLGLYDDVIVFDHVEKKAY  228

Query  854   IIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNM  1033
             IIHWV++D YSS   AY +G K+LE L+++V D+DPPRLS  SV  +T+ FGP L   NM
Sbjct  229   IIHWVKIDRYSSIEDAYSDGMKRLEKLLARVLDIDPPRLSPGSVKLHTQHFGPLLKNSNM  288

Query  1034  TSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQAR  1213
             TS EYK AVL+AKEHI AGDIFQIVLSQRFERRT ADPFE+YRALR+VNPSPYMTY+QAR
Sbjct  289   TSDEYKQAVLRAKEHIQAGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMTYLQAR  348

Query  1214  GCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVD  1393
             GCILVASSPEILTRVK NRVVNRPLAGT +RGKTPEED +LE  LL D K+ AEHTMLVD
Sbjct  349   GCILVASSPEILTRVKNNRVVNRPLAGTVRRGKTPEEDEVLEEQLLKDPKQCAEHTMLVD  408

Query  1394  LGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVS  1573
             LGRNDVGKVSK GSV VERLMN+ERYSHVMHISSTVTGEL DHLTCWDALRAALPVGTVS
Sbjct  409   LGRNDVGKVSKHGSVKVERLMNVERYSHVMHISSTVTGELHDHLTCWDALRAALPVGTVS  468

Query  1574  GAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSR--  1747
             GAPKVKAMELIDQ+E +RRGPYSGG GG+SF GDMDIALALRT+VF      +T+ S   
Sbjct  469   GAPKVKAMELIDQMEVSRRGPYSGGLGGVSFTGDMDIALALRTMVFPTGTQYNTMYSYKD  528

Query  1748  ---RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                R+EWIA+LQ+GAGIVADS PD E +EC+NK AGL+RAIDLAES FV
Sbjct  529   AQLRREWIAYLQAGAGIVADSVPDDEHRECQNKAAGLARAIDLAESTFV  577



>ref|XP_006435705.1| hypothetical protein CICLE_v10031010mg [Citrus clementina]
 gb|ESR48945.1| hypothetical protein CICLE_v10031010mg [Citrus clementina]
Length=599

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/595 (69%), Positives = 484/595 (81%), Gaps = 12/595 (2%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             MQ+++   RL+PPSH +S +P+T  V+R +    P        +KC  S Q   T S  +
Sbjct  10    MQSLSFSNRLVPPSHRLSLVPVT--VTRIN---LPKSAATFSTVKCCVSRQTTTTTSTAT  64

Query  305   PP--SLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVE  478
                  L  +   F EASK +NL+PL++CIFSDHLTPV+AYRCLV EDDRE PSFLFESVE
Sbjct  65    ATATKLASDALGFSEASKRANLVPLYRCIFSDHLTPVVAYRCLVQEDDREAPSFLFESVE  124

Query  479   PGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKP  658
             PG R S VGRYSVVGAQP ME++ K+N VTI+DH+ G L E+VV+DPM + R ISE+WKP
Sbjct  125   PGVRVSNVGRYSVVGAQPVMEVIVKDNNVTIMDHEKGSLVEEVVDDPMEIPRKISEDWKP  184

Query  659   QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHV  838
             Q+  +LP+AFCGGWVGYFSYDTVRYVEKKKLPF+ AP DDR+L DIHLGLY++V+VFDHV
Sbjct  185   QIIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSKAPHDDRSLADIHLGLYNDVLVFDHV  244

Query  839   DKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSL  1018
             +KK ++IHWVRLD +SS  KAY EG + LE LV++VQD+D PRL+  S+D +T  FGP L
Sbjct  245   EKKVYVIHWVRLDQHSSVQKAYAEGLEHLEKLVARVQDIDLPRLAPGSIDLHTHHFGPPL  304

Query  1019  AKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMT  1198
              K NMTS  YKNAVL+AKEHI AGDIFQIVLSQRFERRT ADPFEVYRALR+VNPSPYMT
Sbjct  305   KKSNMTSEAYKNAVLEAKEHIQAGDIFQIVLSQRFERRTFADPFEVYRALRVVNPSPYMT  364

Query  1199  YMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEH  1378
             Y+QARGCILVASSPEILTRVKKN++VNRPLAGT +RG+T EED MLE  LL D K+ AEH
Sbjct  365   YLQARGCILVASSPEILTRVKKNKIVNRPLAGTVRRGRTTEEDEMLETQLLKDAKQCAEH  424

Query  1379  TMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALP  1558
              MLVDLGRNDVGKV++SGSV VE+LMN+ERYSHVMHISST+TGEL D L+CWDALRAALP
Sbjct  425   VMLVDLGRNDVGKVARSGSVKVEKLMNVERYSHVMHISSTITGELQDRLSCWDALRAALP  484

Query  1559  VGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL  1738
             VGTVSGAPKVKAMELID+LE  RRGPYSGGFGG+SF GDMDIALALRT+VF      DT+
Sbjct  485   VGTVSGAPKVKAMELIDELEVNRRGPYSGGFGGVSFTGDMDIALALRTMVFQTGTRYDTM  544

Query  1739  -----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
                  + +R+EW+A+LQ+GAGIVADS+PD E +EC+NK AGL+RAIDLAESAF+K
Sbjct  545   YLYKDARKRREWVAYLQAGAGIVADSDPDDEHRECQNKAAGLARAIDLAESAFIK  599



>ref|XP_010685584.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=587

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/596 (71%), Positives = 485/596 (81%), Gaps = 19/596 (3%)
 Frame = +2

Query  125   MQAIANCQRL-LPPSHLISELPITSIVSRRSSGYA-PSLRVRTLQ-LKCSSSLQIPVTRS  295
             M AIA   R+ L P H           +RR S ++ P++ +R+ Q L  S S +     S
Sbjct  1     MAAIAVTPRIFLSPHH-----------NRRISPHSFPAVNLRSKQHLSLSLSTRRSFNCS  49

Query  296   PYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESV  475
               S PSL K  ++F+EA+K  NLIPL++CIFSDHLTPVLAYRCLV EDDRE PSFLFE+V
Sbjct  50    AVSSPSLVKNSSEFVEAAKNGNLIPLYRCIFSDHLTPVLAYRCLVQEDDREAPSFLFEAV  109

Query  476   EPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWK  655
             EPG ++S VGRYS+VGAQP+MEI+AKEN VT++DH +GK TE+ VEDPM V R I E+WK
Sbjct  110   EPGFKNSHVGRYSIVGAQPSMEIVAKENLVTLMDHHAGKRTEEFVEDPMAVPRKIMEDWK  169

Query  656   PQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDH  835
             PQL  +LPD FCGGWVGYFSYDTVRYVEKKKLPF+SAP DDRNLPD+HLGLYDNVIVFDH
Sbjct  170   PQLIDELPDVFCGGWVGYFSYDTVRYVEKKKLPFSSAPDDDRNLPDVHLGLYDNVIVFDH  229

Query  836   VDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPS  1015
             V+KKA++IHWVR+D +SSA +AY +G  +LE L+S+V D+  P+L S S+   TR FG S
Sbjct  230   VEKKAYVIHWVRVDRFSSAEEAYNDGMDRLEYLLSRVHDIVTPKLPSGSIKLQTRLFGSS  289

Query  1016  LAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYM  1195
             L   NM+S EYK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE YRALRIVNPSPYM
Sbjct  290   LKTSNMSSEEYKAAVLQAKEHILAGDIFQIVLSQRFERRTFADPFEAYRALRIVNPSPYM  349

Query  1196  TYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAE  1375
              Y+QARGCILVASSPEILT VKK ++ NRPLAGT +RGKTP+ED MLE  LLND+K+ AE
Sbjct  350   GYLQARGCILVASSPEILTCVKKGKITNRPLAGTIRRGKTPKEDYMLENQLLNDQKQCAE  409

Query  1376  HTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAAL  1555
             H MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGELLD+LT WDALRAAL
Sbjct  410   HIMLVDLGRNDVGKVSKFGSVKVEKLMNIERYSHVMHISSTVTGELLDNLTSWDALRAAL  469

Query  1556  PVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDT  1735
             PVGTVSGAPKVKAMELIDQLE  RRGPYSGGFGGISF GDMDIALALRT+VF      DT
Sbjct  470   PVGTVSGAPKVKAMELIDQLEVNRRGPYSGGFGGISFTGDMDIALALRTMVFSTATRYDT  529

Query  1736  LSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             + S     RR+EW+AHLQ+GAGIVADS+P  EQ+ECENK AGL+RAIDLAES+F++
Sbjct  530   MYSYKDVDRRREWVAHLQAGAGIVADSDPADEQRECENKAAGLARAIDLAESSFLE  585



>ref|XP_006486337.1| PREDICTED: LOW QUALITY PROTEIN: anthranilate synthase component 
I-1, chloroplastic-like [Citrus sinensis]
Length=603

 Score =   833 bits (2153),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/595 (69%), Positives = 484/595 (81%), Gaps = 12/595 (2%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             MQ+++   RL+PPSH +S +P+T  V+R +    P        +KC  S Q   T S  +
Sbjct  10    MQSLSFSNRLVPPSHRLSLVPVT--VTRIN---LPKSAATFSTVKCCVSRQTTTTTSTAT  64

Query  305   PP--SLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVE  478
                  L  +   F EASK +NL+PL++CIFSDHLTPV+AYRCLV EDDRE PSFLFESVE
Sbjct  65    ATATKLASDALGFSEASKRANLVPLYRCIFSDHLTPVVAYRCLVQEDDREAPSFLFESVE  124

Query  479   PGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKP  658
             PG R S VGRYSVVGAQP ME++ K+N VTI+DH+ G L E+VV+DPM + R ISE+WKP
Sbjct  125   PGVRVSNVGRYSVVGAQPVMEVIVKDNNVTIMDHEKGSLVEEVVDDPMEIPRKISEDWKP  184

Query  659   QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHV  838
             Q+  +LP+AFCGGWVGYFSYDTVRYVEKKKLPF+ AP DDR+L DIHLGLY++V+VFDHV
Sbjct  185   QIIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSKAPHDDRSLADIHLGLYNDVLVFDHV  244

Query  839   DKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSL  1018
             +KK ++IHWVRLD +SS  KAY EG + LE LV++VQD+D PRL+  S+D +T  FGP L
Sbjct  245   EKKVYVIHWVRLDQHSSVQKAYAEGLEHLEKLVARVQDIDLPRLAPGSIDLHTHHFGPPL  304

Query  1019  AKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMT  1198
              K NMTS  YKNAVL+AKEHI AGDIFQIVLSQRFERRT ADPFEVYRALR+VNPSPYMT
Sbjct  305   KKSNMTSEAYKNAVLEAKEHIQAGDIFQIVLSQRFERRTFADPFEVYRALRVVNPSPYMT  364

Query  1199  YMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEH  1378
             Y+QARGCILVASSPEILTRVKKN++VNRPLAGT +RG+T EED MLE  LL D K+ AEH
Sbjct  365   YLQARGCILVASSPEILTRVKKNKIVNRPLAGTVRRGRTTEEDEMLETQLLKDAKQCAEH  424

Query  1379  TMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALP  1558
              MLVDLGRNDVGKV++SGSV VE+LMN+ERYSHVMHISST+TGEL D L+CWDALRAALP
Sbjct  425   VMLVDLGRNDVGKVARSGSVKVEKLMNVERYSHVMHISSTITGELQDRLSCWDALRAALP  484

Query  1559  VGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL  1738
             VGTVSGAPKVKAMELID+LE  RRGPYSGGFGG+SF GDMDIALALRT+VF      DT+
Sbjct  485   VGTVSGAPKVKAMELIDELEVNRRGPYSGGFGGVSFTGDMDIALALRTMVFQTGTRYDTM  544

Query  1739  -----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
                  + +R+EW+A+LQ+GAGIVADS+PD E +EC+NK AGL+RAIDLAESAF+K
Sbjct  545   YLYKDARKRREWVAYLQAGAGIVADSDPDDEHRECQNKAAGLARAIDLAESAFIK  599



>ref|XP_006488497.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like 
[Citrus sinensis]
Length=596

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/555 (74%), Positives = 466/555 (84%), Gaps = 17/555 (3%)
 Frame = +2

Query  236   RVRTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLA  415
             R RTL    S+SL             +D+ E KF EASK  NLIPL++CIFSDHLTPVLA
Sbjct  52    RARTLTCAASASLLF-----------VDQSE-KFQEASKKGNLIPLYRCIFSDHLTPVLA  99

Query  416   YRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKL  595
             YRCLV EDDR+ PSFLFESVEPGS++S++GRYSVVGAQP +EI+AKEN VTILDH  G+ 
Sbjct  100   YRCLVKEDDRDAPSFLFESVEPGSQASSIGRYSVVGAQPAIEIVAKENMVTILDHKDGQR  159

Query  596   TEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQD  775
             TE++V+DPM V R I E WKPQL  +LP+AFCGGWVGYFSYDTVRY E KKLPF+SAP+D
Sbjct  160   TEEIVDDPMVVPRRIMEGWKPQLIDELPEAFCGGWVGYFSYDTVRYAETKKLPFSSAPED  219

Query  776   DRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDV  955
             DRNLPD+HLGLYD+VIVFDHV+KKA++IHWVRLD YSS  +A+ +G  +LE LVS+V D+
Sbjct  220   DRNLPDVHLGLYDDVIVFDHVEKKAYVIHWVRLDRYSSVQEAFNDGMNRLENLVSRVHDI  279

Query  956   DPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRT  1135
              PPRL + S+  +TR FGP L   +MTS  YK AVL+AKEHILAGDIFQIVLSQRFERRT
Sbjct  280   VPPRLRTGSIKLHTRHFGPKLESSSMTSEAYKEAVLQAKEHILAGDIFQIVLSQRFERRT  339

Query  1136  TADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKT  1315
              ADPFE+YRALRIVNPSPYMTY+QARGCILVASSPEILTRVKK ++ NRPLAGT +RGKT
Sbjct  340   FADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKRKITNRPLAGTVRRGKT  399

Query  1316  PEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISS  1495
             P+ED++ E  LLNDEK+ AEH MLVDLGRNDVGKVSKSGSV VE+LMNIE YSHVMHISS
Sbjct  400   PKEDLVFEKELLNDEKQCAEHIMLVDLGRNDVGKVSKSGSVKVEKLMNIEHYSHVMHISS  459

Query  1496  TVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGD  1675
             TVTGELLDHLT WDALRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF GD
Sbjct  460   TVTGELLDHLTSWDALRAALPVGTVSGAPKVKAMELIDELEVTRRGPYSGGFGGISFTGD  519

Query  1676  MDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKV  1840
             MDIALALRTIVF      DT+ S      R+EWIAHLQ+GAGIVADS+P+ EQKECENK 
Sbjct  520   MDIALALRTIVFPTATRYDTMYSYKDVDNRREWIAHLQAGAGIVADSDPNDEQKECENKA  579

Query  1841  AGLSRAIDLAESAFV  1885
             AG++RAIDLAES+FV
Sbjct  580   AGIARAIDLAESSFV  594



>gb|KHN36387.1| Anthranilate synthase component I-1, chloroplastic [Glycine soja]
Length=585

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/590 (71%), Positives = 481/590 (82%), Gaps = 24/590 (4%)
 Frame = +2

Query  131   AIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPP  310
             A A   R++P  H +S   +T +   RS           L L+CS     P++    S P
Sbjct  13    AKAFSSRMVPFGHRLSPATLTGVSLSRSP----------LTLRCS-----PLS----STP  53

Query  311   SLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSR  490
             S  +E AKF+EASK  NLIPL +CIFSD LTP+LAYR LV EDDRE+PSFLFES EP   
Sbjct  54    SYVEEGAKFVEASKNGNLIPLCQCIFSDQLTPILAYRILVKEDDRESPSFLFESAEPSYH  113

Query  491   SSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTA  670
             +S+VGRYSVVGAQPTME++AKENKVTI+DH+SG LTEK+V+DPM + R +SE WKP L  
Sbjct  114   ASSVGRYSVVGAQPTMEVVAKENKVTIIDHESGNLTEKIVDDPMMIPRKVSEGWKPYLIN  173

Query  671   DLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKA  850
             +LPDAFCGGW GYFSYDTVRYVEKKKLPF++AP+DDRNL DIHLGLY+NVIVFDHV+KKA
Sbjct  174   ELPDAFCGGWAGYFSYDTVRYVEKKKLPFSNAPEDDRNLADIHLGLYENVIVFDHVEKKA  233

Query  851   FIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGN  1030
             ++I WVR+D YSSA  AY++G ++LE LV+K+QD  PPRL+  SVD +T  FGPSL K +
Sbjct  234   YVILWVRVDRYSSAESAYKDGMERLEKLVAKLQDGQPPRLAPGSVDLHTHHFGPSLKKSS  293

Query  1031  MTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQA  1210
             MTS  YK AVL+AKEHI AGDIFQIVLSQRFERRT ADPFE+YRALR+VNPSPYM Y+QA
Sbjct  294   MTSEAYKEAVLQAKEHIKAGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMAYLQA  353

Query  1211  RGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLV  1390
             RGCILVASSPEILTR+KKN++VNRPLAGTAKRGKTPEED  LE +LL DEK+ AEH MLV
Sbjct  354   RGCILVASSPEILTRIKKNKIVNRPLAGTAKRGKTPEEDARLEAILLRDEKQCAEHVMLV  413

Query  1391  DLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTV  1570
             DLGRNDVGKV+KSGSV VE+LMNIERYSHVMHISSTVTGEL DHLT WDALRAALPVGTV
Sbjct  414   DLGRNDVGKVAKSGSVKVEKLMNIERYSHVMHISSTVTGELQDHLTSWDALRAALPVGTV  473

Query  1571  SGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS--  1744
             SGAPKVKAMELID+LE  RRGPYSGGFG ISF+G+MDIALALRT+VF      DT+ S  
Sbjct  474   SGAPKVKAMELIDELEVKRRGPYSGGFGYISFLGEMDIALALRTMVFPTGTRYDTMYSYK  533

Query  1745  ---RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                +R EWIA+LQ+GAGIVADS PD E +EC+NK AGL+RAIDLAE+AFV
Sbjct  534   DVDQRHEWIAYLQAGAGIVADSVPDDEHQECQNKAAGLARAIDLAEAAFV  583



>ref|XP_009802665.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=592

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/567 (74%), Positives = 468/567 (83%), Gaps = 16/567 (3%)
 Frame = +2

Query  200   VSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHK  379
             +S  SS  A + RVR L  KCS+        SP  PPS      KF EA+K  NLIPL++
Sbjct  34    LSFSSSPVAAASRVRIL--KCSAV-------SP--PPSFVDNSVKFKEAAKHGNLIPLYR  82

Query  380   CIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKEN  559
              IFSDHLTPVLAYRCLV EDDRE PSFLFESVEPG + S VGRYSV+GAQPTMEI+AKEN
Sbjct  83    SIFSDHLTPVLAYRCLVKEDDREAPSFLFESVEPGLKVSNVGRYSVIGAQPTMEIVAKEN  142

Query  560   KVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVE  739
              VTI+DH  G+ TE+ VEDPM V R I E WKPQ   +LP+AFCGGWVGYFSYDTVRYVE
Sbjct  143   MVTIMDHHEGRRTEEFVEDPMIVPRRIMERWKPQCIDELPEAFCGGWVGYFSYDTVRYVE  202

Query  740   KKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKK  919
             KKK+PF++AP DDRNLPD+HLGLYD+VIVFDHV+KKAF+IHWVRLD +SS  +AY +G  
Sbjct  203   KKKIPFSNAPMDDRNLPDLHLGLYDDVIVFDHVEKKAFVIHWVRLDQFSSVEEAYNDGMT  262

Query  920   QLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIF  1099
             +LEAL+S+V D+ PPRL+S S+  +T +FG SL K  MT  +Y+ AVL AKEHILAGDIF
Sbjct  263   RLEALMSRVHDIIPPRLASGSIKLHTSQFGTSLKKSTMTREDYQKAVLNAKEHILAGDIF  322

Query  1100  QIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVN  1279
             QIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+QARGCILVASSPEILTRVKK  V N
Sbjct  323   QIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKKTVTN  382

Query  1280  RPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMN  1459
             RPLAGT +RGKTPEED MLE  LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMN
Sbjct  383   RPLAGTIRRGKTPEEDYMLENQLLHDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEKLMN  442

Query  1460  IERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPY  1639
             +ERYSHVMHISSTVTGELLDHL+ WDALRAALPVGTVSGAPKVKAMELIDQLE TRRGPY
Sbjct  443   VERYSHVMHISSTVTGELLDHLSSWDALRAALPVGTVSGAPKVKAMELIDQLEVTRRGPY  502

Query  1640  SGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSN  1804
             SGGFGGISF G+MDIALALRTIVF      DT+ S     +R++WIAHLQSGAGIVADS+
Sbjct  503   SGGFGGISFTGEMDIALALRTIVFPTGTRYDTMYSYKDANKRRDWIAHLQSGAGIVADSD  562

Query  1805  PDSEQKECENKVAGLSRAIDLAESAFV  1885
             P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  563   PADEQRECENKAAALARAIDLAESSFV  589



>ref|XP_011035977.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic 
[Populus euphratica]
Length=580

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/592 (70%), Positives = 472/592 (80%), Gaps = 20/592 (3%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             MQ ++    L   SH +  + +T I +RRSS               S S   P+     S
Sbjct  1     MQTLSFSNCLYLSSHRLCPVSVTGISTRRSS---------------SVSCVRPLNCISLS  45

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
               SL  +  KF EA+K  NL+PLH CIFSD LTPV AYRCLV EDDRE PSFLFESVEPG
Sbjct  46    SDSLVVDATKFKEAAKNGNLVPLHTCIFSDQLTPVTAYRCLVKEDDREAPSFLFESVEPG  105

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
             SR S+VGRYSVVGAQP +EI+AKE+KV+++DH++G L E++VED M V R ISE WKPQL
Sbjct  106   SRVSSVGRYSVVGAQPAIEIVAKEDKVSLMDHEAGTLIEEIVEDAMLVPRRISEAWKPQL  165

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
                LPDAFCGGWVGYFSYDTVRY EKKKLPF+ AP+DDRNLPDIHLGLYD+VIVFDHV+K
Sbjct  166   IDGLPDAFCGGWVGYFSYDTVRYTEKKKLPFSRAPKDDRNLPDIHLGLYDDVIVFDHVEK  225

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             KAFIIHWV++D YSS   AY +G K+LE L+++V D+DPPRLS  SV  +T+ FGP L  
Sbjct  226   KAFIIHWVKIDRYSSIEDAYSDGMKRLEKLLARVLDIDPPRLSPGSVKLHTQHFGPLLKN  285

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
              NMTS EYK AVL+AKEHI AGDIFQIVLSQRFERRT ADPFE+YRALR+VNPSPYMTY+
Sbjct  286   SNMTSDEYKQAVLRAKEHIQAGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMTYL  345

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEILTRVK NRVVNRPLAGT +RGKTPEED +LE  LL D K+ AEHTM
Sbjct  346   QARGCILVASSPEILTRVKNNRVVNRPLAGTVRRGKTPEEDEVLEEQLLKDPKQCAEHTM  405

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVGKVSK GSV VERLMN+ERYSHVMHISSTV GEL DHLTCWDALRAALPVG
Sbjct  406   LVDLGRNDVGKVSKHGSVKVERLMNVERYSHVMHISSTVAGELDDHLTCWDALRAALPVG  465

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS  1744
             TVSGAPKVKAMELIDQ+E +RRGPYSGG GG+SF GDMDIALALRT+VF      +T+ S
Sbjct  466   TVSGAPKVKAMELIDQMEVSRRGPYSGGLGGVSFTGDMDIALALRTMVFPTGTQYNTMYS  525

Query  1745  R-----RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                   R+EWIA+LQ+GAGIVADS PD E +EC+NK AGL+RAIDLAES FV
Sbjct  526   YKDAHLRREWIAYLQAGAGIVADSVPDDEHRECQNKAAGLARAIDLAESTFV  577



>ref|XP_009606063.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=595

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/587 (71%), Positives = 475/587 (81%), Gaps = 16/587 (3%)
 Frame = +2

Query  173   ISELPITSIVSRRSSGY--------APSLRVRTLQLKCSSSLQIPVTRSPYSPPSLD---  319
             +S  P+ ++  +RSS +        A SL   +  +  +S ++I    +   PPSL    
Sbjct  6     LSHRPVPTVSGQRSSIFSGHSAASTATSLSFSSFPVAAASRVRILKCSAVSPPPSLVCAV  65

Query  320   KEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSST  499
                 KF EA+K  NLIPL++ IFSDHLTPVLAYRCLV EDDRE PSFLFESVEPG + S 
Sbjct  66    DNSVKFKEAAKHGNLIPLYRSIFSDHLTPVLAYRCLVKEDDREAPSFLFESVEPGLKVSN  125

Query  500   VGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLP  679
             VGRYSV+GAQPTMEI+AKEN VTI+DH  G+ TE+ VEDPM V R I E WKPQ   +LP
Sbjct  126   VGRYSVIGAQPTMEIVAKENMVTIMDHQEGRRTEEFVEDPMIVPRRIMERWKPQCIDELP  185

Query  680   DAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFII  859
             +AFCGGWVGYFSYDTVRYVEKKKLPF++AP DDRNLPD+HLGLYD+VIVFDHV+KKAF+I
Sbjct  186   EAFCGGWVGYFSYDTVRYVEKKKLPFSNAPVDDRNLPDLHLGLYDDVIVFDHVEKKAFVI  245

Query  860   HWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTS  1039
             HWVRLD ++S  +AY +G  +LEAL+S+V D+ PPRL+S S+  +T  FG SL K  MTS
Sbjct  246   HWVRLDRFASVEEAYNDGMTRLEALMSRVHDIVPPRLASGSIKLHTSLFGTSLKKSTMTS  305

Query  1040  GEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGC  1219
              +Y+ AVL AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+QARGC
Sbjct  306   EDYQKAVLNAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYLQARGC  365

Query  1220  ILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLG  1399
             ILVASSPEILTRVKK  V NRPLAGT +RGKTPEED MLE  LL+DEK+ AEH MLVDLG
Sbjct  366   ILVASSPEILTRVKKKTVTNRPLAGTIRRGKTPEEDYMLENQLLHDEKQCAEHIMLVDLG  425

Query  1400  RNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGA  1579
             RNDVGKVSK GSV VE+LMN+ERYSHVMHISSTVTGELLDHL+ WDALRAALPVGTVSGA
Sbjct  426   RNDVGKVSKPGSVKVEKLMNVERYSHVMHISSTVTGELLDHLSSWDALRAALPVGTVSGA  485

Query  1580  PKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----  1744
             PKVKAMELIDQLE TRRGPYSGGFGGISF G+MDIALALRTIVF      DT+ S     
Sbjct  486   PKVKAMELIDQLEVTRRGPYSGGFGGISFTGEMDIALALRTIVFPTGTRYDTMYSYKDVN  545

Query  1745  RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             RR++WIAHLQSGAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  546   RRRDWIAHLQSGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  592



>gb|AAU84989.1| anthranilate synthase alpha 2 [Camptotheca acuminata]
Length=579

 Score =   828 bits (2140),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/592 (70%), Positives = 479/592 (81%), Gaps = 20/592 (3%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             MQ++A   RL P +H +S +P T+I SR S   A       L +KC S LQ         
Sbjct  1     MQSLAMSLRLSPSTHCLSPIPATAISSRSSGSLAC-----VLSIKCCS-LQ---------  45

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
              PS+  +E +F+EASK  NLIPLH CIFSD LTPVLAYRCLV EDDRE PSFL+ES+EPG
Sbjct  46    SPSIVVDETRFLEASKKGNLIPLHACIFSDQLTPVLAYRCLVKEDDREAPSFLYESIEPG  105

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
              +  TVGRYSVVGAQP MEI+AKEN VTI+DH+SG++TEKVV+DPMT+ RSISE WKPQ 
Sbjct  106   FQVLTVGRYSVVGAQPAMEIMAKENAVTIVDHESGRVTEKVVDDPMTIPRSISESWKPQF  165

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               +LP+AFCGGWVG           K+  PF  AP+DDRNL DIHLGLYD+VIVFDHV+K
Sbjct  166   LDELPNAFCGGWVGISHMIQFVMWRKRSCPFLRAPRDDRNLADIHLGLYDDVIVFDHVEK  225

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             KA++IHWVRLD YSSA KAY +G K+LE LVSKV D+D PRLS   V+  T +FG SL K
Sbjct  226   KAYVIHWVRLDQYSSAEKAYVDGMKRLEILVSKVLDIDSPRLSPGFVELCTHQFGRSLNK  285

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
              NMTS EYK+ VL+AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+VNPSPYMTY+
Sbjct  286   SNMTSEEYKDVVLQAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRVVNPSPYMTYL  345

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILV SSPE+LTRV K +++NRPLAGT +RG+TP +D +L++ LLND+K+ AEHTM
Sbjct  346   QARGCILVGSSPEVLTRVTKKKIINRPLAGTVRRGRTPHDDEILKVQLLNDQKQCAEHTM  405

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVGKVSKSGSVNVE+LM +ERYSHVMHISSTVTGELLDHLTCWDALRAALPVG
Sbjct  406   LVDLGRNDVGKVSKSGSVNVEKLMTVERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  465

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS  1744
             TVSGAPKVKAMELIDQLE TRRGPYSGGFG ISF GDMDIA+ALRT+VF N    DT+ S
Sbjct  466   TVSGAPKVKAMELIDQLEPTRRGPYSGGFGAISFSGDMDIAIALRTMVFSNGPRYDTMYS  525

Query  1745  -----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                  RR+EW+A+LQ+GAGIVADS PD EQ ECENK+AGL+R+IDLAESAFV
Sbjct  526   YKNGKRRQEWVAYLQAGAGIVADSIPDDEQTECENKIAGLARSIDLAESAFV  577



>ref|XP_009802664.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=595

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 418/570 (73%), Positives = 468/570 (82%), Gaps = 19/570 (3%)
 Frame = +2

Query  200   VSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPPSLD---KEEAKFIEASKTSNLIP  370
             +S  SS  A + RVR L  KCS+        SP  PPS         KF EA+K  NLIP
Sbjct  34    LSFSSSPVAAASRVRIL--KCSAV-------SP--PPSFVCAVDNSVKFKEAAKHGNLIP  82

Query  371   LHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILA  550
             L++ IFSDHLTPVLAYRCLV EDDRE PSFLFESVEPG + S VGRYSV+GAQPTMEI+A
Sbjct  83    LYRSIFSDHLTPVLAYRCLVKEDDREAPSFLFESVEPGLKVSNVGRYSVIGAQPTMEIVA  142

Query  551   KENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVR  730
             KEN VTI+DH  G+ TE+ VEDPM V R I E WKPQ   +LP+AFCGGWVGYFSYDTVR
Sbjct  143   KENMVTIMDHHEGRRTEEFVEDPMIVPRRIMERWKPQCIDELPEAFCGGWVGYFSYDTVR  202

Query  731   YVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYRE  910
             YVEKKK+PF++AP DDRNLPD+HLGLYD+VIVFDHV+KKAF+IHWVRLD +SS  +AY +
Sbjct  203   YVEKKKIPFSNAPMDDRNLPDLHLGLYDDVIVFDHVEKKAFVIHWVRLDQFSSVEEAYND  262

Query  911   GKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAG  1090
             G  +LEAL+S+V D+ PPRL+S S+  +T +FG SL K  MT  +Y+ AVL AKEHILAG
Sbjct  263   GMTRLEALMSRVHDIIPPRLASGSIKLHTSQFGTSLKKSTMTREDYQKAVLNAKEHILAG  322

Query  1091  DIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNR  1270
             DIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+QARGCILVASSPEILTRVKK  
Sbjct  323   DIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKKT  382

Query  1271  VVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVER  1450
             V NRPLAGT +RGKTPEED MLE  LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+
Sbjct  383   VTNRPLAGTIRRGKTPEEDYMLENQLLHDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEK  442

Query  1451  LMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRR  1630
             LMN+ERYSHVMHISSTVTGELLDHL+ WDALRAALPVGTVSGAPKVKAMELIDQLE TRR
Sbjct  443   LMNVERYSHVMHISSTVTGELLDHLSSWDALRAALPVGTVSGAPKVKAMELIDQLEVTRR  502

Query  1631  GPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVA  1795
             GPYSGGFGGISF G+MDIALALRTIVF      DT+ S     +R++WIAHLQSGAGIVA
Sbjct  503   GPYSGGFGGISFTGEMDIALALRTIVFPTGTRYDTMYSYKDANKRRDWIAHLQSGAGIVA  562

Query  1796  DSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             DS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  563   DSDPADEQRECENKAAALARAIDLAESSFV  592



>gb|AAA74901.1| anthranilate synthase alpha subunit [Ruta graveolens]
Length=613

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/606 (68%), Positives = 484/606 (80%), Gaps = 24/606 (4%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             MQ++    RL+PPS  +S +P     +      AP   VRT++  C+SS    +  +  +
Sbjct  8     MQSLKFSNRLVPPSRRLSPVPNNVTCNNLPKSAAP---VRTVKC-CASSWNSTINGAAAT  63

Query  305   PPSLD--------------KEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDD  442
                                 +  +FI++SK +NL+PL++CIF+DHLTPVLAYRCLV EDD
Sbjct  64    TNGASAASNGASTTTTTYVSDATRFIDSSKRANLVPLYRCIFADHLTPVLAYRCLVQEDD  123

Query  443   RETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPM  622
             +ETPSFLFESVEPG R STVGRYSVVGA P ME++AK+N VT++DH+ G L E+VV+DPM
Sbjct  124   KETPSFLFESVEPG-RISTVGRYSVVGAHPVMEVIAKDNMVTVMDHEKGSLVEEVVDDPM  182

Query  623   TVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHL  802
              + R ISE+WKPQ+  DLP+AFCGGWVG+FSYDTVRYVEKKKLPF+ APQDDRNL D+HL
Sbjct  183   EIPRRISEDWKPQIIDDLPEAFCGGWVGFFSYDTVRYVEKKKLPFSKAPQDDRNLADMHL  242

Query  803   GLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSAS  982
             GLY++VIVFDHV+KK ++IHWVRL+  SS  KAY EG + LE LVS+VQD + PRL+  S
Sbjct  243   GLYNDVIVFDHVEKKVYVIHWVRLNQQSSEEKAYAEGLEHLERLVSRVQDENTPRLAPGS  302

Query  983   VDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYR  1162
             +D +T  FGP L K NMT  EYK AVL AKEHI AGDIFQIVLSQRFERRT ADPFEVYR
Sbjct  303   IDLHTGHFGPPLKKSNMTCEEYKMAVLAAKEHIQAGDIFQIVLSQRFERRTFADPFEVYR  362

Query  1163  ALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEM  1342
             ALR+VNPSPYMTYMQARGC+LVASSPEILTRVKKN++VNRPLAGTA+RG+T EED MLE 
Sbjct  363   ALRVVNPSPYMTYMQARGCVLVASSPEILTRVKKNKIVNRPLAGTARRGRTTEEDEMLET  422

Query  1343  LLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDH  1522
              LL D K+ AEH MLVDLGRNDVGKVSKSGSV VE+LMN+ERYSHVMHISSTVTGEL D+
Sbjct  423   QLLKDAKQCAEHVMLVDLGRNDVGKVSKSGSVKVEKLMNVERYSHVMHISSTVTGELQDN  482

Query  1523  LTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRT  1702
             L+CWDALRAALPVGTVSGAPKVKAMELID+LE  RRGPYSGGFGGISF GDMDIALALRT
Sbjct  483   LSCWDALRAALPVGTVSGAPKVKAMELIDELEVNRRGPYSGGFGGISFTGDMDIALALRT  542

Query  1703  IVFLNDGMNDTL-----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDL  1867
             IVF      DT+     +++R++W+A+LQ+GAGIVADS+PD E +EC+NK AGL+RAIDL
Sbjct  543   IVFQTGTRYDTMYSYKNATKRRQWVAYLQAGAGIVADSDPDDEHRECQNKAAGLARAIDL  602

Query  1868  AESAFV  1885
             AESAFV
Sbjct  603   AESAFV  608



>emb|CDX98861.1| BnaC09g49740D [Brassica napus]
Length=595

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/603 (67%), Positives = 486/603 (81%), Gaps = 26/603 (4%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLP--PSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPV  286
             N+  MQ ++  +RL P   SH++S     +  SRRSS YAPSLR     +KC S+     
Sbjct  7     NVASMQPLSFSRRLAPSAASHVLSSSVTVTGYSRRSSPYAPSLR----SIKCVSA-----  57

Query  287   TRSPYSPP--SLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSF  460
                   PP  S+  +  K  +ASK++NLIP++ CIFSD LTPVLAYRCLV EDDRE PSF
Sbjct  58    ------PPEASIVTDTKKLADASKSTNLIPIYSCIFSDQLTPVLAYRCLVKEDDREAPSF  111

Query  461   LFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSI  640
             LFESVEPGS+ S+VGRYSVVGAQP MEI+AKENKV ++DH +G +TE+ VEDPM + R I
Sbjct  112   LFESVEPGSQMSSVGRYSVVGAQPAMEIVAKENKVIVMDHKNGSMTEEYVEDPMEIPRKI  171

Query  641   SEEWKP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYD  814
             SE W P  QL  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF+ AP+DDRNLPD+HLGLYD
Sbjct  172   SESWNPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNLPDMHLGLYD  231

Query  815   NVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFN  994
             +VIVFDHV+KKA++IHW+RLD      KAY  G + LE LV+K+ D++PP+L++ +V+  
Sbjct  232   DVIVFDHVEKKAYVIHWIRLDGSVPYDKAYSNGVQHLETLVAKLHDIEPPKLAAGNVNLQ  291

Query  995   TREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRI  1174
             TR+FGP+L   N+T  EYK AV+ AKEHILAGDIFQIVLSQRFE+RT ADPFEVYRALR+
Sbjct  292   TRQFGPALENSNVTREEYKEAVVNAKEHILAGDIFQIVLSQRFEKRTFADPFEVYRALRV  351

Query  1175  VNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLN  1354
             VNPSPYM Y+QARGCILVASSPEILT+VK+N++VNRPLAGT++RGKT  ED  LE  LL 
Sbjct  352   VNPSPYMGYLQARGCILVASSPEILTKVKQNKIVNRPLAGTSRRGKTEVEDKRLEKELLE  411

Query  1355  DEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCW  1534
             +EK+ AEH MLVDLGRNDVGKV+K GSV VE+LMNIERYSHVMHISSTVTGEL D L+CW
Sbjct  412   NEKQCAEHIMLVDLGRNDVGKVAKYGSVKVEKLMNIERYSHVMHISSTVTGELQDDLSCW  471

Query  1535  DALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFL  1714
             D LRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGG+SF GDMDIAL+LRTIVF 
Sbjct  472   DTLRAALPVGTVSGAPKVKAMELIDELEPTRRGPYSGGFGGVSFTGDMDIALSLRTIVFP  531

Query  1715  NDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESA  1879
                  +T+ S     +R+EW+A+LQ+GAG+VADS+P+ E +EC+NK AGL+RAIDLAESA
Sbjct  532   TASQYNTMYSYKDANKRREWVAYLQAGAGVVADSDPEDEHRECQNKAAGLARAIDLAESA  591

Query  1880  FVK  1888
             FVK
Sbjct  592   FVK  594



>ref|XP_009416627.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009416628.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=601

 Score =   823 bits (2127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/547 (74%), Positives = 460/547 (84%), Gaps = 11/547 (2%)
 Frame = +2

Query  278   IPVTR-SPYSPPSL-----DKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDED  439
             IP  R S   PPS+     + E  KF+EA+K  NL+PL++CIFSDHLTPV AYRCLV ED
Sbjct  52    IPSIRCSAVPPPSVSATVGNDEPFKFMEAAKKGNLVPLYQCIFSDHLTPVQAYRCLVKED  111

Query  440   DRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDP  619
             DRE PSFLFESVE G R + VGRYSVVGAQP MEI+AKEN V+I+DH+ G++TE+ VEDP
Sbjct  112   DREAPSFLFESVEQGLRGTNVGRYSVVGAQPAMEIVAKENTVSIMDHEEGRMTEETVEDP  171

Query  620   MTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIH  799
             M + R I E W PQ   +LPDAFCGGWVGYFSYDTVRYVEKKKLPF+SAP+DDRNLPD+H
Sbjct  172   MQIPRRIMEGWTPQFIDELPDAFCGGWVGYFSYDTVRYVEKKKLPFSSAPKDDRNLPDVH  231

Query  800   LGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSA  979
             LGLY++VIVFDHV+KKA++IHWV++D YSS  KAY++GK  L+ L+SKVQ+V+ PRLS+ 
Sbjct  232   LGLYNDVIVFDHVEKKAYVIHWVQVDRYSSVEKAYQDGKNHLDNLLSKVQNVNVPRLSAG  291

Query  980   SVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVY  1159
             SV  +T++FG +L K +MTS EYK AVL+AKE I AGDIFQIVLSQRFERRT ADPFEVY
Sbjct  292   SVKMHTQQFGTTLTKSSMTSEEYKKAVLQAKERIFAGDIFQIVLSQRFERRTFADPFEVY  351

Query  1160  RALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLE  1339
             RALRIVNPSPYM Y+QARGCILVASSPEILTRVKK  ++NRPLAGT KRG+  EED + E
Sbjct  352   RALRIVNPSPYMAYLQARGCILVASSPEILTRVKKGTIINRPLAGTVKRGRMDEEDKLNE  411

Query  1340  MLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLD  1519
               LLNDEK+ AEH MLVDLGRNDVG+VSK GSV VE+LMNIERYSHVMHISSTVTGEL D
Sbjct  412   QQLLNDEKQCAEHIMLVDLGRNDVGRVSKPGSVKVEKLMNIERYSHVMHISSTVTGELFD  471

Query  1520  HLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALR  1699
             HLTCWDALRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGGFGG+SF G+MDIALALR
Sbjct  472   HLTCWDALRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGFGGVSFTGNMDIALALR  531

Query  1700  TIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAID  1864
             TIVF      +T+ S     RR+EW+AHLQ+GAGIVADSNPD EQ+ECENK A L+RAID
Sbjct  532   TIVFPTGSRFNTMYSYKDMGRRQEWVAHLQAGAGIVADSNPDDEQRECENKAAALARAID  591

Query  1865  LAESAFV  1885
             LAES FV
Sbjct  592   LAESTFV  598



>ref|XP_006344046.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like 
[Solanum tuberosum]
Length=587

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/559 (73%), Positives = 464/559 (83%), Gaps = 14/559 (3%)
 Frame = +2

Query  224   APSLRVRTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLT  403
             +P    R   LKCS+++         SPPSL  +  KF EA+K  NLIPL++ IFSDHLT
Sbjct  36    SPVAAARLRILKCSAAV---------SPPSLVDDSVKFKEAAKDGNLIPLYRSIFSDHLT  86

Query  404   PVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHD  583
             PVLAYRCLV EDDRE PSFLFESVEPG ++S VGRYSV+GAQPTMEI+AKEN VTI+DH 
Sbjct  87    PVLAYRCLVKEDDREAPSFLFESVEPGLKASNVGRYSVIGAQPTMEIVAKENMVTIMDHL  146

Query  584   SGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFAS  763
              G  TE+  EDPM++ R I E+WKPQ   +LP+AFCGGWVG+FSYDTVRYVEKKKLPF++
Sbjct  147   EGSRTEEFEEDPMSIPRRIMEKWKPQCINELPEAFCGGWVGFFSYDTVRYVEKKKLPFSN  206

Query  764   APQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSK  943
             AP DDRNLPD+HLGLYD+VIVFDHV+KKAF+IHWVRLD ++S  +AY +G  +LEAL+S+
Sbjct  207   APMDDRNLPDLHLGLYDDVIVFDHVEKKAFVIHWVRLDRFASVEEAYNDGTTRLEALLSR  266

Query  944   VQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRF  1123
             V D+ PP L+S S+  +T  FG SL K NMTS +Y+ AVLKAKEHILAGDIFQIVLSQRF
Sbjct  267   VHDIVPPTLASGSIKLHTSLFGTSLKKSNMTSEDYQKAVLKAKEHILAGDIFQIVLSQRF  326

Query  1124  ERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAK  1303
             ERRT ADPFEVYRALRIVNPSPYMTY+QARGCILVASSPEILTRVKK  V NRPLAGT +
Sbjct  327   ERRTFADPFEVYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKRTVTNRPLAGTIR  386

Query  1304  RGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVM  1483
             RGKT EED MLE  LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVM
Sbjct  387   RGKTLEEDYMLENQLLHDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEKLMNIERYSHVM  446

Query  1484  HISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGIS  1663
             HISSTVTGELLDHL+ WDALRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGGFGGIS
Sbjct  447   HISSTVTGELLDHLSSWDALRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGFGGIS  506

Query  1664  FVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKEC  1828
             F G+MDIALALRTIVF      DT+ S     +R++WIA+LQ+GAGIVADS+P  EQ EC
Sbjct  507   FTGEMDIALALRTIVFPTGTRYDTMYSYKDVDKRRDWIAYLQAGAGIVADSDPADEQNEC  566

Query  1829  ENKVAGLSRAIDLAESAFV  1885
             ENK A L RAIDLAES+FV
Sbjct  567   ENKAAALVRAIDLAESSFV  585



>ref|XP_010273416.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
[Nelumbo nucifera]
Length=598

 Score =   820 bits (2119),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/598 (70%), Positives = 485/598 (81%), Gaps = 11/598 (2%)
 Frame = +2

Query  125   MQAIANCQRLLPP-SHLISELPITSIVSRRS--SGYAPSLRVRTLQLKCSSSLQIPVTRS  295
             M+ +A     LPP S   +++ + S+ SRRS  S   P  R  +    C+ + Q+ V  S
Sbjct  1     METLAVSPHFLPPRSRSSTKVSVGSLCSRRSICSLTLPISRFLSHSRSCNLT-QLTVKCS  59

Query  296   PYSPPSLDKEEA-KFIEASKTS-NLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFE  469
               S PSL ++ A KF EASK   NLIPL++CIFSDHLTPVLAYRCLV EDDRE PSFLFE
Sbjct  60    ALSYPSLAEDGAVKFTEASKNGKNLIPLYRCIFSDHLTPVLAYRCLVKEDDREAPSFLFE  119

Query  470   SVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEE  649
             +VE G R+S VGRYSV+GAQP ME++AK+N VTI+DH+ G  TE+ V+DPM V R I E+
Sbjct  120   TVEQGFRASNVGRYSVIGAQPKMEVVAKDNFVTIMDHEEGSRTEEYVDDPMVVPRRIMEK  179

Query  650   WKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVF  829
             W+PQ   +LPDAF GGWVGYFSYDTVRYVEKKKLPF+SAP++DRNL D+HLGLYD+VIVF
Sbjct  180   WRPQRVDELPDAFVGGWVGYFSYDTVRYVEKKKLPFSSAPENDRNLADVHLGLYDDVIVF  239

Query  830   DHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFG  1009
             DHV+KKA++IHWV LD YSS  +AY +G  +LE LVSKVQD+DPPRLSS SV  +TR FG
Sbjct  240   DHVEKKAYVIHWVWLDRYSSVDEAYNDGLNRLEILVSKVQDIDPPRLSSGSVKLHTRHFG  299

Query  1010  PSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSP  1189
               + K NMTS +YK  V +AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALR+VNPSP
Sbjct  300   SLVKKSNMTSEDYKKVVAQAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSP  359

Query  1190  YMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKER  1369
             YMTY+QARGCILVASSPEILTRVKK ++ NRPLAGT +RGKT +ED M+E  LLNDEK+ 
Sbjct  360   YMTYLQARGCILVASSPEILTRVKKGKITNRPLAGTVRRGKTDKEDDMMEKQLLNDEKQC  419

Query  1370  AEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRA  1549
             AEH MLVDLGRNDVGKVSKSGSV VE+LMNIERYSHVMHISSTVTGELLD LTCWDALRA
Sbjct  420   AEHIMLVDLGRNDVGKVSKSGSVKVEKLMNIERYSHVMHISSTVTGELLDDLTCWDALRA  479

Query  1550  ALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMN  1729
             ALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFG ISF  +MDIALALRTIVF      
Sbjct  480   ALPVGTVSGAPKVKAMELIDRLEVTRRGPYSGGFGYISFYDNMDIALALRTIVFPTGTRY  539

Query  1730  DTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             DT+ S     +R+EWIAHLQ+GAGIVADS+PD EQ+ECENK A L+RAIDLA+S F++
Sbjct  540   DTMYSYKDANKRREWIAHLQAGAGIVADSDPDDEQRECENKAAALARAIDLADSTFIE  597



>ref|XP_004240399.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic 
[Solanum lycopersicum]
Length=587

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/570 (72%), Positives = 468/570 (82%), Gaps = 18/570 (3%)
 Frame = +2

Query  191   TSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIP  370
             TS+   RS   A  LR+    LKCS+++         SPPSL  +  KF EA+K  NLIP
Sbjct  29    TSLSFSRSPVSAARLRI----LKCSAAI---------SPPSLVDDSVKFKEAAKHGNLIP  75

Query  371   LHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILA  550
             L++ IFSDHLTPVLAYRCLV EDDRE PSFLFESVEPG ++S VGRYSV+GAQPTMEI+A
Sbjct  76    LYRSIFSDHLTPVLAYRCLVKEDDREAPSFLFESVEPGLKASNVGRYSVIGAQPTMEIVA  135

Query  551   KENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVR  730
             KEN VTI+DH  G  TE+  EDPM++ R I E+WKPQ   +LP+AFCGGWVG+FSYDTVR
Sbjct  136   KENMVTIMDHLEGSRTEEFEEDPMSIPRRIMEKWKPQCINELPEAFCGGWVGFFSYDTVR  195

Query  731   YVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYRE  910
             YVEKKKLPF++AP DDRNLPD+HLGLYD+VIVFDHV+KKAF+IHWVRLD ++S  +AY +
Sbjct  196   YVEKKKLPFSNAPMDDRNLPDLHLGLYDDVIVFDHVEKKAFVIHWVRLDRFASVEEAYND  255

Query  911   GKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAG  1090
             G  +LEAL+S+V D+ PP L+S S+  +T  FG SL    MTS +Y+ AVLKAKEHILAG
Sbjct  256   GTTRLEALLSRVHDIVPPTLASGSIKLHTSLFGTSLKNSTMTSEDYQKAVLKAKEHILAG  315

Query  1091  DIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNR  1270
             DIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+QARGCILVASSPEILTRVKK  
Sbjct  316   DIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKKT  375

Query  1271  VVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVER  1450
             V NRPLAGT +RGKT EED MLE  LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+
Sbjct  376   VTNRPLAGTIRRGKTLEEDYMLENQLLHDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEK  435

Query  1451  LMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRR  1630
             LMNIERYSHVMHISSTVTGELLDHL+ WDALRAALPVGTVSGAPKVKAMELIDQLE TRR
Sbjct  436   LMNIERYSHVMHISSTVTGELLDHLSSWDALRAALPVGTVSGAPKVKAMELIDQLEVTRR  495

Query  1631  GPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVA  1795
             GPYSGGFGGISF G+MDIALALRTIVF      DT+ S     +R++WIA+LQ+GAGIVA
Sbjct  496   GPYSGGFGGISFTGEMDIALALRTIVFPTGTRYDTMYSYKDVDKRRDWIAYLQAGAGIVA  555

Query  1796  DSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             DS+P  EQ ECENK A L RAIDLAES+FV
Sbjct  556   DSDPADEQNECENKAAALVRAIDLAESSFV  585



>gb|KFK25012.1| hypothetical protein AALP_AA8G055100 [Arabis alpina]
Length=592

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/599 (67%), Positives = 486/599 (81%), Gaps = 20/599 (3%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTR  292
             N+  +Q ++  +RL+P   ++S     S  S R+SGYAPS R     + C       ++ 
Sbjct  6     NVATIQPLSFSRRLVPSRGVLSSSVTVSRFSGRNSGYAPSFR----SINC-------ISV  54

Query  293   SPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFES  472
             SP +  S+  +  KF +ASK++NLIP+++CIFSD LTPVLAYRCLV EDDRE PSFLFES
Sbjct  55    SPEA--SIVTDTKKFSDASKSTNLIPIYRCIFSDQLTPVLAYRCLVKEDDREAPSFLFES  112

Query  473   VEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEW  652
             VEPGS+ S+VGRYSVVGAQP MEI+AKENKV ++DH +  +TE+ VEDPM + R ISE W
Sbjct  113   VEPGSQMSSVGRYSVVGAQPAMEIVAKENKVIVMDHTNESMTEEYVEDPMEIPRKISESW  172

Query  653   KP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIV  826
              P  QL  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF+ AP+DDRNLPD+HLGLYD+VIV
Sbjct  173   NPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNLPDMHLGLYDDVIV  232

Query  827   FDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREF  1006
             FDHV+KKA++IHW+RLD      KAY  G + LE LV+K+ D++PP+L++ +V+  TR++
Sbjct  233   FDHVEKKAYVIHWIRLDGSLPYEKAYSNGMQHLEHLVAKLHDIEPPKLAAGNVNLQTRQY  292

Query  1007  GPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPS  1186
             GP+L   N+T  EYK AV++AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+VNPS
Sbjct  293   GPALENSNVTCEEYKEAVVQAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRVVNPS  352

Query  1187  PYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKE  1366
             PYM Y+QARGCI+VASSPEILT+VK+N++VNRPLAGT+KRGKT  ED  LE  LL +EK+
Sbjct  353   PYMGYLQARGCIMVASSPEILTKVKQNKIVNRPLAGTSKRGKTEVEDKRLEKELLENEKQ  412

Query  1367  RAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALR  1546
              AEH MLVDLGRNDVGKV+K GSV VE+LMNIERYSHVMHISSTVTGEL D LTCWD LR
Sbjct  413   CAEHIMLVDLGRNDVGKVAKYGSVKVEKLMNIERYSHVMHISSTVTGELQDDLTCWDTLR  472

Query  1547  AALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGM  1726
             AALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGG+SF GDMDIAL+LRTIVF     
Sbjct  473   AALPVGTVSGAPKVKAMELIDKLEPTRRGPYSGGFGGVSFTGDMDIALSLRTIVFPTASQ  532

Query  1727  NDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
              +T+ S     +R+EW+A+LQ+GAG+VADS+P+ E +EC+NK AGL+RAIDLAESAFVK
Sbjct  533   YNTMYSYKDANKRREWVAYLQAGAGVVADSDPEDEHRECQNKAAGLARAIDLAESAFVK  591



>ref|XP_009122172.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic 
[Brassica rapa]
Length=597

 Score =   819 bits (2116),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/603 (67%), Positives = 483/603 (80%), Gaps = 24/603 (4%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLPPS----HLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQI  280
             N+  MQ   +  R L PS    H++S     +  SRRSS YAPS R     +KC      
Sbjct  7     NVASMQQPLSFSRRLAPSAASSHVLSSSVTVTGYSRRSSLYAPSHR----SIKC------  56

Query  281   PVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSF  460
              V+  P   PS+  +  K  +ASK++NLIP++ CIFSD LTPVLAYRCLV EDDRE PSF
Sbjct  57    -VSAPP--EPSIVTDTKKLADASKSTNLIPIYSCIFSDQLTPVLAYRCLVKEDDREAPSF  113

Query  461   LFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSI  640
             LFESVEPGS+ S+VGRYSVVGAQP MEI+AKENKV ++DH +G +TE+ VEDPM + R I
Sbjct  114   LFESVEPGSQMSSVGRYSVVGAQPAMEIVAKENKVIVMDHKNGSMTEEYVEDPMEIPRQI  173

Query  641   SEEWKP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYD  814
             SE W P  QL  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF+ AP+DDRNLPD+HLGLYD
Sbjct  174   SESWNPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNLPDMHLGLYD  233

Query  815   NVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFN  994
             +VIVFDHV+KKA++IHW+RLD      KAY  G + LE LV+K+ D++PP+L++ +V+  
Sbjct  234   DVIVFDHVEKKAYVIHWIRLDGSVPYEKAYSNGVQHLETLVAKLHDIEPPKLAAGNVNLQ  293

Query  995   TREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRI  1174
             TR+FGP+L   N+T  EYK AV+ AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+
Sbjct  294   TRQFGPALENSNVTREEYKEAVVNAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRV  353

Query  1175  VNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLN  1354
             VNPSPYM Y+QARGCILVASSPEILT+VK+N++VNRPLAGT++RGKT  ED  LE  LL 
Sbjct  354   VNPSPYMGYLQARGCILVASSPEILTKVKQNKIVNRPLAGTSRRGKTDVEDKRLEKELLE  413

Query  1355  DEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCW  1534
             +EK+ AEH MLVDLGRNDVGKV+K GSV VE+LMNIERYSHVMHISSTVTGEL D L+CW
Sbjct  414   NEKQCAEHIMLVDLGRNDVGKVAKYGSVKVEKLMNIERYSHVMHISSTVTGELQDDLSCW  473

Query  1535  DALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFL  1714
             D LRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGG+SF GDMDIAL+LRTIVF 
Sbjct  474   DTLRAALPVGTVSGAPKVKAMELIDELEPTRRGPYSGGFGGVSFTGDMDIALSLRTIVFP  533

Query  1715  NDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESA  1879
                  +T+ S     +R+EW+A+LQ+GAG+VADS+P+ E +EC+NK AGL+RAIDLAESA
Sbjct  534   TASQYNTMYSYKDANKRREWVAYLQAGAGVVADSDPEDEHRECQNKAAGLARAIDLAESA  593

Query  1880  FVK  1888
             FVK
Sbjct  594   FVK  596



>ref|NP_196192.1| anthranilate synthase component I-1 [Arabidopsis thaliana]
 sp|P32068.1|TRPE_ARATH RecName: Full=Anthranilate synthase alpha subunit 1, chloroplastic; 
AltName: Full=Anthranilate synthase component 1-1; AltName: 
Full=Anthranilate synthase component I-1; AltName: Full=Protein 
A-METHYL TRYPTOPHAN RESISTANT 1; AltName: Full=Protein 
JASMONATE-INDUCED DEFECTIVE LATERAL ROOT 1; AltName: Full=Protein 
TRYPTOPHAN BIOSYNTHESIS 5; AltName: Full=Protein 
WEAK ETHYLENE INSENSITIVE 2; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAA32738.1| anthranilate synthase alpha subunit [Arabidopsis thaliana]
 dbj|BAB09667.1| anthranilate synthase component I-1 precursor [Arabidopsis thaliana]
 gb|AED90915.1| anthranilate synthase component I-1 [Arabidopsis thaliana]
Length=595

 Score =   819 bits (2115),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/602 (68%), Positives = 486/602 (81%), Gaps = 23/602 (4%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLP--PSHLISELPIT-SIVSRRSSGYAPSLRVRTLQLKCSSSLQIP  283
             N+  MQA+   +RLLP   S  +S   +T +  S RSS YAPS R     +KC       
Sbjct  6     NVATMQALTFSRRLLPSVASRYLSSSSVTVTGYSGRSSAYAPSFR----SIKC-------  54

Query  284   VTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFL  463
             V+ SP +  S+  +  K  +ASK++NLIP+++CIFSD LTPVLAYRCLV EDDRE PSFL
Sbjct  55    VSVSPEA--SIVSDTKKLADASKSTNLIPIYRCIFSDQLTPVLAYRCLVKEDDREAPSFL  112

Query  464   FESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSIS  643
             FESVEPGS+ S+VGRYSVVGAQP MEI+AKENKV ++DH++  +TE+ VEDPM + R IS
Sbjct  113   FESVEPGSQMSSVGRYSVVGAQPAMEIVAKENKVIVMDHNNETMTEEFVEDPMEIPRKIS  172

Query  644   EEWKP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDN  817
             E+W P  QL  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF+ AP+DDRNLPD+HLGLYD+
Sbjct  173   EKWNPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNLPDMHLGLYDD  232

Query  818   VIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNT  997
             V+VFDHV+KKA++IHW+RLD      KAY  G + LE LV+K+ D++PP+L++ +V+  T
Sbjct  233   VVVFDHVEKKAYVIHWIRLDGSLPYEKAYSNGMQHLENLVAKLHDIEPPKLAAGNVNLQT  292

Query  998   REFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIV  1177
             R+FGPSL   N+T  EYK AV+KAKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+V
Sbjct  293   RQFGPSLDNSNVTCEEYKEAVVKAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRVV  352

Query  1178  NPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLND  1357
             NPSPYM Y+QARGCILVASSPEILT+VK+N++VNRPLAGT+KRGK   ED  LE  LL +
Sbjct  353   NPSPYMGYLQARGCILVASSPEILTKVKQNKIVNRPLAGTSKRGKNEVEDKRLEKELLEN  412

Query  1358  EKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWD  1537
             EK+ AEH MLVDLGRNDVGKV+K GSV VE+LMNIERYSHVMHISSTVTGEL D LTCWD
Sbjct  413   EKQCAEHIMLVDLGRNDVGKVTKYGSVKVEKLMNIERYSHVMHISSTVTGELQDGLTCWD  472

Query  1538  ALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLN  1717
              LRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGG+SF GDMDIAL+LRTIVF  
Sbjct  473   VLRAALPVGTVSGAPKVKAMELIDELEPTRRGPYSGGFGGVSFTGDMDIALSLRTIVFPT  532

Query  1718  DGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
                 +T+ S     +R+EW+A+LQ+GAG+VADS+P  E  EC+NK AGL+RAIDLAESAF
Sbjct  533   ACQYNTMYSYKDANKRREWVAYLQAGAGVVADSDPQDEHCECQNKAAGLARAIDLAESAF  592

Query  1883  VK  1888
             VK
Sbjct  593   VK  594



>gb|EYU45742.1| hypothetical protein MIMGU_mgv1a003752mg [Erythranthe guttata]
Length=566

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/533 (75%), Positives = 457/533 (86%), Gaps = 5/533 (1%)
 Frame = +2

Query  302   SPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEP  481
             SPPSL     KF EA+K  NLIPL++ IFSDHLTPVLAYRCLV ED+R+ PSFLFESV+P
Sbjct  32    SPPSLVDHSVKFKEAAKDGNLIPLYRPIFSDHLTPVLAYRCLVKEDERDAPSFLFESVDP  91

Query  482   GSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQ  661
             G ++S+VGRYSV+GAQPTMEI+AKEN VTI+DH  G+ TE+ VEDPM V R I E+WKPQ
Sbjct  92    GLKASSVGRYSVIGAQPTMEIVAKENMVTIVDHHEGRRTEEFVEDPMVVPRRIMEKWKPQ  151

Query  662   LTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVD  841
                +LPDAFCGGWVGYFSYDTVRYVEK+KLPF+ AP DDRNLPDIHLGLYD+VIVFDHV+
Sbjct  152   RIDELPDAFCGGWVGYFSYDTVRYVEKRKLPFSKAPHDDRNLPDIHLGLYDDVIVFDHVE  211

Query  842   KKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLA  1021
             KKA++IHWVRLD +SS  +AY +G  +LEALVS+V D+ PP+L++ S++  T  FGPSL+
Sbjct  212   KKAYVIHWVRLDQFSSVEEAYDDGMNRLEALVSRVHDIVPPKLAAGSINLYTSLFGPSLS  271

Query  1022  KGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTY  1201
               +MTS EY+ AV +AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY
Sbjct  272   NSSMTSEEYQKAVTQAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTY  331

Query  1202  MQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHT  1381
             +QARGCILV SSPEILTRVKK ++ NRPLAGT +RGKTP+ED MLE  LL+DEK+ AEH 
Sbjct  332   LQARGCILVGSSPEILTRVKKGKITNRPLAGTVRRGKTPKEDYMLENQLLHDEKQCAEHI  391

Query  1382  MLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPV  1561
             MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGEL  +LT WDALRAALPV
Sbjct  392   MLVDLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVTGELSSNLTSWDALRAALPV  451

Query  1562  GTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLS  1741
             GTVSGAPKVKAMELIDQLE TRRGPYSGGFGGIS+ GDMDIAL+LRTIVF  +   DT+ 
Sbjct  452   GTVSGAPKVKAMELIDQLEVTRRGPYSGGFGGISYTGDMDIALSLRTIVFPTNMRYDTMY  511

Query  1742  S-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             S     +R++WIAHLQ+GAGIVADS P  EQ+ECENK AGL+RAIDLAES+FV
Sbjct  512   SYKGGEKRRDWIAHLQAGAGIVADSVPADEQRECENKAAGLARAIDLAESSFV  564



>ref|XP_006399030.1| hypothetical protein EUTSA_v10013041mg [Eutrema salsugineum]
 gb|ESQ40483.1| hypothetical protein EUTSA_v10013041mg [Eutrema salsugineum]
Length=594

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/601 (67%), Positives = 486/601 (81%), Gaps = 22/601 (4%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLP--PSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPV  286
             N+  MQ ++  +RL+P   S  +S     +  S R+S YAPS R     +KC       V
Sbjct  6     NVATMQPLSFSRRLVPSVASRGLSSSLTVAGYSGRNSAYAPSFR----SIKC-------V  54

Query  287   TRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLF  466
             + SP +  S+  +  K  +ASK++NLIP+++CIFSD LTPVLAYRCLV EDDRE PSFLF
Sbjct  55    SISPEA--SIVSDTKKLADASKSTNLIPIYRCIFSDQLTPVLAYRCLVKEDDREAPSFLF  112

Query  467   ESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISE  646
             ESVEPGS+ S+VGRYSVVGAQP MEI+AKENKV ++DH +  +TE+ VEDPM + R ISE
Sbjct  113   ESVEPGSQMSSVGRYSVVGAQPAMEIVAKENKVIVMDHKNESMTEEYVEDPMEIPRKISE  172

Query  647   EWKP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNV  820
              W P  QL  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF++AP+DDRNLPD+HLGLYD+V
Sbjct  173   SWNPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSNAPEDDRNLPDMHLGLYDDV  232

Query  821   IVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTR  1000
             IVFDHV+KKA++IHW+RLD      KAY  G + LE LV+K+ D++PP+L++ +V+  TR
Sbjct  233   IVFDHVEKKAYVIHWIRLDGSVPYEKAYSNGMQHLENLVAKLHDIEPPKLAAGNVNLQTR  292

Query  1001  EFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVN  1180
             +FGP+L   N+T  EYK AV+KAKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+VN
Sbjct  293   QFGPALENSNVTCEEYKEAVVKAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRVVN  352

Query  1181  PSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDE  1360
             PSPYM Y+QARGCI+VASSPEILT+VK+N++VNRPLAGT+KRGKT  ED  LE  LL +E
Sbjct  353   PSPYMGYLQARGCIMVASSPEILTKVKQNKIVNRPLAGTSKRGKTEVEDKRLEKELLENE  412

Query  1361  KERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDA  1540
             K+ AEH MLVDLGRNDVGKV+K GSV VE+LMNIERYSHVMHISSTVTGEL D LTCWD 
Sbjct  413   KQCAEHIMLVDLGRNDVGKVAKYGSVKVEKLMNIERYSHVMHISSTVTGELQDDLTCWDT  472

Query  1541  LRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLND  1720
             LRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGG+SF GDMDIAL+LRTIVF   
Sbjct  473   LRAALPVGTVSGAPKVKAMELIDELEPTRRGPYSGGFGGVSFTGDMDIALSLRTIVFPTA  532

Query  1721  GMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                +T+ S     +R+EW+A+LQ+GAG+VADS+P+ E +EC+NK AGL+RAIDLAESAFV
Sbjct  533   SQYNTMYSYKDANKRREWVAYLQAGAGVVADSDPEDEHRECQNKAAGLARAIDLAESAFV  592

Query  1886  K  1888
             K
Sbjct  593   K  593



>ref|XP_008392945.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic 
[Malus domestica]
 ref|XP_008392946.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic 
[Malus domestica]
Length=577

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/595 (69%), Positives = 477/595 (80%), Gaps = 26/595 (4%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             M A+   QRL+ PSH +S +P+  I SR SS  A     R  + KC +           S
Sbjct  1     MLALCFSQRLVQPSHRLSRVPVIGISSRNSSSLA-----RVPKTKCCA----------LS  45

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
               SL  + +KF+EASK  NL+PL+KCIFSD LTPVLAYRCLV+EDDRE PSFLFESVE  
Sbjct  46    NQSLVTDASKFLEASKNGNLVPLYKCIFSDQLTPVLAYRCLVNEDDREAPSFLFESVE--  103

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEW--KP  658
                +  GR+SVVGAQPT+EI+AKENKVTI+DH+ G++TE+ VEDPM + R ISE W   P
Sbjct  104   --QNLQGRFSVVGAQPTIEIVAKENKVTIMDHEEGRMTEEFVEDPMVIPRRISEGWCPSP  161

Query  659   QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHV  838
              L  DLPDAFCGGWVGYF+YDTVRYVEK++LPF+ AP+DDRNLPDIHLGLYD VIVFDHV
Sbjct  162   LLIDDLPDAFCGGWVGYFTYDTVRYVEKRRLPFSKAPEDDRNLPDIHLGLYDEVIVFDHV  221

Query  839   DKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSL  1018
             +K+ ++IHWVRL+ YSS  +AY +G K+LE LV++V DVD PRLS  S++ +TR+FGP L
Sbjct  222   EKRVYVIHWVRLERYSSVEEAYTDGVKRLEDLVARVHDVDLPRLSPGSMNLHTRQFGPPL  281

Query  1019  AKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMT  1198
                +MTS +YK+ V +AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR VNPSPY T
Sbjct  282   KNSSMTSEDYKDKVKQAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRTVNPSPYXT  341

Query  1199  YMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEH  1378
             Y+QARGCILVASSPEIL  +KK ++VNRPLAGT +RGKT EED   E+ LL+DEK+ AEH
Sbjct  342   YLQARGCILVASSPEILMTLKKKKIVNRPLAGTVRRGKTVEEDKKFELQLLDDEKQCAEH  401

Query  1379  TMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALP  1558
              MLVDLGRNDVGKVSK GSV V+ LMN+ERYSHVMHISSTVTGEL D LTCWDALRAALP
Sbjct  402   IMLVDLGRNDVGKVSKYGSVKVDTLMNVERYSHVMHISSTVTGELRDDLTCWDALRAALP  461

Query  1559  VGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL  1738
             VGTVSGAPKVKAMELID+LE TRRGPYSGGFGG+SF GDMDIALALRT+VF      DT+
Sbjct  462   VGTVSGAPKVKAMELIDELEVTRRGPYSGGFGGVSFTGDMDIALALRTMVFTTGSRFDTM  521

Query  1739  SS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
              S     RR+EW+AHLQ+GAGIVADS+PD E +EC+NK AGL+RAIDLAE+AFVK
Sbjct  522   YSYKDANRRREWVAHLQAGAGIVADSDPDDENQECQNKAAGLARAIDLAEAAFVK  576



>ref|XP_007218949.1| hypothetical protein PRUPE_ppa003426mg [Prunus persica]
 gb|EMJ20148.1| hypothetical protein PRUPE_ppa003426mg [Prunus persica]
Length=575

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/592 (69%), Positives = 470/592 (79%), Gaps = 24/592 (4%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             MQA    +RL+P SH +S +P+  I SR S+  A   R +     CS S Q         
Sbjct  1     MQAPCISRRLVPASHRLSPVPVIGISSRSSTSLACVPRTKC----CSLSNQ---------  47

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
               SL  +  KF EASK  NL+PL KCIFSDHLTPVLAYRCLV EDDRE PSFLFESVE  
Sbjct  48    --SLANDVKKFEEASKKGNLVPLSKCIFSDHLTPVLAYRCLVKEDDREAPSFLFESVEQN  105

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
             ++    GRYSVVGAQPTMEI+AKENKVTI+DH+   LTE+VVEDPM + R ISE W PQL
Sbjct  106   NQ----GRYSVVGAQPTMEIVAKENKVTIMDHEERCLTEEVVEDPMAIPRRISETWSPQL  161

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               DLPDAFCGGWVGYFSYDTVRYVE+++LPF+ AP+DDRNLPD+HLGLYD+VIVFDHV+K
Sbjct  162   IDDLPDAFCGGWVGYFSYDTVRYVERRRLPFSKAPKDDRNLPDMHLGLYDDVIVFDHVEK  221

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             + + IHWVRLD YSS  KAY +G ++LE LV++V D+D PRLS  S++ +TR+FGP L  
Sbjct  222   RVYAIHWVRLDRYSSVEKAYTDGVRRLEKLVARVHDIDVPRLSPGSMNLHTRQFGPPLKN  281

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
              NMTS  YKN V  AKEHI+AGDIFQIVLSQRFERRT ADPFEVYRALR VNPSPY+TY+
Sbjct  282   SNMTSEAYKNIVNHAKEHIVAGDIFQIVLSQRFERRTFADPFEVYRALRTVNPSPYLTYL  341

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEIL   KK +++NRPLAGT +RGKT  ED MLE  LL+DEK+ AEH M
Sbjct  342   QARGCILVASSPEILMSAKKKKIINRPLAGTCRRGKTTAEDQMLEEQLLDDEKQCAEHIM  401

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVGKV K GSV V+RLM IERYSHVMHISSTVTGEL D LTCWDALRAALPVG
Sbjct  402   LVDLGRNDVGKVCKFGSVKVDRLMEIERYSHVMHISSTVTGELQDDLTCWDALRAALPVG  461

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL--  1738
             TVSGAPKVKAMELID+LE  RRGPYSGGFG +SF GDMDIALALRT+VF      DTL  
Sbjct  462   TVSGAPKVKAMELIDELEVARRGPYSGGFGAVSFSGDMDIALALRTMVFTTGSRFDTLYS  521

Query  1739  ---SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                +S+R+EW+AHLQ+GAGIVADS+PD E +EC+NK AGL+RAIDLAE+AFV
Sbjct  522   YKDASQRREWVAHLQAGAGIVADSDPDDENQECQNKAAGLARAIDLAEAAFV  573



>dbj|BAD90675.1| anthranilate synthetase alpha subunit [eukaryotic synthetic construct]
 dbj|BAD98991.1| anthranilate synthase [eukaryotic synthetic construct]
Length=595

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/602 (68%), Positives = 486/602 (81%), Gaps = 23/602 (4%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLP--PSHLISELPIT-SIVSRRSSGYAPSLRVRTLQLKCSSSLQIP  283
             N+  MQA+   +RLLP   S  +S   +T +  S RSS YAPS R     +KC       
Sbjct  6     NVATMQALTFSRRLLPSVASRYLSSSSVTVTGYSGRSSAYAPSFR----SIKC-------  54

Query  284   VTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFL  463
             V+ SP +  S+  +  K  +ASK++NLIP+++CIFSD LTPVLAYRCLV EDDRE PSFL
Sbjct  55    VSVSPEA--SIVSDTKKLADASKSTNLIPIYRCIFSDQLTPVLAYRCLVKEDDREAPSFL  112

Query  464   FESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSIS  643
             FESVEPGS+ S+VGRYSVVGAQP MEI+AKENKV ++DH++  +TE+ VEDPM + R IS
Sbjct  113   FESVEPGSQMSSVGRYSVVGAQPAMEIVAKENKVIVMDHNNETMTEEFVEDPMEIPRKIS  172

Query  644   EEWKP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDN  817
             E+W P  QL  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF+ AP+DDRNLPD+HLGLYD+
Sbjct  173   EKWNPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNLPDMHLGLYDD  232

Query  818   VIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNT  997
             V+VFDHV+KKA++IHW+RLD      KAY  G + LE LV+K+ D++PP+L++ +V+  T
Sbjct  233   VVVFDHVEKKAYVIHWIRLDGSLPYEKAYSNGMQHLENLVAKLHDIEPPKLAAGNVNLQT  292

Query  998   REFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIV  1177
             R+FGPSL   N+T  EYK AV+KAKEHILAGDIFQIVLSQRFERRT A+PFEVYRALR+V
Sbjct  293   RQFGPSLDNSNVTCEEYKEAVVKAKEHILAGDIFQIVLSQRFERRTFANPFEVYRALRVV  352

Query  1178  NPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLND  1357
             NPSPYM Y+QARGCILVASSPEILT+VK+N++VNRPLAGT+KRGK   ED  LE  LL +
Sbjct  353   NPSPYMGYLQARGCILVASSPEILTKVKQNKIVNRPLAGTSKRGKNEVEDKRLEKELLEN  412

Query  1358  EKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWD  1537
             EK+ AEH MLVDLGRNDVGKV+K GSV VE+LMNIERYSHVMHISSTVTGEL D LTCWD
Sbjct  413   EKQCAEHIMLVDLGRNDVGKVTKYGSVKVEKLMNIERYSHVMHISSTVTGELQDGLTCWD  472

Query  1538  ALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLN  1717
              LRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGG+SF GDMDIAL+LRTIVF  
Sbjct  473   VLRAALPVGTVSGAPKVKAMELIDELEPTRRGPYSGGFGGVSFTGDMDIALSLRTIVFPT  532

Query  1718  DGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
                 +T+ S     +R+EW+A+LQ+GAG+VADS+P  E  EC+NK AGL+RAIDLAESAF
Sbjct  533   ACQYNTMYSYKDANKRREWVAYLQAGAGVVADSDPQDEHCECQNKAAGLARAIDLAESAF  592

Query  1883  VK  1888
             VK
Sbjct  593   VK  594



>emb|CDX80970.1| BnaC03g02240D [Brassica napus]
Length=594

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/601 (67%), Positives = 485/601 (81%), Gaps = 22/601 (4%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLPP--SHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPV  286
             N+ K++ ++  +RL+P   S  +S     S  S RSS YAPSLR     +KC       V
Sbjct  6     NVAKVKPLSFSRRLVPSAVSRGLSSSVTVSGYSGRSSAYAPSLR----SIKC-------V  54

Query  287   TRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLF  466
             + SP +  S+  +  K  +ASK++NL+P+ +CIFSD LTPVLAYRCLV EDDRE PSFLF
Sbjct  55    SVSPEA--SIVSDTKKLADASKSTNLVPIFRCIFSDRLTPVLAYRCLVKEDDREAPSFLF  112

Query  467   ESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISE  646
             ESVEPGS+ S+VGRYSVVGAQP MEI+AKE+KV ++DH SG LTE+ VEDPM + R ISE
Sbjct  113   ESVEPGSQMSSVGRYSVVGAQPAMEIVAKEDKVIVMDHKSGSLTEEYVEDPMEIPRKISE  172

Query  647   EWKP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNV  820
              W P  QL  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF+ AP+DDRNLPD+HLGLYD+V
Sbjct  173   SWNPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNLPDMHLGLYDDV  232

Query  821   IVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTR  1000
             +VFDHV+KKA++IHW+RLD+      AY  G + LE LVSK+ D+ PP+L++ +V+  TR
Sbjct  233   VVFDHVEKKAYVIHWIRLDATVPYETAYSNGLQHLENLVSKLHDIAPPKLAAGNVNLQTR  292

Query  1001  EFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVN  1180
             +FGP+L   N+T  EYK AV+ AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+VN
Sbjct  293   QFGPALENSNVTREEYKEAVVNAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRVVN  352

Query  1181  PSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDE  1360
             PSPYM Y+QARGCILVASSPEILT+VK+N++VNRPLAGT++RGKT  ED  LE  LL +E
Sbjct  353   PSPYMGYLQARGCILVASSPEILTKVKQNKIVNRPLAGTSRRGKTEVEDKRLEKELLENE  412

Query  1361  KERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDA  1540
             K+ AEH MLVDLGRNDVGKV+K GSV VE+LMNIERYSHVMHISSTVTGEL D L+CWD 
Sbjct  413   KQGAEHIMLVDLGRNDVGKVAKYGSVKVEKLMNIERYSHVMHISSTVTGELQDDLSCWDT  472

Query  1541  LRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLND  1720
             LRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGG+SF GDMDIAL+LRTIVF   
Sbjct  473   LRAALPVGTVSGAPKVKAMELIDELEPTRRGPYSGGFGGVSFTGDMDIALSLRTIVFPTA  532

Query  1721  GMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                +T+ S     +R+EW+A+LQ+GAG+VADS+P+ E +EC+NK AGL+RAIDLAESAFV
Sbjct  533   SQYNTMYSYKDANKRREWVAYLQAGAGVVADSDPEDEHRECQNKAAGLARAIDLAESAFV  592

Query  1886  K  1888
             K
Sbjct  593   K  593



>ref|XP_010256590.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic 
isoform X1 [Nelumbo nucifera]
Length=600

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/535 (74%), Positives = 452/535 (84%), Gaps = 6/535 (1%)
 Frame = +2

Query  302   SPPSL-DKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVE  478
             SPPSL D+E  KF EASK  NL+PL+ CIFSDHLT VLAYRCLV EDDRE PSFLFESVE
Sbjct  65    SPPSLVDEEAVKFAEASKDGNLVPLYHCIFSDHLTSVLAYRCLVKEDDREAPSFLFESVE  124

Query  479   PGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKP  658
              G   S+VGRYSV+GA P ME++AKEN VTI+DHD+G   E+ V+DPM + R I E WKP
Sbjct  125   QGFGVSSVGRYSVIGAHPMMEVVAKENFVTIMDHDNGSRIEEYVDDPMVIPRKIMENWKP  184

Query  659   QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHV  838
             Q   +LP  FCGGWVGYFSYDTVRYVEKKKLPF+ AP+DDRNLPD+HLGLYD+VIVFDHV
Sbjct  185   QRIDELPGVFCGGWVGYFSYDTVRYVEKKKLPFSRAPEDDRNLPDVHLGLYDDVIVFDHV  244

Query  839   DKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSL  1018
             +KKAF+IHWV LD YSS  +AY +G K+L+ LVSK+Q++DPPRLS+ S++ +T  FG SL
Sbjct  245   EKKAFVIHWVLLDRYSSVDEAYNDGMKRLQVLVSKIQNIDPPRLSAGSIELHTHHFGSSL  304

Query  1019  AKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMT  1198
                +MTS  YK AV++AKEHIL+GDIFQIVLSQRFERRT ADPFE+YRALR+VNPSPYM 
Sbjct  305   KNSSMTSEAYKKAVVQAKEHILSGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMA  364

Query  1199  YMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEH  1378
             Y+QARGCILVASSPEILTRVK+ ++ NRPLAGT +RG+T +ED +LE  LLNDEK+ AEH
Sbjct  365   YLQARGCILVASSPEILTRVKQRKITNRPLAGTVRRGRTNKEDEILEEQLLNDEKQCAEH  424

Query  1379  TMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALP  1558
              MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGELLD LTCWDALRAALP
Sbjct  425   IMLVDLGRNDVGKVSKFGSVKVEKLMNIERYSHVMHISSTVTGELLDDLTCWDALRAALP  484

Query  1559  VGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL  1738
             VGTVSGAPKVKAMELIDQLE  RRGPYSGGFGGI F GDMDIALALRT+VF      DT+
Sbjct  485   VGTVSGAPKVKAMELIDQLEVKRRGPYSGGFGGICFSGDMDIALALRTMVFPTGARYDTM  544

Query  1739  -----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
                  S++R+EW+AHLQ+GAGIVADSNPD EQ+ECENK A L+RAIDLAES F++
Sbjct  545   YSYKDSNKRREWVAHLQAGAGIVADSNPDDEQRECENKAAALARAIDLAESTFIE  599



>ref|XP_006601954.1| PREDICTED: anthranilate synthase component I-1, chloroplastic-like 
[Glycine max]
Length=589

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/593 (69%), Positives = 477/593 (80%), Gaps = 24/593 (4%)
 Frame = +2

Query  122   KMQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPY  301
             K  ++A  +R++P  H +S   +T +          SL    L L+CSS           
Sbjct  14    KGSSLAFSRRMVPSGHRLSPATLTGV----------SLSRAPLTLRCSSL---------S  54

Query  302   SPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEP  481
             + PS  +E  KF+EASK  NLIPL + IF+D LTPVLAYR LV EDD E PSFL ES EP
Sbjct  55    NTPSYVEEGRKFVEASKNGNLIPLCQSIFADQLTPVLAYRILVKEDDWEAPSFLLESAEP  114

Query  482   GSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQ  661
                +S+VGRYSV+GA PTME++AKENKVTI+DH+SG LTE++V+DPM + R ISE WKP 
Sbjct  115   SYHASSVGRYSVLGANPTMEVVAKENKVTIIDHESGNLTEEIVDDPMVIPRKISEGWKPY  174

Query  662   LTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVD  841
             L  +LPDAFCGGW GYFSYDTVRYVEKKKLPF++AP+DDRNL DIHLGLY+NVIVFDHV+
Sbjct  175   LIDELPDAFCGGWAGYFSYDTVRYVEKKKLPFSNAPEDDRNLADIHLGLYENVIVFDHVE  234

Query  842   KKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLA  1021
             KKA++I WVR+D YSSA  AY++G ++LE LV+K+QD  PPRL+  SVD +T  FGPSL 
Sbjct  235   KKAYVILWVRVDRYSSAESAYKDGMERLEKLVAKLQDGQPPRLAPGSVDLHTHHFGPSLK  294

Query  1022  KGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTY  1201
             K +MTS  YK AVL+AKEHI AGDIFQIVLSQRFERRT ADPFE+YRALR+VNPSPYM Y
Sbjct  295   KSSMTSEAYKEAVLQAKEHIKAGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMAY  354

Query  1202  MQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHT  1381
             +QARGCILVASSPEILTRVKKN+++NRPLAGTA+RGKTPEED   E +LL DEK+ AEH 
Sbjct  355   LQARGCILVASSPEILTRVKKNKIMNRPLAGTARRGKTPEEDARFEAILLRDEKQCAEHV  414

Query  1382  MLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPV  1561
             MLVDLGRNDVGKV+KSGSV VE+LMN+ERYSHVMHISSTVTGEL +HLT WDALRAALPV
Sbjct  415   MLVDLGRNDVGKVAKSGSVKVEKLMNVERYSHVMHISSTVTGELQEHLTSWDALRAALPV  474

Query  1562  GTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLS  1741
             GTVSGAPKVKAMELID+LE TRRGPYSGGFG ISF G+MDIALALRT+VF +    DT+ 
Sbjct  475   GTVSGAPKVKAMELIDELEVTRRGPYSGGFGYISFSGEMDIALALRTMVFPSGTRYDTMY  534

Query  1742  S-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             S     +R+EWIA+LQ+GAGIVADS PD E +EC+NK AGL+RAIDLAESAFV
Sbjct  535   SYKDVDQRREWIAYLQAGAGIVADSVPDDEHQECQNKAAGLARAIDLAESAFV  587



>ref|XP_003555838.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like 
[Glycine max]
Length=567

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/531 (75%), Positives = 454/531 (85%), Gaps = 6/531 (1%)
 Frame = +2

Query  308   PSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGS  487
             PSL     KF+EASK  N+IPL +CIFSDHLTPVLAYRCLV ED+R+ PSFLFESVEPG 
Sbjct  36    PSLVDNAQKFLEASKKGNVIPLFRCIFSDHLTPVLAYRCLVKEDERDAPSFLFESVEPGQ  95

Query  488   RSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLT  667
              SS +GRYSVVGAQP MEI+AKEN VTI+DH  G+ +E++VEDP+ + R I E+W PQL 
Sbjct  96    ISS-IGRYSVVGAQPCMEIVAKENVVTIMDHVEGRRSEEIVEDPLVIPRRIMEKWTPQLL  154

Query  668   ADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKK  847
              +LP+AFCGGWVGYFSYDT+RYVEKKKLPF++AP DDRNLPD+HLGLYD+VIVFDHV+KK
Sbjct  155   DELPEAFCGGWVGYFSYDTMRYVEKKKLPFSNAPVDDRNLPDVHLGLYDSVIVFDHVEKK  214

Query  848   AFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKG  1027
             A++IHWVR+D YSSA +A+ +G+ +LE LVS+V D+  PRL + S+   TR FGP L   
Sbjct  215   AYVIHWVRVDRYSSAEEAFEDGRNRLETLVSRVHDIITPRLPTGSIKLYTRLFGPKLEMS  274

Query  1028  NMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQ  1207
             NMT+ EYK AVLKAKEHI AGDIFQIVLSQRFE+RT ADPFE+YRALRIVNPSPYMTY+Q
Sbjct  275   NMTNEEYKRAVLKAKEHIRAGDIFQIVLSQRFEQRTFADPFEIYRALRIVNPSPYMTYLQ  334

Query  1208  ARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTML  1387
             ARG ILVASSPEILTRVKK ++ NRPLAGT +RGKTP+ED+MLE  LLNDEK+ AEH ML
Sbjct  335   ARGSILVASSPEILTRVKKRKITNRPLAGTVRRGKTPKEDIMLEKQLLNDEKQCAEHVML  394

Query  1388  VDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGT  1567
             VDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGELLDHLT WDALRAALPVGT
Sbjct  395   VDLGRNDVGKVSKPGSVQVEKLMNIERYSHVMHISSTVTGELLDHLTSWDALRAALPVGT  454

Query  1568  VSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-  1744
             VSGAPKVKAM+LID+LE  RRGPYSGGFGGISF GDMDIALALRTIVF  +   DT+ S 
Sbjct  455   VSGAPKVKAMQLIDELEVARRGPYSGGFGGISFNGDMDIALALRTIVFPTNARYDTMYSY  514

Query  1745  ----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                 +R+EW+AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  515   KDKNKRREWVAHLQAGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  565



>ref|XP_004497238.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like 
[Cicer arietinum]
Length=567

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/577 (71%), Positives = 465/577 (81%), Gaps = 25/577 (4%)
 Frame = +2

Query  173   ISELPITSI-VSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEAS  349
             +S LP     VSR  S Y P        ++CS+           S P ++  E KF+EAS
Sbjct  8     LSTLPFPKFSVSRSRSNYRP--------IRCSAQ----------SLPIVENAE-KFLEAS  48

Query  350   KTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQ  529
             K  N+IPL++CIFSDHLTPVLAYRCLV ED+R+ PSFLFES EPG + S+ GRYSVVGAQ
Sbjct  49    KKGNVIPLYRCIFSDHLTPVLAYRCLVKEDERDAPSFLFESAEPGLQISSTGRYSVVGAQ  108

Query  530   PTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGY  709
             P MEI+AKEN VTI+DH+ G   E++ EDP+ + R I E+W PQL  DLP+AFCGGWVGY
Sbjct  109   PCMEIVAKENMVTIMDHEEGSKIEEIAEDPLVIPRRIMEKWTPQLIDDLPEAFCGGWVGY  168

Query  710   FSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSS  889
             FSYDT+RYVEKKKLPFA+AP DDR LPDIHLGLY+NVIVFDHV+KKA++IHWVRLD YSS
Sbjct  169   FSYDTMRYVEKKKLPFANAPIDDRGLPDIHLGLYENVIVFDHVEKKAYVIHWVRLDRYSS  228

Query  890   ASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKA  1069
             A +A  +G  +LE LVS+V D+  PRL + S+   T  FGP L   NMT+ EYK AVL+A
Sbjct  229   AEEALNDGMDRLETLVSRVHDIITPRLPAGSIKLLTNLFGPKLEMSNMTNEEYKKAVLQA  288

Query  1070  KEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEIL  1249
             KEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+QARG ILVASSPEIL
Sbjct  289   KEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYLQARGSILVASSPEIL  348

Query  1250  TRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsks  1429
             TRVKK ++ NRPLAGT +RGKTP+ED+MLE  LLNDEK+ AEH MLVDLGRNDVG+VSK 
Sbjct  349   TRVKKRKITNRPLAGTVRRGKTPKEDIMLEKDLLNDEKQCAEHVMLVDLGRNDVGRVSKP  408

Query  1430  gsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELID  1609
             GSV VE+LMNIERYSHVMHISSTVTGEL DHLT WDALRAALPVGTVSGAPKVKAMELID
Sbjct  409   GSVQVEKLMNIERYSHVMHISSTVTGELSDHLTSWDALRAALPVGTVSGAPKVKAMELID  468

Query  1610  QLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQ  1774
             QLE  RRGPYSGGFGGISF GDMDIALALRTIVF  +   DT+ S     +R+EWIAHLQ
Sbjct  469   QLEVARRGPYSGGFGGISFTGDMDIALALRTIVFPTNTRFDTMYSYKDVNKRREWIAHLQ  528

Query  1775  SGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             +GAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  529   AGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  565



>emb|CDY11333.1| BnaA03g01690D [Brassica napus]
Length=594

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/601 (67%), Positives = 484/601 (81%), Gaps = 22/601 (4%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLPP--SHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPV  286
             N+  ++ ++  +RL+P   S  ++     S  S RSS YAPSLR     +KC       V
Sbjct  6     NVATVKPLSFSRRLVPSAVSRGLASSVTVSGYSSRSSAYAPSLR----SIKC-------V  54

Query  287   TRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLF  466
             + SP +  S+  +  K  +ASK++NL+P+ +CIFSD LTPVLAYRCLV EDDRE PSFLF
Sbjct  55    SVSPEA--SIVSDTKKLADASKSTNLVPIFRCIFSDQLTPVLAYRCLVKEDDREAPSFLF  112

Query  467   ESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISE  646
             ESVEPGS+ S+VGRYSVVGAQP MEI+AKE+KV ++DH SG LTE+ VEDPM + R ISE
Sbjct  113   ESVEPGSQMSSVGRYSVVGAQPAMEIVAKEDKVIVMDHKSGSLTEEYVEDPMEIPRKISE  172

Query  647   EWKP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNV  820
              W P  QL  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF+ AP+DDRNLPD+HLGLYD+V
Sbjct  173   SWNPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNLPDMHLGLYDDV  232

Query  821   IVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTR  1000
             +VFDHV+KKA++IHW+RLD+      AY  G + LE LVSK+ D+ PP+L++ +V+  TR
Sbjct  233   VVFDHVEKKAYVIHWIRLDATVPYETAYSNGLQHLENLVSKLHDIAPPKLAAGNVNLQTR  292

Query  1001  EFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVN  1180
             +FGP+L   N+T  EYK AV+ AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+VN
Sbjct  293   QFGPALENSNVTREEYKEAVVNAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRVVN  352

Query  1181  PSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDE  1360
             PSPYM Y+QARGCILVASSPEILT+VK+N++VNRPLAGT++RGKT  ED  LE  LL +E
Sbjct  353   PSPYMGYLQARGCILVASSPEILTKVKQNKIVNRPLAGTSRRGKTEVEDKRLEKELLENE  412

Query  1361  KERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDA  1540
             K+ AEH MLVDLGRNDVGKV+K GSV VE+LMNIERYSHVMHISSTVTGEL D L+CWD 
Sbjct  413   KQCAEHIMLVDLGRNDVGKVAKYGSVKVEKLMNIERYSHVMHISSTVTGELQDDLSCWDT  472

Query  1541  LRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLND  1720
             LRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGG+SF GDMDIAL+LRTIVF   
Sbjct  473   LRAALPVGTVSGAPKVKAMELIDELEPTRRGPYSGGFGGVSFTGDMDIALSLRTIVFPTA  532

Query  1721  GMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                +T+ S     +R+EW+A+LQ+GAG+VADS+P+ E +EC+NK AGL+RAIDLAESAFV
Sbjct  533   SQYNTMYSYKDANKRREWVAYLQAGAGVVADSDPEDEHRECQNKAAGLARAIDLAESAFV  592

Query  1886  K  1888
             K
Sbjct  593   K  593



>ref|XP_010452479.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
[Camelina sativa]
Length=596

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/603 (67%), Positives = 482/603 (80%), Gaps = 24/603 (4%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLPPSHLISELPITSIV----SRRSSGYAPSLRVRTLQLKCSSSLQI  280
             N+  MQ ++  +RL+P   L S    +S+     S RSS Y PS R     +KC      
Sbjct  6     NVATMQPLSFTRRLVPSRGLSSSSSSSSVTVTGYSGRSSAYPPSFR----SIKC------  55

Query  281   PVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSF  460
              V+ SP +    D +E    +ASK++NLIP+++CIFSD LTPVLAYRCLV EDDRE PSF
Sbjct  56    -VSVSPEASIVSDTQE--LADASKSTNLIPIYRCIFSDQLTPVLAYRCLVKEDDREAPSF  112

Query  461   LFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSI  640
             LFESVEPGS+ S+VGRYSV+GAQP MEI+AKENKVT++DH +  +TEK VEDPM + R I
Sbjct  113   LFESVEPGSQMSSVGRYSVIGAQPAMEIVAKENKVTVMDHKNETMTEKYVEDPMEIPRQI  172

Query  641   SEEWKP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYD  814
             SE W P  QL  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF+ AP+DDRNLPD+HLGLYD
Sbjct  173   SENWNPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNLPDMHLGLYD  232

Query  815   NVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFN  994
             +VIVFDHV+KKA++IHW+RLD      KAY  G + LE LV+K+ D++PP+L++ +V+  
Sbjct  233   DVIVFDHVEKKAYVIHWIRLDGSLPYEKAYSNGMQHLENLVAKLHDIEPPKLAAGNVNLQ  292

Query  995   TREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRI  1174
             TR+FGP+L   N+T  EYK AV+KAKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+
Sbjct  293   TRQFGPTLTNSNVTCEEYKEAVVKAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRV  352

Query  1175  VNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLN  1354
             VNPSPYM Y+QARGCI+VASSPEILT+VK+N++VNRPLAGT+KRGK   ED  LE  LL 
Sbjct  353   VNPSPYMGYLQARGCIMVASSPEILTKVKQNKIVNRPLAGTSKRGKNKVEDKRLEKELLE  412

Query  1355  DEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCW  1534
             +EK+ AEH MLVDLGRNDVGKV+K GSV VE+LMNIERYSHVMHISSTVTGEL D LTCW
Sbjct  413   NEKQCAEHIMLVDLGRNDVGKVAKYGSVKVEKLMNIERYSHVMHISSTVTGELQDDLTCW  472

Query  1535  DALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFL  1714
             D LRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGG+SF GDMDIAL+LRTIVF 
Sbjct  473   DTLRAALPVGTVSGAPKVKAMELIDELEPTRRGPYSGGFGGVSFTGDMDIALSLRTIVFP  532

Query  1715  NDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESA  1879
                  +T+ S     +R+EW+A+LQ+GAG+VADS+P  E  EC+NK AGL+RAIDLAESA
Sbjct  533   TACQYNTMYSYKNANKRREWVAYLQAGAGVVADSDPQDEHCECQNKAAGLARAIDLAESA  592

Query  1880  FVK  1888
             FVK
Sbjct  593   FVK  595



>gb|KHN36388.1| Anthranilate synthase component I-1, chloroplastic [Glycine soja]
Length=589

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/593 (69%), Positives = 477/593 (80%), Gaps = 24/593 (4%)
 Frame = +2

Query  122   KMQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPY  301
             K  ++A  +R++P  H +S   +T +          SL    L L+CSS           
Sbjct  14    KGSSLAFSRRMVPSGHRLSPATLTGV----------SLSRAPLTLRCSSL---------S  54

Query  302   SPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEP  481
             + PS  +E  KF+EASK  NLIPL + IF+D LTPVLAYR LV EDD E PSFL ES EP
Sbjct  55    NTPSYVEEGRKFVEASKNGNLIPLCQSIFADQLTPVLAYRILVKEDDWEAPSFLLESAEP  114

Query  482   GSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQ  661
                +S+VGRYSV+GA PTME++AKENKVTI+DH+SG LTE++V+DPM + R ISE WKP 
Sbjct  115   SYHASSVGRYSVLGANPTMEVVAKENKVTIIDHESGNLTEEIVDDPMVIPRKISEGWKPY  174

Query  662   LTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVD  841
             L  +LPDAFCGGW GYFSYDTVRYVEKKKLPF++AP+DDRNL DIHLGLY+NVIVFDHV+
Sbjct  175   LIDELPDAFCGGWAGYFSYDTVRYVEKKKLPFSNAPEDDRNLADIHLGLYENVIVFDHVE  234

Query  842   KKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLA  1021
             KKA++I WVR+D YSSA  AY++G ++LE LV+K+QD  PPRL+  SVD +T  FGPSL 
Sbjct  235   KKAYVILWVRVDRYSSAESAYKDGMERLEKLVAKLQDGPPPRLAPGSVDLHTHHFGPSLK  294

Query  1022  KGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTY  1201
             K +MTS  YK AVL+AKEHI AGDIFQIVLSQRFERRT ADPFE+YRALR+VNPSPYM Y
Sbjct  295   KSSMTSEAYKEAVLQAKEHIKAGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMAY  354

Query  1202  MQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHT  1381
             +QARGCILVASSPEILTRVKKN+++NRPLAGTA+RGKTPEED   E +LL DEK+ AEH 
Sbjct  355   LQARGCILVASSPEILTRVKKNKIMNRPLAGTARRGKTPEEDARFEAILLRDEKQCAEHV  414

Query  1382  MLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPV  1561
             MLVDLGRNDVGKV+KSGSV VE+LMN+ERYSHVMHISSTVTGEL +HLT WDALRAALPV
Sbjct  415   MLVDLGRNDVGKVAKSGSVKVEKLMNVERYSHVMHISSTVTGELQEHLTSWDALRAALPV  474

Query  1562  GTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLS  1741
             GTVSGAPKVKAMELID+LE TRRGPYSGGFG ISF G+MDIALALRT+VF +    DT+ 
Sbjct  475   GTVSGAPKVKAMELIDELEVTRRGPYSGGFGYISFSGEMDIALALRTMVFPSGTRYDTMY  534

Query  1742  S-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             S     +R+EWIA+LQ+GAGIVADS PD E +EC+NK AGL+RAIDLAESAFV
Sbjct  535   SYKDVDQRREWIAYLQAGAGIVADSVPDDEHQECQNKAAGLARAIDLAESAFV  587



>ref|XP_010534810.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=595

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/540 (75%), Positives = 450/540 (83%), Gaps = 8/540 (1%)
 Frame = +2

Query  284   VTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFL  463
             V+ SP S  S  K   KF+E SK  NL+PL   IFSDHLTPVLAYRCLV EDDRE PSFL
Sbjct  49    VSLSPCS--STAKGGMKFVEPSKNENLVPLCHTIFSDHLTPVLAYRCLVKEDDREAPSFL  106

Query  464   FESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSIS  643
             FESVEPGS SSTVGRYSVVGAQPTMEI+AKE  VT++DH  G LT++ VEDPM + R IS
Sbjct  107   FESVEPGSLSSTVGRYSVVGAQPTMEIVAKEKTVTVMDHVRGTLTKEEVEDPMEIPRRIS  166

Query  644   EEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVI  823
             E WKPQL  +LPDAFCGGWVGYFSYDTVRY+EK+KLPF+ AP DDR+LPD+HL LYD+VI
Sbjct  167   ETWKPQLIDELPDAFCGGWVGYFSYDTVRYMEKRKLPFSKAPLDDRSLPDMHLSLYDDVI  226

Query  824   VFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTRE  1003
             VFDHV+KK  +IHWVR+   SS    Y +G   L+ LVS++QDVDPP+L + SV+  TR+
Sbjct  227   VFDHVEKKVHVIHWVRVSENSSFEDVYADGVAHLDELVSRLQDVDPPKLPAGSVELRTRQ  286

Query  1004  FGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNP  1183
             FGP L K +MTS  YKNAVL+AKEHI AGDIFQIVLSQRFERRT ADPFEVYRALR+VNP
Sbjct  287   FGPPLKKSSMTSDAYKNAVLQAKEHISAGDIFQIVLSQRFERRTFADPFEVYRALRVVNP  346

Query  1184  SPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEK  1363
             SPYM Y+QARGCILVASSPEILTRVKKN+VVNRPLAGT +RGKT EED MLE LLL DEK
Sbjct  347   SPYMGYLQARGCILVASSPEILTRVKKNKVVNRPLAGTVRRGKTFEEDQMLEKLLLKDEK  406

Query  1364  ERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDAL  1543
             + AEH MLVDLGRNDVGKVSK GSV VE+LMN+ERYSHVMHISSTVTGEL + LTCWD L
Sbjct  407   QCAEHIMLVDLGRNDVGKVSKDGSVKVEKLMNVERYSHVMHISSTVTGELREDLTCWDVL  466

Query  1544  RAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDG  1723
             RAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF GDMDIALALRTIVF  + 
Sbjct  467   RAALPVGTVSGAPKVKAMELIDELEVTRRGPYSGGFGGISFAGDMDIALALRTIVFPTET  526

Query  1724  MNDTLSS------RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
               DT+ S      RR EWIAHLQ+GAG+VADS PD E +EC+NK AGL+RAIDLAESAFV
Sbjct  527   RYDTMYSYKDKNMRRHEWIAHLQAGAGVVADSQPDDEHRECQNKAAGLARAIDLAESAFV  586



>gb|KHN23104.1| Anthranilate synthase component I-2, chloroplastic [Glycine soja]
Length=567

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/531 (74%), Positives = 453/531 (85%), Gaps = 6/531 (1%)
 Frame = +2

Query  308   PSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGS  487
             PSL     KF+EASK  N+IPL +CIFSDHLTPVLAYRCLV ED+R+ PSFLFESVEPG 
Sbjct  36    PSLVDNAQKFLEASKKGNVIPLFRCIFSDHLTPVLAYRCLVKEDERDAPSFLFESVEPGQ  95

Query  488   RSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLT  667
              SS +GRYSVVGAQP MEI+AKEN VTI+DH  G+ +E++VEDP+ + R I E+W PQL 
Sbjct  96    ISS-IGRYSVVGAQPCMEIVAKENVVTIMDHVEGRRSEEIVEDPLVIPRRIMEKWTPQLL  154

Query  668   ADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKK  847
              +LP+AFCGGWVGYFSYDT+RYVEKKKLPF++AP DDRNLPD+HLGLYD+VIVFDHV+KK
Sbjct  155   DELPEAFCGGWVGYFSYDTMRYVEKKKLPFSNAPVDDRNLPDVHLGLYDSVIVFDHVEKK  214

Query  848   AFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKG  1027
             A++IHWVR+D YSSA +A+ +G+ +LE LVS+V D+  PRL + S+   TR FGP L   
Sbjct  215   AYVIHWVRVDRYSSAEEAFEDGRNRLETLVSRVHDIITPRLPTGSIKLYTRLFGPKLEMS  274

Query  1028  NMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQ  1207
             NMT+ EYK AVLKAKEHI AGDIFQIVLSQRFE+RT ADPFE+YRALRIVNPSPYMTY+Q
Sbjct  275   NMTNEEYKRAVLKAKEHIRAGDIFQIVLSQRFEQRTFADPFEIYRALRIVNPSPYMTYLQ  334

Query  1208  ARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTML  1387
             ARG ILVASSPEILTRVKK ++ NRPLAGT +RGKTP+ED+MLE  LLNDEK+ AEH ML
Sbjct  335   ARGSILVASSPEILTRVKKRKITNRPLAGTVRRGKTPKEDIMLEKQLLNDEKQCAEHVML  394

Query  1388  VDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGT  1567
             VDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGELLDHLT WDALRAALPVGT
Sbjct  395   VDLGRNDVGKVSKPGSVQVEKLMNIERYSHVMHISSTVTGELLDHLTSWDALRAALPVGT  454

Query  1568  VSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-  1744
             VSGAPKVKAM+LID+LE  RRGPYSGGFGG+SF GDMDIALALRTIVF  +   DT+ S 
Sbjct  455   VSGAPKVKAMQLIDELEVARRGPYSGGFGGVSFNGDMDIALALRTIVFPTNARYDTMYSY  514

Query  1745  ----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                 +R+EW+AHLQ+GAGIVADS+   EQ+ECENK A L+RAIDLAES+FV
Sbjct  515   KDKNKRREWVAHLQAGAGIVADSDAADEQRECENKAAALARAIDLAESSFV  565



>ref|XP_008368076.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
[Malus domestica]
Length=575

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/593 (68%), Positives = 474/593 (80%), Gaps = 24/593 (4%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             M A+   QRL+ PS  +S +P+  I SR SS  A   R     + C+ S Q         
Sbjct  1     MPALCFSQRLVQPSQRLSRVPVIGISSRNSSSLACVPRT----ICCALSNQ---------  47

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
               SL  E +KF+EASK  NL+PL+KCIFSD LTPVLAYRCLV EDDRE PSFLFESVE  
Sbjct  48    --SLVTESSKFVEASKNGNLVPLYKCIFSDQLTPVLAYRCLVKEDDREAPSFLFESVEQN  105

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
             S+    GR+SVVG+QPTMEI+AKENKVTI+DH+ G++TE+ VEDPM + R ISE W PQL
Sbjct  106   SQ----GRFSVVGSQPTMEIVAKENKVTIMDHEEGRMTEEFVEDPMVIPRRISEGWSPQL  161

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               +LPDAFCGGWVGYFSYDTVRYVEK++LPF+ AP+DDRNLPD+HLGLYD+VIVFDHVDK
Sbjct  162   IDELPDAFCGGWVGYFSYDTVRYVEKRRLPFSKAPKDDRNLPDMHLGLYDDVIVFDHVDK  221

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             + +++HWVRL+ YSS  +AY +G K+L+ LV++V  +D PRL   S++ +TR+FGP L  
Sbjct  222   RVYVVHWVRLERYSSVEQAYTDGVKRLKDLVARVHGLDLPRLPPGSMNLSTRQFGPPLKN  281

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
              +MTS  YK+ +  AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR VNPSPY+TY+
Sbjct  282   SSMTSEGYKDKITHAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRTVNPSPYLTYL  341

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEIL  +KK ++VNRPLAGT +RGKT EED  LE  LL+DEK+ AEH M
Sbjct  342   QARGCILVASSPEILVTLKKKKIVNRPLAGTVRRGKTIEEDQKLEAQLLDDEKQCAEHIM  401

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVGKVSK GSV V+RLMN+ERYSHVMHISSTVTGEL D LTCWDALR+ALPVG
Sbjct  402   LVDLGRNDVGKVSKYGSVKVDRLMNVERYSHVMHISSTVTGELHDDLTCWDALRSALPVG  461

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS  1744
             TVSGAPKVKAMELID+LE TRRGPYSGGFG +SF GDMDIALALRT+VF      DT+ S
Sbjct  462   TVSGAPKVKAMELIDELEVTRRGPYSGGFGWVSFTGDMDIALALRTMVFTTGSRFDTMYS  521

Query  1745  -----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
                  RR+EW+AHLQ+GAGIVADS+P+ E +EC+NK AGL+RAIDLAE AFVK
Sbjct  522   YKDANRRREWVAHLQAGAGIVADSDPEDENQECQNKAAGLARAIDLAEVAFVK  574



>ref|XP_010423436.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic 
[Camelina sativa]
Length=595

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/602 (67%), Positives = 482/602 (80%), Gaps = 23/602 (4%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLPPSHLISELPITSIV---SRRSSGYAPSLRVRTLQLKCSSSLQIP  283
             N+  MQ ++  +R +P   L S    +  V   S RSS Y PS R     +KC       
Sbjct  6     NVATMQPLSFSRRRVPSRALSSSYSSSVTVTGFSGRSSAYPPSFR----SIKC-------  54

Query  284   VTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFL  463
             V+ SP +  S+  +  K  +ASK++NLIP+++CIFSD LTPVLAYRCLV EDDRE PSFL
Sbjct  55    VSVSPEA--SIVSDTKKLGDASKSTNLIPIYRCIFSDQLTPVLAYRCLVKEDDREAPSFL  112

Query  464   FESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSIS  643
             FESVEPGS+ S+VGRYSVVGAQP MEI+AKENKVT++DH +  +TE+ VEDPM + R IS
Sbjct  113   FESVEPGSQMSSVGRYSVVGAQPAMEIVAKENKVTVMDHKNETMTEEYVEDPMEIPRQIS  172

Query  644   EEWKP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDN  817
             E+W P  QL  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF+ AP+DDRNLPD+HLGLYD+
Sbjct  173   EKWNPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNLPDMHLGLYDD  232

Query  818   VIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNT  997
             VIVFDHV+KKA++IHW+RLD      KAY  G + LE LV+K+ D++PP+L++ +V+  T
Sbjct  233   VIVFDHVEKKAYVIHWIRLDGSLPYEKAYSNGMQHLENLVAKLHDIEPPKLAAGNVNLQT  292

Query  998   REFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIV  1177
             R+FGP+L   N+T  EYK AV+KAKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+V
Sbjct  293   RQFGPTLTNSNVTCEEYKEAVVKAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRVV  352

Query  1178  NPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLND  1357
             NPSPYM Y+QARGCI+VASSPEILT+VK+N++VNRPLAGT+KRGK   ED  LE  LL +
Sbjct  353   NPSPYMGYLQARGCIMVASSPEILTKVKQNKIVNRPLAGTSKRGKNEVEDKRLEKDLLEN  412

Query  1358  EKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWD  1537
             EK+ AEH MLVDLGRNDVGKV+K GSV VE+LMNIERYSHVMHISSTVTGEL D LTCWD
Sbjct  413   EKQCAEHIMLVDLGRNDVGKVAKYGSVKVEKLMNIERYSHVMHISSTVTGELQDDLTCWD  472

Query  1538  ALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLN  1717
              LRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGGFGG+SF GDMDIAL+LRTIVF  
Sbjct  473   TLRAALPVGTVSGAPKVKAMELIDQLEPTRRGPYSGGFGGVSFTGDMDIALSLRTIVFPT  532

Query  1718  DGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
                 +T+ S     +R+EW+A+LQ+GAG+VADS+P  E  EC+NK AGL+RAIDLAESAF
Sbjct  533   ACQYNTMYSYKNANKRREWVAYLQAGAGVVADSDPQDEHCECQNKAAGLARAIDLAESAF  592

Query  1883  VK  1888
             VK
Sbjct  593   VK  594



>ref|XP_010650923.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic 
isoform X2 [Vitis vinifera]
Length=608

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/607 (70%), Positives = 486/607 (80%), Gaps = 19/607 (3%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPI--------TSIV---SRRSSGYAPSLRVRT---LQLKC  262
             M+ +A   RLLP +      P         T++V    R  +G + + R  T   L L  
Sbjct  1     METLAASHRLLPANRRFDAAPTCGNSNCRATNVVFGNGRGLNGVSDNGRALTSGSLALVS  60

Query  263   SSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDD  442
             S      V    +S PSL    AKF EA+K  NLIPLH+ IFSDHLTPVLAYRCLV EDD
Sbjct  61    SGRRWHAVACLSHSSPSLVDHSAKFFEAAKKGNLIPLHRSIFSDHLTPVLAYRCLVKEDD  120

Query  443   RETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPM  622
             R+ PSFL+ESVEPG +SS VGRYSV+GAQPT+EI+AKEN VTI+DH++G  TE++VEDPM
Sbjct  121   RDAPSFLYESVEPGIQSSNVGRYSVIGAQPTIEIVAKENMVTIMDHEAGSRTEEIVEDPM  180

Query  623   TVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHL  802
             ++ R + E WKPQL  +LP+AFCGGWVGYFSYDTVRYVEKKKLPF SAP+DDRNLPD+HL
Sbjct  181   SIPRRMMEGWKPQLLDELPEAFCGGWVGYFSYDTVRYVEKKKLPFLSAPKDDRNLPDVHL  240

Query  803   GLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSAS  982
             GLY++V+VFDHV K+ F+IHWVRLD YSS  +A+ +G  +LEALVS+V D+ PP+L++ S
Sbjct  241   GLYEDVLVFDHVKKQVFVIHWVRLDQYSSVEEAFNDGMNRLEALVSRVHDIVPPKLAAGS  300

Query  983   VDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYR  1162
             +   T  FGPSL K  MT  EY  AVL+AKEHILAGDIFQIVLSQRFERRT ADPFEVYR
Sbjct  301   IKLQTGLFGPSLEKSTMTCDEYMKAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEVYR  360

Query  1163  ALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEM  1342
             ALRIVNPSPYMTY+QARGCILVASSPEILTRVKKNR++NRPLAGT +RGKTP+ED+MLE 
Sbjct  361   ALRIVNPSPYMTYLQARGCILVASSPEILTRVKKNRIINRPLAGTVRRGKTPKEDIMLEN  420

Query  1343  LLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDH  1522
              L NDEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGELLDH
Sbjct  421   QLRNDEKQCAEHIMLVDLGRNDVGKVSKPGSVTVEKLMNIERYSHVMHISSTVTGELLDH  480

Query  1523  LTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRT  1702
             LT WDALRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGGFGGISF GDMDIALALRT
Sbjct  481   LTSWDALRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGFGGISFSGDMDIALALRT  540

Query  1703  IVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDL  1867
             IVF +    DT+ S     +R+EW+AHLQ+GAGIVADS P  EQ+ECENK A L+RAIDL
Sbjct  541   IVFPSGSRFDTMFSYKDMNKRREWVAHLQAGAGIVADSVPADEQRECENKAAALARAIDL  600

Query  1868  AESAFVK  1888
             AES+F++
Sbjct  601   AESSFIE  607



>emb|CDX70133.1| BnaA10g24820D [Brassica napus]
Length=597

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/571 (70%), Positives = 469/571 (82%), Gaps = 24/571 (4%)
 Frame = +2

Query  203   SRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPP--SLDKEEAKFIEASKTSNLIPLH  376
             SRRSS YAPS R     +KC S+           PP  S+  +  K  +ASK++NLIP++
Sbjct  41    SRRSSPYAPSHR----SIKCVSA-----------PPEASIVTDTKKLADASKSTNLIPIY  85

Query  377   KCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKE  556
              CIFSD LTPVLAYRCLV EDDRE PSFLFESVEPGS+ S+VGRYSVVGAQP MEI+AKE
Sbjct  86    TCIFSDQLTPVLAYRCLVKEDDREAPSFLFESVEPGSQMSSVGRYSVVGAQPAMEIVAKE  145

Query  557   NKVTILDHDSGKLTEKVVEDPMTVARSISEEWKP--QLTADLPDAFCGGWVGYFSYDTVR  730
             NKV ++DH +G +TE+ VEDPM + R ISE W P  QL  DLPDAFCGGWVG+FSYDTVR
Sbjct  146   NKVIVMDHKNGSMTEEYVEDPMEIPRKISESWNPDPQLVQDLPDAFCGGWVGFFSYDTVR  205

Query  731   YVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYRE  910
             YVEK+KLPF+ AP+DDRNLPD+HLGLYD+VIVFDHV+KKA++IHW+RLD      KAY  
Sbjct  206   YVEKRKLPFSKAPEDDRNLPDMHLGLYDDVIVFDHVEKKAYVIHWIRLDGSVPYEKAYSN  265

Query  911   GKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAG  1090
             G + LE LV+K+ D++PP+L++ +V+  TR+FGP+L   N+T  EYK AV+ AKEHILAG
Sbjct  266   GVQHLETLVAKLHDIEPPKLAAGNVNLQTRQFGPALENSNVTREEYKEAVVNAKEHILAG  325

Query  1091  DIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNR  1270
             DIFQIVLSQRFERRT ADPFEVYRALR+VNPSPYM Y+QARGCILVASSPEILT+VK+N+
Sbjct  326   DIFQIVLSQRFERRTFADPFEVYRALRVVNPSPYMGYLQARGCILVASSPEILTKVKQNK  385

Query  1271  VVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVER  1450
             +VNRPLAGT++RGKT  ED  LE  LL +EK+ AEH MLVDLGRNDVGKV+K GSV VE+
Sbjct  386   IVNRPLAGTSRRGKTDVEDKRLEKELLENEKQCAEHIMLVDLGRNDVGKVAKYGSVKVEK  445

Query  1451  LMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRR  1630
             L+NIERYSHVMHISSTVTGEL D L+CWD LRAALPVGTVSGAPKVKAMELID+LE TRR
Sbjct  446   LLNIERYSHVMHISSTVTGELQDDLSCWDTLRAALPVGTVSGAPKVKAMELIDELEPTRR  505

Query  1631  GPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVA  1795
             GPYSGGFGG+SF GDMDIAL+LRTIVF      +T+ S     +R+EW+A+LQ+GAG+VA
Sbjct  506   GPYSGGFGGVSFTGDMDIALSLRTIVFPTASQYNTMYSYKDANKRREWVAYLQAGAGVVA  565

Query  1796  DSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             DS+P+ E +EC+NK AGL+RAIDLAESAFVK
Sbjct  566   DSDPEDEHRECQNKAAGLARAIDLAESAFVK  596



>ref|XP_009350798.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
[Pyrus x bretschneideri]
Length=576

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/593 (68%), Positives = 475/593 (80%), Gaps = 23/593 (4%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             M A+   QRL+ PS L+S +P+  I SR SS  A   R +     C+ S Q  VT     
Sbjct  1     MPALCFSQRLVLPSQLLSRVPVIGISSRNSSSLACVPRTKC----CALSNQSLVT-----  51

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
                   + +KF+EASK  NL+PL+KCIFSD LTPVLAYRCLV EDDRE PSFLFESVE  
Sbjct  52    -----DDASKFVEASKKGNLVPLYKCIFSDQLTPVLAYRCLVKEDDREAPSFLFESVE--  104

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
                +  GR+SVVG+QPTMEI+AKENKVTI+DH+ G++TE+ VEDPM + R ISE W PQL
Sbjct  105   --QNLQGRFSVVGSQPTMEIVAKENKVTIMDHEEGRMTEEFVEDPMVIPRRISEGWSPQL  162

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               +LPDAFCGGWVGYFSYDTVRYVEK++LPF+ AP+DDRNLPD+HLGLYD+VIVFDHVDK
Sbjct  163   IDELPDAFCGGWVGYFSYDTVRYVEKRRLPFSKAPKDDRNLPDMHLGLYDDVIVFDHVDK  222

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             + +++HWVRL+ YSS  +AY +G K+L+ LV++V  +D PRL   S++ +TR+FGP L  
Sbjct  223   RVYVVHWVRLERYSSVEQAYTDGVKRLKDLVARVHGLDLPRLPPGSMNLHTRQFGPPLKN  282

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
              +M+S  YK+ V  AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR VNPSPY+TY+
Sbjct  283   SSMSSECYKDKVKHAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRTVNPSPYLTYL  342

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEIL  +KK ++VNRPLAGT +RGKT EED  LE  LL+DEK+ AEH M
Sbjct  343   QARGCILVASSPEILVTLKKKKIVNRPLAGTVRRGKTTEEDQKLEAQLLDDEKQCAEHIM  402

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVGKVSK GSV V+RLMN+ERYSHVMHISSTVTGEL D LTCWDALR+ALPVG
Sbjct  403   LVDLGRNDVGKVSKYGSVKVDRLMNVERYSHVMHISSTVTGELHDDLTCWDALRSALPVG  462

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS  1744
             TVSGAPKVKAMELID+LE TRRGPYSGGFG +SF GDMDIALALRT+VF      DT+ S
Sbjct  463   TVSGAPKVKAMELIDELEVTRRGPYSGGFGWVSFTGDMDIALALRTMVFTTGSRFDTMYS  522

Query  1745  -----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
                  RR+EW+AHLQ+GAGIVADS+P+ E +EC+NK AGL+RAIDLAE+AFVK
Sbjct  523   YKDANRRREWVAHLQAGAGIVADSDPEDENQECQNKAAGLTRAIDLAEAAFVK  575



>gb|AFL91702.1| anthranilate synthase alpha-subunit 1 [Mitragyna speciosa]
Length=616

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/602 (71%), Positives = 481/602 (80%), Gaps = 23/602 (4%)
 Frame = +2

Query  149   RLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPPSLDKEE  328
             RL P +H +S + +   VSR S      L +RT Q     SLQ        S P +D+E 
Sbjct  17    RLPPVNHSVSPVSVKISVSRPSLSSGRRLSLRTFQ---CCSLQ-------SSSPVMDRE-  65

Query  329   AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGR  508
              +F+EAS+  N+IPL+KCIFSDHLTPVLAYRCLV EDDRE PSFLFES+EPG  +S VGR
Sbjct  66    -RFMEASRHGNVIPLYKCIFSDHLTPVLAYRCLVKEDDREAPSFLFESIEPGFLASNVGR  124

Query  509   YSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAF  688
             YSVVGAQP MEI+AKEN VT LDH  GKL E VVEDP+T+ R ISE WKPQL  +LPD F
Sbjct  125   YSVVGAQPAMEIVAKENSVTFLDHHKGKLKEMVVEDPLTIPREISESWKPQLINELPDTF  184

Query  689   CGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWV  868
             CGGWVGYFSYDTVRY+EKKKLPF+ AP DDRNL DIHLGLYD+VIVFDHV+KKAF+IHWV
Sbjct  185   CGGWVGYFSYDTVRYIEKKKLPFSRAPHDDRNLADIHLGLYDDVIVFDHVEKKAFVIHWV  244

Query  869   RLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEY  1048
             +LD Y S  KAY +G K+LE L+S+VQ++DPPRLS  S +  T  FG SL K NMT  EY
Sbjct  245   QLDEYPSKEKAYIDGMKRLERLLSRVQNIDPPRLSPGSAEMWTHNFGLSLNKSNMTREEY  304

Query  1049  KNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILV  1228
             K AV++AKEHILAGDIFQIVLSQRFE+RT ADPFEVYRALRI+NPSPYM Y+QARG I V
Sbjct  305   KKAVIQAKEHILAGDIFQIVLSQRFEKRTFADPFEVYRALRIINPSPYMAYLQARGSIHV  364

Query  1229  ASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRND  1408
             ASSPEILTRVK+ R+VNRPLAGT +RGKTP ED M ++ LL DEK+ AEH MLVDLGRND
Sbjct  365   ASSPEILTRVKRKRIVNRPLAGTTRRGKTPHEDEMQKLQLLKDEKQCAEHIMLVDLGRND  424

Query  1409  vgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKV  1588
             VGKVSK GSVNVE+LM +ERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKV
Sbjct  425   VGKVSKPGSVNVEKLMTVERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKV  484

Query  1589  KAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL-----SSRRK  1753
             KAMELIDQLE  RRGPYSGGFGGISF GDMDIALALRTIVF +    DT+     S++R+
Sbjct  485   KAMELIDQLEVARRGPYSGGFGGISFSGDMDIALALRTIVFPSGVRYDTMYSYKDSNKRR  544

Query  1754  EWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAF------VKTKRKPQPPP  1915
             EW+AHLQ+GAGIVADS PD EQ ECENK AGL+RAI+LAESAF      VK+ +   P P
Sbjct  545   EWVAHLQAGAGIVADSIPDDEQMECENKAAGLARAIELAESAFVNREHEVKSNQSSSPTP  604

Query  1916  AV  1921
              +
Sbjct  605   VL  606



>ref|XP_009780337.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=589

 Score =   808 bits (2086),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/598 (71%), Positives = 476/598 (80%), Gaps = 46/598 (8%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             MQ++    RL P +H    LP+ ++ S RSS  + SLRVRTLQ +C  S           
Sbjct  1     MQSLPISHRLFPATHR-KVLPL-AVFSCRSSTSSLSLRVRTLQCRCLHS-----------  47

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
               SL  +E +FIEASK+ NLIPL K IFSDHLTPVLAYRCLV EDDRE PSFLFESVEPG
Sbjct  48    -SSLVMDEDRFIEASKSGNLIPLQKTIFSDHLTPVLAYRCLVKEDDREAPSFLFESVEPG  106

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
              R S+VGRYSVVGAQP+MEI+AKE+ VTILDH +GKLT+K V+DPMT+ R ISEEWKP+L
Sbjct  107   FRGSSVGRYSVVGAQPSMEIVAKEHNVTILDHHTGKLTQKTVQDPMTIPRCISEEWKPRL  166

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               +LPD FCGGWVGYFSYDTVRYVE +KLPF  AP+DDRNL DI LGLY++V+VFDHV+K
Sbjct  167   VDELPDTFCGGWVGYFSYDTVRYVENRKLPFLRAPEDDRNLADIQLGLYEDVVVFDHVEK  226

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             KA +IHWVRLD YSS  +AY +GKK+LE LVS+VQ ++ PRLS  SVDF T  FGPSL K
Sbjct  227   KAHVIHWVRLDQYSSLPEAYLDGKKRLEILVSRVQGIESPRLSPGSVDFCTHTFGPSLTK  286

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
             GNMTS EYKNAVL+AKEHI AGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+
Sbjct  287   GNMTSEEYKNAVLQAKEHIAAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYI  346

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEILTRVKK R+VNRPLAGT++RGKTP+EDVMLEM +L DEK+ AEH M
Sbjct  347   QARGCILVASSPEILTRVKKRRIVNRPLAGTSRRGKTPDEDVMLEMQMLKDEKQCAEHIM  406

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDV                             V+GELLDHLTCWDALRAALPVG
Sbjct  407   LVDLGRNDV---------------------------GKVSGELLDHLTCWDALRAALPVG  439

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL--  1738
             TVSGAPKVKAMELIDQLE TRRGPYSGGFGGISF GDMDIALALRT+VFLN    DT+  
Sbjct  440   TVSGAPKVKAMELIDQLEVTRRGPYSGGFGGISFSGDMDIALALRTMVFLNGARYDTMYS  499

Query  1739  ---SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKTKRKP  1903
                +S+R+EW+AHLQSGAGIVADSNPD EQ ECENKVAGL RAID+AESAFVK + KP
Sbjct  500   YTDASKRQEWVAHLQSGAGIVADSNPDEEQIECENKVAGLCRAIDVAESAFVKGRHKP  557



>ref|XP_007142762.1| hypothetical protein PHAVU_007G014800g [Phaseolus vulgaris]
 gb|ESW14756.1| hypothetical protein PHAVU_007G014800g [Phaseolus vulgaris]
Length=573

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/531 (74%), Positives = 451/531 (85%), Gaps = 7/531 (1%)
 Frame = +2

Query  311   SLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSR  490
             SL     KF+EASK  N+IPL++CIFSDHLTPVLAYRCLV ED+R+ PSFLFESVEPG  
Sbjct  41    SLADNGEKFLEASKKGNVIPLYRCIFSDHLTPVLAYRCLVKEDERDAPSFLFESVEPGQF  100

Query  491   SSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTA  670
             SS +GRYSVVGAQP MEI+AKEN VT++DH  G+ +E++ EDP+ + R I E+W PQL  
Sbjct  101   SS-IGRYSVVGAQPCMEIVAKENVVTVMDHMEGRRSEEIAEDPLVIPRRIMEKWTPQLID  159

Query  671   DLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKA  850
             +LP+AFCGGW+GYFSYDT+RYVEKKKLPF++AP DDRNLPDIHLGLYDNVIVFDHV+KKA
Sbjct  160   ELPEAFCGGWIGYFSYDTMRYVEKKKLPFSNAPVDDRNLPDIHLGLYDNVIVFDHVEKKA  219

Query  851   FIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGN  1030
             ++IHWVRLD YSSA +A  +G+ +LE LVS+V D+  P+L++ S+  +T  FGP L   N
Sbjct  220   YVIHWVRLDRYSSAEEALSDGRNRLETLVSRVHDIVTPKLAAGSIKLHTHLFGPKLEMSN  279

Query  1031  MTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQA  1210
             MT+ EYK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+Q 
Sbjct  280   MTNEEYKRAVLQAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYLQV  339

Query  1211  RGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLV  1390
             RG ILVASSPEILTRVKK  + NRPLAGT +RGKTP+ED+MLE  LL DEK+ AEH MLV
Sbjct  340   RGSILVASSPEILTRVKKRNITNRPLAGTVRRGKTPKEDIMLEEELLKDEKQCAEHVMLV  399

Query  1391  DLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTV  1570
             DLGRNDVGKVSK GSV VERLMNIERYSHVMHISSTVTGELLD+LT WDALRAALPVGTV
Sbjct  400   DLGRNDVGKVSKPGSVQVERLMNIERYSHVMHISSTVTGELLDNLTSWDALRAALPVGTV  459

Query  1571  SGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS--  1744
             SGAPKVKAMELID+LE  RRGPYSGGFGGISF GDMDIALALRTIVF  +   DT+ S  
Sbjct  460   SGAPKVKAMELIDELEVARRGPYSGGFGGISFNGDMDIALALRTIVFPTNARYDTMYSYK  519

Query  1745  ----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                 +R+EW+AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  520   DHMNKRREWVAHLQAGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  570



>ref|XP_009344662.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic 
[Pyrus x bretschneideri]
Length=577

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 412/596 (69%), Positives = 478/596 (80%), Gaps = 28/596 (5%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRS-PY  301
             M A+   QRL+PPSH +S +P+  I SR SS            L C     +P+T+    
Sbjct  1     MLALCFSQRLVPPSHRLSRVPVIGISSRNSS-----------SLSC-----VPLTKCCAL  44

Query  302   SPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEP  481
             S  SL  + +KF+EASK  NL+PL+KCIFSD LTPVLAYRCLV+EDDRE PSFLFESVE 
Sbjct  45    SNQSLVTDASKFLEASKNGNLVPLYKCIFSDQLTPVLAYRCLVNEDDREAPSFLFESVE-  103

Query  482   GSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEW--K  655
                 +  GR+SVVGAQPTMEI+AKENKVTI+DH+ G++TE+ VEDPM + R ISE W   
Sbjct  104   ---QNLQGRFSVVGAQPTMEIVAKENKVTIMDHEEGRMTEEFVEDPMVIPRRISEGWCPS  160

Query  656   PQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDH  835
             P L  DLPDAFCGGWVGYF+YDTVRYVEK++LPF+ AP+DDRNLPDIHLGLYD VIVFDH
Sbjct  161   PLLIDDLPDAFCGGWVGYFTYDTVRYVEKRRLPFSKAPKDDRNLPDIHLGLYDEVIVFDH  220

Query  836   VDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPS  1015
             V+K+ ++IHWVRL+ Y S  +AY +G K+LE LV++V DVD PRLS  S++ +T +FGP 
Sbjct  221   VEKRVYVIHWVRLERYFSVEEAYTDGVKRLEDLVARVHDVDLPRLSPGSMNLHTCQFGPP  280

Query  1016  LAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYM  1195
             L   +MTS EYK+ V +AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR VNPSPY+
Sbjct  281   LKNSSMTSEEYKDKVKQAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRTVNPSPYL  340

Query  1196  TYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAE  1375
             TY+QARGCILVASSPEIL  +KK ++VNRPLAGT +RGKT EED  LE  LL+DEK+ AE
Sbjct  341   TYLQARGCILVASSPEILMTLKKKKIVNRPLAGTVRRGKTVEEDKKLEQQLLDDEKQCAE  400

Query  1376  HTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAAL  1555
             H MLVDLGRNDVGKVSK GSV V+ LMN+ERYSHVMHISSTVTGEL D LTCWDALRAAL
Sbjct  401   HIMLVDLGRNDVGKVSKYGSVKVDTLMNVERYSHVMHISSTVTGELRDDLTCWDALRAAL  460

Query  1556  PVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDT  1735
             PVGTVSGAPKVKAMELID+LE TRRGPYSGGFGG+SF GDMDIALALRT+VF      DT
Sbjct  461   PVGTVSGAPKVKAMELIDELEVTRRGPYSGGFGGVSFTGDMDIALALRTMVFTTGSRFDT  520

Query  1736  LSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             + S     RR+EWIAHLQ+GAGIVADS+PD E +EC+NK AGL+RAIDLAE+AFVK
Sbjct  521   MYSYKDANRRREWIAHLQAGAGIVADSDPDDENQECQNKAAGLARAIDLAEAAFVK  576



>emb|CAN83610.1| hypothetical protein VITISV_035611 [Vitis vinifera]
Length=601

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/601 (69%), Positives = 486/601 (81%), Gaps = 14/601 (2%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSS-----GYAPSLRVRTLQLKCSSSLQIPVT  289
             M+ +A   RLLP +      P     + R++     G++ S ++R   L C   L   V+
Sbjct  1     METLAASHRLLPANRRFDAAPTCGNSNCRATNSSDIGFSGSRQLRA-SLACGRVLVSLVS  59

Query  290   RSPYS---PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSF  460
              + ++   P       AKF EA+K  NLIPLH+ IFSDHLTPVLAYRCLV EDDR+ PSF
Sbjct  60    FTSFNWCDPVFAVDHSAKFFEAAKKGNLIPLHRSIFSDHLTPVLAYRCLVKEDDRDAPSF  119

Query  461   LFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSI  640
             L+ESVEPG +SS VGRYSV+GAQPT+EI+AKEN VTI+DH++G  TE++VEDPM++ R +
Sbjct  120   LYESVEPGIQSSNVGRYSVIGAQPTIEIVAKENMVTIMDHEAGSRTEEIVEDPMSIPRRM  179

Query  641   SEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNV  820
              E WKPQL  +LP+AFCGGWVGYFSYDTVRYVEKKKLPF SAP+DDRNLPD+HLGLY++V
Sbjct  180   MEGWKPQLLDELPEAFCGGWVGYFSYDTVRYVEKKKLPFLSAPKDDRNLPDVHLGLYEDV  239

Query  821   IVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTR  1000
             +VFDHV K+ F+IHWVRLD YSS  +A+ +G  +LEALVS+V D+ PP+L++ S+   T 
Sbjct  240   LVFDHVKKQVFVIHWVRLDQYSSVEEAFNDGMNRLEALVSRVHDIVPPKLAAGSIKLQTG  299

Query  1001  EFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVN  1180
              FGPSL K  MT  EY  AVL+AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVN
Sbjct  300   LFGPSLEKSTMTCDEYMKAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVN  359

Query  1181  PSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDE  1360
             PSPYMTY+QARGCILVASSPEILTRVKKN+++NRPLAGT +RGKTP+ED+MLE  L NDE
Sbjct  360   PSPYMTYLQARGCILVASSPEILTRVKKNKIINRPLAGTVRRGKTPKEDIMLENQLRNDE  419

Query  1361  KERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDA  1540
             K+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGELLDHLT WDA
Sbjct  420   KQCAEHIMLVDLGRNDVGKVSKPGSVTVEKLMNIERYSHVMHISSTVTGELLDHLTSWDA  479

Query  1541  LRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLND  1720
             LRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGGFGGISF GDMDIALALRTIVF + 
Sbjct  480   LRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGFGGISFSGDMDIALALRTIVFPSG  539

Query  1721  GMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                DT+ S     +R+EW+AHLQ+GAGIVADS P  EQ+ECENK A L+RAIDLAES+F+
Sbjct  540   SRFDTMFSYKDMNKRREWVAHLQAGAGIVADSVPADEQRECENKAAALARAIDLAESSFI  599

Query  1886  K  1888
             +
Sbjct  600   E  600



>ref|XP_009130895.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic 
isoform X2 [Brassica rapa]
Length=594

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/601 (66%), Positives = 483/601 (80%), Gaps = 22/601 (4%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLPP--SHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPV  286
             N+  ++ ++  +RL+P   S  ++     S  S ++S YAPSLR     +KC       V
Sbjct  6     NVATVKPLSFSRRLVPSAVSRGLASSVTVSGYSGKTSAYAPSLR----SIKC-------V  54

Query  287   TRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLF  466
             + SP +  S+  +  K  +ASK++NL+P+ +CIFSD LTPVLAYRCLV EDDRE PSFLF
Sbjct  55    SVSPEA--SIVSDTKKLADASKSTNLVPIFRCIFSDQLTPVLAYRCLVKEDDREAPSFLF  112

Query  467   ESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISE  646
             ESVEPGS+ S+VGRYSVVGAQP MEI+AKE+KV ++DH SG LTE+ VEDPM + R ISE
Sbjct  113   ESVEPGSQMSSVGRYSVVGAQPAMEIVAKEDKVIVMDHKSGSLTEEYVEDPMEIPRKISE  172

Query  647   EWKP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNV  820
              W P  QL  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF+ AP+DDRNLPD+HLGLYD+V
Sbjct  173   SWNPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNLPDMHLGLYDDV  232

Query  821   IVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTR  1000
             +VFDHV+KKA++IHW+RLD+      AY  G + LE LVSK+ D+ PP+L++ +V+  TR
Sbjct  233   VVFDHVEKKAYVIHWIRLDATVPYETAYSNGLQHLENLVSKLHDIAPPKLAAGNVNLQTR  292

Query  1001  EFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVN  1180
             +FGP+L   N+T  EYK AV+ AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+VN
Sbjct  293   QFGPALENSNVTREEYKEAVVNAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRVVN  352

Query  1181  PSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDE  1360
             PSPYM Y+QARGCILVASSPEILT+VK+N++VNRPLAGT++RGKT  ED  LE  LL +E
Sbjct  353   PSPYMGYLQARGCILVASSPEILTKVKQNKIVNRPLAGTSRRGKTEVEDKRLEKELLENE  412

Query  1361  KERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDA  1540
             K+ AEH MLVDLGRNDVGKV+K GSV VE+LMNIERYSHVMHISSTVTGEL D L+CWD 
Sbjct  413   KQCAEHIMLVDLGRNDVGKVAKYGSVKVEKLMNIERYSHVMHISSTVTGELQDDLSCWDT  472

Query  1541  LRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLND  1720
             LRAALPVGTVSGAPKV A+ELID+LE TRRGPYSGGFGG+SF GDMDIAL+LRTIVF   
Sbjct  473   LRAALPVGTVSGAPKVNALELIDELEPTRRGPYSGGFGGVSFTGDMDIALSLRTIVFPTA  532

Query  1721  GMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                +T+ S     +R+EW+A+LQ+GAG+VADS+P+ E +EC+NK AGL+RAIDLAESAFV
Sbjct  533   SQYNTMYSYKDANKRREWVAYLQAGAGVVADSDPEDEHRECQNKAAGLARAIDLAESAFV  592

Query  1886  K  1888
             K
Sbjct  593   K  593



>ref|XP_008233737.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic 
[Prunus mume]
Length=575

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/592 (69%), Positives = 463/592 (78%), Gaps = 24/592 (4%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             MQA     RL+P SH +S +P+  I SR S+  A   R +     CS S Q         
Sbjct  1     MQAPCISWRLVPASHRLSPVPVIGISSRSSTSLACVPRTKC----CSLSNQ---------  47

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
               SL  +  KF EASK  NL+PL KCIFSD LTPVLAYRCLV EDDRE PSFLFESVE  
Sbjct  48    --SLANDVKKFEEASKNGNLVPLSKCIFSDQLTPVLAYRCLVKEDDREAPSFLFESVEQN  105

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
             ++    GRYSVVG QPTMEI+AKENKVTI+DH+   LTE+VVEDPM + R ISE W PQL
Sbjct  106   NQ----GRYSVVGGQPTMEIVAKENKVTIMDHEERCLTEEVVEDPMAIPRRISETWSPQL  161

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               DLPDAFCGGWVGYFSYDTVRY E+++LPF+ AP+DDRNLPD+HLGLYD+VIVFDHV+K
Sbjct  162   IDDLPDAFCGGWVGYFSYDTVRYAERRRLPFSKAPKDDRNLPDMHLGLYDDVIVFDHVEK  221

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             + + IHWVRLD YSS  KAY +G  +LE LV++V D+D PRLS  S++ +TR+FGP L  
Sbjct  222   RVYAIHWVRLDRYSSVEKAYTDGVGRLEKLVARVHDIDVPRLSPGSMNLHTRQFGPPLKN  281

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
              NMTS  YKN V  AKEHI AGDIFQIVLSQRFERRT ADPFEVYRALR VNPSPY+TY+
Sbjct  282   SNMTSEAYKNIVNHAKEHIAAGDIFQIVLSQRFERRTFADPFEVYRALRTVNPSPYLTYL  341

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEIL   KK +++NRPLAGT +RGKT  ED M E  LL+DEK+ AEH M
Sbjct  342   QARGCILVASSPEILMSAKKKKIINRPLAGTCRRGKTTAEDQMFEEQLLDDEKQCAEHIM  401

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVGKV K GSV V+RLM IERYSHVMHISSTVTGEL D L+CWDALRAALPVG
Sbjct  402   LVDLGRNDVGKVCKFGSVKVDRLMEIERYSHVMHISSTVTGELQDDLSCWDALRAALPVG  461

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL--  1738
             TVSGAPKVKAMELID+LE  RRGPYSGGFG +SF GDMDIALALRT+VF      DTL  
Sbjct  462   TVSGAPKVKAMELIDELEVARRGPYSGGFGAVSFSGDMDIALALRTMVFTTGSRFDTLYS  521

Query  1739  ---SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                +S+R+EW+AHLQ+GAGIVADS+PD E +EC+NK AGL+RAIDLAE+AFV
Sbjct  522   YKDASQRREWVAHLQAGAGIVADSDPDDENQECQNKAAGLARAIDLAEAAFV  573



>ref|XP_010104658.1| Anthranilate synthase component I-2 [Morus notabilis]
 gb|EXC01464.1| Anthranilate synthase component I-2 [Morus notabilis]
Length=738

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/589 (70%), Positives = 473/589 (80%), Gaps = 25/589 (4%)
 Frame = +2

Query  164   SHLISELPITSIVSRRSSG--------YAPSLRVRTLQLKCSSSLQIPVTRSPYSPPSLD  319
             S L S L + S+VS   +G          PS RV T   +CS+           S PSL 
Sbjct  6     SQLTSTLRLPSMVSVSFNGRLSSSIVLTKPSSRVHTF--RCSA----------LSSPSLV  53

Query  320   KEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSST  499
              +  +F EASK  NLIPL++ IFSDHLTPVLAYRCLV EDDR+ PSFLFESVEPG R+S+
Sbjct  54    DQSERFSEASKKGNLIPLYRTIFSDHLTPVLAYRCLVKEDDRDAPSFLFESVEPGLRASS  113

Query  500   VGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLP  679
             +GRYSVVGAQP +EI+AKEN VTILDH+ G  TE++VEDPM V R + E W PQL  +LP
Sbjct  114   IGRYSVVGAQPAIEIVAKENMVTILDHEEGCRTEEIVEDPMIVPRRLMEGWTPQLVDELP  173

Query  680   DAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFII  859
             +AFCGGWVG+FSYDTVRYVEKKKLPF+SAP DDRNLPD+HLGLYD+VIVFDHV+KKA++I
Sbjct  174   EAFCGGWVGFFSYDTVRYVEKKKLPFSSAPLDDRNLPDVHLGLYDDVIVFDHVEKKAYVI  233

Query  860   HWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTS  1039
             HWVRL  YSS  +A+ +G  +LEALVS+V DV  PRL + S++ +T  FG  L   +MTS
Sbjct  234   HWVRLGRYSSVEEAFNDGMDRLEALVSRVHDVVTPRLPAGSINLHTHLFGSKLENSSMTS  293

Query  1040  GEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGC  1219
              EYK AVLKAKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+QARGC
Sbjct  294   EEYKEAVLKAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYLQARGC  353

Query  1220  ILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLG  1399
             ILVASSPEILT VKK ++ NRPLAGT +RGKTP+ED+MLE  LL+DEK+ AEH MLVDLG
Sbjct  354   ILVASSPEILTCVKKKKITNRPLAGTIRRGKTPKEDLMLEKQLLDDEKQCAEHIMLVDLG  413

Query  1400  RNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGA  1579
             RNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGELLD LT WD LRAALPVGTVSGA
Sbjct  414   RNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVTGELLDDLTSWDVLRAALPVGTVSGA  473

Query  1580  PKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----  1744
             PKVKAMELID+LE TRRG YSGGFGGISF GDMDIALALRTIVF      DT+ S     
Sbjct  474   PKVKAMELIDELEVTRRGAYSGGFGGISFNGDMDIALALRTIVFPTSTRYDTMFSYKDVN  533

Query  1745  RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKT  1891
              R+EW+AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV++
Sbjct  534   NRREWVAHLQAGAGIVADSDPSDEQRECENKAAALARAIDLAESSFVRS  582



>ref|XP_002873221.1| hypothetical protein ARALYDRAFT_487374 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49480.1| hypothetical protein ARALYDRAFT_487374 [Arabidopsis lyrata subsp. 
lyrata]
Length=596

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/603 (67%), Positives = 481/603 (80%), Gaps = 24/603 (4%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLP--PSHLISELPITSIV--SRRSSGYAPSLRVRTLQLKCSSSLQI  280
             N+  MQ +   +RL+P   S  +S     ++   S RSS YAPS       +KC      
Sbjct  6     NVATMQPLTFSRRLVPSVASRYLSSSSSVTVTGYSGRSSAYAPSFP----SIKC------  55

Query  281   PVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSF  460
              V+ SP +  S+  +  K  +ASK++NLIP+++CIFSD LTPVLAYRCLV EDDRE PSF
Sbjct  56    -VSVSPEA--SIVSDTKKLADASKSTNLIPIYRCIFSDQLTPVLAYRCLVKEDDREAPSF  112

Query  461   LFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSI  640
             LFESVEPGS+ S+VGRYSVVGAQP MEI+AKENKV ++DH +  +TE+ VEDPM + R I
Sbjct  113   LFESVEPGSQMSSVGRYSVVGAQPAMEIVAKENKVIVMDHSNETMTEEYVEDPMEIPRQI  172

Query  641   SEEWKP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYD  814
             SE+W P  QL  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF+ AP+DDRNLPD+HLGLYD
Sbjct  173   SEKWNPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNLPDMHLGLYD  232

Query  815   NVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFN  994
             +V+VFDHV+KKA++IHW+RLD      KAY  G + LE LV+K+ D++PP+LS+ +V+  
Sbjct  233   DVVVFDHVEKKAYVIHWIRLDGSLPYEKAYSNGMQHLENLVAKLHDIEPPKLSAGNVNLQ  292

Query  995   TREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRI  1174
             TR+FGPSL   N+T  EYK AV+KAKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+
Sbjct  293   TRQFGPSLDNSNVTCEEYKEAVVKAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRV  352

Query  1175  VNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLN  1354
             VNPSPYM Y+QARGCILVASSPEILT+VK+N++VNRPLAGT+KRGK   ED   E  LL 
Sbjct  353   VNPSPYMGYLQARGCILVASSPEILTKVKQNKIVNRPLAGTSKRGKNEVEDKRFEKELLE  412

Query  1355  DEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCW  1534
             +EK+ AEH MLVDLGRNDVGKV+K GSV VE+LMNIERYSHVMHISSTVTGEL D LTCW
Sbjct  413   NEKQCAEHIMLVDLGRNDVGKVAKYGSVKVEKLMNIERYSHVMHISSTVTGELQDDLTCW  472

Query  1535  DALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFL  1714
             D LRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGG+SF GDMDIAL+LRTIVF 
Sbjct  473   DTLRAALPVGTVSGAPKVKAMELIDELEPTRRGPYSGGFGGVSFTGDMDIALSLRTIVFP  532

Query  1715  NDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESA  1879
                  +T+ S     +R+EW+A+LQ+GAG+VADS+P  E  EC+NK AGL+RAIDLAESA
Sbjct  533   TACQYNTMYSYKDANKRREWVAYLQAGAGVVADSDPQDEHCECQNKAAGLARAIDLAESA  592

Query  1880  FVK  1888
             FVK
Sbjct  593   FVK  595



>ref|XP_010650922.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic 
isoform X1 [Vitis vinifera]
Length=611

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/610 (69%), Positives = 486/610 (80%), Gaps = 22/610 (4%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPI--------TSIV---SRRSSGYAPSLRVRT---LQLKC  262
             M+ +A   RLLP +      P         T++V    R  +G + + R  T   L L  
Sbjct  1     METLAASHRLLPANRRFDAAPTCGNSNCRATNVVFGNGRGLNGVSDNGRALTSGSLALVS  60

Query  263   SSSLQIPVTRSPYSPPSLD---KEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVD  433
             S      V    +S PSL       AKF EA+K  NLIPLH+ IFSDHLTPVLAYRCLV 
Sbjct  61    SGRRWHAVACLSHSSPSLVFAVDHSAKFFEAAKKGNLIPLHRSIFSDHLTPVLAYRCLVK  120

Query  434   EDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVE  613
             EDDR+ PSFL+ESVEPG +SS VGRYSV+GAQPT+EI+AKEN VTI+DH++G  TE++VE
Sbjct  121   EDDRDAPSFLYESVEPGIQSSNVGRYSVIGAQPTIEIVAKENMVTIMDHEAGSRTEEIVE  180

Query  614   DPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPD  793
             DPM++ R + E WKPQL  +LP+AFCGGWVGYFSYDTVRYVEKKKLPF SAP+DDRNLPD
Sbjct  181   DPMSIPRRMMEGWKPQLLDELPEAFCGGWVGYFSYDTVRYVEKKKLPFLSAPKDDRNLPD  240

Query  794   IHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLS  973
             +HLGLY++V+VFDHV K+ F+IHWVRLD YSS  +A+ +G  +LEALVS+V D+ PP+L+
Sbjct  241   VHLGLYEDVLVFDHVKKQVFVIHWVRLDQYSSVEEAFNDGMNRLEALVSRVHDIVPPKLA  300

Query  974   SASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFE  1153
             + S+   T  FGPSL K  MT  EY  AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE
Sbjct  301   AGSIKLQTGLFGPSLEKSTMTCDEYMKAVLEAKEHILAGDIFQIVLSQRFERRTFADPFE  360

Query  1154  VYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVM  1333
             VYRALRIVNPSPYMTY+QARGCILVASSPEILTRVKKNR++NRPLAGT +RGKTP+ED+M
Sbjct  361   VYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKNRIINRPLAGTVRRGKTPKEDIM  420

Query  1334  LEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGEL  1513
             LE  L NDEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGEL
Sbjct  421   LENQLRNDEKQCAEHIMLVDLGRNDVGKVSKPGSVTVEKLMNIERYSHVMHISSTVTGEL  480

Query  1514  LDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALA  1693
             LDHLT WDALRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGGFGGISF GDMDIALA
Sbjct  481   LDHLTSWDALRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGFGGISFSGDMDIALA  540

Query  1694  LRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRA  1858
             LRTIVF +    DT+ S     +R+EW+AHLQ+GAGIVADS P  EQ+ECENK A L+RA
Sbjct  541   LRTIVFPSGSRFDTMFSYKDMNKRREWVAHLQAGAGIVADSVPADEQRECENKAAALARA  600

Query  1859  IDLAESAFVK  1888
             IDLAES+F++
Sbjct  601   IDLAESSFIE  610



>ref|XP_006287339.1| hypothetical protein CARUB_v10000538mg [Capsella rubella]
 gb|EOA20237.1| hypothetical protein CARUB_v10000538mg [Capsella rubella]
Length=591

 Score =   804 bits (2076),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/599 (67%), Positives = 479/599 (80%), Gaps = 21/599 (4%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTR  292
             N+  MQ ++  +RL     L S + +T   S RSS YAPS       +KC       V+ 
Sbjct  6     NVATMQPLSFSRRLFLSRGLSSPVTVTGY-SGRSSAYAPSFS----SIKC-------VSV  53

Query  293   SPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFES  472
             SP +  S+  +  K ++ASK++NLIP+++CIFSDHLTPVLAYRCLV EDDRE PSFLFES
Sbjct  54    SPEA--SIVSDTKKLVDASKSTNLIPIYRCIFSDHLTPVLAYRCLVKEDDREAPSFLFES  111

Query  473   VEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEW  652
             VEPGS+ S+VGRYSVVGAQP MEI+AKENKV ++DH +  +TE+ VEDPM + R ISE+W
Sbjct  112   VEPGSQMSSVGRYSVVGAQPAMEIVAKENKVIVMDHKNETMTEEYVEDPMEIPRKISEKW  171

Query  653   KP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIV  826
              P  QL  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF+ AP+DDRNLPD+HLGLY++VIV
Sbjct  172   NPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNLPDMHLGLYEDVIV  231

Query  827   FDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREF  1006
             FDHV+KKA++IHW+R D      KAY  G + LE LV+ + D + P+L++ +V+  TR+F
Sbjct  232   FDHVEKKAYVIHWIRQDGSLPDEKAYSNGMQHLENLVAMLHDTERPKLAAGNVNLQTRQF  291

Query  1007  GPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPS  1186
             GP+L   N+T  EYK AV+KAKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+VNPS
Sbjct  292   GPTLTNSNVTCEEYKEAVVKAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRVVNPS  351

Query  1187  PYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKE  1366
             PYM Y+QARGCI+VASSPEILT+VK+N++VNRPLAGT+KRGK   ED  LE  LL +EK+
Sbjct  352   PYMGYLQARGCIMVASSPEILTKVKQNKIVNRPLAGTSKRGKDEVEDKRLEKELLENEKQ  411

Query  1367  RAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALR  1546
              AEH MLVDLGRNDVGKV+K GSV VE+LMNIERYSHVMHISSTVTGEL D LTCWD LR
Sbjct  412   CAEHIMLVDLGRNDVGKVAKYGSVKVEKLMNIERYSHVMHISSTVTGELQDDLTCWDTLR  471

Query  1547  AALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGM  1726
             AALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGG+SF GDMDIAL+LRTIVF     
Sbjct  472   AALPVGTVSGAPKVKAMELIDELEPTRRGPYSGGFGGVSFTGDMDIALSLRTIVFPTACQ  531

Query  1727  NDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
              +T+ S     +R+EW+A+LQ+GAG+VADS+P  E  EC+NK AGL+RAIDLAESAFVK
Sbjct  532   YNTMYSYKDANKRREWVAYLQAGAGVVADSDPQDEHCECQNKAAGLARAIDLAESAFVK  590



>ref|XP_010491108.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
[Camelina sativa]
Length=593

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/600 (67%), Positives = 482/600 (80%), Gaps = 21/600 (4%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLPPSHLISELPITSI-VSRRSSGYAPSLRVRTLQLKCSSSLQIPVT  289
             N+  MQ ++  +RL+P   L S   +T    S RSS Y PS R     +KC       V+
Sbjct  6     NVATMQPLSFSRRLVPFRGLSSSSSVTVTGYSGRSSAYPPSFR----SIKC-------VS  54

Query  290   RSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFE  469
              SP +  S+  +  K  +ASK++NLIP+++CIFSD LTPVLAYRCLV EDDRE PSFLFE
Sbjct  55    VSPEA--SIVSDTKKLGDASKSTNLIPIYRCIFSDQLTPVLAYRCLVKEDDREAPSFLFE  112

Query  470   SVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEE  649
             SVEPGS+ S+VGRYSV+GAQP MEI+AKE KVT++DH +  +TE+ VEDPM + R ISE+
Sbjct  113   SVEPGSQMSSVGRYSVIGAQPAMEIVAKETKVTVMDHKNETMTEEYVEDPMEIPRQISEK  172

Query  650   WKP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVI  823
             W P  QL  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF+ AP+DDRNLPD+HLGLYD+VI
Sbjct  173   WNPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNLPDMHLGLYDDVI  232

Query  824   VFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTRE  1003
             VFDHV+KKA++IHW+RL+      KAY  G + LE LV+K+ D++PP+L++ +V+  TR+
Sbjct  233   VFDHVEKKAYVIHWIRLNGSLPYEKAYSNGMQHLENLVAKLHDIEPPKLAAGNVNLQTRQ  292

Query  1004  FGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNP  1183
             FGP+L   N+T  EYK AV+KAKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+VNP
Sbjct  293   FGPTLTNSNVTCEEYKEAVVKAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRVVNP  352

Query  1184  SPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEK  1363
             SPYM Y+QARGCI+VASSPEILT+VK+N++VNRPLAGT+KRGK   ED  LE  LL +EK
Sbjct  353   SPYMGYLQARGCIMVASSPEILTKVKQNKIVNRPLAGTSKRGKNEVEDKRLEKELLENEK  412

Query  1364  ERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDAL  1543
             + AEH MLVDLGRNDVGKV+K GSV VE+LMNIERYSHVMHISSTVTGEL D LTCWD L
Sbjct  413   QCAEHIMLVDLGRNDVGKVAKYGSVKVEKLMNIERYSHVMHISSTVTGELQDDLTCWDTL  472

Query  1544  RAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDG  1723
             RAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGG+SF GDMDIAL+LRTIVF    
Sbjct  473   RAALPVGTVSGAPKVKAMELIDELEPTRRGPYSGGFGGVSFTGDMDIALSLRTIVFPTAC  532

Query  1724  MNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
               +T+ S     +R+EW+A+LQ+GAG+VADS+P  E  EC+NK AGL+RAIDLAESAFVK
Sbjct  533   QYNTMYSYKNANKRREWVAYLQAGAGVVADSDPQDELCECQNKAAGLARAIDLAESAFVK  592



>ref|XP_010095088.1| Anthranilate synthase component I-1 [Morus notabilis]
 gb|EXB58194.1| Anthranilate synthase component I-1 [Morus notabilis]
Length=581

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/582 (68%), Positives = 465/582 (80%), Gaps = 20/582 (3%)
 Frame = +2

Query  155   LPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPPSLDKEEAK  334
              P  H +  +P+T  + R  S  + +  V+   L+ SS               L  +  K
Sbjct  13    FPTRHRLRPVPVTGRLVRTLSSPSYARTVKCCSLRSSS---------------LIDDANK  57

Query  335   FIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYS  514
             F EA+K  NL+PL++CIFSD LTP+L YRCLV EDDRE PSFL ESVEP  R S+VGR+S
Sbjct  58    FSEAAKKGNLVPLYQCIFSDQLTPILVYRCLVREDDREAPSFLCESVEPNLRDSSVGRFS  117

Query  515   VVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCG  694
             VVGAQPTMEI+AKENKVTI+DH+ G +TE++VEDPM +   ISE W PQL  +LPDAFCG
Sbjct  118   VVGAQPTMEIVAKENKVTIMDHEEGLMTEEIVEDPMAIPARISEGWNPQLIDELPDAFCG  177

Query  695   GWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRL  874
             GW+GYFSYDTVRYVEK+K+PF+ AP+DDRNL DIH+GLYD+V VFDHV+KK + IHWVRL
Sbjct  178   GWLGYFSYDTVRYVEKRKVPFSKAPKDDRNLADIHVGLYDDVFVFDHVEKKVYAIHWVRL  237

Query  875   DSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKN  1054
             D YSS   AY++G K+LE+L++++Q  DPPRLS+  VD  TR FGP L   NMT+ E+  
Sbjct  238   DRYSSIEAAYKDGMKRLESLLARIQTADPPRLSAGYVDLYTRHFGPPLKNSNMTTEEFTK  297

Query  1055  AVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVAS  1234
             AV  AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALR+VNPSPYMTY+QARGCILVAS
Sbjct  298   AVRDAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMTYLQARGCILVAS  357

Query  1235  SPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvg  1414
             SPEILTRVKK +VVNRPLAGTA+RGKT +ED MLE  L+ +EKE AEH MLVDLGRNDVG
Sbjct  358   SPEILTRVKKRKVVNRPLAGTARRGKTTKEDKMLETQLITNEKECAEHIMLVDLGRNDVG  417

Query  1415  kvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKA  1594
             KVSK G+V VE+LMNIERYSHVMHISSTVTG+L D L+CWD LRAALPVGTVSGAPKVKA
Sbjct  418   KVSKDGTVKVEKLMNIERYSHVMHISSTVTGDLRDSLSCWDVLRAALPVGTVSGAPKVKA  477

Query  1595  MELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSR-----RKEW  1759
             MELID+LE +RRGPYSGGFGG+SF GDMDIALALRTIVF      DT+ S      R+EW
Sbjct  478   MELIDELEVSRRGPYSGGFGGVSFTGDMDIALALRTIVFPTGTRFDTMYSYKDAGGRREW  537

Query  1760  IAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             +A+LQ+GAG+VADS+PD+E +EC+NK AGL+RAIDLAESAFV
Sbjct  538   VAYLQAGAGVVADSDPDAEHRECQNKAAGLARAIDLAESAFV  579



>ref|XP_010256592.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic 
isoform X3 [Nelumbo nucifera]
Length=565

 Score =   800 bits (2067),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/527 (73%), Positives = 451/527 (86%), Gaps = 6/527 (1%)
 Frame = +2

Query  326   EAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVG  505
             + KF+EASKT+N++P+H+C+FSDHLTPVLAYRCLV+E D + PSF+F+S    S+SS +G
Sbjct  38    KTKFVEASKTANVVPMHRCLFSDHLTPVLAYRCLVEESDPQAPSFVFDSFGKDSQSSVLG  97

Query  506   RYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWK-PQLTADLPD  682
             RYSVVG QPTMEI+A+EN+VTIL+H  G+  E++VEDPM + R I + W+ PQL   LPD
Sbjct  98    RYSVVGYQPTMEIIAEENRVTILNHVEGRRVEELVEDPMVIPRRIMQGWRTPQLMDKLPD  157

Query  683   AFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIH  862
              FCGGWVGYFSYDTVRYVEKKKLPF+ AP+DDRNLPD+HLGLYD+VIVFDHV+KKAF+IH
Sbjct  158   TFCGGWVGYFSYDTVRYVEKKKLPFSRAPEDDRNLPDVHLGLYDDVIVFDHVEKKAFVIH  217

Query  863   WVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSG  1042
             WV LD YSS  +AY +G K+L+ LVSK+Q++DPPRLS+ S++ +T  FG SL   +MTS 
Sbjct  218   WVLLDRYSSVDEAYNDGMKRLQVLVSKIQNIDPPRLSAGSIELHTHHFGSSLKNSSMTSE  277

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
              YK AV++AKEHIL+GDIFQIVLSQRFERRT ADPFE+YRALR+VNPSPYM Y+QARGCI
Sbjct  278   AYKKAVVQAKEHILSGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMAYLQARGCI  337

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
             LVASSPEILTRVK+ ++ NRPLAGT +RG+T +ED +LE  LLNDEK+ AEH MLVDLGR
Sbjct  338   LVASSPEILTRVKQRKITNRPLAGTVRRGRTNKEDEILEEQLLNDEKQCAEHIMLVDLGR  397

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             NDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGELLD LTCWDALRAALPVGTVSGAP
Sbjct  398   NDVGKVSKFGSVKVEKLMNIERYSHVMHISSTVTGELLDDLTCWDALRAALPVGTVSGAP  457

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL-----SSR  1747
             KVKAMELIDQLE  RRGPYSGGFGGI F GDMDIALALRT+VF      DT+     S++
Sbjct  458   KVKAMELIDQLEVKRRGPYSGGFGGICFSGDMDIALALRTMVFPTGARYDTMYSYKDSNK  517

Query  1748  RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             R+EW+AHLQ+GAGIVADSNPD EQ+ECENK A L+RAIDLAES F++
Sbjct  518   RREWVAHLQAGAGIVADSNPDDEQRECENKAAALARAIDLAESTFIE  564



>ref|NP_001190231.1| anthranilate synthase component I-1 [Arabidopsis thaliana]
 gb|AED90916.1| anthranilate synthase component I-1 [Arabidopsis thaliana]
Length=624

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/631 (65%), Positives = 486/631 (77%), Gaps = 52/631 (8%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLP--PSHLISELPIT-SIVSRRSSGYAPSLRVRTLQLKCSSSLQIP  283
             N+  MQA+   +RLLP   S  +S   +T +  S RSS YAPS R     +KC       
Sbjct  6     NVATMQALTFSRRLLPSVASRYLSSSSVTVTGYSGRSSAYAPSFR----SIKC-------  54

Query  284   VTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFL  463
             V+ SP +  S+  +  K  +ASK++NLIP+++CIFSD LTPVLAYRCLV EDDRE PSFL
Sbjct  55    VSVSPEA--SIVSDTKKLADASKSTNLIPIYRCIFSDQLTPVLAYRCLVKEDDREAPSFL  112

Query  464   FESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSIS  643
             FESVEPGS+ S+VGRYSVVGAQP MEI+AKENKV ++DH++  +TE+ VEDPM + R IS
Sbjct  113   FESVEPGSQMSSVGRYSVVGAQPAMEIVAKENKVIVMDHNNETMTEEFVEDPMEIPRKIS  172

Query  644   EEWKP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDN  817
             E+W P  QL  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF+ AP+DDRNLPD+HLGLYD+
Sbjct  173   EKWNPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNLPDMHLGLYDD  232

Query  818   VIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNT  997
             V+VFDHV+KKA++IHW+RLD      KAY  G + LE LV+K+ D++PP+L++ +V+  T
Sbjct  233   VVVFDHVEKKAYVIHWIRLDGSLPYEKAYSNGMQHLENLVAKLHDIEPPKLAAGNVNLQT  292

Query  998   REFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIV  1177
             R+FGPSL   N+T  EYK AV+KAKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+V
Sbjct  293   RQFGPSLDNSNVTCEEYKEAVVKAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRVV  352

Query  1178  NPSPYMTYM-----------------------------QARGCILVASSPEILTRVKKNR  1270
             NPSPYM Y+                             QARGCILVASSPEILT+VK+N+
Sbjct  353   NPSPYMGYLQVGDGENISQQLCILYLWINHQCCFRSVIQARGCILVASSPEILTKVKQNK  412

Query  1271  VVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVER  1450
             +VNRPLAGT+KRGK   ED  LE  LL +EK+ AEH MLVDLGRNDVGKV+K GSV VE+
Sbjct  413   IVNRPLAGTSKRGKNEVEDKRLEKELLENEKQCAEHIMLVDLGRNDVGKVTKYGSVKVEK  472

Query  1451  LMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRR  1630
             LMNIERYSHVMHISSTVTGEL D LTCWD LRAALPVGTVSGAPKVKAMELID+LE TRR
Sbjct  473   LMNIERYSHVMHISSTVTGELQDGLTCWDVLRAALPVGTVSGAPKVKAMELIDELEPTRR  532

Query  1631  GPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVA  1795
             GPYSGGFGG+SF GDMDIAL+LRTIVF      +T+ S     +R+EW+A+LQ+GAG+VA
Sbjct  533   GPYSGGFGGVSFTGDMDIALSLRTIVFPTACQYNTMYSYKDANKRREWVAYLQAGAGVVA  592

Query  1796  DSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             DS+P  E  EC+NK AGL+RAIDLAESAFVK
Sbjct  593   DSDPQDEHCECQNKAAGLARAIDLAESAFVK  623



>emb|CDP14042.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/541 (76%), Positives = 462/541 (85%), Gaps = 7/541 (1%)
 Frame = +2

Query  302   SPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEP  481
             S P  DK+  +F+EAS+  N+IPL++CIFSDHLTPVLAYRCLV EDDRE PSFLFESVEP
Sbjct  59    SSPVTDKK--RFMEASRHGNVIPLYQCIFSDHLTPVLAYRCLVKEDDREAPSFLFESVEP  116

Query  482   GSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQ  661
             G R+S VGRYSVVGAQP +EI+AKEN VTILDH  GKL E VVEDPMT+ R ISE WKPQ
Sbjct  117   GFRTSHVGRYSVVGAQPAVEIVAKENDVTILDHYKGKLKEIVVEDPMTIPREISESWKPQ  176

Query  662   LTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVD  841
             L ++LPD FCGGWVGYFSYDTVRY+EKKKLPF+ AP+DDR+L DIHLGLYD+VIVFDHV+
Sbjct  177   LISELPDTFCGGWVGYFSYDTVRYLEKKKLPFSQAPRDDRSLADIHLGLYDDVIVFDHVE  236

Query  842   KKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLA  1021
             KKA++IHWV+LD Y S  KAY  G K+LE L+SKVQ++DPP LS+ SV+  T  FG SL 
Sbjct  237   KKAYVIHWVQLDQYPSREKAYTSGMKRLERLMSKVQNIDPPMLSAGSVELWTNNFGLSLN  296

Query  1022  KGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTY  1201
             K NMT  EYK AV++AKEHILAGDIFQIVLSQRFE+RT ADPFEVYRALR++NPSPYM Y
Sbjct  297   KSNMTREEYKKAVIQAKEHILAGDIFQIVLSQRFEKRTFADPFEVYRALRVINPSPYMAY  356

Query  1202  MQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHT  1381
             +QARG I VASSPEILTRVKK RVVNRPLAGT +RGKTP ED M E+ LL D+K+ AEH 
Sbjct  357   LQARGSIHVASSPEILTRVKKKRVVNRPLAGTTRRGKTPHEDEMQELQLLKDKKQCAEHI  416

Query  1382  MLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPV  1561
             MLVDLGRNDVGKVSK GSVNVE+LM +ERYSHVMHISSTVTGELLDHLTCWDALRAALPV
Sbjct  417   MLVDLGRNDVGKVSKPGSVNVEKLMTVERYSHVMHISSTVTGELLDHLTCWDALRAALPV  476

Query  1562  GTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL-  1738
             GTVSGAPKVKAMELIDQLE  RRGPYSGGFGGISF GDMDIALALRTIVF      DT+ 
Sbjct  477   GTVSGAPKVKAMELIDQLEVARRGPYSGGFGGISFSGDMDIALALRTIVFPTGVRYDTMY  536

Query  1739  ----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKTKRKPQ  1906
                 S++R+EW+AHLQ+GAGIVADS P+ EQ ECENKVAGL+RAI+LAESAFV  +++ +
Sbjct  537   SYQGSNKRQEWVAHLQAGAGIVADSTPEDEQMECENKVAGLARAIELAESAFVDREQEIK  596

Query  1907  P  1909
             P
Sbjct  597   P  597



>gb|AFL91701.1| anthranilate synthase alpha-subunit 2 [Mitragyna speciosa]
Length=575

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/537 (75%), Positives = 459/537 (85%), Gaps = 5/537 (1%)
 Frame = +2

Query  293   SPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFES  472
             S  SPPSL  + AKF EA+K  NLIPL++ IFSDHLTPVLAYRCLV EDDRE PSFLFES
Sbjct  38    STVSPPSLVDQSAKFKEAAKHGNLIPLYRPIFSDHLTPVLAYRCLVKEDDREAPSFLFES  97

Query  473   VEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEW  652
             VEPG ++S++GRYSV+GAQPTMEI+AKEN VTI+DH  G+  E+  EDPM + R I E+W
Sbjct  98    VEPGLKASSLGRYSVIGAQPTMEIIAKENMVTIMDHHQGRRVEQFEEDPMLIPRRIMEKW  157

Query  653   KPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFD  832
             KPQ   +LP AFCGGWVGYFSYDTVRYVEKKKLPF++AP DDRNLPD+HLGLYD+VIVFD
Sbjct  158   KPQRIEELPAAFCGGWVGYFSYDTVRYVEKKKLPFSNAPIDDRNLPDVHLGLYDDVIVFD  217

Query  833   HVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGP  1012
             HV+KKA++IHWVRLD +SS  +AY +G  +LE+LVS+V D+ PPRL++ S++  T  FGP
Sbjct  218   HVEKKAYLIHWVRLDEFSSVEEAYNDGINRLESLVSRVHDIVPPRLAAGSINLYTSLFGP  277

Query  1013  SLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPY  1192
             SL K  MTS +Y+ AVL+AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPY
Sbjct  278   SLKKSTMTSEDYEKAVLQAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPY  337

Query  1193  MTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERA  1372
             MTY+QARGCILVASSPEILTRVKK  + NRPLAGT +RGKTP+ED MLE  LL+DEK+ A
Sbjct  338   MTYLQARGCILVASSPEILTRVKKGTITNRPLAGTTRRGKTPKEDYMLETQLLHDEKQCA  397

Query  1373  EHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAA  1552
             EH MLVDLGRNDVGKVSK GSVNVE+LMNIERYSHV HISSTVTGELLDHLT WD LRAA
Sbjct  398   EHIMLVDLGRNDVGKVSKPGSVNVEKLMNIERYSHVTHISSTVTGELLDHLTSWDVLRAA  457

Query  1553  LPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMND  1732
             LPVGTVSGAPKVKAMELIDQLE TRRGPYSGGFGGISF GDMD+ALALRTIVF      D
Sbjct  458   LPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGFGGISFSGDMDVALALRTIVFPTGTRYD  517

Query  1733  TLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             T+ S     +R+EWIAHLQSGAGIVADS+P  EQ+EC+NK A L+RAIDLAES+FV+
Sbjct  518   TMYSYKDEIKRREWIAHLQSGAGIVADSDPSDEQRECQNKAAALARAIDLAESSFVE  574



>gb|KFK23180.1| hypothetical protein AALP_AAs58904U000100 [Arabis alpina]
Length=628

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/572 (69%), Positives = 464/572 (81%), Gaps = 18/572 (3%)
 Frame = +2

Query  200   VSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPPSLD---KEEAKFIEASKTSNLIP  370
             +SR       +L  R   +KCSSS          S PSLD    +  KF EA+   NL+P
Sbjct  55    ISRSKVLRVCNLTSRLRSIKCSSS----------STPSLDLLDDQLTKFKEAAGKGNLVP  104

Query  371   LHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILA  550
             L++C+FSDHLTP+LAYRCLV EDDR+ PSFLFESVEPG ++S +GRYSVVGAQPT+EI+A
Sbjct  105   LYRCVFSDHLTPILAYRCLVKEDDRDAPSFLFESVEPGLQASNIGRYSVVGAQPTIEIVA  164

Query  551   KENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVR  730
             K N VT++DH +G+ TE+ VEDPM V + I EEWKPQ   +LP+AFCGGWVGYFSYDTVR
Sbjct  165   KGNVVTVMDHGAGRKTEEEVEDPMVVPQKIMEEWKPQRIDELPEAFCGGWVGYFSYDTVR  224

Query  731   YVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYRE  910
             YVEKKKLPF++AP+DDR LPD+HLGLYD+VIVFDHV+KKA++IHWVR+D   S    + +
Sbjct  225   YVEKKKLPFSNAPEDDRGLPDLHLGLYDDVIVFDHVEKKAYVIHWVRIDKDRSVEDNFTD  284

Query  911   GKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAG  1090
             G  QLE+LVS++QD  PP++ +  +   T+ FGP L K NMTS  YK AVL+AKEHILAG
Sbjct  285   GMDQLESLVSRIQDQKPPKMPTGFIKLRTQLFGPKLEKSNMTSEAYKKAVLEAKEHILAG  344

Query  1091  DIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNR  1270
             DIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYM Y+QARGCILVASSPEIL R KK +
Sbjct  345   DIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMAYLQARGCILVASSPEILLRSKKRK  404

Query  1271  VVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVER  1450
             + NRPLAGT +RGKTP+ED+MLE  LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+
Sbjct  405   ITNRPLAGTVRRGKTPKEDLMLEKELLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVEVEK  464

Query  1451  LMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRR  1630
             LMNIE YSHVMHISSTVTGELLD LT WDALRAALPVGTVSGAPKVKAMELID+LE  RR
Sbjct  465   LMNIEWYSHVMHISSTVTGELLDDLTSWDALRAALPVGTVSGAPKVKAMELIDELEVMRR  524

Query  1631  GPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVA  1795
             GPYSGGFGGISF GDMDIAL+LRT+VF  +   DTL S     RR+EWIAH+Q+GAG+VA
Sbjct  525   GPYSGGFGGISFNGDMDIALSLRTMVFPTNARYDTLYSYKHPQRRREWIAHIQAGAGVVA  584

Query  1796  DSNPDSEQKECENKVAGLSRAIDLAESAFVKT  1891
             DSNPD EQ+ECENK A L+RAIDLAES+F++T
Sbjct  585   DSNPDDEQRECENKAAALARAIDLAESSFLET  616



>gb|AGJ70266.1| anthranilate synthase A [Vitis vinifera]
Length=608

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/535 (75%), Positives = 460/535 (86%), Gaps = 5/535 (1%)
 Frame = +2

Query  299   YSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVE  478
             +S PSL    AKF EA+K  NLIPL++ IFSDHLTPVLAYRCLV EDDR+ PSFLFESVE
Sbjct  73    HSSPSLVDHSAKFFEAAKKGNLIPLYRSIFSDHLTPVLAYRCLVKEDDRDAPSFLFESVE  132

Query  479   PGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKP  658
             PG +SS VGRYSV+GAQPT+EI+AKEN VTI+DH++G  TE++VEDPM++ R + E  KP
Sbjct  133   PGFQSSNVGRYSVIGAQPTIEIVAKENMVTIMDHEAGSRTEEIVEDPMSIPRRMMEGRKP  192

Query  659   QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHV  838
             QL  +LP+AFCGGWVGYFSYDTVRYVEKKKLPF SAP+DDRNLPD+HLGLY++V+VFDHV
Sbjct  193   QLLDELPEAFCGGWVGYFSYDTVRYVEKKKLPFLSAPKDDRNLPDVHLGLYEDVLVFDHV  252

Query  839   DKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSL  1018
              K+ F+IHWVRLD YSS  +A+ +G  +LEALVS+V D+ PP+L++ S+   T  FGPSL
Sbjct  253   KKQVFVIHWVRLDQYSSVEEAFNDGMNRLEALVSRVHDIVPPKLAAGSIKLQTGLFGPSL  312

Query  1019  AKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMT  1198
              K  MT  EY  AVL+AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMT
Sbjct  313   EKSTMTCDEYMKAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMT  372

Query  1199  YMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEH  1378
             Y+QARGCILVASSPEILTRVKKN+++NRPLAGT +RGKTP+ED+MLE  L NDEK+ AEH
Sbjct  373   YLQARGCILVASSPEILTRVKKNKIINRPLAGTVRRGKTPKEDIMLENQLRNDEKQCAEH  432

Query  1379  TMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALP  1558
              MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGELLDHLT WDALRAALP
Sbjct  433   IMLVDLGRNDVGKVSKPGSVTVEKLMNIERYSHVMHISSTVTGELLDHLTSWDALRAALP  492

Query  1559  VGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL  1738
             VGTVSGAPKVKAMELIDQLE TRRGPYSGGFGGISF GDMDIALALRTIVF +    DT+
Sbjct  493   VGTVSGAPKVKAMELIDQLEVTRRGPYSGGFGGISFSGDMDIALALRTIVFPSGSRFDTM  552

Query  1739  SS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
              S     +R+EW+AHLQ+GAGIVADS P  EQ+ECENK A L+RAIDLAES+F++
Sbjct  553   FSYKDMNKRREWVAHLQAGAGIVADSVPADEQRECENKAAALARAIDLAESSFIE  607



>emb|CBI15979.3| unnamed protein product [Vitis vinifera]
Length=589

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/602 (69%), Positives = 478/602 (79%), Gaps = 28/602 (5%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPI--------TSIV---SRRSSGYAPSLRVRT---LQLKC  262
             M+ +A   RLLP +      P         T++V    R  +G + + R  T   L L  
Sbjct  1     METLAASHRLLPANRRFDAAPTCGNSNCRATNVVFGNGRGLNGVSDNGRALTSGSLALVS  60

Query  263   SSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDD  442
             S      V    +S PSL    AKF EA+K  NLIPLH+ IFSDHLTPVLAYRCLV EDD
Sbjct  61    SGRRWHAVACLSHSSPSLVDHSAKFFEAAKKGNLIPLHRSIFSDHLTPVLAYRCLVKEDD  120

Query  443   RETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPM  622
             R+ PSFL+ESVEPG +SS VGRYSV+GAQPT+EI+AKEN VTI+DH++G  TE++VEDPM
Sbjct  121   RDAPSFLYESVEPGIQSSNVGRYSVIGAQPTIEIVAKENMVTIMDHEAGSRTEEIVEDPM  180

Query  623   TVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHL  802
             ++ R + E WKPQL  +LP+AFCGGWVGYFSYDTVRYVEKKKLPF SAP+DDRNLPD+HL
Sbjct  181   SIPRRMMEGWKPQLLDELPEAFCGGWVGYFSYDTVRYVEKKKLPFLSAPKDDRNLPDVHL  240

Query  803   GLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSAS  982
             GLY++V+VFDHV K+ F+IHWVRLD YSS  +A+ +G  +LEALVS+V D+ PP+L++ S
Sbjct  241   GLYEDVLVFDHVKKQVFVIHWVRLDQYSSVEEAFNDGMNRLEALVSRVHDIVPPKLAAGS  300

Query  983   VDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYR  1162
             +   T  FGPSL K  MT  EY  AVL+AKEHILAGDIFQIVLSQRFERRT ADPFEVYR
Sbjct  301   IKLQTGLFGPSLEKSTMTCDEYMKAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEVYR  360

Query  1163  ALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEM  1342
             ALRIVNPSPYMTY+QARGCILVASSPEILTRVKKNR++NRPLAGT +RGKTP+ED+MLE 
Sbjct  361   ALRIVNPSPYMTYLQARGCILVASSPEILTRVKKNRIINRPLAGTVRRGKTPKEDIMLEN  420

Query  1343  LLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDH  1522
              L NDEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGELLDH
Sbjct  421   QLRNDEKQCAEHIMLVDLGRNDVGKVSKPGSVTVEKLMNIERYSHVMHISSTVTGELLDH  480

Query  1523  LTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRT  1702
             LT WDALRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGGFGGISF GDMDIALALRT
Sbjct  481   LTSWDALRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGFGGISFSGDMDIALALRT  540

Query  1703  IVFLNDGMNDTLSSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
             I              R+EW+AHLQ+GAGIVADS P  EQ+ECENK A L+RAIDLAES+F
Sbjct  541   I--------------RREWVAHLQAGAGIVADSVPADEQRECENKAAALARAIDLAESSF  586

Query  1883  VK  1888
             ++
Sbjct  587   IE  588



>gb|AAA74900.1| anthranilate synthase alpha subunit [Ruta graveolens]
Length=608

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/558 (73%), Positives = 470/558 (84%), Gaps = 5/558 (1%)
 Frame = +2

Query  230   SLRVRTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPV  409
             S R+RTL+   S+S     + SP   PSL  + A F EASK  NLIPL++CIFSDHLTPV
Sbjct  50    SYRLRTLKCAASASTSASTSASPSPSPSLVDQSANFHEASKKGNLIPLYRCIFSDHLTPV  109

Query  410   LAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSG  589
             LAYRCLV EDDR+ PSFLFESVEPGS++S++GRYSVVGAQP +EI+AKEN VTILDH+ G
Sbjct  110   LAYRCLVKEDDRDAPSFLFESVEPGSQASSIGRYSVVGAQPAIEIVAKENMVTILDHEGG  169

Query  590   KLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAP  769
             + TE+ VEDPM V R I E WKPQL  +LP+AFCGGWVGYFSYDTVRYVEKKKLPF SAP
Sbjct  170   QRTEQFVEDPMDVPRRIMEGWKPQLIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFFSAP  229

Query  770   QDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQ  949
              DDRNLPD+HLGLYD+VIVFDHV+KKAF+IHWVRLD YSS ++AY +G  +LE LVS+V 
Sbjct  230   TDDRNLPDVHLGLYDDVIVFDHVEKKAFVIHWVRLDQYSSVAEAYNDGMNRLENLVSRVH  289

Query  950   DVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFER  1129
             D+ PP+L S S+  +TR FGP L + +MTS  YK AVL+AKEHILAGDIFQIVLSQRFER
Sbjct  290   DIVPPKLRSGSIKLHTRHFGPKLERSSMTSEAYKEAVLEAKEHILAGDIFQIVLSQRFER  349

Query  1130  RTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRG  1309
             RT ADPFE+YR+LRIVNPSPYMTY+QARGCILVASSPEILTRVKK ++ NRPLAGT +RG
Sbjct  350   RTFADPFEIYRSLRIVNPSPYMTYLQARGCILVASSPEILTRVKKRKITNRPLAGTIRRG  409

Query  1310  KTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHI  1489
             KT +ED++ E  LLNDEK+ AEH MLVDLGRNDVGKVS+ GSV VE+LMNIE YSHVMHI
Sbjct  410   KTRKEDLVFEKELLNDEKQCAEHIMLVDLGRNDVGKVSEPGSVKVEKLMNIEHYSHVMHI  469

Query  1490  SSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFV  1669
             SSTVTGELLDHLT WDALRAALPVGTVSGAPKVKAME+ID+LE TRRGPY GGFGGISF 
Sbjct  470   SSTVTGELLDHLTSWDALRAALPVGTVSGAPKVKAMEIIDKLEVTRRGPYGGGFGGISFT  529

Query  1670  GDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECEN  1834
             GD+DIALALRT+VF      DT+ S     +R+EWIAHLQ+GAGIVADS+P  EQ+ECEN
Sbjct  530   GDLDIALALRTMVFQTATRYDTMYSYKDVDKRREWIAHLQAGAGIVADSDPADEQRECEN  589

Query  1835  KVAGLSRAIDLAESAFVK  1888
             K A L+RAIDLAES+F++
Sbjct  590   KAAALARAIDLAESSFIE  607



>gb|AGJ70267.1| anthranilate synthase A [Vitis labrusca]
Length=611

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/610 (69%), Positives = 484/610 (79%), Gaps = 22/610 (4%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPI--------TSIV---SRRSSGYAPSLRVRT---LQLKC  262
             M+ +A   RLLP +      P         T++V    R  +G + + R  T   L L  
Sbjct  1     METLAASHRLLPANRRFDAAPTCGNSNCRATNVVFGNGRGLNGVSDNGRALTSGSLALVS  60

Query  263   SSSLQIPVTRSPYSPPSL---DKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVD  433
             S           +S PSL       AKF EA+K  NLIPLH+ IFSDHLTPVLAYRCLV 
Sbjct  61    SGRRWHAAACLSHSSPSLVFAADHSAKFFEAAKKGNLIPLHRSIFSDHLTPVLAYRCLVK  120

Query  434   EDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVE  613
             EDDR+ PSFL+ESVEPG +SS VGRYSV+GAQPT+EI+AKEN VTI+DH++G  TE++VE
Sbjct  121   EDDRDAPSFLYESVEPGFQSSNVGRYSVIGAQPTIEIVAKENMVTIMDHEAGSRTEEIVE  180

Query  614   DPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPD  793
             DPM++ R + E WKPQL  +LP+AFCGGWVGYFSYDTVRYVEKKKLPF SAP+DDRNLPD
Sbjct  181   DPMSIPRRMMEGWKPQLLDELPEAFCGGWVGYFSYDTVRYVEKKKLPFLSAPKDDRNLPD  240

Query  794   IHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLS  973
             +HLGLY++V+VFDHV K+ F+IHWVRLD YSS  +A+ +G  +LEALVS+V D+ PP+L+
Sbjct  241   VHLGLYEDVLVFDHVKKQVFVIHWVRLDQYSSVEEAFNDGMNRLEALVSRVHDIVPPKLA  300

Query  974   SASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFE  1153
             + S+   T  FGPSL K  MT  EY  AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE
Sbjct  301   AGSIKLQTGLFGPSLEKSTMTCDEYMKAVLEAKEHILAGDIFQIVLSQRFERRTFADPFE  360

Query  1154  VYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVM  1333
             VYRALRIVNPSPYMTY+QARGCILVASSPEILTRVKKN+++NRPLAGT +RGKTP+ED+M
Sbjct  361   VYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKNKIINRPLAGTVRRGKTPKEDLM  420

Query  1334  LEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGEL  1513
             LE  L NDEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGEL
Sbjct  421   LENQLRNDEKQCAEHIMLVDLGRNDVGKVSKPGSVTVEKLMNIERYSHVMHISSTVTGEL  480

Query  1514  LDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALA  1693
             LDHLT WDALRA LPVGTVSGAPKVKAMELIDQLE TRRGPYSGGFGGISF GDMDIALA
Sbjct  481   LDHLTSWDALRATLPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGFGGISFSGDMDIALA  540

Query  1694  LRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRA  1858
             LRTIVF +    DT+ S     +R+EW+AHLQ+GAGIVADS P  EQ+ECENK A L+RA
Sbjct  541   LRTIVFPSGSRFDTMFSYKDMNKRREWVAHLQAGAGIVADSVPADEQRECENKAAALARA  600

Query  1859  IDLAESAFVK  1888
             IDLAES+F++
Sbjct  601   IDLAESSFIE  610



>gb|EPS68997.1| anthranilate synthase alpha 1, partial [Genlisea aurea]
Length=528

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/527 (74%), Positives = 445/527 (84%), Gaps = 5/527 (1%)
 Frame = +2

Query  323   EEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTV  502
             +E KF+EAS+  N++PL+KCIF DHLTPVLAYRCLV+EDDRE PSFLFESVEPG R+STV
Sbjct  1     DEKKFVEASRNGNVVPLYKCIFCDHLTPVLAYRCLVNEDDREAPSFLFESVEPGFRASTV  60

Query  503   GRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPD  682
             GRYSVVGA P ME++AKENKVTILDHDSGK+TEK +EDPM + RSISE WKPQL  DLP 
Sbjct  61    GRYSVVGAHPAMEVVAKENKVTILDHDSGKITEKTMEDPMLIPRSISETWKPQLLQDLPH  120

Query  683   AFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIH  862
             AFCGGWVG+FSYDTVRYVEKKKLPF+ AP+DDR+L D+HLGLYD+V++FDHV+KKA+ IH
Sbjct  121   AFCGGWVGFFSYDTVRYVEKKKLPFSKAPKDDRDLVDMHLGLYDDVVIFDHVEKKAYAIH  180

Query  863   WVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSG  1042
             WVRLD Y+SA  AY++G K+L+ LVSK+QD +   L   ++DF T++ G SL K NMT+ 
Sbjct  181   WVRLDKYTSAKTAYQDGMKRLQTLVSKLQDRNRMWLCPGNIDFCTQDVGHSLNKANMTNE  240

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
             EY   V++AK+HI+AGDIFQIVLSQRFERRT ADPF+VYRALR+VNPSPYM Y+QARGCI
Sbjct  241   EYMRVVVQAKQHIVAGDIFQIVLSQRFERRTFADPFQVYRALRVVNPSPYMAYLQARGCI  300

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
             LV+SSPEILTRV  N VVNRPLAGTA+RG T  ED M+E  LL DEK+ AEH MLVDLGR
Sbjct  301   LVSSSPEILTRVTNNNVVNRPLAGTARRGMTSHEDEMIESNLLIDEKQCAEHLMLVDLGR  360

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             NDVGKV+K GSV VE+LM +ERYSHVMHISSTVTGEL DHL  WDALRA LPVGTVSGAP
Sbjct  361   NDVGKVTKPGSVKVEKLMTVERYSHVMHISSTVTGELNDHLNAWDALRATLPVGTVSGAP  420

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----R  1747
             KVKAMELID+ E TRRGPYSGGFGGISF GDMDIALALRTIVF  +   DT+ S     +
Sbjct  421   KVKAMELIDEFEPTRRGPYSGGFGGISFQGDMDIALALRTIVFPTNVRYDTIYSYRDGHK  480

Query  1748  RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             R+EWIAHLQ+GAGIVADS P  E  ECE K A LSRAIDLAESAF+K
Sbjct  481   RREWIAHLQTGAGIVADSEPHEELIECERKAAALSRAIDLAESAFIK  527



>ref|XP_010504458.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=594

 Score =   798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/550 (73%), Positives = 445/550 (81%), Gaps = 15/550 (3%)
 Frame = +2

Query  254   LKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVD  433
             +KC S L  P      SP S   E  KF E SK  NL+PL   IFSDHLTPVLAYRCLV 
Sbjct  48    IKCGSILSCP------SPSS---EAMKFAEGSKKENLVPLRHTIFSDHLTPVLAYRCLVK  98

Query  434   EDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVE  613
             EDD+ETPSFLFESVEPG  SSTVGRYSVVGA P MEI+AKENKVT++DH  G LT + V 
Sbjct  99    EDDQETPSFLFESVEPGHHSSTVGRYSVVGAHPKMEIVAKENKVTVMDHVKGTLTTEEVA  158

Query  614   DPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPD  793
             DPM + R ISE WKPQL  DLPDAFCGGWVGYFSYDTVRY E +KLPF+ AP DDRNLPD
Sbjct  159   DPMMIPRRISETWKPQLIDDLPDAFCGGWVGYFSYDTVRYAEMRKLPFSKAPVDDRNLPD  218

Query  794   IHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLS  973
             +HLGLYD+VIVFDHV+KK  IIHWVRL    S    Y  G K LE LVS+++ ++PP+L 
Sbjct  219   MHLGLYDDVIVFDHVEKKMHIIHWVRLSGNCSFDDVYANGVKHLEELVSRIKCINPPKLP  278

Query  974   SASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFE  1153
               SVD +T +FG  L K +MTS EYKNAVL+AKEHILAGDIFQIVLSQRFERRT A PFE
Sbjct  279   YGSVDLHTNQFGTPLEKSSMTSDEYKNAVLEAKEHILAGDIFQIVLSQRFERRTFAHPFE  338

Query  1154  VYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVM  1333
             VYRALRIVNPSP M Y+QARGCILVASSPEILTRVKKN++VNRPLAGTA+RGKT EED M
Sbjct  339   VYRALRIVNPSPSMCYLQARGCILVASSPEILTRVKKNKIVNRPLAGTARRGKTFEEDQM  398

Query  1334  LEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGEL  1513
             LE  LL DEK+ AEH MLVDLGRNDVGKVSK+GSV VER MNIERYSHVMHISSTVTGEL
Sbjct  399   LEETLLKDEKQCAEHIMLVDLGRNDVGKVSKNGSVKVERFMNIERYSHVMHISSTVTGEL  458

Query  1514  LDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALA  1693
              ++LTCWD LRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFG +SF GDMDIALA
Sbjct  459   QENLTCWDTLRAALPVGTVSGAPKVKAMELIDELEVTRRGPYSGGFGSVSFTGDMDIALA  518

Query  1694  LRTIVFLNDGMNDTLSSR------RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSR  1855
             LRTIVF      DT+ S       R+EWIA+LQ+GAGIVADS+P+ E +EC+NK AGL+R
Sbjct  519   LRTIVFPTQARYDTMYSYKGSDTPRREWIAYLQTGAGIVADSDPEDEHRECQNKAAGLAR  578

Query  1856  AIDLAESAFV  1885
             AIDLAESAFV
Sbjct  579   AIDLAESAFV  588



>emb|CDX83311.1| BnaA03g21950D [Brassica napus]
Length=629

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/558 (70%), Positives = 460/558 (82%), Gaps = 10/558 (2%)
 Frame = +2

Query  281   PVTRSPYSPPSLDKEE-----AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDR  445
             P+  SP   PSL  +      AKF EA++  NL+PL++C+FSDHLTP+LAYRCLV EDDR
Sbjct  68    PIKSSPSPTPSLAADSSANQLAKFKEAAEKGNLVPLYRCVFSDHLTPILAYRCLVKEDDR  127

Query  446   ETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMT  625
             + PSFLFESVEPG ++S +GRYSVVGAQPT+EI+AK N VT++DH +G+ T + V+DPM 
Sbjct  128   DAPSFLFESVEPGLQASNIGRYSVVGAQPTIEIVAKGNVVTVMDHGAGRRTVEEVDDPMV  187

Query  626   VARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLG  805
             V + I EEW+PQ   +LP+AFCGGWVGYFSYDTVRYVEKKKLPF++AP+DDR+LPD+HLG
Sbjct  188   VPQKIMEEWEPQRIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSNAPEDDRSLPDVHLG  247

Query  806   LYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASV  985
             LYD+VIVFDHV+KKA++IHWVR+D   S    Y +G  QLE+LVS++QD  PP++ +  +
Sbjct  248   LYDDVIVFDHVEKKAYVIHWVRIDKDRSVEDNYSDGMYQLESLVSRIQDQKPPKMPTGFI  307

Query  986   DFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRA  1165
                T +FGP L K  MTS  YK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRA
Sbjct  308   KLRTEQFGPKLEKSTMTSEAYKEAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEIYRA  367

Query  1166  LRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEML  1345
             LRIVNPSPYM Y+QARGCILVASSPEIL R K  ++ NRPLAGT +RGKTP+ED+MLE  
Sbjct  368   LRIVNPSPYMAYLQARGCILVASSPEILLRSKNRKITNRPLAGTVRRGKTPKEDLMLEKE  427

Query  1346  LLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHL  1525
             LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTV GELLD L
Sbjct  428   LLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVEVEKLMNIERYSHVMHISSTVKGELLDDL  487

Query  1526  TCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTI  1705
             T WDALRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF GDMDIALALRT+
Sbjct  488   TSWDALRAALPVGTVSGAPKVKAMELIDKLEVTRRGPYSGGFGGISFNGDMDIALALRTM  547

Query  1706  VFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLA  1870
             VF  +   DTL S     RR+EWIAH+Q+GAG+VADSNP+ EQ+ECENK A L+RAIDLA
Sbjct  548   VFPTNTRYDTLYSYKHPQRRREWIAHIQAGAGVVADSNPEDEQRECENKAAALARAIDLA  607

Query  1871  ESAFVKTKRKPQPPPAVH  1924
             ES+F++T    +P P ++
Sbjct  608   ESSFLETPEVTRPRPRIN  625



>ref|XP_008442227.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
[Cucumis melo]
Length=586

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/529 (77%), Positives = 454/529 (86%), Gaps = 6/529 (1%)
 Frame = +2

Query  314   LDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRS  493
             +D  EA FIEASK  NLIPLH+CIFSDHL+PVLAYRCLV EDDRE PSFLFESVEPG + 
Sbjct  57    VDSPEA-FIEASKKGNLIPLHRCIFSDHLSPVLAYRCLVKEDDREAPSFLFESVEPGLQV  115

Query  494   STVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTAD  673
             S VGRYSVVGAQP++EILAKEN VTIL+H+ GK TE++VEDPMTV R I E+WKPQL  +
Sbjct  116   SNVGRYSVVGAQPSIEILAKENVVTILNHEEGKRTEEIVEDPMTVPRRIMEKWKPQLIDE  175

Query  674   LPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAF  853
             LPDAFCGGWVGYFSYDTVRYVEKKKLPF+SAP DDRNLPD+HLGLYD+VIVFDHV+K+A+
Sbjct  176   LPDAFCGGWVGYFSYDTVRYVEKKKLPFSSAPTDDRNLPDVHLGLYDDVIVFDHVNKQAY  235

Query  854   IIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNM  1033
             +IHWV LD YSS  +AY++G  +LE L+S+V D+ PP+L + S+   T  FGP L   +M
Sbjct  236   VIHWVHLDQYSSVQEAYKDGTARLEKLLSRVHDIVPPKLPAGSIRLLTHLFGPKLKMSSM  295

Query  1034  TSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQAR  1213
             TS EYK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+QAR
Sbjct  296   TSLEYKKAVLQAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYLQAR  355

Query  1214  GCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVD  1393
             GCILVASSPEILTRVKK ++ NRPLAGT +RGKT +ED MLE  LLND K+ AEH MLVD
Sbjct  356   GCILVASSPEILTRVKKGKITNRPLAGTIRRGKTEKEDKMLEKELLNDAKQCAEHIMLVD  415

Query  1394  LGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVS  1573
             LGRNDVGKVS+SGSV VE+LMNIERYSHVMHISSTVTGEL+D L  WD LRAALPVGTVS
Sbjct  416   LGRNDVGKVSRSGSVKVEKLMNIERYSHVMHISSTVTGELVDDLNSWDVLRAALPVGTVS  475

Query  1574  GAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS---  1744
             GAPKVKAMELIDQLE TRRGPYSGGFGGISF GDMDIALALRTIVF  +   DT+ S   
Sbjct  476   GAPKVKAMELIDQLEVTRRGPYSGGFGGISFSGDMDIALALRTIVFPTNTRYDTIYSYKD  535

Query  1745  --RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
               RR EW+AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAES+F+
Sbjct  536   ANRRMEWVAHLQAGAGIVADSDPGDEQRECENKAAALARAIDLAESSFI  584



>ref|XP_003600871.1| Anthranilate synthase alpha [Medicago truncatula]
 gb|AES71122.1| anthranilate synthase alpha 1 [Medicago truncatula]
Length=602

 Score =   797 bits (2058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/526 (73%), Positives = 447/526 (85%), Gaps = 5/526 (1%)
 Frame = +2

Query  323   EEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTV  502
             E  KFIEASK  NLIP+++CIFSD LTPVLAYR LV+EDDRE PSFLFES EP  + S V
Sbjct  75    ERKKFIEASKNGNLIPIYQCIFSDQLTPVLAYRSLVNEDDREAPSFLFESAEPNFQGSNV  134

Query  503   GRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPD  682
             GRYSVVGAQP MEI+AKENKVT+++H+SG+LTE++V+DPM + R IS++W+P L  +LPD
Sbjct  135   GRYSVVGAQPIMEIVAKENKVTVMNHESGQLTEEIVDDPMEIPRKISQDWRPCLNDELPD  194

Query  683   AFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIH  862
             AFCGGW GYFSYDTVRYVEKKKLPF+ +P+DDR L DIHLGLY+ VIVFDHV+KKA++I 
Sbjct  195   AFCGGWAGYFSYDTVRYVEKKKLPFSDSPKDDRQLADIHLGLYETVIVFDHVEKKAYVIL  254

Query  863   WVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSG  1042
             WVR D YSS   AY +G  +L+ LV+K+QD  PPRL+  +VD  TR+FGP L + NMT+ 
Sbjct  255   WVRTDQYSSVESAYVDGTIRLKKLVAKLQDNKPPRLAPGAVDLQTRQFGPPLKESNMTAE  314

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
              YK+AVL+AKEHI AGDIFQIVLSQRFERRT ADPFEVYRALR+VNPSPYMTY+QARGCI
Sbjct  315   AYKDAVLQAKEHIKAGDIFQIVLSQRFERRTFADPFEVYRALRVVNPSPYMTYLQARGCI  374

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
             LVASSPEIL R+K N++VNRPLAGTAKRG TPEED  L   LL DEK+ AEH MLVDLGR
Sbjct  375   LVASSPEILARIKNNKIVNRPLAGTAKRGNTPEEDENLSAKLLKDEKQCAEHVMLVDLGR  434

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             NDVGKV+KSGSV VE+LMN+ERYSHVMHISSTVTGEL D+LTCWDALRAALPVGTVSGAP
Sbjct  435   NDVGKVAKSGSVKVEKLMNVERYSHVMHISSTVTGELQDNLTCWDALRAALPVGTVSGAP  494

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----R  1747
             KV+AM+LID+LE +RRGPYSGGFG ISF GDMDIALALRTIVF      DT+ S     +
Sbjct  495   KVRAMQLIDELEVSRRGPYSGGFGYISFSGDMDIALALRTIVFPTGTRYDTMYSYKDLNK  554

Query  1748  RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             R+EWIA+LQ+GAGIVADS+P  E +EC+NK AGL+R+IDLAESAF+
Sbjct  555   RQEWIAYLQAGAGIVADSDPADEHQECQNKAAGLARSIDLAESAFI  600



>ref|XP_004144668.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004161666.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like 
[Cucumis sativus]
 gb|KGN54866.1| hypothetical protein Csa_4G563190 [Cucumis sativus]
Length=588

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/553 (74%), Positives = 460/553 (83%), Gaps = 18/553 (3%)
 Frame = +2

Query  242   RTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYR  421
             R L +KCS++  +            D  EA FIEASK  NLIPLH+CIFSDHL+PVLAYR
Sbjct  47    RVLAIKCSAASLV------------DSPEA-FIEASKKGNLIPLHRCIFSDHLSPVLAYR  93

Query  422   CLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTE  601
             CLV EDDRE PSFLFESVEPG + S VGRYSVVGAQP++EILAKEN VTIL+H+ GK TE
Sbjct  94    CLVKEDDREAPSFLFESVEPGLQVSNVGRYSVVGAQPSIEILAKENVVTILNHEEGKRTE  153

Query  602   KVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDR  781
             ++VEDPMTV R I E+WKPQ+  +LPDAFCGGWVGYFSYDTVRYVEKKKLPF+SAP DDR
Sbjct  154   EIVEDPMTVPRRIMEKWKPQMIDELPDAFCGGWVGYFSYDTVRYVEKKKLPFSSAPTDDR  213

Query  782   NLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDP  961
             NLPD+HLGLYD+VIVFDHV+K+A++IHWV LD YSS  +AY +G  +LE L+S+V D+ P
Sbjct  214   NLPDVHLGLYDDVIVFDHVNKQAYVIHWVHLDQYSSVQEAYEDGTARLEKLLSRVHDIVP  273

Query  962   PRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTA  1141
             P+L + S+   T  FGP L   +MTS EYK AVL+AKEHILAGDIFQIVLSQRFERRT A
Sbjct  274   PKLPAGSIRLLTHLFGPKLKMSSMTSLEYKKAVLQAKEHILAGDIFQIVLSQRFERRTFA  333

Query  1142  DPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPE  1321
             DPFEVYRALRIVNPSPYMTY+QARGCILVASSPEILTRVKK ++ NRPLAGT +RGKT +
Sbjct  334   DPFEVYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKGKITNRPLAGTIRRGKTEK  393

Query  1322  EDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTV  1501
             ED +LE  LLND K+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTV
Sbjct  394   EDKVLEKELLNDAKQCAEHIMLVDLGRNDVGKVSKFGSVKVEKLMNIERYSHVMHISSTV  453

Query  1502  TGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMD  1681
             TGEL+D L  WD LRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGGFGGISF GDMD
Sbjct  454   TGELVDDLNSWDVLRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGFGGISFSGDMD  513

Query  1682  IALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAG  1846
             IALALRTIVF  +   DT+ S     RR EW+AHLQ+GAGIVADS+P  EQ+ECENK A 
Sbjct  514   IALALRTIVFPTNTRYDTIYSYKDANRRMEWVAHLQAGAGIVADSDPGDEQRECENKAAA  573

Query  1847  LSRAIDLAESAFV  1885
             L+RAIDLAES+F+
Sbjct  574   LARAIDLAESSFI  586



>gb|KHG13037.1| Anthranilate synthase component I-2, chloroplastic -like protein 
[Gossypium arboreum]
Length=594

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/566 (72%), Positives = 465/566 (82%), Gaps = 16/566 (3%)
 Frame = +2

Query  203   SRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKC  382
             SR  S    + RVRTL  +C+S           S PS+  +  KF EASK  NL+PL++C
Sbjct  38    SRSISLVGSTSRVRTL--RCTSL---------SSSPSIVDQSVKFREASKNGNLVPLYRC  86

Query  383   IFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENK  562
             IFSDHLTPV+AYRCLV EDDR+ PSFLFESVEPG  +S+VGRYSVVGAQP++EI+AKEN 
Sbjct  87    IFSDHLTPVIAYRCLVKEDDRDAPSFLFESVEPGLMASSVGRYSVVGAQPSIEIVAKENM  146

Query  563   VTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEK  742
             VTI++H  G   E++V+DPM V R I E+W+PQ   +LP+ FCGGWVGYFSYDTVRYVEK
Sbjct  147   VTIMNHAEGSKIEEIVDDPMIVPRRIMEQWEPQRIDELPEVFCGGWVGYFSYDTVRYVEK  206

Query  743   KKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQ  922
             KKLPF+SAP DDRNLPD HLGLYD+VIVFDHV+KKAF+IHWVRLD YSS  +AY +G K+
Sbjct  207   KKLPFSSAPLDDRNLPDAHLGLYDDVIVFDHVEKKAFLIHWVRLDQYSSVDEAYNDGMKR  266

Query  923   LEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQ  1102
             LE LVS+V D+DPP+L + S+   TR FGP L   +MTS  Y  AVL+AKEHILAGDIFQ
Sbjct  267   LETLVSRVHDIDPPKLPAGSIKLYTRLFGPKLEISSMTSDAYTEAVLRAKEHILAGDIFQ  326

Query  1103  IVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNR  1282
             IVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+QARGCILVASSPEILTRVKK ++ NR
Sbjct  327   IVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKGKITNR  386

Query  1283  PLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNI  1462
             PLAGT +RGKTP+ED+MLE  LL DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNI
Sbjct  387   PLAGTIRRGKTPKEDLMLEKELLADEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEKLMNI  446

Query  1463  ERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYS  1642
             ERYSHVMHISSTVTGELLD LT WDALRAALPVGTVSGAPKVKAMELIDQLE TRRGPYS
Sbjct  447   ERYSHVMHISSTVTGELLDDLTSWDALRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYS  506

Query  1643  GGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNP  1807
             GGFGGISF GDMDIALALRTIVF      DT+ S     +R+EW+AHLQ+GAGIVADS P
Sbjct  507   GGFGGISFSGDMDIALALRTIVFPTATRYDTMYSYKDANKRREWVAHLQAGAGIVADSVP  566

Query  1808  DSEQKECENKVAGLSRAIDLAESAFV  1885
               EQ+ECENK A L+RAIDLAES+FV
Sbjct  567   AEEQRECENKAAALARAIDLAESSFV  592



>ref|XP_010534737.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=623

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/568 (71%), Positives = 450/568 (79%), Gaps = 36/568 (6%)
 Frame = +2

Query  284   VTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFL  463
             V+ SP S  S  K   KF+E SK  NL+PL   IFSDHLTPVLAYRCLV EDDRE PSFL
Sbjct  49    VSLSPCS--STAKGGMKFVEPSKNENLVPLCHTIFSDHLTPVLAYRCLVKEDDREAPSFL  106

Query  464   FESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSIS  643
             FESVEPGS SSTVGRYSVVGAQPTMEI+AKE  VT++DH  G LT++ VEDPM + R IS
Sbjct  107   FESVEPGSLSSTVGRYSVVGAQPTMEIVAKEKTVTVMDHVRGTLTKEEVEDPMEIPRRIS  166

Query  644   EEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVI  823
             E WKPQL  +LPDAFCGGWVGYFSYDTVRY+EK+KLPF+ AP DDR+LPD+HL LYD+VI
Sbjct  167   ETWKPQLIDELPDAFCGGWVGYFSYDTVRYMEKRKLPFSKAPLDDRSLPDMHLSLYDDVI  226

Query  824   VFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTRE  1003
             VFDHV+KK  +IHWVR+   SS    Y +G   L+ LVS++QDVDPP+L + SV+  TR+
Sbjct  227   VFDHVEKKVHVIHWVRVSENSSFEDVYADGVAHLDELVSRLQDVDPPKLPAGSVELRTRQ  286

Query  1004  FGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNP  1183
             FGP L K +MTS  YKNAVL+AKEHI AGDIFQIVLSQRFERRT ADPFEVYRALR+VNP
Sbjct  287   FGPPLKKSSMTSDAYKNAVLQAKEHISAGDIFQIVLSQRFERRTFADPFEVYRALRVVNP  346

Query  1184  SPYMTYMQ----------------------------ARGCILVASSPEILTRVKKNRVVN  1279
             SPYM Y+Q                            ARGCILVASSPEILTRVKKN+VVN
Sbjct  347   SPYMGYLQVSDCSSDNHNFFCFHSVLPINIFSFLFQARGCILVASSPEILTRVKKNKVVN  406

Query  1280  RPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMN  1459
             RPLAGT +RGKT EED MLE LLL DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMN
Sbjct  407   RPLAGTVRRGKTFEEDQMLEKLLLKDEKQCAEHIMLVDLGRNDVGKVSKDGSVKVEKLMN  466

Query  1460  IERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPY  1639
             +ERYSHVMHISSTVTGEL + LTCWD LRAALPVGTVSGAPKVKAMELID+LE TRRGPY
Sbjct  467   VERYSHVMHISSTVTGELREDLTCWDVLRAALPVGTVSGAPKVKAMELIDELEVTRRGPY  526

Query  1640  SGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS------RRKEWIAHLQSGAGIVADS  1801
             SGGFGGISF GDMDIALALRTIVF  +   DT+ S      RR EWIAHLQ+GAG+VADS
Sbjct  527   SGGFGGISFAGDMDIALALRTIVFPTETRYDTMYSYKDKNMRRHEWIAHLQAGAGVVADS  586

Query  1802  NPDSEQKECENKVAGLSRAIDLAESAFV  1885
              PD E +EC+NK AGL+RAIDLAESAFV
Sbjct  587   QPDDEHRECQNKAAGLARAIDLAESAFV  614



>ref|XP_011082384.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X1 [Sesamum indicum]
Length=561

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/552 (73%), Positives = 465/552 (84%), Gaps = 6/552 (1%)
 Frame = +2

Query  248   LQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCL  427
             + LK +     PV R   +PPS     AKF EA+K  NL+PL + IFSDHLTPVLAYRCL
Sbjct  10    IALKANFKTLRPV-RCSVAPPSFVDHSAKFKEAAKHGNLVPLFRPIFSDHLTPVLAYRCL  68

Query  428   VDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKV  607
             V ED+R+ PSFLFESVEPG ++S+VGRYSV+GAQPTMEI+AKEN VTI+DH  G+ TE+ 
Sbjct  69    VKEDERDAPSFLFESVEPGLKASSVGRYSVIGAQPTMEIVAKENVVTIVDHHEGQRTEEF  128

Query  608   VEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNL  787
             VEDPM + R I E+WKPQ   +LP+AFCGGWVGYFSYDTVRYVEKKKLPF+ AP+DDRNL
Sbjct  129   VEDPMVIPRRIMEKWKPQRIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSKAPEDDRNL  188

Query  788   PDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPR  967
             PD+HLGLYD+VIVFDHV+KKA++IHWVRLD +SS  +AY +G  +LEALVS+V D+ PP+
Sbjct  189   PDVHLGLYDDVIVFDHVEKKAYVIHWVRLDQFSSVEEAYDDGMNRLEALVSRVHDIVPPK  248

Query  968   LSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADP  1147
             L++ S+   T  FGPSL+K  MTS EY+ AV++AKEHILAGDIFQIVLSQRFERRT ADP
Sbjct  249   LAAGSIKLYTSLFGPSLSKSTMTSEEYRKAVMQAKEHILAGDIFQIVLSQRFERRTFADP  308

Query  1148  FEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEED  1327
             FEVYRALRIVNPSPYMTY+QARGCILVASSPEILTRVKK +V+NRPLAGT +RGKTP+ED
Sbjct  309   FEVYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKGKVINRPLAGTVRRGKTPKED  368

Query  1328  VMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTG  1507
              MLE  LL+DEK+ AEH MLVDLGRNDVGKVSKSGSV VE+L NIERYSHVMHISSTVTG
Sbjct  369   YMLENQLLHDEKQCAEHIMLVDLGRNDVGKVSKSGSVKVEKLKNIERYSHVMHISSTVTG  428

Query  1508  ELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIA  1687
             EL  +LT WDALRAALPVGTVSGAPKVKAMELID LE TRRGPYSGGFGGISF GDMDIA
Sbjct  429   ELSSNLTSWDALRAALPVGTVSGAPKVKAMELIDHLEVTRRGPYSGGFGGISFSGDMDIA  488

Query  1688  LALRTIVFLNDGMNDTL-----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLS  1852
             LALRTIVF      DT+     S +R++W+AHLQ+GAGIVADS+P  EQ+ECENK A L+
Sbjct  489   LALRTIVFPTSTRYDTMYSYKDSGKRRDWVAHLQAGAGIVADSDPADEQRECENKAAALA  548

Query  1853  RAIDLAESAFVK  1888
             RAIDLAES+FV+
Sbjct  549   RAIDLAESSFVE  560



>ref|XP_010414346.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=625

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/558 (70%), Positives = 460/558 (82%), Gaps = 17/558 (3%)
 Frame = +2

Query  242   RTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFI---EASKTSNLIPLHKCIFSDHLTPVL  412
             R   +KCSSS         Y+PP LD  E +FI   +AS+  NL+PL++C+FSDHLTP+L
Sbjct  62    RLTCIKCSSS--------SYTPP-LDLSEEQFIKFKQASEKGNLVPLYRCVFSDHLTPIL  112

Query  413   AYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGK  592
             AYRCLV EDDR+ PSFLFESVEPG +SS +GRYSVVGAQPT+EI+AK N VT++DH +G 
Sbjct  113   AYRCLVKEDDRDAPSFLFESVEPGLQSSNIGRYSVVGAQPTIEIVAKGNVVTVMDHGAGL  172

Query  593   LTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQ  772
              TE+ VEDPM V + I +EWKPQ   +LP+AFCGGWVGYFSYDTVRYVEKKKLPF++AP+
Sbjct  173   RTEEEVEDPMMVPQKIMDEWKPQRIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSNAPE  232

Query  773   DDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQD  952
             DDR+LPD+HLGLYD+VIVFDHV+KKA++IHWVR+D   S    + +G  +LE+L S++QD
Sbjct  233   DDRSLPDVHLGLYDDVIVFDHVEKKAYVIHWVRIDKDRSVEDNFTDGMNRLESLTSRIQD  292

Query  953   VDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERR  1132
               PP++ +  +   T+ FGP L K  MTS  YK AV++AKEHILAGDIFQIVLSQRFERR
Sbjct  293   QKPPKMPTGFIKLRTQLFGPKLEKSTMTSEAYKKAVVEAKEHILAGDIFQIVLSQRFERR  352

Query  1133  TTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGK  1312
             T ADPFE+YRALRIVNPSPYM Y+QARGCILVASSPEIL R K  ++ NRPLAGT +RGK
Sbjct  353   TFADPFEIYRALRIVNPSPYMAYLQARGCILVASSPEILLRSKNRKITNRPLAGTVRRGK  412

Query  1313  TPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHIS  1492
             TP+ED+MLE  LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHIS
Sbjct  413   TPKEDLMLEKELLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVEVEKLMNIERYSHVMHIS  472

Query  1493  STVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVG  1672
             STV GELLD+LT WDALRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF G
Sbjct  473   STVKGELLDNLTSWDALRAALPVGTVSGAPKVKAMELIDKLEVTRRGPYSGGFGGISFNG  532

Query  1673  DMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENK  1837
             DMDIALALRT+VF  +   DTL S     RR+EWIAH+Q+GAG+VADSNPD E +ECENK
Sbjct  533   DMDIALALRTMVFPTNTRYDTLYSYKHPQRRREWIAHIQAGAGVVADSNPDDEHRECENK  592

Query  1838  VAGLSRAIDLAESAFVKT  1891
              A L+RAIDLAES+F+++
Sbjct  593   AAALARAIDLAESSFLES  610



>ref|XP_011082385.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X2 [Sesamum indicum]
Length=560

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/552 (73%), Positives = 466/552 (84%), Gaps = 7/552 (1%)
 Frame = +2

Query  248   LQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCL  427
             + LK +     PV R   +PPS D   AKF EA+K  NL+PL + IFSDHLTPVLAYRCL
Sbjct  10    IALKANFKTLRPV-RCSVAPPSFD-HSAKFKEAAKHGNLVPLFRPIFSDHLTPVLAYRCL  67

Query  428   VDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKV  607
             V ED+R+ PSFLFESVEPG ++S+VGRYSV+GAQPTMEI+AKEN VTI+DH  G+ TE+ 
Sbjct  68    VKEDERDAPSFLFESVEPGLKASSVGRYSVIGAQPTMEIVAKENVVTIVDHHEGQRTEEF  127

Query  608   VEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNL  787
             VEDPM + R I E+WKPQ   +LP+AFCGGWVGYFSYDTVRYVEKKKLPF+ AP+DDRNL
Sbjct  128   VEDPMVIPRRIMEKWKPQRIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSKAPEDDRNL  187

Query  788   PDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPR  967
             PD+HLGLYD+VIVFDHV+KKA++IHWVRLD +SS  +AY +G  +LEALVS+V D+ PP+
Sbjct  188   PDVHLGLYDDVIVFDHVEKKAYVIHWVRLDQFSSVEEAYDDGMNRLEALVSRVHDIVPPK  247

Query  968   LSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADP  1147
             L++ S+   T  FGPSL+K  MTS EY+ AV++AKEHILAGDIFQIVLSQRFERRT ADP
Sbjct  248   LAAGSIKLYTSLFGPSLSKSTMTSEEYRKAVMQAKEHILAGDIFQIVLSQRFERRTFADP  307

Query  1148  FEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEED  1327
             FEVYRALRIVNPSPYMTY+QARGCILVASSPEILTRVKK +V+NRPLAGT +RGKTP+ED
Sbjct  308   FEVYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKGKVINRPLAGTVRRGKTPKED  367

Query  1328  VMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTG  1507
              MLE  LL+DEK+ AEH MLVDLGRNDVGKVSKSGSV VE+L NIERYSHVMHISSTVTG
Sbjct  368   YMLENQLLHDEKQCAEHIMLVDLGRNDVGKVSKSGSVKVEKLKNIERYSHVMHISSTVTG  427

Query  1508  ELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIA  1687
             EL  +LT WDALRAALPVGTVSGAPKVKAMELID LE TRRGPYSGGFGGISF GDMDIA
Sbjct  428   ELSSNLTSWDALRAALPVGTVSGAPKVKAMELIDHLEVTRRGPYSGGFGGISFSGDMDIA  487

Query  1688  LALRTIVFLNDGMNDTL-----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLS  1852
             LALRTIVF      DT+     S +R++W+AHLQ+GAGIVADS+P  EQ+ECENK A L+
Sbjct  488   LALRTIVFPTSTRYDTMYSYKDSGKRRDWVAHLQAGAGIVADSDPADEQRECENKAAALA  547

Query  1853  RAIDLAESAFVK  1888
             RAIDLAES+FV+
Sbjct  548   RAIDLAESSFVE  559



>ref|XP_010510457.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010510458.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=625

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/554 (70%), Positives = 460/554 (83%), Gaps = 17/554 (3%)
 Frame = +2

Query  254   LKCSSSLQIPVTRSPYSPPSLDKEEAKFI---EASKTSNLIPLHKCIFSDHLTPVLAYRC  424
             +KCSSS         Y+PP LD  E +FI   +AS+  NL+PL++C+FSDHLTP+LAYRC
Sbjct  66    IKCSSS--------SYTPP-LDLSEEQFIKFKQASEKGNLVPLYRCVFSDHLTPILAYRC  116

Query  425   LVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEK  604
             LV EDDR+ PSFLFESVEPG +SS +GRYSVVGAQPT+EI+AK N VT++DH +G  TE+
Sbjct  117   LVKEDDRDAPSFLFESVEPGLQSSNIGRYSVVGAQPTIEIVAKGNVVTVMDHGAGLRTEE  176

Query  605   VVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRN  784
              VEDPM V + I +EWKPQ   +LP+AFCGGWVGYFSYDTVRYVEKKKLPF++AP+DDR+
Sbjct  177   EVEDPMMVPQKIMDEWKPQRIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSNAPEDDRS  236

Query  785   LPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPP  964
             LPD+HLGLYD+VIVFDHV+KKA++IHWVR+D   S    + +G  +LE+L S++QD  PP
Sbjct  237   LPDVHLGLYDDVIVFDHVEKKAYVIHWVRIDKDRSVEDNFTDGMNRLESLTSRIQDQKPP  296

Query  965   RLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTAD  1144
             ++ +  +   T+ FGP L K  MTS  YK AV++AKEHILAGDIFQIVLSQRFERRT AD
Sbjct  297   KMPTGFIKLRTQLFGPKLEKSTMTSEAYKKAVVEAKEHILAGDIFQIVLSQRFERRTFAD  356

Query  1145  PFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEE  1324
             PFE+YRALRIVNPSPYM Y+QARGCILVASSPEIL R K  ++ NRPLAGT +RGKTP+E
Sbjct  357   PFEIYRALRIVNPSPYMAYLQARGCILVASSPEILLRSKNRKITNRPLAGTVRRGKTPKE  416

Query  1325  DVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVT  1504
             D+MLE  LL+DEK+ AEH MLVDLGRNDVGKVSK GSV+VE+LMNIERYSHVMHISSTV 
Sbjct  417   DLMLEKELLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVDVEKLMNIERYSHVMHISSTVK  476

Query  1505  GELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDI  1684
             GELLD+LT WDALRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF GDMDI
Sbjct  477   GELLDNLTSWDALRAALPVGTVSGAPKVKAMELIDKLEVTRRGPYSGGFGGISFNGDMDI  536

Query  1685  ALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGL  1849
             ALALRT+VF  +   DTL S     RR+EWIAH+Q+GAG+VADSNPD E +ECENK A L
Sbjct  537   ALALRTMVFPTNTRYDTLYSYKHPQRRREWIAHIQAGAGVVADSNPDDEHRECENKAAAL  596

Query  1850  SRAIDLAESAFVKT  1891
             +RAIDLAES+F+++
Sbjct  597   ARAIDLAESSFLES  610



>gb|KEH34470.1| anthranilate synthase alpha 1 [Medicago truncatula]
Length=601

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/526 (73%), Positives = 445/526 (85%), Gaps = 5/526 (1%)
 Frame = +2

Query  323   EEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTV  502
             E  KFIEASK  NLIPL++CIFSD LTPVLAYR LV E+DRE PSFLFES EP  + S V
Sbjct  74    ERKKFIEASKNGNLIPLYQCIFSDQLTPVLAYRSLVTENDREAPSFLFESAEPNFQGSNV  133

Query  503   GRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPD  682
             GRYSVVGAQPTMEI+AKENKVT+++H+SG+LTE++V+DPM + R IS++W+P L+ +LPD
Sbjct  134   GRYSVVGAQPTMEIVAKENKVTVMNHESGQLTEEIVDDPMEIPRKISQDWRPCLSDELPD  193

Query  683   AFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIH  862
             AFCGGW GYFSYDTVRYVEKKKLPF+ AP+DDR+L DIHL LY+ VIVFDHV+KKA++I 
Sbjct  194   AFCGGWAGYFSYDTVRYVEKKKLPFSDAPKDDRHLADIHLSLYETVIVFDHVEKKAYVIL  253

Query  863   WVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSG  1042
             WVR D YSS  +AY +G  +L+ LV+K+QD   PRL+  +VD  TR+FGP L + NMT+ 
Sbjct  254   WVRTDQYSSVERAYVDGTIRLKKLVAKLQDNKLPRLAPGAVDLQTRQFGPPLKESNMTAE  313

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
              YK+AVL+AKEHI AGDIFQIVLSQRFERRT ADPFEVYRALR+VNPSPYMTY QARGCI
Sbjct  314   AYKDAVLQAKEHIKAGDIFQIVLSQRFERRTFADPFEVYRALRVVNPSPYMTYFQARGCI  373

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
             LVASSPEIL R+K N++VNRPLAGT+KRG T EED  L   LL DEK+ AEH MLVDLGR
Sbjct  374   LVASSPEILARIKNNKIVNRPLAGTSKRGNTAEEDESLSAKLLKDEKQCAEHVMLVDLGR  433

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             NDVGKV+KSGSV VE+LMN+ERYSHVMHISSTVTGEL DHLTCWDALRAALPVGTVSGAP
Sbjct  434   NDVGKVAKSGSVKVEKLMNVERYSHVMHISSTVTGELQDHLTCWDALRAALPVGTVSGAP  493

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----R  1747
             KV+AM+LID+LE  RRGPYSGGFG ISF GDMDIALALRTIVF      DT+ S     +
Sbjct  494   KVRAMQLIDELEVARRGPYSGGFGYISFSGDMDIALALRTIVFPTGTRYDTMYSYKDLNK  553

Query  1748  RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             R+EWIA+LQ+GAGIVADS+P  E +EC+NK AGL+R+IDLAESAFV
Sbjct  554   RQEWIAYLQAGAGIVADSDPADEHQECQNKAAGLARSIDLAESAFV  599



>ref|XP_007016132.1| Anthranilate synthase 2 isoform 1 [Theobroma cacao]
 gb|EOY33751.1| Anthranilate synthase 2 isoform 1 [Theobroma cacao]
Length=596

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/593 (70%), Positives = 477/593 (80%), Gaps = 24/593 (4%)
 Frame = +2

Query  149   RLLPPSHLISELPITSIVSRRSSGYAPSLR--------VRTLQLKCSSSLQIPVTRSPYS  304
             R LP + L     ++   + R SGY             +RTL  KCS+           S
Sbjct  14    RQLPSTPLCPSTTVSVNFNARLSGYRSRSLLLLSSTSRIRTL--KCSAL---------SS  62

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
             P SL  +  KF EASK  NL+PL +CIFSDHLTPV+AYRCLV EDDR+ PSFLFESVEPG
Sbjct  63    PSSLVDQSVKFREASKNGNLVPLFRCIFSDHLTPVIAYRCLVKEDDRDAPSFLFESVEPG  122

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
              ++S++GRYSVVGAQP++EI+AK N VTIL+H+ G  TE++VEDPM V R I E W+PQ 
Sbjct  123   WQTSSIGRYSVVGAQPSIEIVAKGNMVTILNHEEGCRTEEIVEDPMIVPRRIMEGWEPQR  182

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               +LP+ FCGGWVGYFSYDTVRYVEKKKLPF+SAP DDRNLPD+HLGLY +VIVFDHV+K
Sbjct  183   IDELPEVFCGGWVGYFSYDTVRYVEKKKLPFSSAPLDDRNLPDVHLGLYGDVIVFDHVEK  242

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             KAF+IHWVRLD YSS  +AY +G K+LE+LVS+V D+DPP+L + ++   TR FGP L  
Sbjct  243   KAFVIHWVRLDQYSSVDEAYNDGMKRLESLVSRVHDIDPPKLPAGAIKLYTRLFGPKLEI  302

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
              +MTS  YK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+
Sbjct  303   SSMTSEAYKEAVLQAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYL  362

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEILTRVKK +V NRPLAGT +RGKTP+ED+MLE  LL DEKE AEH M
Sbjct  363   QARGCILVASSPEILTRVKKGKVTNRPLAGTIRRGKTPKEDLMLEKELLADEKECAEHIM  422

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGELLD L+ WDALRAALPVG
Sbjct  423   LVDLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVTGELLDDLSSWDALRAALPVG  482

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS  1744
             TVSGAPKVKAMELID+LEATRRGPYSGGFGGISF GDMD+ALALRTIVF +    DT+ S
Sbjct  483   TVSGAPKVKAMELIDRLEATRRGPYSGGFGGISFSGDMDVALALRTIVFPSTTRFDTMYS  542

Query  1745  -----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
                  +R+EW+AHLQ+GAGIVADS P  EQ+ECENK A L+RAIDLAES+FV+
Sbjct  543   YKDVNKRREWVAHLQAGAGIVADSVPADEQRECENKAAALARAIDLAESSFVE  595



>ref|XP_009374261.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
[Pyrus x bretschneideri]
Length=585

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/598 (70%), Positives = 475/598 (79%), Gaps = 26/598 (4%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPS----LRVRTL--QLKCSSSLQIPV  286
             M+ +A   R LP     S     S VS      APS    LRV  L   L+CS+ L    
Sbjct  1     METLAVGSRQLP-----STFASPSAVSVNFHNRAPSSLSLLRVTPLVGTLRCSALLS---  52

Query  287   TRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLF  466
                    PSL  +  KF+EASK  NLIPL++ IFSDHLTPVLAYRCLV EDDR+ PSFLF
Sbjct  53    -------PSLADQSEKFVEASKKGNLIPLYRSIFSDHLTPVLAYRCLVKEDDRDAPSFLF  105

Query  467   ESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISE  646
             ESVEPGS+ S VGRYSV+GAQP++EI+AKEN VTI+DH  G  TE++VEDPMTV R I E
Sbjct  106   ESVEPGSKDSNVGRYSVIGAQPSIEIVAKENMVTIMDHREGCRTEEIVEDPMTVPRRIME  165

Query  647   EWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIV  826
              W PQL  +LP+AFCGGWVG+FSYDTVRYVEKKKLPF SAP DDRNLPD+HLGLYD+VIV
Sbjct  166   GWTPQLLDELPEAFCGGWVGFFSYDTVRYVEKKKLPFPSAPPDDRNLPDVHLGLYDDVIV  225

Query  827   FDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREF  1006
             FDHV+KKA +IHWV+LD YSS  +A+ +G  +LE LVS+V D+  PRL + S++FNT+ F
Sbjct  226   FDHVEKKAHVIHWVQLDQYSSVEEAFNDGINRLETLVSRVHDIVTPRLPAGSIEFNTQHF  285

Query  1007  GPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPS  1186
             G  L   ++TS EYK AVLKAKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPS
Sbjct  286   GTKLEDSSLTSEEYKEAVLKAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPS  345

Query  1187  PYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKE  1366
             PYMTY+QARGCILVASSPEILTRVKK  + NRPLAGT +RGKTP+ED+MLE  LLNDEK+
Sbjct  346   PYMTYLQARGCILVASSPEILTRVKKQTITNRPLAGTVRRGKTPKEDLMLEKQLLNDEKQ  405

Query  1367  RAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALR  1546
              AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGEL D LT WD LR
Sbjct  406   CAEHIMLVDLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVTGELRDDLTSWDVLR  465

Query  1547  AALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGM  1726
              ALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF G+MDIALALRTIVF     
Sbjct  466   TALPVGTVSGAPKVKAMELIDKLEVTRRGPYSGGFGGISFSGNMDIALALRTIVFPTSFR  525

Query  1727  NDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
              DT+ S     +R+EW+AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  526   YDTMYSYKDANKRREWVAHLQAGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  583



>ref|XP_010414347.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X3 [Camelina sativa]
Length=625

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/558 (70%), Positives = 460/558 (82%), Gaps = 17/558 (3%)
 Frame = +2

Query  242   RTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFI---EASKTSNLIPLHKCIFSDHLTPVL  412
             R   +KCSSS         Y+PP LD  E +FI   +AS+  NL+PL++C+FSDHLTP+L
Sbjct  62    RLTCIKCSSS--------SYTPP-LDLSEEQFIKFKQASEKGNLVPLYRCVFSDHLTPIL  112

Query  413   AYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGK  592
             AYRCLV EDDR+ PSFLFESVEPG +SS +GRYSVVGAQPT+EI+AK N VT++DH +G 
Sbjct  113   AYRCLVKEDDRDAPSFLFESVEPGLQSSNIGRYSVVGAQPTIEIVAKGNVVTVMDHGAGL  172

Query  593   LTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQ  772
              TE+ VEDPM V + I +EW+PQ   +LP+AFCGGWVGYFSYDTVRYVEKKKLPF++AP+
Sbjct  173   RTEEEVEDPMMVPQKIMDEWRPQRIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSNAPE  232

Query  773   DDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQD  952
             DDR+LPD+HLGLYD+VIVFDHV+KKA++IHWVR+D   S    + +G  +LE+L S++QD
Sbjct  233   DDRSLPDVHLGLYDDVIVFDHVEKKAYVIHWVRIDKDRSVEDNFTDGMNRLESLTSRIQD  292

Query  953   VDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERR  1132
               PP++ +  +   T+ FGP L K  MTS  YK AV++AKEHILAGDIFQIVLSQRFERR
Sbjct  293   QKPPKMPTGFIKLRTQLFGPKLEKSTMTSEAYKKAVVEAKEHILAGDIFQIVLSQRFERR  352

Query  1133  TTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGK  1312
             T ADPFE+YRALRIVNPSPYM Y+QARGCILVASSPEIL R K  ++ NRPLAGT +RGK
Sbjct  353   TFADPFEIYRALRIVNPSPYMAYLQARGCILVASSPEILLRSKNRKITNRPLAGTVRRGK  412

Query  1313  TPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHIS  1492
             TP+ED+MLE  LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHIS
Sbjct  413   TPKEDLMLEKELLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVEVEKLMNIERYSHVMHIS  472

Query  1493  STVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVG  1672
             STV GELLD+LT WDALRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF G
Sbjct  473   STVKGELLDNLTSWDALRAALPVGTVSGAPKVKAMELIDKLEVTRRGPYSGGFGGISFNG  532

Query  1673  DMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENK  1837
             DMDIALALRT+VF  +   DTL S     RR+EWIAH+Q+GAG+VADSNPD E +ECENK
Sbjct  533   DMDIALALRTMVFPTNTRYDTLYSYKHPQRRREWIAHIQAGAGVVADSNPDDEHRECENK  592

Query  1838  VAGLSRAIDLAESAFVKT  1891
              A L+RAIDLAES+F+++
Sbjct  593   AAALARAIDLAESSFLES  610



>emb|CAC29060.1| anthranilate synthase alpha subunit [Catharanthus roseus]
Length=608

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/557 (73%), Positives = 462/557 (83%), Gaps = 13/557 (2%)
 Frame = +2

Query  251   QLKCSSSLQIPVTRSPY-------SPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPV  409
             QL C S L + V  SP        SPPS     AKF  A+K  NLIPL++ IFSDHLTPV
Sbjct  51    QLACCS-LHLLVLSSPLLDKCSAVSPPSFVDHSAKFKVAAKHGNLIPLYRPIFSDHLTPV  109

Query  410   LAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSG  589
             LAYRCLV EDDRE PSFLFESVEPG + S VGRYSV+GAQPTMEI+AKEN VT++DH  G
Sbjct  110   LAYRCLVKEDDREAPSFLFESVEPGLKVSNVGRYSVIGAQPTMEIVAKENMVTVMDHRQG  169

Query  590   KLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAP  769
             +  E+  EDPM V R I E+WKPQ T +LP+AFCGGWVGYFSYDTVRYVEKKKLPF++AP
Sbjct  170   RRVEQYEEDPMVVPRRIMEKWKPQRTEELPEAFCGGWVGYFSYDTVRYVEKKKLPFSNAP  229

Query  770   QDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQ  949
              DDR+LPDIHLGLYD+VIVFDHV+KKA++IHWVRLD +SS  +AY++G K+LE+LVS+V 
Sbjct  230   VDDRDLPDIHLGLYDDVIVFDHVEKKAYVIHWVRLDQFSSVEEAYKDGMKRLESLVSRVH  289

Query  950   DVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFER  1129
             D+ PP+LS+ S++ +T  FGP L    MTS EY+ AVL+AKEHILAGDIFQ+VLSQRFER
Sbjct  290   DIVPPKLSAGSINLHTSLFGPKLKNSTMTSEEYEKAVLQAKEHILAGDIFQLVLSQRFER  349

Query  1130  RTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRG  1309
             RT ADPFEVYRALRIVNPSPYMTY+QARGCILVASSPEILTRVK+  + NRPLAGT +RG
Sbjct  350   RTFADPFEVYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKQGTITNRPLAGTTRRG  409

Query  1310  KTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHI  1489
             KTP+ED MLE  LLNDEK+ AEH MLVDLGRNDVGKVSK GS  VE+LMNIE YSHVMHI
Sbjct  410   KTPKEDYMLEQQLLNDEKQCAEHIMLVDLGRNDVGKVSKPGSEKVEKLMNIEPYSHVMHI  469

Query  1490  SSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFV  1669
             SSTVTGELLD+LT WD LRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF 
Sbjct  470   SSTVTGELLDNLTSWDVLRAALPVGTVSGAPKVKAMELIDELEVTRRGPYSGGFGGISFS  529

Query  1670  GDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECEN  1834
             GDMD+ALALRTIVF      DT+ S     +R+EWIAHLQ+GAGIVADS+P  EQ+ECEN
Sbjct  530   GDMDVALALRTIVFSIGTRYDTMYSYKTRFKRREWIAHLQAGAGIVADSDPADEQRECEN  589

Query  1835  KVAGLSRAIDLAESAFV  1885
             K A L+RAIDLAES+FV
Sbjct  590   KSAALARAIDLAESSFV  606



>ref|XP_008220596.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic 
isoform X1 [Prunus mume]
Length=585

 Score =   791 bits (2044),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/595 (70%), Positives = 475/595 (80%), Gaps = 20/595 (3%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYA---PSLRVRTLQLKCSSSLQIPVTRS  295
             M+ +A   R LP +         +   R SS  A   P  RVRTL  +CS+         
Sbjct  1     METLAVGSRQLPSTLTSPSAVSNNFRGRASSSLALLRPIPRVRTL--RCSA---------  49

Query  296   PYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESV  475
               S PSL  +  KF+EASK  NLIPL++ IFSDHLTPVLAYRCLV EDDR+ PSFLFESV
Sbjct  50    -LSSPSLADQSEKFVEASKKGNLIPLYRSIFSDHLTPVLAYRCLVKEDDRDAPSFLFESV  108

Query  476   EPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWK  655
             EPGS+ S VGRYSV+GAQP++EI+AKEN VTI+DH  G  TE++VEDPMTV + I E W 
Sbjct  109   EPGSKDSNVGRYSVIGAQPSIEIVAKENMVTIMDHREGCRTEEIVEDPMTVPQRIMEGWT  168

Query  656   PQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDH  835
             PQL  +LP+AFCGGWVGYFSYDTVRYVE KKLPFASAP DDRNLPD+HLGLYD+VIVFDH
Sbjct  169   PQLVDELPEAFCGGWVGYFSYDTVRYVETKKLPFASAPPDDRNLPDVHLGLYDDVIVFDH  228

Query  836   VDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPS  1015
             V+KKA +IHWV+LD YSS  +A+ +G  +LE LVS+V D+  PRL + S++FNT+ FGP 
Sbjct  229   VEKKAHVIHWVQLDQYSSVEEAFNDGINRLETLVSRVHDIITPRLPAGSIEFNTQLFGPE  288

Query  1016  LAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYM  1195
             L   ++TS EYK AVLKAKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYM
Sbjct  289   LEDSSLTSEEYKEAVLKAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYM  348

Query  1196  TYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAE  1375
             TY+QARGCILVASSPEILT VKK  + NRPLAGT +RGKT +ED++LE  LLNDEK+ AE
Sbjct  349   TYLQARGCILVASSPEILTHVKKRTITNRPLAGTVRRGKTAKEDLILEKQLLNDEKQCAE  408

Query  1376  HTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAAL  1555
             H MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGEL D LT WDALR AL
Sbjct  409   HIMLVDLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVTGELRDDLTSWDALRTAL  468

Query  1556  PVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDT  1735
             PVGTVSGAPKV+AMELIDQLE TRRGPYSGGFGGISF G+MDIALALRTIVF      DT
Sbjct  469   PVGTVSGAPKVRAMELIDQLEVTRRGPYSGGFGGISFSGNMDIALALRTIVFPTSFRYDT  528

Query  1736  LSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             + S     +R+EW+AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  529   MYSYKDVNKRREWVAHLQAGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  583



>ref|XP_011032135.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=606

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/554 (73%), Positives = 462/554 (83%), Gaps = 18/554 (3%)
 Frame = +2

Query  242   RTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYR  421
             R   LKCS+S             +LD + A+F EASK  NLIPL++ IFSDHLTPVLAYR
Sbjct  65    RGCTLKCSAS-------------TLDNQVARFQEASKNGNLIPLYRYIFSDHLTPVLAYR  111

Query  422   CLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTE  601
             CLV EDDR+ PSFLFESVEPG  +ST+GRYSVVGAQP MEI+AKEN VTI+DH  G+  E
Sbjct  112   CLVREDDRDAPSFLFESVEPGLDASTIGRYSVVGAQPRMEIVAKENMVTIMDHYDGRRME  171

Query  602   KVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDR  781
             ++VEDPM V R I E WKPQL  +LP+AFCGGWVGYFSYDTVRYVEKKKLPF+ AP DDR
Sbjct  172   EIVEDPMEVPRKIMEGWKPQLIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSGAPPDDR  231

Query  782   NLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDP  961
             NLPD+HLGLYD+VIVFDHV+KKA +IHWV+LD +SS  +AY +G  +LE+++S+V D+ P
Sbjct  232   NLPDVHLGLYDDVIVFDHVEKKACVIHWVQLDRFSSVKEAYEDGMNRLESILSRVHDIAP  291

Query  962   PRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTA  1141
             PRL + S+   TR FGP L   +MTS EYK+AVL+AK+HILAGDIFQIVLSQRFERRT A
Sbjct  292   PRLPAGSIKLFTRLFGPKLENSSMTSEEYKDAVLQAKDHILAGDIFQIVLSQRFERRTFA  351

Query  1142  DPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPE  1321
             DPFE+YRALR+VNPSPYMTY+QARGCILVASSPEILTRVKK ++ NRPLAGT +RGKTP+
Sbjct  352   DPFEIYRALRVVNPSPYMTYLQARGCILVASSPEILTRVKKEKITNRPLAGTVRRGKTPK  411

Query  1322  EDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTV  1501
             ED+MLE  LLND+K+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTV
Sbjct  412   EDLMLEKELLNDQKQCAEHIMLVDLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTV  471

Query  1502  TGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMD  1681
             TGELLD+LT WD LRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGGFGGISF GDMD
Sbjct  472   TGELLDNLTRWDVLRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGFGGISFSGDMD  531

Query  1682  IALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAG  1846
             IALALRTIVF      DT+ S      R+EW+AHLQ+GAGIVADS+P  EQ+ECENK A 
Sbjct  532   IALALRTIVFPTSTRYDTMYSYKDVNTRREWVAHLQAGAGIVADSDPADEQRECENKAAA  591

Query  1847  LSRAIDLAESAFVK  1888
             L+RAIDLAESAF+K
Sbjct  592   LARAIDLAESAFLK  605



>ref|XP_006410032.1| hypothetical protein EUTSA_v10016377mg [Eutrema salsugineum]
 gb|ESQ51485.1| hypothetical protein EUTSA_v10016377mg [Eutrema salsugineum]
Length=627

 Score =   792 bits (2046),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/601 (67%), Positives = 471/601 (78%), Gaps = 26/601 (4%)
 Frame = +2

Query  161   PSHLISELPITSI-----VSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPPSLD--  319
             PS L S  P TS+      S   S   P  R+R +  KCSSS            PSLD  
Sbjct  38    PSSLASP-PATSLHFDGGASISRSNLLPVSRLRPI--KCSSS----------PTPSLDLL  84

Query  320   -KEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSS  496
               +  KF EA++  NL+P+++C+FSDHLTP+LAYRCLV EDDR+ PSFLFESVEPG ++S
Sbjct  85    GDQLIKFKEAAEKGNLVPVYRCVFSDHLTPILAYRCLVKEDDRDAPSFLFESVEPGLQAS  144

Query  497   TVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADL  676
              +GRYSVVGAQPT+EI+AK N VT++DH +G  TE+ VEDPM V + I EEWKPQ   +L
Sbjct  145   NIGRYSVVGAQPTIEIVAKGNVVTVMDHGAGLRTEEEVEDPMMVPQKIMEEWKPQRIDEL  204

Query  677   PDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFI  856
             P+AFCGGWVGYFSYDTVRYVEKKKLPF++AP+DDR+LPD+HLGLYD+VIVFDHV+KKA++
Sbjct  205   PEAFCGGWVGYFSYDTVRYVEKKKLPFSNAPEDDRSLPDVHLGLYDDVIVFDHVEKKAYV  264

Query  857   IHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMT  1036
             IHWVR+D   S    + +G  +LE+L S++QD  PP++ +  +   T  FGP L K  MT
Sbjct  265   IHWVRIDRDRSVEDNFSDGMNRLESLTSRIQDQKPPKMPTGFIKLRTELFGPKLEKSTMT  324

Query  1037  SGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARG  1216
                YK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYM Y+QARG
Sbjct  325   REAYKEAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMAYLQARG  384

Query  1217  CILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDL  1396
             CILVASSPEIL R K  ++ NRPLAGT +RGKTP+ED+MLE  LL+DEK+ AEH MLVDL
Sbjct  385   CILVASSPEILLRSKNRKITNRPLAGTVRRGKTPKEDLMLEKELLSDEKQCAEHVMLVDL  444

Query  1397  GRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSG  1576
             GRNDVGKVSK GSV VE+LMNIERYSHVMHISSTV GELLD LT WDALRAALPVGTVSG
Sbjct  445   GRNDVGKVSKPGSVEVEKLMNIERYSHVMHISSTVKGELLDDLTSWDALRAALPVGTVSG  504

Query  1577  APKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS----  1744
             APKVKAMELID+LE TRRGPYSGGFGGISF GDMDIALALRT+VF  +   DTL S    
Sbjct  505   APKVKAMELIDELEVTRRGPYSGGFGGISFNGDMDIALALRTMVFPTNTRYDTLYSYKHP  564

Query  1745  -RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKTKRKPQPPPAV  1921
              RR+EWIAH+Q+GAG+VADSNPD EQKECENK A L+RAIDLAES+F++T       P V
Sbjct  565   QRRREWIAHIQAGAGVVADSNPDDEQKECENKAAALARAIDLAESSFLETPEVTTSTPRV  624

Query  1922  H  1924
             +
Sbjct  625   N  625



>emb|CDX95746.1| BnaC03g26270D [Brassica napus]
Length=625

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/547 (70%), Positives = 454/547 (83%), Gaps = 10/547 (2%)
 Frame = +2

Query  281   PVTRSPYSPPSLDKEEA-----KFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDR  445
             P+  SP   PSL  + +     KF EA++  NL+PL++C+FSDHLTP+LAYRCLV EDDR
Sbjct  66    PIKSSPSPTPSLAADSSVNQLTKFKEAAEKGNLVPLYRCVFSDHLTPILAYRCLVKEDDR  125

Query  446   ETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMT  625
             + PSFLFESVEPG ++S +GRYSVVGAQPT+EI+AK N VT++DH + + T + V+DPM 
Sbjct  126   DAPSFLFESVEPGLQASNIGRYSVVGAQPTIEIVAKGNVVTVMDHGAVRRTVEEVDDPMM  185

Query  626   VARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLG  805
             V + I EEW+PQ   +LP+AFCGGWVGYFSYDTVR+VEKKKLPF++AP+DDR+LPD+HLG
Sbjct  186   VPQKIMEEWEPQRIDELPEAFCGGWVGYFSYDTVRFVEKKKLPFSNAPEDDRSLPDVHLG  245

Query  806   LYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASV  985
             LYD+VIVFDHV+KKA++IHWVR+D   S    Y +G  QLE+LVS++QD  PP++ +  +
Sbjct  246   LYDDVIVFDHVEKKAYVIHWVRIDKDRSVEDNYTDGMYQLESLVSRIQDQKPPKMPTGFI  305

Query  986   DFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRA  1165
                T +FGP L K  MTS  YK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRA
Sbjct  306   KLRTEQFGPKLEKSTMTSEAYKEAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEIYRA  365

Query  1166  LRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEML  1345
             LRIVNPSPYM Y+QARGCILVASSPEIL R K  ++ NRPLAGT +RGKTP+ED+MLE  
Sbjct  366   LRIVNPSPYMAYLQARGCILVASSPEILLRSKNRKITNRPLAGTVRRGKTPKEDLMLEKE  425

Query  1346  LLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHL  1525
             LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTV GELLD L
Sbjct  426   LLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVEVEKLMNIERYSHVMHISSTVKGELLDDL  485

Query  1526  TCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTI  1705
             T WDALRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF GDMDIALALRT+
Sbjct  486   TSWDALRAALPVGTVSGAPKVKAMELIDKLEVTRRGPYSGGFGGISFNGDMDIALALRTM  545

Query  1706  VFLNDGMNDTL-----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLA  1870
             VF  +   DTL     S RR+EWIAH+Q+GAG+VADSNP+ EQ+ECENK A L+RAIDLA
Sbjct  546   VFPTNTRYDTLYSYKHSQRRREWIAHIQAGAGVVADSNPEDEQRECENKAAALARAIDLA  605

Query  1871  ESAFVKT  1891
             ES+F++T
Sbjct  606   ESSFLET  612



>ref|XP_009133845.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic 
isoform X3 [Brassica rapa]
Length=625

 Score =   792 bits (2045),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/551 (70%), Positives = 456/551 (83%), Gaps = 8/551 (1%)
 Frame = +2

Query  281   PVTRSPYSPPSLD---KEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRET  451
             P+  SP   PSLD    + AKF EA++  NL+PL++C+FSDHLTP+LAYRCLV EDDR+ 
Sbjct  68    PIKSSPSPTPSLDSSANQLAKFKEAAEKGNLVPLYRCVFSDHLTPILAYRCLVKEDDRDA  127

Query  452   PSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVA  631
             PSFLFESVEPG ++S +GRYSVVGAQPT+EI+AK N VT++DH +G+ T + V+DPM V 
Sbjct  128   PSFLFESVEPGLQASNIGRYSVVGAQPTIEIVAKGNVVTVMDHGAGRRTVEEVDDPMVVP  187

Query  632   RSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLY  811
             + I EEW+PQ   +LP+AFCGGWVGYFSYDTVRYVEKKKLPF++AP+DDR+LPD+HLGLY
Sbjct  188   QKIMEEWEPQRIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSNAPEDDRSLPDVHLGLY  247

Query  812   DNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDF  991
             D+VIVFDHV+KKA++IHWVR+D   S    Y +G  QLE+LVS++QD  PP++ +  +  
Sbjct  248   DDVIVFDHVEKKAYVIHWVRIDKDRSVEDNYSDGMYQLESLVSRIQDQKPPKMPTGFIKL  307

Query  992   NTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALR  1171
              T +FGP L K  MTS  YK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALR
Sbjct  308   RTEQFGPKLEKSTMTSEAYKEAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALR  367

Query  1172  IVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLL  1351
             IVNPSPYM Y+QARGCILVASSPEIL R K  ++ NRPLAGT +RGKTP+ED+M E  LL
Sbjct  368   IVNPSPYMAYLQARGCILVASSPEILLRSKNRKITNRPLAGTVRRGKTPKEDLMQEKELL  427

Query  1352  NDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTC  1531
             +DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTV GELLD LT 
Sbjct  428   SDEKQCAEHIMLVDLGRNDVGKVSKPGSVEVEKLMNIERYSHVMHISSTVKGELLDDLTS  487

Query  1532  WDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVF  1711
             WDALRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF GDMDIAL+LRT+VF
Sbjct  488   WDALRAALPVGTVSGAPKVKAMELIDKLEVTRRGPYSGGFGGISFNGDMDIALSLRTMVF  547

Query  1712  LNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAES  1876
               +   DTL S     RR+E IAH+Q+GAG+VADSNP+ EQ+ECENK A L+RAIDLAES
Sbjct  548   PTNTRYDTLYSYKHPQRRREGIAHIQAGAGVVADSNPEDEQRECENKAAALARAIDLAES  607

Query  1877  AFVKTKRKPQP  1909
             +F++T    +P
Sbjct  608   SFLETPEVTRP  618



>ref|XP_010469929.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic 
[Camelina sativa]
Length=625

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/554 (70%), Positives = 459/554 (83%), Gaps = 17/554 (3%)
 Frame = +2

Query  254   LKCSSSLQIPVTRSPYSPPSLDKEEAKFI---EASKTSNLIPLHKCIFSDHLTPVLAYRC  424
             +KCSSS         Y+PP LD  E +FI   +AS+  NL+PL++C+FSDHLTP+LAYRC
Sbjct  66    IKCSSS--------SYTPP-LDLSEEQFIKFKQASEKGNLVPLYRCVFSDHLTPILAYRC  116

Query  425   LVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEK  604
             LV EDDR+ PSFLFESVEPG +SS +GRYSVVGAQPT+EI+AK N VT++DH +G  TE+
Sbjct  117   LVKEDDRDAPSFLFESVEPGLQSSNIGRYSVVGAQPTIEIVAKGNVVTVMDHGAGLRTEE  176

Query  605   VVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRN  784
              VEDPM V + I +EWKPQ   +LP+AFCGGWVGYFSYDTVRYVEKKKLPF++AP+DDR+
Sbjct  177   EVEDPMMVPQKIMDEWKPQRIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSNAPEDDRS  236

Query  785   LPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPP  964
             LPD+HLGLYD+VIVFDHV+KKA++IHWVR+D   S    + +G  +LE+L S++QD  PP
Sbjct  237   LPDVHLGLYDDVIVFDHVEKKAYVIHWVRIDKDRSVEDNFTDGMNRLESLTSRIQDQRPP  296

Query  965   RLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTAD  1144
             ++ +  +   T+ FGP L K  MTS  YK AV++AKEHIL+GDIFQIVLSQRFERRT AD
Sbjct  297   KMPTGFIKLRTQLFGPKLEKSTMTSEAYKEAVVEAKEHILSGDIFQIVLSQRFERRTFAD  356

Query  1145  PFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEE  1324
             PFE+YRALRIVNPSPYM Y+QARGCILVASSPEIL R K  ++ NRPLAGT +RGKTP+E
Sbjct  357   PFEIYRALRIVNPSPYMAYLQARGCILVASSPEILLRSKNRKITNRPLAGTVRRGKTPKE  416

Query  1325  DVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVT  1504
             D+MLE  LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTV 
Sbjct  417   DLMLEKELLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVEVEKLMNIERYSHVMHISSTVK  476

Query  1505  GELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDI  1684
             GELLD+LT WDALRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF GDMDI
Sbjct  477   GELLDNLTSWDALRAALPVGTVSGAPKVKAMELIDKLEVTRRGPYSGGFGGISFNGDMDI  536

Query  1685  ALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGL  1849
             ALALRT+VF  +   DTL S     RR+EWIAH+Q+GAG+VADSNPD E +ECENK A L
Sbjct  537   ALALRTMVFPTNTRYDTLYSYKHPQRRREWIAHIQAGAGVVADSNPDDEHRECENKAAAL  596

Query  1850  SRAIDLAESAFVKT  1891
             +RAIDLAES+F+++
Sbjct  597   ARAIDLAESSFLES  610



>ref|XP_002879228.1| hypothetical protein ARALYDRAFT_481885 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55487.1| hypothetical protein ARALYDRAFT_481885 [Arabidopsis lyrata subsp. 
lyrata]
Length=622

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/558 (70%), Positives = 459/558 (82%), Gaps = 17/558 (3%)
 Frame = +2

Query  242   RTLQLKCSSSLQIPVTRSPYSPPSLDKEE---AKFIEASKTSNLIPLHKCIFSDHLTPVL  412
             R   +KCSSS         Y+P SLD  E    KF +AS+  NL+PL++C+FSDHLTP+L
Sbjct  61    RLPSIKCSSS--------SYTP-SLDLSEEQFTKFKQASEKGNLVPLYRCVFSDHLTPIL  111

Query  413   AYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGK  592
             AYRCLV EDDR+ PSFLFESVEPG +SS +GR+SVVGAQPT+EI+AK N VT++DH +G 
Sbjct  112   AYRCLVKEDDRDAPSFLFESVEPGLQSSNIGRFSVVGAQPTIEIVAKGNAVTVMDHGAGL  171

Query  593   LTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQ  772
              TE+ V+DPM V + I +EWKPQ   +LP+AFCGGWVGYFSYDTVRYVEKKKLPF++AP+
Sbjct  172   RTEEEVDDPMMVPQKIMDEWKPQRIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSNAPE  231

Query  773   DDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQD  952
             DDR+LPD+HLGLYD+VIVFDHV+KKA++IHWVR+D   S    + +G  +LE+L +++QD
Sbjct  232   DDRSLPDVHLGLYDDVIVFDHVEKKAYVIHWVRIDKDRSVEDNFTDGMNRLESLTARIQD  291

Query  953   VDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERR  1132
               PP++ +  +   T+ FGP L K  MTS  YK AV++AKEHILAGDIFQIVLSQRFERR
Sbjct  292   QKPPKMPTGFIKLRTQLFGPKLEKSTMTSEAYKEAVVEAKEHILAGDIFQIVLSQRFERR  351

Query  1133  TTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGK  1312
             T ADPFE+YRALRIVNPSPYM Y+QARGCILVASSPEIL R K  ++ NRPLAGT +RGK
Sbjct  352   TFADPFEIYRALRIVNPSPYMAYLQARGCILVASSPEILLRSKNRKITNRPLAGTVRRGK  411

Query  1313  TPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHIS  1492
             TP+ED+MLE  LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHIS
Sbjct  412   TPKEDLMLEKELLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVEVEKLMNIERYSHVMHIS  471

Query  1493  STVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVG  1672
             STV GELLD+LT WDALRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF G
Sbjct  472   STVKGELLDNLTSWDALRAALPVGTVSGAPKVKAMELIDELEVTRRGPYSGGFGGISFNG  531

Query  1673  DMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENK  1837
             DMDIALALRT+VF  +   DTL S     RR+EWIAH+Q+GAG+VADSNPD E +ECENK
Sbjct  532   DMDIALALRTMVFPTNTRYDTLYSYKHPQRRREWIAHIQAGAGVVADSNPDDEHRECENK  591

Query  1838  VAGLSRAIDLAESAFVKT  1891
              A L+RAIDLAES+F++T
Sbjct  592   AAALARAIDLAESSFLET  609



>ref|XP_009130894.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic 
isoform X1 [Brassica rapa]
Length=621

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/628 (64%), Positives = 483/628 (77%), Gaps = 49/628 (8%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLPP--SHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPV  286
             N+  ++ ++  +RL+P   S  ++     S  S ++S YAPSLR     +KC       V
Sbjct  6     NVATVKPLSFSRRLVPSAVSRGLASSVTVSGYSGKTSAYAPSLR----SIKC-------V  54

Query  287   TRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLF  466
             + SP +  S+  +  K  +ASK++NL+P+ +CIFSD LTPVLAYRCLV EDDRE PSFLF
Sbjct  55    SVSPEA--SIVSDTKKLADASKSTNLVPIFRCIFSDQLTPVLAYRCLVKEDDREAPSFLF  112

Query  467   ESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISE  646
             ESVEPGS+ S+VGRYSVVGAQP MEI+AKE+KV ++DH SG LTE+ VEDPM + R ISE
Sbjct  113   ESVEPGSQMSSVGRYSVVGAQPAMEIVAKEDKVIVMDHKSGSLTEEYVEDPMEIPRKISE  172

Query  647   EWKP--QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNV  820
              W P  QL  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF+ AP+DDRNLPD+HLGLYD+V
Sbjct  173   SWNPDPQLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNLPDMHLGLYDDV  232

Query  821   IVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTR  1000
             +VFDHV+KKA++IHW+RLD+      AY  G + LE LVSK+ D+ PP+L++ +V+  TR
Sbjct  233   VVFDHVEKKAYVIHWIRLDATVPYETAYSNGLQHLENLVSKLHDIAPPKLAAGNVNLQTR  292

Query  1001  EFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVN  1180
             +FGP+L   N+T  EYK AV+ AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+VN
Sbjct  293   QFGPALENSNVTREEYKEAVVNAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRVVN  352

Query  1181  PSPYMTY---------------------------MQARGCILVASSPEILTRVKKNRVVN  1279
             PSPYM Y                           +QARGCILVASSPEILT+VK+N++VN
Sbjct  353   PSPYMGYLQVCNGETCSCTTMYLFLRWITIDAFNLQARGCILVASSPEILTKVKQNKIVN  412

Query  1280  RPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMN  1459
             RPLAGT++RGKT  ED  LE  LL +EK+ AEH MLVDLGRNDVGKV+K GSV VE+LMN
Sbjct  413   RPLAGTSRRGKTEVEDKRLEKELLENEKQCAEHIMLVDLGRNDVGKVAKYGSVKVEKLMN  472

Query  1460  IERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPY  1639
             IERYSHVMHISSTVTGEL D L+CWD LRAALPVGTVSGAPKV A+ELID+LE TRRGPY
Sbjct  473   IERYSHVMHISSTVTGELQDDLSCWDTLRAALPVGTVSGAPKVNALELIDELEPTRRGPY  532

Query  1640  SGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSN  1804
             SGGFGG+SF GDMDIAL+LRTIVF      +T+ S     +R+EW+A+LQ+GAG+VADS+
Sbjct  533   SGGFGGVSFTGDMDIALSLRTIVFPTASQYNTMYSYKDANKRREWVAYLQAGAGVVADSD  592

Query  1805  PDSEQKECENKVAGLSRAIDLAESAFVK  1888
             P+ E +EC+NK AGL+RAIDLAESAFVK
Sbjct  593   PEDEHRECQNKAAGLARAIDLAESAFVK  620



>ref|XP_010046381.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic 
[Eucalyptus grandis]
Length=734

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/585 (71%), Positives = 470/585 (80%), Gaps = 14/585 (2%)
 Frame = +2

Query  173   ISELPITSIVSRRSSGYAPSL--RVRTLQLKC------SSSLQIPVTRSPYSP-PSLDKE  325
             +  +P     SRRS G APS    +   +          S  + P  R    P PSL  +
Sbjct  148   VGGIPSRPAGSRRSPGRAPSRPPSISAAEFPAPSSLRSRSRSRFPALRCSAQPSPSLVDQ  207

Query  326   EAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVG  505
              AKF EA+K  NL+PL+KCIFSDHLTPVLAYRCLV EDDR+ PSFLFESVEPG + S++G
Sbjct  208   SAKFQEAAKKGNLVPLYKCIFSDHLTPVLAYRCLVKEDDRDAPSFLFESVEPGLQVSSIG  267

Query  506   RYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDA  685
             RYS VGAQPT+EI+AKEN VTI+DH+ G  TE++VEDPM V R I E WKPQ+  +LP+A
Sbjct  268   RYSFVGAQPTIEIVAKENMVTIMDHEKGSRTEEIVEDPMVVPRRIMEGWKPQMIDELPEA  327

Query  686   FCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHW  865
             FCGGWVGYFSYDTVRYVEK+KLPF SAP DDRNLPD+HLGLY +VIVFDHVDKKA++IHW
Sbjct  328   FCGGWVGYFSYDTVRYVEKRKLPFCSAPSDDRNLPDVHLGLYVDVIVFDHVDKKAYVIHW  387

Query  866   VRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGE  1045
             VRLD Y S  +A+ +G  +LE LVS+V D+DPPRL + S+   TR FGP L   +MTS E
Sbjct  388   VRLDQYPSVDEAFDDGMNRLETLVSRVHDIDPPRLPAGSIKLFTRLFGPKLEMSSMTSEE  447

Query  1046  YKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCIL  1225
             YK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYM Y+Q RGCIL
Sbjct  448   YKKAVLQAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMAYLQGRGCIL  507

Query  1226  VASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRN  1405
             VASSPEILTRVKK RV NRPLAGT +RGKTP+ED+MLE  LL+DEK+ AEH MLVDLGRN
Sbjct  508   VASSPEILTRVKKRRVTNRPLAGTVRRGKTPKEDLMLEKELLSDEKQCAEHIMLVDLGRN  567

Query  1406  DvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPK  1585
             DVGKVS  GSV VE+LMNIERYSHVMHISSTVTGELL++L+ WDALRAALPVGTVSGAPK
Sbjct  568   DVGKVSIPGSVKVEKLMNIERYSHVMHISSTVTGELLENLSGWDALRAALPVGTVSGAPK  627

Query  1586  VKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RR  1750
             VKAMELIDQLE TRRGPYSGGFGGISF GDMDIALALRTIVF      DT+ S      R
Sbjct  628   VKAMELIDQLEVTRRGPYSGGFGGISFSGDMDIALALRTIVFPTGIRYDTMYSYKDMNNR  687

Query  1751  KEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             +EW+AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  688   REWVAHLQAGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  732



>ref|XP_004500675.1| PREDICTED: anthranilate synthase component I-1, chloroplastic-like 
[Cicer arietinum]
Length=601

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/526 (73%), Positives = 443/526 (84%), Gaps = 5/526 (1%)
 Frame = +2

Query  323   EEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTV  502
             E +KF+E SK  NLIPL++CIFSD LTPVLAYR LV+EDDRE PSFLFES EP  ++S V
Sbjct  74    ERSKFVETSKNGNLIPLYQCIFSDQLTPVLAYRSLVNEDDREAPSFLFESAEPNFQASNV  133

Query  503   GRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPD  682
             GRYSVVGA+PTMEI+AKE+KVTI+DH+SG LTE++V+DPM + R IS++W+P L+ +LP+
Sbjct  134   GRYSVVGAKPTMEIVAKEDKVTIMDHESGHLTEEIVDDPMAIPRRISQDWRPCLSDELPN  193

Query  683   AFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIH  862
             AFCGGW GYFSYDTVRYVEKKKL F+ AP+DDRNL DIHLGLY+ VIVFDHV+KKA++I 
Sbjct  194   AFCGGWAGYFSYDTVRYVEKKKLQFSDAPKDDRNLADIHLGLYETVIVFDHVEKKAYVIL  253

Query  863   WVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSG  1042
             WVR D YSS   AY +GK++L+ LV K+QD +PPRL+  SVD  TR FG  L + NMTS 
Sbjct  254   WVRTDRYSSVESAYTDGKERLQKLVDKLQDDNPPRLAPGSVDLQTRHFGTPLKESNMTSD  313

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
              YK AVL+AKEHI AGDIFQIVLSQRFERRT ADPFEVYRALR+VNPSPYMTY+QARGCI
Sbjct  314   AYKEAVLQAKEHIKAGDIFQIVLSQRFERRTFADPFEVYRALRVVNPSPYMTYLQARGCI  373

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
             LVASSPEIL R+K  ++VNRPLAGT KRGKT EED  L   LL DEK+ AEH MLVDLGR
Sbjct  374   LVASSPEILARIKNKKIVNRPLAGTCKRGKTLEEDEKLSAQLLKDEKQCAEHVMLVDLGR  433

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             NDVGKVSKSGSV VE+LMN+ERYSHVMHISSTVTGEL DHLTCWDALRAALPVGTVSGAP
Sbjct  434   NDVGKVSKSGSVKVEKLMNVERYSHVMHISSTVTGELQDHLTCWDALRAALPVGTVSGAP  493

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----R  1747
             KV+AM+LID+LE   RGPYSGGFG ISF GDMDIALALRTIVF      DT+ S     +
Sbjct  494   KVRAMQLIDELEVAMRGPYSGGFGYISFSGDMDIALALRTIVFPTGTRYDTMYSYKDLNQ  553

Query  1748  RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             R+EWIA+LQ+GAGIVADS+P  E +EC+NK A L+R+IDLAESAFV
Sbjct  554   RREWIAYLQAGAGIVADSDPADEHQECQNKAAALARSIDLAESAFV  599



>ref|XP_009133842.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic 
isoform X1 [Brassica rapa]
Length=627

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/553 (70%), Positives = 455/553 (82%), Gaps = 10/553 (2%)
 Frame = +2

Query  281   PVTRSPYSPPSLDKEE-----AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDR  445
             P+  SP   PSL  +      AKF EA++  NL+PL++C+FSDHLTP+LAYRCLV EDDR
Sbjct  68    PIKSSPSPTPSLAADSSANQLAKFKEAAEKGNLVPLYRCVFSDHLTPILAYRCLVKEDDR  127

Query  446   ETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMT  625
             + PSFLFESVEPG ++S +GRYSVVGAQPT+EI+AK N VT++DH +G+ T + V+DPM 
Sbjct  128   DAPSFLFESVEPGLQASNIGRYSVVGAQPTIEIVAKGNVVTVMDHGAGRRTVEEVDDPMV  187

Query  626   VARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLG  805
             V + I EEW+PQ   +LP+AFCGGWVGYFSYDTVRYVEKKKLPF++AP+DDR+LPD+HLG
Sbjct  188   VPQKIMEEWEPQRIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSNAPEDDRSLPDVHLG  247

Query  806   LYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASV  985
             LYD+VIVFDHV+KKA++IHWVR+D   S    Y +G  QLE+LVS++QD  PP++ +  +
Sbjct  248   LYDDVIVFDHVEKKAYVIHWVRIDKDRSVEDNYSDGMYQLESLVSRIQDQKPPKMPTGFI  307

Query  986   DFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRA  1165
                T +FGP L K  MTS  YK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRA
Sbjct  308   KLRTEQFGPKLEKSTMTSEAYKEAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEIYRA  367

Query  1166  LRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEML  1345
             LRIVNPSPYM Y+QARGCILVASSPEIL R K  ++ NRPLAGT +RGKTP+ED+M E  
Sbjct  368   LRIVNPSPYMAYLQARGCILVASSPEILLRSKNRKITNRPLAGTVRRGKTPKEDLMQEKE  427

Query  1346  LLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHL  1525
             LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTV GELLD L
Sbjct  428   LLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVEVEKLMNIERYSHVMHISSTVKGELLDDL  487

Query  1526  TCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTI  1705
             T WDALRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF GDMDIAL+LRT+
Sbjct  488   TSWDALRAALPVGTVSGAPKVKAMELIDKLEVTRRGPYSGGFGGISFNGDMDIALSLRTM  547

Query  1706  VFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLA  1870
             VF  +   DTL S     RR+E IAH+Q+GAG+VADSNP+ EQ+ECENK A L+RAIDLA
Sbjct  548   VFPTNTRYDTLYSYKHPQRRREGIAHIQAGAGVVADSNPEDEQRECENKAAALARAIDLA  607

Query  1871  ESAFVKTKRKPQP  1909
             ES+F++T    +P
Sbjct  608   ESSFLETPEVTRP  620



>ref|XP_009133844.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic 
isoform X2 [Brassica rapa]
Length=626

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/552 (70%), Positives = 455/552 (82%), Gaps = 9/552 (2%)
 Frame = +2

Query  281   PVTRSPYSPPSLD----KEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRE  448
             P+  SP   PSL      + AKF EA++  NL+PL++C+FSDHLTP+LAYRCLV EDDR+
Sbjct  68    PIKSSPSPTPSLADSSANQLAKFKEAAEKGNLVPLYRCVFSDHLTPILAYRCLVKEDDRD  127

Query  449   TPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTV  628
              PSFLFESVEPG ++S +GRYSVVGAQPT+EI+AK N VT++DH +G+ T + V+DPM V
Sbjct  128   APSFLFESVEPGLQASNIGRYSVVGAQPTIEIVAKGNVVTVMDHGAGRRTVEEVDDPMVV  187

Query  629   ARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGL  808
              + I EEW+PQ   +LP+AFCGGWVGYFSYDTVRYVEKKKLPF++AP+DDR+LPD+HLGL
Sbjct  188   PQKIMEEWEPQRIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSNAPEDDRSLPDVHLGL  247

Query  809   YDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVD  988
             YD+VIVFDHV+KKA++IHWVR+D   S    Y +G  QLE+LVS++QD  PP++ +  + 
Sbjct  248   YDDVIVFDHVEKKAYVIHWVRIDKDRSVEDNYSDGMYQLESLVSRIQDQKPPKMPTGFIK  307

Query  989   FNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRAL  1168
               T +FGP L K  MTS  YK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRAL
Sbjct  308   LRTEQFGPKLEKSTMTSEAYKEAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEIYRAL  367

Query  1169  RIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLL  1348
             RIVNPSPYM Y+QARGCILVASSPEIL R K  ++ NRPLAGT +RGKTP+ED+M E  L
Sbjct  368   RIVNPSPYMAYLQARGCILVASSPEILLRSKNRKITNRPLAGTVRRGKTPKEDLMQEKEL  427

Query  1349  LNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLT  1528
             L+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTV GELLD LT
Sbjct  428   LSDEKQCAEHIMLVDLGRNDVGKVSKPGSVEVEKLMNIERYSHVMHISSTVKGELLDDLT  487

Query  1529  CWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIV  1708
              WDALRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF GDMDIAL+LRT+V
Sbjct  488   SWDALRAALPVGTVSGAPKVKAMELIDKLEVTRRGPYSGGFGGISFNGDMDIALSLRTMV  547

Query  1709  FLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAE  1873
             F  +   DTL S     RR+E IAH+Q+GAG+VADSNP+ EQ+ECENK A L+RAIDLAE
Sbjct  548   FPTNTRYDTLYSYKHPQRRREGIAHIQAGAGVVADSNPEDEQRECENKAAALARAIDLAE  607

Query  1874  SAFVKTKRKPQP  1909
             S+F++T    +P
Sbjct  608   SSFLETPEVTRP  619



>ref|XP_009371532.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=588

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/555 (74%), Positives = 457/555 (82%), Gaps = 17/555 (3%)
 Frame = +2

Query  236   RVRTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLA  415
             RVRTL  +CS+           S  SL  E  KF+EASK  NLIPL + IFSDHLTPVLA
Sbjct  44    RVRTL--RCSA----------LSSASLADESEKFVEASKKGNLIPLSRSIFSDHLTPVLA  91

Query  416   YRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKL  595
             YRCLV EDDR+ PSFLFESVEPGS  S VGRYS +GAQP++EI+AKEN VTI+DH  G  
Sbjct  92    YRCLVKEDDRDAPSFLFESVEPGSNDSNVGRYSFIGAQPSIEIVAKENMVTIMDHREGCR  151

Query  596   TEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQD  775
             TE++VEDPMTV R I E W PQL  +LP+AFCGGWVGYFSYDTVRYVEKKKLPF SAP D
Sbjct  152   TEEIVEDPMTVPRRIMEGWTPQLLDELPEAFCGGWVGYFSYDTVRYVEKKKLPFPSAPPD  211

Query  776   DRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDV  955
             DRNLPD+HLGLYD+VIVFDHVDKKA +IHWV+LD YSS  +A+ +G  +LE L+SKV D+
Sbjct  212   DRNLPDVHLGLYDDVIVFDHVDKKAHVIHWVQLDQYSSVDEAFNDGINRLETLLSKVHDI  271

Query  956   DPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRT  1135
               PRL + S++FNT+ FG  L   ++TS EYK AVL+AKEHILAGDIFQIVLSQRFERRT
Sbjct  272   ITPRLPAGSIEFNTQLFGTKLEDSSLTSEEYKEAVLEAKEHILAGDIFQIVLSQRFERRT  331

Query  1136  TADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKT  1315
              ADPFE+YRALRIVNPSPYMTY+QARGCILVASSPEILTRVKK  + NRPLAGT +RGKT
Sbjct  332   FADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKKTITNRPLAGTVRRGKT  391

Query  1316  PEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISS  1495
             P+ED+MLE  LLNDEK+ AEH MLVDLGRNDVGKVSK GSV VE LMNIERYSHVMHISS
Sbjct  392   PKEDLMLEKQLLNDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEELMNIERYSHVMHISS  451

Query  1496  TVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGD  1675
             TVTGELLD LT WD LR ALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF G+
Sbjct  452   TVTGELLDDLTSWDVLRTALPVGTVSGAPKVKAMELIDKLEVTRRGPYSGGFGGISFSGN  511

Query  1676  MDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKV  1840
             MDIALALRTIVF      DT+ S     +R+EW+AHLQ+GAGIVADS+P  EQ+ECENK 
Sbjct  512   MDIALALRTIVFPTSFRYDTMYSYKDTNKRREWVAHLQAGAGIVADSDPADEQRECENKA  571

Query  1841  AGLSRAIDLAESAFV  1885
             A L+RAIDLAES+FV
Sbjct  572   AALARAIDLAESSFV  586



>ref|XP_009371533.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=587

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/555 (74%), Positives = 459/555 (83%), Gaps = 18/555 (3%)
 Frame = +2

Query  236   RVRTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLA  415
             RVRTL  +CS+           S  SLD+ E KF+EASK  NLIPL + IFSDHLTPVLA
Sbjct  44    RVRTL--RCSA----------LSSASLDESE-KFVEASKKGNLIPLSRSIFSDHLTPVLA  90

Query  416   YRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKL  595
             YRCLV EDDR+ PSFLFESVEPGS  S VGRYS +GAQP++EI+AKEN VTI+DH  G  
Sbjct  91    YRCLVKEDDRDAPSFLFESVEPGSNDSNVGRYSFIGAQPSIEIVAKENMVTIMDHREGCR  150

Query  596   TEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQD  775
             TE++VEDPMTV R I E W PQL  +LP+AFCGGWVGYFSYDTVRYVEKKKLPF SAP D
Sbjct  151   TEEIVEDPMTVPRRIMEGWTPQLLDELPEAFCGGWVGYFSYDTVRYVEKKKLPFPSAPPD  210

Query  776   DRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDV  955
             DRNLPD+HLGLYD+VIVFDHVDKKA +IHWV+LD YSS  +A+ +G  +LE L+SKV D+
Sbjct  211   DRNLPDVHLGLYDDVIVFDHVDKKAHVIHWVQLDQYSSVDEAFNDGINRLETLLSKVHDI  270

Query  956   DPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRT  1135
               PRL + S++FNT+ FG  L   ++TS EYK AVL+AKEHILAGDIFQIVLSQRFERRT
Sbjct  271   ITPRLPAGSIEFNTQLFGTKLEDSSLTSEEYKEAVLEAKEHILAGDIFQIVLSQRFERRT  330

Query  1136  TADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKT  1315
              ADPFE+YRALRIVNPSPYMTY+QARGCILVASSPEILTRVKK  + NRPLAGT +RGKT
Sbjct  331   FADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKKTITNRPLAGTVRRGKT  390

Query  1316  PEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISS  1495
             P+ED+MLE  LLNDEK+ AEH MLVDLGRNDVGKVSK GSV VE LMNIERYSHVMHISS
Sbjct  391   PKEDLMLEKQLLNDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEELMNIERYSHVMHISS  450

Query  1496  TVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGD  1675
             TVTGELLD LT WD LR ALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF G+
Sbjct  451   TVTGELLDDLTSWDVLRTALPVGTVSGAPKVKAMELIDKLEVTRRGPYSGGFGGISFSGN  510

Query  1676  MDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKV  1840
             MDIALALRTIVF      DT+ S     +R+EW+AHLQ+GAGIVADS+P  EQ+ECENK 
Sbjct  511   MDIALALRTIVFPTSFRYDTMYSYKDTNKRREWVAHLQAGAGIVADSDPADEQRECENKA  570

Query  1841  AGLSRAIDLAESAFV  1885
             A L+RAIDLAES+FV
Sbjct  571   AALARAIDLAESSFV  585



>ref|XP_002314114.2| hypothetical protein POPTR_0009s04890g [Populus trichocarpa]
 gb|EEE88069.2| hypothetical protein POPTR_0009s04890g [Populus trichocarpa]
Length=591

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/531 (75%), Positives = 453/531 (85%), Gaps = 5/531 (1%)
 Frame = +2

Query  311   SLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSR  490
             S D + A+F EASK  NLIPL++ IFSDHLTPVLAYRCLV EDDR+ PSFLFESVEPG  
Sbjct  60    SGDNQVARFQEASKNGNLIPLYRYIFSDHLTPVLAYRCLVREDDRDAPSFLFESVEPGLD  119

Query  491   SSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTA  670
             +ST+GRYSVVGAQP MEI+AKEN VTI+DH  G+  E++VEDPM V R I E W+PQL  
Sbjct  120   ASTIGRYSVVGAQPRMEIVAKENMVTIMDHYEGRRMEEIVEDPMEVPRKIMEGWEPQLID  179

Query  671   DLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKA  850
             +LP+AFCGGWVGYFSYDTVRYVEKKKLPF+ AP DDRNLPD+HLGLYD+VIVFDHV+KKA
Sbjct  180   ELPEAFCGGWVGYFSYDTVRYVEKKKLPFSGAPPDDRNLPDVHLGLYDDVIVFDHVEKKA  239

Query  851   FIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGN  1030
              +IHWV+LD +SS  +AY +G  +LE ++S+V D+ PPRL + S+   TR FGP L   +
Sbjct  240   CVIHWVQLDRFSSVKEAYEDGMNRLENILSRVHDIAPPRLPAGSIKLFTRLFGPKLENSS  299

Query  1031  MTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQA  1210
             MTS EYK+AVL+AK+HILAGDIFQIVLSQRFERRT ADPFE+YRALR+VNPSPYMTY+QA
Sbjct  300   MTSEEYKDAVLQAKDHILAGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMTYLQA  359

Query  1211  RGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLV  1390
             RGCILVASSPEILTRVKK ++ NRPLAGT +RGKTP+ED+MLE  LLNDEK+ AEH MLV
Sbjct  360   RGCILVASSPEILTRVKKEKITNRPLAGTVRRGKTPKEDLMLEKELLNDEKQCAEHIMLV  419

Query  1391  DLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTV  1570
             DLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGELLD+LT WD LRAALPVGTV
Sbjct  420   DLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVTGELLDNLTRWDVLRAALPVGTV  479

Query  1571  SGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS--  1744
             SGAPKVKAMELIDQLE TRRGPYSGGFGGISF GDMDIALALRTIVF      DT+ S  
Sbjct  480   SGAPKVKAMELIDQLEVTRRGPYSGGFGGISFSGDMDIALALRTIVFPTSTRYDTMYSYK  539

Query  1745  ---RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
                 R+EW+AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAESAF+K
Sbjct  540   DVNTRREWVAHLQAGAGIVADSDPADEQRECENKAAALARAIDLAESAFLK  590



>ref|XP_002525623.1| anthranilate synthase component I, putative [Ricinus communis]
 gb|EEF36741.1| anthranilate synthase component I, putative [Ricinus communis]
Length=614

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/554 (72%), Positives = 460/554 (83%), Gaps = 15/554 (3%)
 Frame = +2

Query  242   RTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYR  421
             R   LKCS+S     T   Y+      + AKF EASK  NL+PL+ CI  DHLTPVLAYR
Sbjct  70    RVPTLKCSAS-----TSQAYA-----DQSAKFQEASKKGNLVPLYHCILCDHLTPVLAYR  119

Query  422   CLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTE  601
             CLV EDDR+ PSFLFESVEPGS +STVGRYSV+GAQP++EI+AKEN VTI+DH  G+ TE
Sbjct  120   CLVKEDDRDAPSFLFESVEPGSDASTVGRYSVLGAQPSVEIVAKENMVTIMDHYEGRRTE  179

Query  602   KVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDR  781
             ++V+DPM V R + E W PQL  +LP+ F GGWVGYFSYDTVRYVEKKKLPF  AP DDR
Sbjct  180   EIVDDPMEVPRKMMESWTPQLVDELPEVFSGGWVGYFSYDTVRYVEKKKLPFDGAPPDDR  239

Query  782   NLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDP  961
             NLPD+HLGLY++V++FDH++KKA++IHWVRLD +S+  +A+ +G  +LE LVS+V ++  
Sbjct  240   NLPDVHLGLYEDVMIFDHLEKKAYLIHWVRLDRFSTVEEAFNDGINRLENLVSRVHNITT  299

Query  962   PRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTA  1141
             PRL + S+  +TR FGP L   +MTS EYK AVL+AKEHILAGDIFQIVLSQRFERRT A
Sbjct  300   PRLPAGSIQLSTRLFGPKLEMSSMTSEEYKAAVLQAKEHILAGDIFQIVLSQRFERRTFA  359

Query  1142  DPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPE  1321
             DPFE+YRALRIVNPSPYM Y+QARGCILVASSPEILTRVKKN+++NRPLAGT +RGKTP+
Sbjct  360   DPFEIYRALRIVNPSPYMAYLQARGCILVASSPEILTRVKKNKIINRPLAGTVRRGKTPK  419

Query  1322  EDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTV  1501
             ED MLE  LLNDEK+ AEH MLVDLGRNDVGKVS+ GSV VERLMNIERYSHVMHISSTV
Sbjct  420   EDKMLEKELLNDEKQCAEHIMLVDLGRNDVGKVSEPGSVKVERLMNIERYSHVMHISSTV  479

Query  1502  TGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMD  1681
             +GELLDHLT WDALRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF GDMD
Sbjct  480   SGELLDHLTSWDALRAALPVGTVSGAPKVKAMELIDELEVTRRGPYSGGFGGISFSGDMD  539

Query  1682  IALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAG  1846
             IALALRTIVF      DT+ S     +R+EW+AHLQ+GAGIVADS+P  EQ+ECENK AG
Sbjct  540   IALALRTIVFPTSTRYDTMYSYNNLNKRREWVAHLQAGAGIVADSDPADEQRECENKAAG  599

Query  1847  LSRAIDLAESAFVK  1888
             L+RAIDLAE +FVK
Sbjct  600   LARAIDLAEESFVK  613



>emb|CDP09175.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/550 (73%), Positives = 461/550 (84%), Gaps = 15/550 (3%)
 Frame = +2

Query  254   LKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVD  433
             LKCS+     +T SP+       + A+F EA+K  NLIPL++ IFSDHLTPVLAYRCLV 
Sbjct  44    LKCST-----ITPSPFV-----DQSARFKEAAKHGNLIPLYRPIFSDHLTPVLAYRCLVR  93

Query  434   EDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVE  613
             EDDRE PSFLFESVEPG + S+VGR+SV+GAQPTMEI+AKEN VT++DH  G+  E+  E
Sbjct  94    EDDREAPSFLFESVEPGLKVSSVGRFSVIGAQPTMEIVAKENMVTVMDHRRGQRVEQFEE  153

Query  614   DPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPD  793
             DPM V R I E+WKPQ   +LP+AFCGGWVGYFSYDTVRYVEKKKLPF++AP DDRNLPD
Sbjct  154   DPMIVPRRIMEKWKPQRIEELPEAFCGGWVGYFSYDTVRYVEKKKLPFSNAPVDDRNLPD  213

Query  794   IHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLS  973
             +HLGLYD+VIVFDHV+KKA++IHWVRLD + S  +AY +G  +LEALVS+V ++ PPRL+
Sbjct  214   VHLGLYDDVIVFDHVEKKAYVIHWVRLDEFYSVEEAYNDGMNRLEALVSRVHNIVPPRLA  273

Query  974   SASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFE  1153
             + S++  T  FG SL   +M+S +Y+ AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE
Sbjct  274   AGSINLYTSLFGLSLKNSSMSSEDYEKAVLQAKEHILAGDIFQIVLSQRFERRTFADPFE  333

Query  1154  VYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVM  1333
             VYRALRIVNPSPYMTY+QARG ILV SSPEILTRVKK  + NRPLAGT +RGKTP+ED M
Sbjct  334   VYRALRIVNPSPYMTYLQARGSILVGSSPEILTRVKKRTITNRPLAGTIRRGKTPKEDYM  393

Query  1334  LEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGEL  1513
             LE  LL+DEK+ AEH MLVDLGRNDVGKVSK GSVNVE+LMNIERYSHVMHISSTVTGEL
Sbjct  394   LETQLLHDEKQCAEHIMLVDLGRNDVGKVSKPGSVNVEKLMNIERYSHVMHISSTVTGEL  453

Query  1514  LDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALA  1693
             LDHLT WDALRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGGFGGISF GDMD+ALA
Sbjct  454   LDHLTSWDALRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGFGGISFSGDMDVALA  513

Query  1694  LRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRA  1858
             LRTIVF      DT+ S     RR+EWIAHLQSGAGIVADS+P  EQ+ECENK A L+RA
Sbjct  514   LRTIVFPTGMRYDTMYSYKDECRRREWIAHLQSGAGIVADSDPADEQRECENKAAALARA  573

Query  1859  IDLAESAFVK  1888
             IDLAES+FV+
Sbjct  574   IDLAESSFVE  583



>ref|XP_011032136.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=600

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/525 (76%), Positives = 451/525 (86%), Gaps = 5/525 (1%)
 Frame = +2

Query  329   AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGR  508
             A+F EASK  NLIPL++ IFSDHLTPVLAYRCLV EDDR+ PSFLFESVEPG  +ST+GR
Sbjct  75    ARFQEASKNGNLIPLYRYIFSDHLTPVLAYRCLVREDDRDAPSFLFESVEPGLDASTIGR  134

Query  509   YSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAF  688
             YSVVGAQP MEI+AKEN VTI+DH  G+  E++VEDPM V R I E WKPQL  +LP+AF
Sbjct  135   YSVVGAQPRMEIVAKENMVTIMDHYDGRRMEEIVEDPMEVPRKIMEGWKPQLIDELPEAF  194

Query  689   CGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWV  868
             CGGWVGYFSYDTVRYVEKKKLPF+ AP DDRNLPD+HLGLYD+VIVFDHV+KKA +IHWV
Sbjct  195   CGGWVGYFSYDTVRYVEKKKLPFSGAPPDDRNLPDVHLGLYDDVIVFDHVEKKACVIHWV  254

Query  869   RLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEY  1048
             +LD +SS  +AY +G  +LE+++S+V D+ PPRL + S+   TR FGP L   +MTS EY
Sbjct  255   QLDRFSSVKEAYEDGMNRLESILSRVHDIAPPRLPAGSIKLFTRLFGPKLENSSMTSEEY  314

Query  1049  KNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILV  1228
             K+AVL+AK+HILAGDIFQIVLSQRFERRT ADPFE+YRALR+VNPSPYMTY+QARGCILV
Sbjct  315   KDAVLQAKDHILAGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMTYLQARGCILV  374

Query  1229  ASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRND  1408
             ASSPEILTRVKK ++ NRPLAGT +RGKTP+ED+MLE  LLND+K+ AEH MLVDLGRND
Sbjct  375   ASSPEILTRVKKEKITNRPLAGTVRRGKTPKEDLMLEKELLNDQKQCAEHIMLVDLGRND  434

Query  1409  vgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKV  1588
             VGKVSK GSV VE+LMNIERYSHVMHISSTVTGELLD+LT WD LRAALPVGTVSGAPKV
Sbjct  435   VGKVSKPGSVKVEKLMNIERYSHVMHISSTVTGELLDNLTRWDVLRAALPVGTVSGAPKV  494

Query  1589  KAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRK  1753
             KAMELIDQLE TRRGPYSGGFGGISF GDMDIALALRTIVF      DT+ S      R+
Sbjct  495   KAMELIDQLEVTRRGPYSGGFGGISFSGDMDIALALRTIVFPTSTRYDTMYSYKDVNTRR  554

Query  1754  EWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             EW+AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAESAF+K
Sbjct  555   EWVAHLQAGAGIVADSDPADEQRECENKAAALARAIDLAESAFLK  599



>ref|XP_010905354.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010905355.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010905356.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=590

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/539 (73%), Positives = 453/539 (84%), Gaps = 11/539 (2%)
 Frame = +2

Query  305   PPSL-----DKEEA-KFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLF  466
             PPS+     +KEEA KF EA++  NL+PL++ IF DHLTPVLAYRCLV EDDR  PSFLF
Sbjct  52    PPSVAARGGEKEEAFKFSEAARRGNLLPLYQTIFCDHLTPVLAYRCLVKEDDRAAPSFLF  111

Query  467   ESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISE  646
             ESVE GS  + VGRYSVVGAQP MEI+AKEN VTI+DH++G+ TE+ ++DPM + R I E
Sbjct  112   ESVEQGSSGTNVGRYSVVGAQPAMEIVAKENMVTIMDHEAGRRTEEFLQDPMQIPRKIME  171

Query  647   EWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIV  826
              W PQL  +LPD FCGGWVGYFSYDT+RYVE KKLPF +AP+DDRNLPD+HLGLY++VIV
Sbjct  172   GWNPQLIDELPDVFCGGWVGYFSYDTMRYVETKKLPFFNAPEDDRNLPDVHLGLYNDVIV  231

Query  827   FDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREF  1006
             FDHV+KKA++IHWV LD YSS  KAY +G+ +L  L+S+V +VD PRL++ SV   TR+F
Sbjct  232   FDHVEKKAYVIHWVHLDQYSSIEKAYEDGRNRLGILLSRVHNVDVPRLTAGSVKLYTRQF  291

Query  1007  GPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPS  1186
             G SL K +MTS EYK AV++AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVNPS
Sbjct  292   GSSLKKSSMTSEEYKKAVIQAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPS  351

Query  1187  PYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKE  1366
             PYM Y+QARGCILVASSPEILTRVKK +++NRPLAGTA+RGKT  ED +LE  LLNDEK+
Sbjct  352   PYMAYLQARGCILVASSPEILTRVKKQKIINRPLAGTARRGKTDNEDKLLEEQLLNDEKQ  411

Query  1367  RAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALR  1546
              AEH MLVDLGRNDVG+VSK GSV VE+LMNIERYSHVMHISSTVTGEL DHLT WDALR
Sbjct  412   CAEHIMLVDLGRNDVGRVSKPGSVKVEKLMNIERYSHVMHISSTVTGELFDHLTGWDALR  471

Query  1547  AALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGM  1726
             AALPVGTVSGAPKV+AMELIDQLE  RRGPYSGGFGG+SF GDMD+ALALRTIVF     
Sbjct  472   AALPVGTVSGAPKVRAMELIDQLEVKRRGPYSGGFGGVSFSGDMDVALALRTIVFPTGSR  531

Query  1727  NDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             NDT+ S     RR+EW+AHLQ+GAGIVADS PD EQ+ECENK A L+RAIDLAE+ F +
Sbjct  532   NDTMYSYKDMNRRQEWVAHLQAGAGIVADSKPDDEQRECENKAAALARAIDLAEATFTE  590



>ref|XP_009371515.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=588

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/555 (73%), Positives = 456/555 (82%), Gaps = 17/555 (3%)
 Frame = +2

Query  236   RVRTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLA  415
             RVRTL  +CS+           S  SL  E  KF+EASK  NLIPL + IFSDHLTPVLA
Sbjct  44    RVRTL--RCSA----------LSSASLADESEKFVEASKKGNLIPLSRSIFSDHLTPVLA  91

Query  416   YRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKL  595
             YRCLV EDDR+ PSFL ESVEPGS  S VGRYS +GAQP++EI+AKEN VTI+DH  G  
Sbjct  92    YRCLVKEDDRDAPSFLCESVEPGSNDSNVGRYSFIGAQPSIEIVAKENMVTIMDHREGCR  151

Query  596   TEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQD  775
             TE++VEDPMTV + I E W PQL  +LP+AFCGGWVGYFSYDTVRYVEKKKLPF SAP D
Sbjct  152   TEEIVEDPMTVPQRIMEGWTPQLLDELPEAFCGGWVGYFSYDTVRYVEKKKLPFPSAPPD  211

Query  776   DRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDV  955
             DRNLPD+HLGLYD+VIVFDHVDKKA +IHWV+LD YSS  +A+ +G  +LE L+SKV D+
Sbjct  212   DRNLPDVHLGLYDDVIVFDHVDKKAHVIHWVQLDQYSSVDEAFNDGINRLETLLSKVHDI  271

Query  956   DPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRT  1135
               PRL + S++FNT+ FG  L   ++TS EYK AVL+AKEHILAGDIFQIVLSQRFERRT
Sbjct  272   ITPRLPAGSIEFNTQLFGTKLEDSSLTSEEYKEAVLEAKEHILAGDIFQIVLSQRFERRT  331

Query  1136  TADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKT  1315
              ADPFE+YRALRIVNPSPYMTY+QARGCILVASSPEILTRVKK  + NRPLAGT +RGKT
Sbjct  332   FADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKKTITNRPLAGTVRRGKT  391

Query  1316  PEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISS  1495
             P+ED+MLE  LLNDEK+ AEH MLVDLGRNDVGKVSK GSV VE LMNIERYSHVMHISS
Sbjct  392   PKEDLMLEKQLLNDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEELMNIERYSHVMHISS  451

Query  1496  TVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGD  1675
             TVTGELLD LT WD LR ALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF G+
Sbjct  452   TVTGELLDDLTSWDVLRTALPVGTVSGAPKVKAMELIDKLEVTRRGPYSGGFGGISFSGN  511

Query  1676  MDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKV  1840
             MDIALALRTIVF      DT+ S     +R+EW+AHLQ+GAGIVADS+P  EQ+ECENK 
Sbjct  512   MDIALALRTIVFPTSFRYDTMYSYKDTNKRREWVAHLQAGAGIVADSDPADEQRECENKA  571

Query  1841  AGLSRAIDLAESAFV  1885
             A L+RAIDLAES+FV
Sbjct  572   AALARAIDLAESSFV  586



>ref|XP_007163528.1| hypothetical protein PHAVU_001G241700g [Phaseolus vulgaris]
 gb|ESW35522.1| hypothetical protein PHAVU_001G241700g [Phaseolus vulgaris]
Length=581

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/590 (67%), Positives = 460/590 (78%), Gaps = 34/590 (6%)
 Frame = +2

Query  131   AIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPP  310
             +++  +RL+PP   +S   +T          A SL    L L+CSS              
Sbjct  19    SLSFSRRLVPPCSRLSPATLT----------AASLSCAPLTLRCSS--------------  54

Query  311   SLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSR  490
                    KF EAS+  NLIPL++CIFSD LTPVLAYR L+ EDDRE PSFLFES EP   
Sbjct  55    ----HRTKFEEASEKGNLIPLYQCIFSDQLTPVLAYRILLKEDDREAPSFLFESAEPSYH  110

Query  491   SSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTA  670
             +S+VGRYSVVGA P+MEI+AKENKVTI+DH+SG LTEK V+DP+ + + ISE WKP L  
Sbjct  111   ASSVGRYSVVGAHPSMEIVAKENKVTIIDHESGNLTEKFVDDPIMIPKEISEGWKPCLID  170

Query  671   DLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKA  850
             +LPDAFCGGW GYFSYDTVRYVEKKKLPF++AP+DDRNL DIHLGLY+NVIVFDHV+KKA
Sbjct  171   ELPDAFCGGWAGYFSYDTVRYVEKKKLPFSNAPEDDRNLADIHLGLYENVIVFDHVEKKA  230

Query  851   FIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGN  1030
             ++IHWVR+D Y S   AY++G ++LE L SK+Q    PRL+   VD +T  FGP L K +
Sbjct  231   YLIHWVRIDRYPSVESAYKDGMERLEKLASKLQ-TQSPRLAPGFVDLHTHHFGPPLKKSS  289

Query  1031  MTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQA  1210
             MT+  YK AVL+AKEHI AG+IFQIVLSQRFERRT ADPFE+YRALR+VNPSPYM Y+QA
Sbjct  290   MTTEAYKEAVLQAKEHIKAGNIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMAYLQA  349

Query  1211  RGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLV  1390
             RGCILVASSPEILTR+KKN++VNRPLAGT +RG T EED  LE +LL DEK+ AEH MLV
Sbjct  350   RGCILVASSPEILTRIKKNKIVNRPLAGTTRRGNTREEDARLEAILLKDEKQCAEHVMLV  409

Query  1391  DLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTV  1570
             DLGRNDVGKV+KSGSV VE+LMNIERYSHVMHISSTVTGEL +HL+ WD LR+ALPVGTV
Sbjct  410   DLGRNDVGKVAKSGSVKVEQLMNIERYSHVMHISSTVTGELQEHLSSWDVLRSALPVGTV  469

Query  1571  SGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS--  1744
             SGAPKVKAMELID+LE TRRGPYSGGFG ISF G+MDIALALRT+VF      DT+ S  
Sbjct  470   SGAPKVKAMELIDELEVTRRGPYSGGFGYISFFGEMDIALALRTMVFPTGTRYDTMYSYK  529

Query  1745  ---RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                +R EWIA+LQSGAGIVADS P  E +EC+NK A L+RAIDLAESAFV
Sbjct  530   DLDQRHEWIAYLQSGAGIVADSVPADEHQECQNKAAALARAIDLAESAFV  579



>ref|XP_009371516.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=587

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/555 (73%), Positives = 458/555 (83%), Gaps = 18/555 (3%)
 Frame = +2

Query  236   RVRTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLA  415
             RVRTL  +CS+           S  SLD+ E KF+EASK  NLIPL + IFSDHLTPVLA
Sbjct  44    RVRTL--RCSA----------LSSASLDESE-KFVEASKKGNLIPLSRSIFSDHLTPVLA  90

Query  416   YRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKL  595
             YRCLV EDDR+ PSFL ESVEPGS  S VGRYS +GAQP++EI+AKEN VTI+DH  G  
Sbjct  91    YRCLVKEDDRDAPSFLCESVEPGSNDSNVGRYSFIGAQPSIEIVAKENMVTIMDHREGCR  150

Query  596   TEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQD  775
             TE++VEDPMTV + I E W PQL  +LP+AFCGGWVGYFSYDTVRYVEKKKLPF SAP D
Sbjct  151   TEEIVEDPMTVPQRIMEGWTPQLLDELPEAFCGGWVGYFSYDTVRYVEKKKLPFPSAPPD  210

Query  776   DRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDV  955
             DRNLPD+HLGLYD+VIVFDHVDKKA +IHWV+LD YSS  +A+ +G  +LE L+SKV D+
Sbjct  211   DRNLPDVHLGLYDDVIVFDHVDKKAHVIHWVQLDQYSSVDEAFNDGINRLETLLSKVHDI  270

Query  956   DPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRT  1135
               PRL + S++FNT+ FG  L   ++TS EYK AVL+AKEHILAGDIFQIVLSQRFERRT
Sbjct  271   ITPRLPAGSIEFNTQLFGTKLEDSSLTSEEYKEAVLEAKEHILAGDIFQIVLSQRFERRT  330

Query  1136  TADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKT  1315
              ADPFE+YRALRIVNPSPYMTY+QARGCILVASSPEILTRVKK  + NRPLAGT +RGKT
Sbjct  331   FADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKKTITNRPLAGTVRRGKT  390

Query  1316  PEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISS  1495
             P+ED+MLE  LLNDEK+ AEH MLVDLGRNDVGKVSK GSV VE LMNIERYSHVMHISS
Sbjct  391   PKEDLMLEKQLLNDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEELMNIERYSHVMHISS  450

Query  1496  TVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGD  1675
             TVTGELLD LT WD LR ALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF G+
Sbjct  451   TVTGELLDDLTSWDVLRTALPVGTVSGAPKVKAMELIDKLEVTRRGPYSGGFGGISFSGN  510

Query  1676  MDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKV  1840
             MDIALALRTIVF      DT+ S     +R+EW+AHLQ+GAGIVADS+P  EQ+ECENK 
Sbjct  511   MDIALALRTIVFPTSFRYDTMYSYKDTNKRREWVAHLQAGAGIVADSDPADEQRECENKA  570

Query  1841  AGLSRAIDLAESAFV  1885
             A L+RAIDLAES+FV
Sbjct  571   AALARAIDLAESSFV  585



>ref|XP_007163527.1| hypothetical protein PHAVU_001G241600g [Phaseolus vulgaris]
 gb|ESW35521.1| hypothetical protein PHAVU_001G241600g [Phaseolus vulgaris]
Length=588

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/533 (73%), Positives = 449/533 (84%), Gaps = 8/533 (2%)
 Frame = +2

Query  305   PPSLDKEE-AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEP  481
             P S D EE AKF+EASK  NLIPL +CIFSD LTPVLAYR LV EDDRE PSFLFES EP
Sbjct  56    PNSYDVEEGAKFVEASKNGNLIPLCQCIFSDQLTPVLAYRTLVKEDDREAPSFLFESAEP  115

Query  482   GSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQ  661
                +S+VGRYSVVG  PTME++AKENKVTI+DH+SG LTE+ V+DP+ V + ISE+WKP 
Sbjct  116   SYHASSVGRYSVVGTNPTMEVVAKENKVTIIDHESGNLTEENVDDPIMVPKKISEDWKPC  175

Query  662   LTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVD  841
             L   LPDAFCGGW GYFSYDT+RYVEKKKLPF++AP+DDR+L DIHLGLY++VIVFDHV+
Sbjct  176   LIDKLPDAFCGGWAGYFSYDTIRYVEKKKLPFSNAPKDDRDLADIHLGLYESVIVFDHVE  235

Query  842   KKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLA  1021
             KKA++I WVR+D YSS   AY++GK++LE LV+K+QD  PPRL+  SVD +T  +GP L 
Sbjct  236   KKAYVIVWVRIDRYSSVESAYKDGKERLEKLVAKLQDGQPPRLAPGSVDLHTHHYGPLLK  295

Query  1022  KGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTY  1201
               +MT   YK AVL+A+EHI AGDIFQIVLSQRFERRT ADPFE+YRALR+VNPSPYM Y
Sbjct  296   TSSMTREAYKEAVLQAQEHIKAGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMGY  355

Query  1202  MQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHT  1381
             +QARGCILVASSPEILTR+KK  +VNRPLAGTA+RGKTPEED  LE LLL D K+ AEH 
Sbjct  356   LQARGCILVASSPEILTRIKK--IVNRPLAGTARRGKTPEEDARLESLLLKDMKQCAEHV  413

Query  1382  MLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPV  1561
             MLVDLGRNDVGKV+KSGSV VE+LMNIERYSHVMHISSTV G+L DHLT WDALR+ALPV
Sbjct  414   MLVDLGRNDVGKVAKSGSVRVEQLMNIERYSHVMHISSTVAGQLQDHLTSWDALRSALPV  473

Query  1562  GTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLS  1741
             GTVSGAPKVKAMELID+LE TRRGPYSGGFG IS  G+MD+AL+LRT+VF      DT+ 
Sbjct  474   GTVSGAPKVKAMELIDELEVTRRGPYSGGFGYISLSGEMDVALSLRTMVFPTGTRYDTMY  533

Query  1742  S-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             S     +R+EWIA+LQ+GAGIVADS P+ EQ+EC+NK AGL+RAIDLAES+FV
Sbjct  534   SYKDHNQRREWIAYLQAGAGIVADSVPEDEQQECQNKAAGLARAIDLAESSFV  586



>ref|XP_004295746.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=585

 Score =   780 bits (2014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/557 (71%), Positives = 460/557 (83%), Gaps = 17/557 (3%)
 Frame = +2

Query  236   RVRTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLA  415
             RVRTL  +CS+           S PSL ++  KF EASK  NLIPL++ +FSDHLTPVLA
Sbjct  41    RVRTL--RCSA----------LSSPSLAEQSEKFFEASKNGNLIPLYRSVFSDHLTPVLA  88

Query  416   YRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKL  595
             YRCLV EDDR+  SFLFESVEPGS+ S VGRYSV+GAQP++EI+AKEN VTI+++  G+ 
Sbjct  89    YRCLVKEDDRDASSFLFESVEPGSKDSNVGRYSVIGAQPSIEIVAKENMVTIMNNREGRR  148

Query  596   TEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQD  775
             TE++VEDPMTV + I+E W PQ   +LP+AFCGGWVGYFSYDTVRYVEKKKLPF+ AP D
Sbjct  149   TEEIVEDPMTVPQRITEGWIPQRLDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSGAPPD  208

Query  776   DRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDV  955
             DRNLPD+HLGLYDNVIVFDHV+KKA +IHWV+LD YSS  +A+ +G  +L+ LVS+V D+
Sbjct  209   DRNLPDLHLGLYDNVIVFDHVEKKAHVIHWVQLDQYSSVEEAFNDGMNRLDTLVSRVHDI  268

Query  956   DPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRT  1135
               PRL +  ++  T  FG  L   NMTS EY+ AVLK+KEHILAGDIFQIVLSQRFERRT
Sbjct  269   VSPRLPAGKIELQTHLFGAKLENSNMTSEEYEEAVLKSKEHILAGDIFQIVLSQRFERRT  328

Query  1136  TADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKT  1315
              ADPFE+YRALRIVNPSPYMTY+QARGCILVASSPEILTRVK  ++ NRPLAGT +RGKT
Sbjct  329   FADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKNRKITNRPLAGTVRRGKT  388

Query  1316  PEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISS  1495
             P+ED M+E  LLNDEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISS
Sbjct  389   PKEDQMMENHLLNDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISS  448

Query  1496  TVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGD  1675
             TVTGELLDHL+ WD LR+ALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF G+
Sbjct  449   TVTGELLDHLSSWDVLRSALPVGTVSGAPKVKAMELIDELEVTRRGPYSGGFGGISFSGN  508

Query  1676  MDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKV  1840
             MDIALALRTIVF      DT+ S     +R+EW+AHLQ+GAGIVADS P  EQ+ECENK 
Sbjct  509   MDIALALRTIVFPTSFRYDTMYSYKEAGKRREWVAHLQAGAGIVADSVPAEEQRECENKA  568

Query  1841  AGLSRAIDLAESAFVKT  1891
             AGL+RAIDLAES+FV +
Sbjct  569   AGLARAIDLAESSFVDS  585



>ref|XP_006848166.1| hypothetical protein AMTR_s00029p00234880 [Amborella trichopoda]
 gb|ERN09747.1| hypothetical protein AMTR_s00029p00234880 [Amborella trichopoda]
Length=579

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/549 (72%), Positives = 452/549 (82%), Gaps = 17/549 (3%)
 Frame = +2

Query  254   LKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVD  433
             +KCS++          S  S+D   AKFIEASK  NL+PL++CIFSDHLTPVLAYRCLV 
Sbjct  41    IKCSAT----------STASVDA--AKFIEASKKGNLVPLYRCIFSDHLTPVLAYRCLVK  88

Query  434   EDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVE  613
             EDDRE PSFLFESVE G R + VGRYS+VGAQPT+EI+A EN VTI+DH+ G   E+ VE
Sbjct  89    EDDREAPSFLFESVEQGYRGTNVGRYSIVGAQPTVEIVATENFVTIMDHEKGSRKEEFVE  148

Query  614   DPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPD  793
             DPM V + I E W PQL  +LPDAF GGWVG+FSYDTVRYVE+KKLPF+SAP DDRNLPD
Sbjct  149   DPMDVPQRIMENWNPQLIDELPDAFVGGWVGFFSYDTVRYVERKKLPFSSAPVDDRNLPD  208

Query  794   IHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLS  973
             +HLGLYD+VIVFDHV+KK ++IHWV LD +SS   AY  G   LE L+S+V D+D PRLS
Sbjct  209   VHLGLYDDVIVFDHVEKKVYVIHWVHLDRHSSIEDAYENGMNCLEILISRVHDIDTPRLS  268

Query  974   SASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFE  1153
             S S+   T+ FG SL   +MTS  YK AV++AKEHILAGDIFQIVLSQRFERRT ADPFE
Sbjct  269   SGSIKLCTQLFGESLKNSSMTSEAYKQAVIQAKEHILAGDIFQIVLSQRFERRTFADPFE  328

Query  1154  VYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVM  1333
             VYRALR+VNPSPYMTY+QARGCILVASSPEIL R KKN ++NRPLAGT +RGKT +ED+M
Sbjct  329   VYRALRVVNPSPYMTYLQARGCILVASSPEILIRKKKNMIINRPLAGTIRRGKTAKEDMM  388

Query  1334  LEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGEL  1513
             LE  LLNDEK+RAEH MLVDLGRNDVGKVSK GSV VE+LM IERYSHVMHISSTVTGEL
Sbjct  389   LEKELLNDEKQRAEHIMLVDLGRNDVGKVSKPGSVKVEKLMGIERYSHVMHISSTVTGEL  448

Query  1514  LDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALA  1693
             +DHL+CWDAL A LPVGTVSGAPKV+AMELID+LE  RRGPYSGGFGGISF GD+DIALA
Sbjct  449   MDHLSCWDALSATLPVGTVSGAPKVRAMELIDELEVIRRGPYSGGFGGISFSGDLDIALA  508

Query  1694  LRTIVFLNDGMNDTL-----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRA  1858
             LRTIVF      DT+     +SRR+EW+AHLQ+GAGIVADS PD EQ+ECENK AGL+RA
Sbjct  509   LRTIVFPMGKHYDTMYSYKDASRRREWVAHLQAGAGIVADSKPDDEQRECENKAAGLARA  568

Query  1859  IDLAESAFV  1885
             IDLAESAFV
Sbjct  569   IDLAESAFV  577



>ref|XP_010414345.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=648

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/581 (67%), Positives = 460/581 (79%), Gaps = 40/581 (7%)
 Frame = +2

Query  242   RTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFI---EASKTSNLIPLHKCIFSDHLTPVL  412
             R   +KCSSS         Y+PP LD  E +FI   +AS+  NL+PL++C+FSDHLTP+L
Sbjct  62    RLTCIKCSSS--------SYTPP-LDLSEEQFIKFKQASEKGNLVPLYRCVFSDHLTPIL  112

Query  413   AYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGK  592
             AYRCLV EDDR+ PSFLFESVEPG +SS +GRYSVVGAQPT+EI+AK N VT++DH +G 
Sbjct  113   AYRCLVKEDDRDAPSFLFESVEPGLQSSNIGRYSVVGAQPTIEIVAKGNVVTVMDHGAGL  172

Query  593   LTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQ  772
              TE+ VEDPM V + I +EWKPQ   +LP+AFCGGWVGYFSYDTVRYVEKKKLPF++AP+
Sbjct  173   RTEEEVEDPMMVPQKIMDEWKPQRIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSNAPE  232

Query  773   DDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQD  952
             DDR+LPD+HLGLYD+VIVFDHV+KKA++IHWVR+D   S    + +G  +LE+L S++QD
Sbjct  233   DDRSLPDVHLGLYDDVIVFDHVEKKAYVIHWVRIDKDRSVEDNFTDGMNRLESLTSRIQD  292

Query  953   VDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERR  1132
               PP++ +  +   T+ FGP L K  MTS  YK AV++AKEHILAGDIFQIVLSQRFERR
Sbjct  293   QKPPKMPTGFIKLRTQLFGPKLEKSTMTSEAYKKAVVEAKEHILAGDIFQIVLSQRFERR  352

Query  1133  TTADPFEVYRALRIVNPSPYMTY-----------------------MQARGCILVASSPE  1243
             T ADPFE+YRALRIVNPSPYM Y                       +QARGCILVASSPE
Sbjct  353   TFADPFEIYRALRIVNPSPYMAYLQVYSFVPLFLTFFMKVNITYLWLQARGCILVASSPE  412

Query  1244  ILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvs  1423
             IL R K  ++ NRPLAGT +RGKTP+ED+MLE  LL+DEK+ AEH MLVDLGRNDVGKVS
Sbjct  413   ILLRSKNRKITNRPLAGTVRRGKTPKEDLMLEKELLSDEKQCAEHIMLVDLGRNDVGKVS  472

Query  1424  ksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMEL  1603
             K GSV VE+LMNIERYSHVMHISSTV GELLD+LT WDALRAALPVGTVSGAPKVKAMEL
Sbjct  473   KPGSVEVEKLMNIERYSHVMHISSTVKGELLDNLTSWDALRAALPVGTVSGAPKVKAMEL  532

Query  1604  IDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAH  1768
             ID+LE TRRGPYSGGFGGISF GDMDIALALRT+VF  +   DTL S     RR+EWIAH
Sbjct  533   IDKLEVTRRGPYSGGFGGISFNGDMDIALALRTMVFPTNTRYDTLYSYKHPQRRREWIAH  592

Query  1769  LQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKT  1891
             +Q+GAG+VADSNPD E +ECENK A L+RAIDLAES+F+++
Sbjct  593   IQAGAGVVADSNPDDEHRECENKAAALARAIDLAESSFLES  633



>ref|NP_180530.1| anthranilate synthase component I-2 [Arabidopsis thaliana]
 sp|P32069.1|TRPX_ARATH RecName: Full=Anthranilate synthase alpha subunit 2, chloroplastic; 
AltName: Full=Anthranilate synthase component 1-2; AltName: 
Full=Anthranilate synthase component I-2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAA32739.1| anthranilate synthase alpha subunit [Arabidopsis thaliana]
 gb|AAC35228.1| anthranilate synthase, alpha subunit [Arabidopsis thaliana]
 gb|AEC08294.1| anthranilate synthase component I-2 [Arabidopsis thaliana]
Length=621

 Score =   778 bits (2010),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/548 (70%), Positives = 452/548 (82%), Gaps = 9/548 (2%)
 Frame = +2

Query  269   SLQIPVTRSPYSPPSLDKEE---AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDED  439
             S ++P  +  Y+P SLD  E    KF +AS+  NL+PL +C+FSDHLTP+LAYRCLV ED
Sbjct  61    SRRLPSIKCSYTP-SLDLSEEQFTKFKKASEKGNLVPLFRCVFSDHLTPILAYRCLVKED  119

Query  440   DRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDP  619
             DR+ PSFLFESVEPGS+SS +GRYSVVGAQPT+EI+AK N VT++DH +   TE+ V+DP
Sbjct  120   DRDAPSFLFESVEPGSQSSNIGRYSVVGAQPTIEIVAKGNVVTVMDHGASLRTEEEVDDP  179

Query  620   MTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIH  799
             M V + I EEW PQ   +LP+AFCGGWVGYFSYDTVRYVEKKKLPF++AP+DDR+LPD++
Sbjct  180   MMVPQKIMEEWNPQGIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSNAPEDDRSLPDVN  239

Query  800   LGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSA  979
             LGLYD+VIVFDHV+KKA++IHWVR+D   S  + +REG  +LE+L S++QD  PP++ + 
Sbjct  240   LGLYDDVIVFDHVEKKAYVIHWVRIDKDRSVEENFREGMNRLESLTSRIQDQKPPKMPTG  299

Query  980   SVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVY  1159
              +   T+ FGP L K  MTS  YK AV++AKEHILAGDIFQIVLSQRFERRT ADPFE+Y
Sbjct  300   FIKLRTQLFGPKLEKSTMTSEAYKEAVVEAKEHILAGDIFQIVLSQRFERRTFADPFEIY  359

Query  1160  RALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLE  1339
             RALRIVNPSPYM Y+Q RGCILVASSPEIL R K  ++ NRPLAGT +RGKTP+ED+MLE
Sbjct  360   RALRIVNPSPYMAYLQVRGCILVASSPEILLRSKNRKITNRPLAGTVRRGKTPKEDLMLE  419

Query  1340  MLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLD  1519
               LL+DEK+ AEH MLVDLGRNDVGKVSK GSV V++L +IE +SHVMHISSTV GELLD
Sbjct  420   KELLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVEVKKLKDIEWFSHVMHISSTVVGELLD  479

Query  1520  HLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALR  1699
             HLT WDALRA LPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF GDMDIALALR
Sbjct  480   HLTSWDALRAVLPVGTVSGAPKVKAMELIDELEVTRRGPYSGGFGGISFNGDMDIALALR  539

Query  1700  TIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAID  1864
             T+VF  +   DTL S     RR+EWIAH+Q+GAGIVADSNPD E +ECENK A L+RAID
Sbjct  540   TMVFPTNTRYDTLYSYKHPQRRREWIAHIQAGAGIVADSNPDDEHRECENKAAALARAID  599

Query  1865  LAESAFVK  1888
             LAES+F++
Sbjct  600   LAESSFLE  607



>dbj|BAD95154.1| anthranilate synthase, alpha subunit [Arabidopsis thaliana]
Length=621

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/548 (69%), Positives = 452/548 (82%), Gaps = 9/548 (2%)
 Frame = +2

Query  269   SLQIPVTRSPYSPPSLDKEEAKFIE---ASKTSNLIPLHKCIFSDHLTPVLAYRCLVDED  439
             S ++P  +  Y+P SLD  E +F +   AS+  NL+PL +C+FSDHLTP+LAYRCLV ED
Sbjct  61    SRRLPSIKCSYTP-SLDLSEEQFTKLKKASEKGNLVPLFRCVFSDHLTPILAYRCLVKED  119

Query  440   DRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDP  619
             DR+ PSFLFESVEPGS+SS +GRYSVVGAQPT+EI+AK N VT++DH +   TE+ V+DP
Sbjct  120   DRDAPSFLFESVEPGSQSSNIGRYSVVGAQPTIEIVAKGNVVTVMDHGASLRTEEEVDDP  179

Query  620   MTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIH  799
             M V + I EEW PQ   +LP+AFCGGWVGYFSYDTVRYVEKKKLPF++AP+DDR+LPD++
Sbjct  180   MMVPQKIMEEWNPQGIDELPEAFCGGWVGYFSYDTVRYVEKKKLPFSNAPEDDRSLPDVN  239

Query  800   LGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSA  979
             LGLYD+VIVFDHV+KKA++IHWVR+D   S  + +REG  +LE+L S++QD  PP++ + 
Sbjct  240   LGLYDDVIVFDHVEKKAYVIHWVRIDKDRSVEENFREGMNRLESLTSRIQDQKPPKMPTG  299

Query  980   SVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVY  1159
              +   T+ FGP L K  MTS  YK AV++AKEHILAGDIFQIVLSQRFERRT ADPFE+Y
Sbjct  300   FIKLRTQLFGPKLEKSTMTSEAYKEAVVEAKEHILAGDIFQIVLSQRFERRTFADPFEIY  359

Query  1160  RALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLE  1339
             RALRIVNPSPYM Y+Q RGCILVASSPEIL R K  ++ NRPLAGT +RGKTP+ED+MLE
Sbjct  360   RALRIVNPSPYMAYLQVRGCILVASSPEILLRSKNRKITNRPLAGTVRRGKTPKEDLMLE  419

Query  1340  MLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLD  1519
               LL+DEK+ AEH MLVDLGRNDVGKVSK GSV V++L +IE +SHVMHISSTV GELLD
Sbjct  420   KELLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVEVKKLKDIEWFSHVMHISSTVVGELLD  479

Query  1520  HLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALR  1699
             HLT WDALRA LPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF GDMDIALALR
Sbjct  480   HLTSWDALRAVLPVGTVSGAPKVKAMELIDELEVTRRGPYSGGFGGISFNGDMDIALALR  539

Query  1700  TIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAID  1864
             T+VF  +   DTL S     RR+EWIAH+Q+GAGIVADSNPD E +ECENK A L+RAID
Sbjct  540   TMVFPTNTRYDTLYSYKHPQRRREWIAHIQAGAGIVADSNPDDEHRECENKAAALARAID  599

Query  1865  LAESAFVK  1888
             LAES+F++
Sbjct  600   LAESSFLE  607



>ref|XP_004981203.1| PREDICTED: anthranilate synthase component I-1, chloroplastic-like 
[Setaria italica]
Length=580

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/531 (72%), Positives = 437/531 (82%), Gaps = 6/531 (1%)
 Frame = +2

Query  311   SLDKEEAKF-IEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGS  487
             ++ +EEA F   A++  NL+PL +CIFSDHLTPVLAYRCLV EDDRE PSFLFESVE G 
Sbjct  48    AVREEEANFKASAAEGCNLLPLKRCIFSDHLTPVLAYRCLVKEDDREAPSFLFESVEQGF  107

Query  488   RSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLT  667
               + VGRYSVVGAQPTMEI+AK N VT++DHD     E  V DPM + RSI E+WKP +T
Sbjct  108   EGTNVGRYSVVGAQPTMEIVAKANHVTVMDHDMKSKREHFVPDPMKIPRSIMEQWKPHIT  167

Query  668   ADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKK  847
             A LPDAFCGGWVG+FSYDTVRYVE KKLPF+ AP DDRNLPDIHLGLY++VIVFDHV+KK
Sbjct  168   AGLPDAFCGGWVGFFSYDTVRYVETKKLPFSKAPHDDRNLPDIHLGLYNDVIVFDHVEKK  227

Query  848   AFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKG  1027
               +IHWVRLD Y+SA +AY +G  +LEAL+S++  ++ P LSS S+  N   FG +L K 
Sbjct  228   THVIHWVRLDCYNSADEAYEDGTNRLEALLSRLHCLNVPTLSSGSIKLNVGHFGSALQKS  287

Query  1028  NMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQ  1207
             +M+  +YKNAV++AKEHILAGDIFQ+VLSQRFERRT ADPFE+YRALRIVNPSPYM Y+Q
Sbjct  288   SMSCEDYKNAVVQAKEHILAGDIFQVVLSQRFERRTFADPFEIYRALRIVNPSPYMAYLQ  347

Query  1208  ARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTML  1387
             ARGCILVASSPEILTRV+K  V+NRPLAGT +RGKT  ED +LE LLL+D+K+ AEH ML
Sbjct  348   ARGCILVASSPEILTRVQKRTVINRPLAGTIRRGKTKAEDKVLEQLLLSDQKQCAEHIML  407

Query  1388  VDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGT  1567
             VDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGEL D LTCWDALRAALPVGT
Sbjct  408   VDLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVTGELRDDLTCWDALRAALPVGT  467

Query  1568  VSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSR  1747
             VSGAPKV+AMELID+LE   RGPYSGGFGGISF GDMDIALALRT+VF      DT+ S 
Sbjct  468   VSGAPKVRAMELIDELEVNMRGPYSGGFGGISFNGDMDIALALRTMVFPTGSRFDTMYSY  527

Query  1748  -----RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                  RKEW+AH+Q+GAGIVADS PD E +EC NK AG +RAIDLAES F+
Sbjct  528   TDGNPRKEWVAHIQAGAGIVADSKPDDEHQECLNKAAGAARAIDLAESTFL  578



>gb|EMT21623.1| Anthranilate synthase component I-1, chloroplastic [Aegilops 
tauschii]
Length=683

 Score =   777 bits (2007),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/541 (70%), Positives = 441/541 (82%), Gaps = 9/541 (2%)
 Frame = +2

Query  290   RSPYSPPSLDKEEAKFIE-ASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLF  466
             + P+   ++ +EE  F   A+    L+PL +CIFSDHLTPVLAYRCLV EDDRE PSFLF
Sbjct  138   QCPHCGDAVREEEEAFRSGAAAGHTLLPLQRCIFSDHLTPVLAYRCLVREDDREAPSFLF  197

Query  467   ESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISE  646
             ESVE  S  + VGRYSVVGAQP MEI+AK N+VT++DH+     E+   DPMTV R I E
Sbjct  198   ESVEQASEGTNVGRYSVVGAQPAMEIVAKANQVTVMDHEMRTKEEQYAADPMTVPRDIME  257

Query  647   EWKPQLTAD-LPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVI  823
             +W PQ+T D LPDAFCGGWVG+FSYDTVRYVE KKLPF+ AP+DDRNLPDIHLGLY++V+
Sbjct  258   KWNPQITVDGLPDAFCGGWVGFFSYDTVRYVETKKLPFSKAPEDDRNLPDIHLGLYNDVV  317

Query  824   VFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTRE  1003
             VFDHV+KK  +IHWVRLD Y+S  KAY +GK +LEAL+S++   + P LS+ S+  N  +
Sbjct  318   VFDHVEKKTHVIHWVRLDCYNSIHKAYEDGKNRLEALLSRLHSSNVPTLSAGSIKLNVGQ  377

Query  1004  FGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNP  1183
             FG +L K  M+S +YK +V++AKEHILAGDIFQ+VLSQRFERRT ADPFEVYRALRIVNP
Sbjct  378   FGSALQKSTMSSKDYKKSVVQAKEHILAGDIFQVVLSQRFERRTFADPFEVYRALRIVNP  437

Query  1184  SPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEK  1363
             SPYM Y+QARGCILVASSPEILTRV K  VVNRPLAGT +RGKT  ED +LE LLL+DEK
Sbjct  438   SPYMAYLQARGCILVASSPEILTRVAKRTVVNRPLAGTIRRGKTKAEDKVLEQLLLSDEK  497

Query  1364  ERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDAL  1543
             +RAEH MLVDLGRNDVGKVSK G+V VE+LMNIERYSHVMHISSTVTGEL D LTCWDAL
Sbjct  498   QRAEHIMLVDLGRNDVGKVSKPGTVKVEKLMNIERYSHVMHISSTVTGELRDELTCWDAL  557

Query  1544  RAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDG  1723
             RAALPVGTVSGAPKV+AMELID++E T RGPYSGGFG ISF GDMDIALALRTIVF    
Sbjct  558   RAALPVGTVSGAPKVRAMELIDEMEVTMRGPYSGGFGQISFRGDMDIALALRTIVFPTAS  617

Query  1724  MNDTL-------SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
               DT+       S+ R+EW+AHLQ+GAGIVADS PD EQ+EC+NK AGL+RAIDLAES F
Sbjct  618   RFDTMYSYATDSSNARQEWVAHLQTGAGIVADSKPDDEQQECQNKAAGLARAIDLAESTF  677

Query  1883  V  1885
             V
Sbjct  678   V  678



>ref|XP_006651978.1| PREDICTED: anthranilate synthase component I-1, chloroplastic-like 
[Oryza brachyantha]
Length=557

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/531 (71%), Positives = 439/531 (83%), Gaps = 6/531 (1%)
 Frame = +2

Query  311   SLDKEEAKFIEAS-KTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGS  487
             ++ +EE+ F +A+ +  N++PL +CIFSDHLTPVLAYRCLV EDDRE PSFLFESVE GS
Sbjct  25    TVREEESGFKKAAAEGCNVLPLKRCIFSDHLTPVLAYRCLVKEDDREAPSFLFESVEQGS  84

Query  488   RSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLT  667
               + VGRYSV+GAQP MEI+AK N VT++DH+     E+   DPM + RSI E+W PQ+ 
Sbjct  85    EGTNVGRYSVIGAQPAMEIVAKANHVTVMDHEMKSRKEQFAPDPMKIPRSIMEQWNPQIV  144

Query  668   ADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKK  847
               LPDAFCGGWVG+FSYDTVRYVE KKLPF++AP+DDRNLPDIHLGLY++++VFDHV+KK
Sbjct  145   EGLPDAFCGGWVGFFSYDTVRYVETKKLPFSNAPEDDRNLPDIHLGLYNDIVVFDHVEKK  204

Query  848   AFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKG  1027
               +IHWVR+D + S  KAY +GK QLEAL+S++  V+ P L++ SV  N  +FG +L K 
Sbjct  205   THVIHWVRVDCHQSVDKAYEDGKNQLEALLSRLHSVNVPTLTAGSVKLNVGQFGSALQKS  264

Query  1028  NMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQ  1207
             +M+S +YK AV++AKEHILAGDIFQ+VLSQRFERRT ADPFEVYRALRIVNPSPYM Y+Q
Sbjct  265   SMSSEDYKKAVIQAKEHILAGDIFQVVLSQRFERRTFADPFEVYRALRIVNPSPYMAYLQ  324

Query  1208  ARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTML  1387
             ARGCILVASSPEILTRV+K  +VNRPLAGT +RGKT  ED +LE LLL+DEK+ AEH ML
Sbjct  325   ARGCILVASSPEILTRVEKRTIVNRPLAGTIRRGKTKAEDKVLEQLLLSDEKQCAEHIML  384

Query  1388  VDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGT  1567
             VDLGRNDVGKVSK GSV VE+LMN+ERYSHVMHISSTVTGEL D LTCWDALRAALPVGT
Sbjct  385   VDLGRNDVGKVSKPGSVKVEKLMNVERYSHVMHISSTVTGELRDELTCWDALRAALPVGT  444

Query  1568  VSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-  1744
             VSGAPKV+AMELIDQ+E   RGPYSGGFGGISF GDMDIALALRTIVF      DT+ S 
Sbjct  445   VSGAPKVRAMELIDQMEGKMRGPYSGGFGGISFRGDMDIALALRTIVFPTGSRFDTMYSY  504

Query  1745  ----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                  R+EW+AHLQ+GAGIVADS PD E +EC NK AGL+RAIDLAES FV
Sbjct  505   TDKNARQEWVAHLQAGAGIVADSKPDDEHQECLNKAAGLARAIDLAESTFV  555



>ref|XP_003559222.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic 
[Brachypodium distachyon]
Length=616

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/533 (71%), Positives = 438/533 (82%), Gaps = 6/533 (1%)
 Frame = +2

Query  305   PPSLDKEEAKFIEASKTS-NLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEP  481
             P ++ +EEA F  A+    NL+PL +CIFSDHLTPVLAYRCLV EDDRE PSFLFESVE 
Sbjct  77    PVAVREEEATFRNAAAAGHNLLPLKRCIFSDHLTPVLAYRCLVREDDREAPSFLFESVEQ  136

Query  482   GSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQ  661
             GS+ + VGRYSVVGAQP MEI+AK N+VT++DH+     E+   DPM + R I E+W PQ
Sbjct  137   GSQGTNVGRYSVVGAQPAMEIVAKANQVTVMDHEMKSKKEQYAADPMEIPRDIMEQWNPQ  196

Query  662   LTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVD  841
             +T  LPDAFCGGWVG+FSYDTVRYVE KKLPF+ APQDDRNLPDIHLGLY++V+VFDHV+
Sbjct  197   VTEGLPDAFCGGWVGFFSYDTVRYVETKKLPFSMAPQDDRNLPDIHLGLYNDVVVFDHVE  256

Query  842   KKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLA  1021
             KK  +IHWVR+D Y S  +AY +GK +LEAL+S++   + P LS+ SV  N   FG +L 
Sbjct  257   KKTHVIHWVRVDCYHSVDEAYEDGKNRLEALLSRLHSRNVPTLSAGSVKLNVGHFGSALQ  316

Query  1022  KGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTY  1201
             K +M+S +YK AV++AKEHILAGDIFQ+VLSQRFERRT ADPFEVYRALRIVNPSPYM Y
Sbjct  317   KSSMSSEDYKKAVVQAKEHILAGDIFQVVLSQRFERRTFADPFEVYRALRIVNPSPYMAY  376

Query  1202  MQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHT  1381
             +QARGCILVASSPEILTRV+K  +VNRPLAGT +RGKT  ED +LE LLL+DEK+ AEH 
Sbjct  377   LQARGCILVASSPEILTRVEKRTIVNRPLAGTIRRGKTKAEDKVLEQLLLSDEKQCAEHI  436

Query  1382  MLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPV  1561
             MLVDLGRNDVGKVSK GSV VE+LMN+ERYSHVMHISSTVTGEL D LTCWDALRAALPV
Sbjct  437   MLVDLGRNDVGKVSKPGSVKVEKLMNVERYSHVMHISSTVTGELRDDLTCWDALRAALPV  496

Query  1562  GTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL-  1738
             GTVSGAPKV+AMELID++E   RGPYSGGFGGISF GDMDIALALRTIVF      DT+ 
Sbjct  497   GTVSGAPKVRAMELIDEMEGKMRGPYSGGFGGISFRGDMDIALALRTIVFPTGSRFDTMY  556

Query  1739  ----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                 SS R+EW+AHLQ+GAGIVADS PD E +EC NK AGL+RAIDLAES F+
Sbjct  557   SYADSSARQEWVAHLQAGAGIVADSKPDDEHQECLNKAAGLARAIDLAESTFL  609



>gb|KDP46514.1| hypothetical protein JCGZ_08486 [Jatropha curcas]
Length=609

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/582 (68%), Positives = 469/582 (81%), Gaps = 6/582 (1%)
 Frame = +2

Query  161   PSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS-PPSLDKEEAKF  337
             P  L   LP+ +  S + +G   S    +L L+ S+S  +   +   S   S   +  KF
Sbjct  27    PRQLPLSLPLPTRSSVKFNGRVSSSISTSLALRGSASTCVRTLKCSGSISQSYADQSEKF  86

Query  338   IEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSV  517
             +EASK  N+IPL++CI  DHLTPVLAYRCLV EDDR+ PSFLFESVEPG  +ST+GRYSV
Sbjct  87    LEASKKGNIIPLYRCILCDHLTPVLAYRCLVKEDDRDAPSFLFESVEPGLDASTIGRYSV  146

Query  518   VGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGG  697
             +GAQP++EI+AKEN VTI+DH  G  TE++VEDPM V R + E W PQL  +LP+ F GG
Sbjct  147   IGAQPSVEIVAKENMVTIMDHYEGLRTEQIVEDPMEVPRRMMEGWTPQLVDELPEVFNGG  206

Query  698   WVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLD  877
             WVGYFSYDTVRYVEKKKLPF++AP DDRNLPD+HLGLY++V++FDH++KKA++IHWVRLD
Sbjct  207   WVGYFSYDTVRYVEKKKLPFSTAPPDDRNLPDVHLGLYEDVMIFDHLEKKAYVIHWVRLD  266

Query  878   SYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNA  1057
              YS+  +A+ +G  +LE L+S+V D D PRL +  +  +TR FGP L   +MTS EYK A
Sbjct  267   QYSTVEEAFNDGINRLENLISRVHDTDTPRLPAGLIKLSTRLFGPKLETSSMTSEEYKAA  326

Query  1058  VLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASS  1237
             VL AKEHILAGDIFQIVLSQRFERRT ADPFE+YR+LRIVNPSPYM Y+QARGCILVASS
Sbjct  327   VLHAKEHILAGDIFQIVLSQRFERRTFADPFEIYRSLRIVNPSPYMAYLQARGCILVASS  386

Query  1238  PEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgk  1417
             PEIL+ VKK +++NRPLAGT +RGKTP+ED MLE  LLNDEK+ AEH MLVDLGRNDVGK
Sbjct  387   PEILSSVKKKKIINRPLAGTVRRGKTPKEDKMLEKELLNDEKQCAEHIMLVDLGRNDVGK  446

Query  1418  vsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAM  1597
             VSK GSV VERLM+IERYSHVMHISSTVTGELLDHLT WDALRAALPVGTVSGAPKVKAM
Sbjct  447   VSKPGSVKVERLMDIERYSHVMHISSTVTGELLDHLTSWDALRAALPVGTVSGAPKVKAM  506

Query  1598  ELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWI  1762
             ELIDQLE TRRGPYSGGFGGISF GDMD+ALALRT+VF      DT+ S     +R+EW+
Sbjct  507   ELIDQLEVTRRGPYSGGFGGISFSGDMDVALALRTMVFPTSFRYDTMFSYNDMNKRREWV  566

Query  1763  AHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             AHLQ+GAGIVADS+P  EQ+ECENK AGL+RAIDLAE +F+K
Sbjct  567   AHLQAGAGIVADSDPADEQRECENKAAGLARAIDLAEESFLK  608



>ref|XP_010905357.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=587

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/539 (73%), Positives = 450/539 (83%), Gaps = 14/539 (3%)
 Frame = +2

Query  305   PPSL-----DKEEA-KFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLF  466
             PPS+     +KEEA KF EA++  NL+PL++ IF DHLTPVLAYRCLV EDDR  PSFLF
Sbjct  52    PPSVAARGGEKEEAFKFSEAARRGNLLPLYQTIFCDHLTPVLAYRCLVKEDDRAAPSFLF  111

Query  467   ESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISE  646
             ESVE GS  + VGRYSVVGAQP MEI+AKEN VTI+DH++G+ TE+ ++DPM + R I E
Sbjct  112   ESVEQGSSGTNVGRYSVVGAQPAMEIVAKENMVTIMDHEAGRRTEEFLQDPMQIPRKIME  171

Query  647   EWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIV  826
              W PQL  +LPD FCGGWVGYFSYDT+RYVE KKLPF +AP+DDRNLPD+HLGLY++VIV
Sbjct  172   GWNPQLIDELPDVFCGGWVGYFSYDTMRYVETKKLPFFNAPEDDRNLPDVHLGLYNDVIV  231

Query  827   FDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREF  1006
             FDHV+KKA++IHWV LD YSS  KAY +G+ +L  L+S+V +VD PRL++ SV   TR+F
Sbjct  232   FDHVEKKAYVIHWVHLDQYSSIEKAYEDGRNRLGILLSRVHNVDVPRLTAGSVKLYTRQF  291

Query  1007  GPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPS  1186
             G SL K +MTS EYK AV++AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVNPS
Sbjct  292   GSSLKKSSMTSEEYKKAVIQAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPS  351

Query  1187  PYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKE  1366
             PYM Y+QARGCILVASSPEILTR K   ++NRPLAGTA+RGKT  ED +LE  LLNDEK+
Sbjct  352   PYMAYLQARGCILVASSPEILTRQK---IINRPLAGTARRGKTDNEDKLLEEQLLNDEKQ  408

Query  1367  RAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALR  1546
              AEH MLVDLGRNDVG+VSK GSV VE+LMNIERYSHVMHISSTVTGEL DHLT WDALR
Sbjct  409   CAEHIMLVDLGRNDVGRVSKPGSVKVEKLMNIERYSHVMHISSTVTGELFDHLTGWDALR  468

Query  1547  AALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGM  1726
             AALPVGTVSGAPKV+AMELIDQLE  RRGPYSGGFGG+SF GDMD+ALALRTIVF     
Sbjct  469   AALPVGTVSGAPKVRAMELIDQLEVKRRGPYSGGFGGVSFSGDMDVALALRTIVFPTGSR  528

Query  1727  NDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             NDT+ S     RR+EW+AHLQ+GAGIVADS PD EQ+ECENK A L+RAIDLAE+ F +
Sbjct  529   NDTMYSYKDMNRRQEWVAHLQAGAGIVADSKPDDEQRECENKAAALARAIDLAEATFTE  587



>dbj|BAK01731.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/517 (72%), Positives = 430/517 (83%), Gaps = 8/517 (2%)
 Frame = +2

Query  359   NLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTM  538
              L+PL +CIFSDHLTPVLAYRCLV EDDRE PSFLFESVE  S  + VGRYSV+GAQP M
Sbjct  3     TLLPLRRCIFSDHLTPVLAYRCLVREDDREAPSFLFESVEQASEGTNVGRYSVLGAQPAM  62

Query  539   EILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTAD-LPDAFCGGWVGYFS  715
             EI+AK N+VT++DH+     E+  +DPMTV R I E+W PQ+T D LPDAFCGGWVG+FS
Sbjct  63    EIVAKANRVTVMDHEMRTKKEQYADDPMTVPRDIMEQWNPQITDDGLPDAFCGGWVGFFS  122

Query  716   YDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSAS  895
             YDTVRYVE KKLPF+ AP+DDRNLPDIHLGLY++V++FDHV+KK  +IHWVRLD Y S  
Sbjct  123   YDTVRYVETKKLPFSKAPEDDRNLPDIHLGLYNDVVIFDHVEKKTHVIHWVRLDCYHSVD  182

Query  896   KAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKE  1075
             +AY +GK +LEAL+S++   + P LS+ S+  N  +FG +L K  M+S +YK +V++AKE
Sbjct  183   EAYEDGKNRLEALLSRLHSTNVPTLSAGSIKLNVGQFGSALQKSTMSSEDYKKSVVQAKE  242

Query  1076  HILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTR  1255
             HILAGDIFQ+VLSQRFERRT ADPFEVYRALRIVNPSPYM Y+QARGCILVASSPEILTR
Sbjct  243   HILAGDIFQVVLSQRFERRTFADPFEVYRALRIVNPSPYMAYLQARGCILVASSPEILTR  302

Query  1256  VKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgs  1435
             V K  VVNRPLAGT +RGKT  ED +LE LLL+DEK+RAEH MLVDLGRNDVGKVSK G+
Sbjct  303   VAKRTVVNRPLAGTIRRGKTKAEDKVLEQLLLSDEKQRAEHIMLVDLGRNDVGKVSKPGT  362

Query  1436  vNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQL  1615
             V VE+LMNIERYSHVMHISSTVTGEL D LTCWDALRAALPVGTVSGAPKV+AMELID++
Sbjct  363   VKVEKLMNIERYSHVMHISSTVTGELRDDLTCWDALRAALPVGTVSGAPKVRAMELIDEM  422

Query  1616  EATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL-------SSRRKEWIAHLQ  1774
             E T RGPYSGGFG ISF GDMDIALALRTIVF      DT+       S+ R+EW+AHLQ
Sbjct  423   EVTMRGPYSGGFGQISFRGDMDIALALRTIVFPTASRFDTMYSYAANSSNARQEWVAHLQ  482

Query  1775  SGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             +GAGIVADS PD EQ+EC+NK AGL+RAIDLAES F+
Sbjct  483   TGAGIVADSKPDDEQQECQNKAAGLARAIDLAESTFL  519



>sp|A2XNK3.1|ASA1_ORYSI RecName: Full=Anthranilate synthase alpha subunit 1, chloroplastic; 
Flags: Precursor [Oryza sativa Indica Group]
 gb|EAY92413.1| hypothetical protein OsI_14147 [Oryza sativa Indica Group]
Length=577

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/531 (70%), Positives = 437/531 (82%), Gaps = 6/531 (1%)
 Frame = +2

Query  311   SLDKEEAKF-IEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGS  487
             ++ +EE+KF   A++  N++PL +CIFSDHLTPVLAYRCLV EDDRE PSFLFESVE GS
Sbjct  45    AVREEESKFKAGAAEGCNILPLKRCIFSDHLTPVLAYRCLVREDDREAPSFLFESVEQGS  104

Query  488   RSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLT  667
               + VGRYSVVGAQP MEI+AK N VT++DH      E+   DPM + RSI E+W PQ+ 
Sbjct  105   EGTNVGRYSVVGAQPAMEIVAKANHVTVMDHKMKSRREQFAPDPMKIPRSIMEQWNPQIV  164

Query  668   ADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKK  847
               LPDAFCGGWVG+FSYDTVRYVE KKLPF++AP+DDRNLPDIHLGLY++++VFDHV+KK
Sbjct  165   EGLPDAFCGGWVGFFSYDTVRYVETKKLPFSNAPEDDRNLPDIHLGLYNDIVVFDHVEKK  224

Query  848   AFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKG  1027
               +IHWVR+D + S  +AY +GK QLEAL+S++  V+ P L++ SV  N  +FG +L K 
Sbjct  225   THVIHWVRVDCHESVDEAYEDGKNQLEALLSRLHSVNVPTLTAGSVKLNVGQFGSALQKS  284

Query  1028  NMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQ  1207
             +M+  +YK AV++AKEHILAGDIFQ+VLSQRFERRT ADPFEVYRALRIVNPSPYM Y+Q
Sbjct  285   SMSREDYKKAVVQAKEHILAGDIFQVVLSQRFERRTFADPFEVYRALRIVNPSPYMAYLQ  344

Query  1208  ARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTML  1387
             ARGCILVASSPEILTRV+K  +VNRPLAGT +RGK+  ED +LE LLL+DEK+ AEH ML
Sbjct  345   ARGCILVASSPEILTRVEKRTIVNRPLAGTIRRGKSKAEDKVLEQLLLSDEKQCAEHIML  404

Query  1388  VDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGT  1567
             VDLGRNDVGKVSK GSV VE+LMN+ERYSHVMHISSTVTGEL D LTCWDALRAALPVGT
Sbjct  405   VDLGRNDVGKVSKPGSVKVEKLMNVERYSHVMHISSTVTGELRDDLTCWDALRAALPVGT  464

Query  1568  VSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-  1744
             VSGAPKV+AMELIDQ+E   RGPYSGGFGG+SF GDMDIALALRTIVF      DT+ S 
Sbjct  465   VSGAPKVRAMELIDQMEGKMRGPYSGGFGGVSFRGDMDIALALRTIVFPTGSRFDTMYSY  524

Query  1745  ----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                  R+EW+AHLQ+GAGIVADS PD E +EC NK AGL+RAIDLAES FV
Sbjct  525   TDKNARQEWVAHLQAGAGIVADSKPDDEHQECLNKAAGLARAIDLAESTFV  575



>ref|XP_010256591.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic 
isoform X2 [Nelumbo nucifera]
Length=573

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/535 (69%), Positives = 425/535 (79%), Gaps = 33/535 (6%)
 Frame = +2

Query  302   SPPSL-DKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVE  478
             SPPSL D+E  KF EASK  NL+PL+ CIFSDHLT VLAYRCLV EDDRE PSFLFESVE
Sbjct  65    SPPSLVDEEAVKFAEASKDGNLVPLYHCIFSDHLTSVLAYRCLVKEDDREAPSFLFESVE  124

Query  479   PGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKP  658
              G   S+VGRYSV+GA P ME++AKEN VTI+DHD+G   E+ V+DPM + R I E WKP
Sbjct  125   QGFGVSSVGRYSVIGAHPMMEVVAKENFVTIMDHDNGSRIEEYVDDPMVIPRKIMENWKP  184

Query  659   QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHV  838
             Q   +LP  FCGGWVGYFSYDTVRYVEKKKLPF+ AP+DDRNLPD+HLGLYD+VIVFDHV
Sbjct  185   QRIDELPGVFCGGWVGYFSYDTVRYVEKKKLPFSRAPEDDRNLPDVHLGLYDDVIVFDHV  244

Query  839   DKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSL  1018
             +KKAF+IHWV LD YSS  +AY +G K+L+ LVSK+Q++DPPRLS+ S++ +T  FG SL
Sbjct  245   EKKAFVIHWVLLDRYSSVDEAYNDGMKRLQVLVSKIQNIDPPRLSAGSIELHTHHFGSSL  304

Query  1019  AKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMT  1198
                +MTS  YK AV++AKEHIL+GDIFQIVLSQRFERRT ADPFE+YRALR+VNPSPYM 
Sbjct  305   KNSSMTSEAYKKAVVQAKEHILSGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMA  364

Query  1199  YMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEH  1378
             Y+QARGCILVASSPEILTRVK+ ++ NRPLAGT +RG+T +ED +LE  LLNDEK+ AEH
Sbjct  365   YLQARGCILVASSPEILTRVKQRKITNRPLAGTVRRGRTNKEDEILEEQLLNDEKQCAEH  424

Query  1379  TMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALP  1558
              MLVDLGRNDV                             VTGELLD LTCWDALRAALP
Sbjct  425   IMLVDLGRNDV---------------------------GKVTGELLDDLTCWDALRAALP  457

Query  1559  VGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL  1738
             VGTVSGAPKVKAMELIDQLE  RRGPYSGGFGGI F GDMDIALALRT+VF      DT+
Sbjct  458   VGTVSGAPKVKAMELIDQLEVKRRGPYSGGFGGICFSGDMDIALALRTMVFPTGARYDTM  517

Query  1739  -----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
                  S++R+EW+AHLQ+GAGIVADSNPD EQ+ECENK A L+RAIDLAES F++
Sbjct  518   YSYKDSNKRREWVAHLQAGAGIVADSNPDDEQRECENKAAALARAIDLAESTFIE  572



>ref|NP_001051764.1| Os03g0826500 [Oryza sativa Japonica Group]
 sp|Q94GF1.1|ASA1_ORYSJ RecName: Full=Anthranilate synthase alpha subunit 1, chloroplastic; 
Short=OsASA1; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAK82452.1|AC091247_19 anthranilate synthase alpha 1 subunit [Oryza sativa Japonica 
Group]
 gb|AAL79757.1|AC096687_21 anthranilate synthase alpha 1 subunit [Oryza sativa Japonica 
Group]
 gb|ABF99646.1| anthranilate synthase component I family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13678.1| Os03g0826500 [Oryza sativa Japonica Group]
 gb|EAZ29134.1| hypothetical protein OsJ_13197 [Oryza sativa Japonica Group]
Length=577

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/531 (70%), Positives = 436/531 (82%), Gaps = 6/531 (1%)
 Frame = +2

Query  311   SLDKEEAKF-IEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGS  487
             ++ +EE+KF   A++  N++PL +CIFSDHLTPVLAYRCLV EDDRE PSFLFESVE GS
Sbjct  45    AVREEESKFKAGAAEGCNILPLKRCIFSDHLTPVLAYRCLVREDDREAPSFLFESVEQGS  104

Query  488   RSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLT  667
               + VGRYSVVGAQP MEI+AK N VT++DH      E+   DPM + RSI E+W PQ+ 
Sbjct  105   EGTNVGRYSVVGAQPAMEIVAKANHVTVMDHKMKSRREQFAPDPMKIPRSIMEQWNPQIV  164

Query  668   ADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKK  847
               LPDAFCGGWVG+FSYDTVRYVE KKLPF++AP+DDRNLPDIHLGLY++++VFDHV+KK
Sbjct  165   EGLPDAFCGGWVGFFSYDTVRYVETKKLPFSNAPEDDRNLPDIHLGLYNDIVVFDHVEKK  224

Query  848   AFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKG  1027
               +IHWVR+D + S  +AY +GK QLEAL+S++  V+ P L++ SV  N  +FG +L K 
Sbjct  225   THVIHWVRVDCHESVDEAYEDGKNQLEALLSRLHSVNVPTLTAGSVKLNVGQFGSALQKS  284

Query  1028  NMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQ  1207
             +M+  +YK AV++AKEHILAGDIFQ+VLSQRFERRT ADPFEVYRALRIVNPSPYM Y+Q
Sbjct  285   SMSREDYKKAVVQAKEHILAGDIFQVVLSQRFERRTFADPFEVYRALRIVNPSPYMAYLQ  344

Query  1208  ARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTML  1387
             ARGCILVASSPEILTRV+K  +VNRPLAGT +RGK+  ED +LE LLL+D K+ AEH ML
Sbjct  345   ARGCILVASSPEILTRVEKRTIVNRPLAGTIRRGKSKAEDKVLEQLLLSDGKQCAEHIML  404

Query  1388  VDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGT  1567
             VDLGRNDVGKVSK GSV VE+LMN+ERYSHVMHISSTVTGEL D LTCWDALRAALPVGT
Sbjct  405   VDLGRNDVGKVSKPGSVKVEKLMNVERYSHVMHISSTVTGELRDDLTCWDALRAALPVGT  464

Query  1568  VSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-  1744
             VSGAPKV+AMELIDQ+E   RGPYSGGFGG+SF GDMDIALALRTIVF      DT+ S 
Sbjct  465   VSGAPKVRAMELIDQMEGKMRGPYSGGFGGVSFRGDMDIALALRTIVFPTGSRFDTMYSY  524

Query  1745  ----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                  R+EW+AHLQ+GAGIVADS PD E +EC NK AGL+RAIDLAES FV
Sbjct  525   TDKNARQEWVAHLQAGAGIVADSKPDDEHQECLNKAAGLARAIDLAESTFV  575



>gb|AFR69324.1| anthranilate synthase alpha 1 [Oryza sativa]
Length=577

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/531 (70%), Positives = 435/531 (82%), Gaps = 6/531 (1%)
 Frame = +2

Query  311   SLDKEEAKF-IEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGS  487
             ++ +EE+KF   A++  N++PL +CIFSDHLTPVLAYRCLV EDDRE PSFLFESVE GS
Sbjct  45    AVREEESKFKAGAAEGCNILPLKRCIFSDHLTPVLAYRCLVREDDREAPSFLFESVEQGS  104

Query  488   RSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLT  667
               + VGRYSVVGAQP MEI+AK N VT++DH      E+   DPM + RSI E+W PQ+ 
Sbjct  105   EGTNVGRYSVVGAQPAMEIVAKANHVTVMDHKMKSRREQFAPDPMKIPRSIMEQWNPQIV  164

Query  668   ADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKK  847
               LPDAFCGGWVG+FSYDTVRYVE KKLPF++AP+DDRNLPDIHLGLY++++VFDHV+KK
Sbjct  165   EGLPDAFCGGWVGFFSYDTVRYVETKKLPFSNAPEDDRNLPDIHLGLYNDIVVFDHVEKK  224

Query  848   AFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKG  1027
               +IHWVR+D + S   AY +GK QLEAL+S++  V+ P L++ SV  N  +FG +L K 
Sbjct  225   THVIHWVRVDCHESVDGAYEDGKNQLEALLSRLHSVNVPTLTAGSVKLNVGQFGSALQKS  284

Query  1028  NMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQ  1207
             +M+  +YK AV++AKEHILAGDIFQ+VLSQRFERRT ADPFEVYRALRIVNPSPYM Y+Q
Sbjct  285   SMSREDYKKAVVQAKEHILAGDIFQVVLSQRFERRTFADPFEVYRALRIVNPSPYMAYLQ  344

Query  1208  ARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTML  1387
             ARGCILVASSPEILTRV+K  +VNRPLAGT +RGK+  ED +LE LLL+D K+ AEH ML
Sbjct  345   ARGCILVASSPEILTRVEKRTIVNRPLAGTIRRGKSKAEDKVLEQLLLSDGKQCAEHIML  404

Query  1388  VDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGT  1567
             VDLGRNDVGKVSK GSV VE+LMN+ERYSHVMHISSTVTGEL D LTCWDALRAALPVGT
Sbjct  405   VDLGRNDVGKVSKPGSVKVEKLMNVERYSHVMHISSTVTGELRDDLTCWDALRAALPVGT  464

Query  1568  VSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-  1744
             VSGAPKV+AMELIDQ+E   RGPYSGGFGG+SF GDMDIALALRTIVF      DT+ S 
Sbjct  465   VSGAPKVRAMELIDQMEGKMRGPYSGGFGGVSFRGDMDIALALRTIVFPTGSRFDTMYSY  524

Query  1745  ----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                  R+EW+AHLQ+GAGIVADS PD E +EC NK AGL+RAIDLAES FV
Sbjct  525   TDKNARQEWVAHLQAGAGIVADSKPDDEHQECLNKAAGLARAIDLAESTFV  575



>ref|XP_002876339.1| hypothetical protein ARALYDRAFT_348673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52598.1| hypothetical protein ARALYDRAFT_348673 [Arabidopsis lyrata subsp. 
lyrata]
Length=520

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/518 (74%), Positives = 424/518 (82%), Gaps = 12/518 (2%)
 Frame = +2

Query  350   KTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQ  529
             K  NL+PL   IFSDHLTPVLAYRCLV EDD+E PSFLFESVEPG  SSTVGRYSVVGA 
Sbjct  2     KKENLVPLRHTIFSDHLTPVLAYRCLVKEDDQEAPSFLFESVEPGHHSSTVGRYSVVGAH  61

Query  530   PTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGY  709
             P MEI+AKENKVT++DH  G  T + VEDPM + R ISE WKPQL  DLPD FCGGWVGY
Sbjct  62    PKMEIVAKENKVTVMDHVKGTKTTEEVEDPMMIPRRISETWKPQLIDDLPDVFCGGWVGY  121

Query  710   FSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSS  889
             FSYDTVRY EK+KLPF+ AP DDRNLPD+HLGLYD+VIVFDHV+KK  IIHWVRL   SS
Sbjct  122   FSYDTVRYAEKRKLPFSKAPVDDRNLPDMHLGLYDDVIVFDHVEKKIHIIHWVRLSGNSS  181

Query  890   ASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKA  1069
                 Y  G K LE LVS+++ ++PP+L   SVD +T +FG  L K +MTS  YKNAVL+A
Sbjct  182   FDDVYGNGMKHLEELVSRIKCINPPKLPYGSVDLHTNQFGTPLEKSSMTSDAYKNAVLQA  241

Query  1070  KEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEIL  1249
             KEHILAGDIFQIVLSQRFER T A PFEVYRALRIVNPSP M Y+QARGCILVASSPEIL
Sbjct  242   KEHILAGDIFQIVLSQRFERHTFAHPFEVYRALRIVNPSPSMCYLQARGCILVASSPEIL  301

Query  1250  TRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsks  1429
             TRVKKN++VNRPLAGTA+RGK+ EED MLE  LL DEK+ AEH MLVDLGRNDVGKVSK+
Sbjct  302   TRVKKNKIVNRPLAGTARRGKSFEEDQMLEETLLKDEKQCAEHIMLVDLGRNDVGKVSKN  361

Query  1430  gsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELID  1609
             GSV VERLMNIERYSHVMHISSTVTGEL ++LTCWD LRAALPVGT      VKAMELID
Sbjct  362   GSVKVERLMNIERYSHVMHISSTVTGELQENLTCWDTLRAALPVGT------VKAMELID  415

Query  1610  QLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSR------RKEWIAHL  1771
             +LE TRRGPYSGGFG +SF GDMDIALALRTIVF      DT+ S       R+EWIA+L
Sbjct  416   ELEVTRRGPYSGGFGSVSFTGDMDIALALRTIVFPTQARYDTMYSYKDKDTPRREWIAYL  475

Query  1772  QSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             Q+GAGIVADS+P+ E +EC+NK AGL+RAIDLAESAFV
Sbjct  476   QAGAGIVADSDPEDEHRECQNKAAGLARAIDLAESAFV  513



>gb|AFR69323.1| anthranilate synthase alpha 1 [Oryza sativa]
 gb|AFR69325.1| anthranilate synthase alpha 1 [Oryza sativa]
Length=577

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/531 (70%), Positives = 436/531 (82%), Gaps = 6/531 (1%)
 Frame = +2

Query  311   SLDKEEAKF-IEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGS  487
             ++ +EE+KF   A++  N++PL +CIFSDHLTPVLAYRCLV EDDRE PSFLFESVE GS
Sbjct  45    AVREEESKFKAGAAEGCNILPLKRCIFSDHLTPVLAYRCLVREDDREAPSFLFESVEQGS  104

Query  488   RSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLT  667
               + VGRYSVVGAQP MEI+AK N VT++DH      E+   DPM + RSI E+W PQ+ 
Sbjct  105   EGTNVGRYSVVGAQPAMEIVAKANHVTVMDHKMKSRREQFAPDPMKIPRSIMEQWNPQIV  164

Query  668   ADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKK  847
               LPDAFCGGWVG+FSYDTVRYVE KKLPF++AP+DDRNLPDIHLGLY++++VFDHV+KK
Sbjct  165   EGLPDAFCGGWVGFFSYDTVRYVETKKLPFSNAPEDDRNLPDIHLGLYNDIVVFDHVEKK  224

Query  848   AFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKG  1027
               +IHWVR+D + S  +AY +GK QLEAL+S++  V+ P L++ SV  N  +FG +L K 
Sbjct  225   THVIHWVRVDCHESVDEAYEDGKNQLEALLSRLHSVNVPTLTAGSVKLNVGQFGSALQKS  284

Query  1028  NMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQ  1207
             +M+  +YK AV++AKEHILAGDIFQ+VLSQRFERRT ADPFEVYRALRIVNPSPYM Y+Q
Sbjct  285   SMSREDYKKAVVQAKEHILAGDIFQVVLSQRFERRTFADPFEVYRALRIVNPSPYMAYLQ  344

Query  1208  ARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTML  1387
             ARGCILVASSPEILTRV+K  +VNRPLAGT +RGK+  ED +LE LLL+D K+ AEH ML
Sbjct  345   ARGCILVASSPEILTRVEKRTIVNRPLAGTIRRGKSKAEDKVLEQLLLSDGKQCAEHIML  404

Query  1388  VDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGT  1567
             VDLGRNDVGKVSK GSV VE+LMN+ERYSHVMHISSTVTGEL D LTCWDALRAALPVGT
Sbjct  405   VDLGRNDVGKVSKPGSVKVEKLMNVERYSHVMHISSTVTGELRDDLTCWDALRAALPVGT  464

Query  1568  VSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-  1744
             VSGAPKV+AMELIDQ+E   RGPYSGGFGG+S+ GDMDIALALRTIVF      DT+ S 
Sbjct  465   VSGAPKVRAMELIDQMEGKMRGPYSGGFGGVSYRGDMDIALALRTIVFPTGSRFDTMYSY  524

Query  1745  ----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                  R+EW+AHLQ+GAGIVADS PD E +EC NK AGL+RAIDLAES FV
Sbjct  525   TDKNARQEWVAHLQAGAGIVADSKPDDEHQECLNKAAGLARAIDLAESTFV  575



>ref|XP_004308927.1| PREDICTED: anthranilate synthase component I-1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=585

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/606 (65%), Positives = 466/606 (77%), Gaps = 36/606 (6%)
 Frame = +2

Query  125   MQAIANCQRLL-PPSHLISELPITSIVSRRSS---------GYAPSLRVRTLQLKCSSSL  274
             MQ +    RL+ P +H +  +P+  I +R SS          Y PS+R       CS   
Sbjct  1     MQGLCLSHRLVTPATHRLCPVPVIGISTRTSSSTLSCVPKLNYVPSIRC------CSQKN  54

Query  275   QIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETP  454
             Q           SL  +  KF EASK  NL+PL++C+FSD LTPVLAYRCLV EDDRE P
Sbjct  55    Q-----------SLTTDAKKFEEASKHGNLVPLYRCLFSDQLTPVLAYRCLVKEDDREAP  103

Query  455   SFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVAR  634
             SFLFESVE     ST GRYS+VGAQP MEI+AKENKVT+LDH++G   E+ VEDPM V +
Sbjct  104   SFLFESVE----QSTQGRYSIVGAQPAMEIVAKENKVTVLDHEAGCSIEQFVEDPMAVPK  159

Query  635   SISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYD  814
              IS+ W+PQL  +LPDAFCGGWVG+FSYDTVRYVEKK+LPF+ AP+DDRNLPD+HLGLY 
Sbjct  160   RISDNWRPQLIDELPDAFCGGWVGFFSYDTVRYVEKKRLPFSKAPEDDRNLPDMHLGLYV  219

Query  815   NVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFN  994
             +VIVFDHV+KK + IHWVRLD YSS  KAY++G ++LE LV++V D++ P++S  +    
Sbjct  220   DVIVFDHVEKKIYAIHWVRLDRYSSVEKAYKDGARRLENLVARVHDIESPKISPGAFSLE  279

Query  995   TREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRI  1174
             T++F P+L   NMT   YKN V +AKEHIL+GDIFQIVLSQRFERRT A PFE+YR+LR 
Sbjct  280   TQKFDPALTISNMTGEAYKNIVKQAKEHILSGDIFQIVLSQRFERRTFAHPFEIYRSLRT  339

Query  1175  VNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLN  1354
             VNPSPY+TY+QARGCILVASSPEIL   KK ++VNRPLAGTA+RGKT EED  LE+ LL 
Sbjct  340   VNPSPYLTYLQARGCILVASSPEILMSAKKKKIVNRPLAGTARRGKTLEEDQQLEVKLLQ  399

Query  1355  DEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCW  1534
             DEK+ AEH MLVDLGRNDVGKVSKSGSV V+RLM+IERYSHVMHISSTVTGEL + LTCW
Sbjct  400   DEKQCAEHIMLVDLGRNDVGKVSKSGSVKVDRLMDIERYSHVMHISSTVTGELREGLTCW  459

Query  1535  DALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFL  1714
             DALRAALPVGTVSGAPK+KA+ELID+LE  RRGPYSGGFG ISF GDMDIALALRT+V  
Sbjct  460   DALRAALPVGTVSGAPKMKAIELIDKLEVNRRGPYSGGFGTISFSGDMDIALALRTMVIP  519

Query  1715  NDGMNDTL-----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESA  1879
                  DT+      + R+EW+A+LQ+GAGIVADS+PD E  EC+NK AGL+RAIDLAE+A
Sbjct  520   TAPRFDTMYFYNNGNTRREWVAYLQAGAGIVADSDPDDENLECQNKAAGLARAIDLAEAA  579

Query  1880  FVKTKR  1897
             FV  ++
Sbjct  580   FVDVEQ  585



>dbj|BAA82094.1| anthranilate synthase alpha 1 subunit [Oryza sativa Japonica 
Group]
Length=577

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/531 (70%), Positives = 435/531 (82%), Gaps = 6/531 (1%)
 Frame = +2

Query  311   SLDKEEAKF-IEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGS  487
             ++ +EE+KF   A++  N++PL +CIFSDHLTPVLAYRCLV EDDRE PSFLFESVE GS
Sbjct  45    AVREEESKFKAGAAEGCNILPLKRCIFSDHLTPVLAYRCLVREDDREAPSFLFESVEQGS  104

Query  488   RSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLT  667
               + VGRYSVVGAQP MEI+AK N VT++DH      E+   DPM + RSI E+W PQ+ 
Sbjct  105   EGTNVGRYSVVGAQPAMEIVAKANHVTVMDHKMKSRREQFAPDPMKIPRSIMEQWNPQIV  164

Query  668   ADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKK  847
               LP AFCGGWVG+FSYDTVRYVE KKLPF++AP+DDRNLPDIHLGLY++++VFDHV+KK
Sbjct  165   EGLPHAFCGGWVGFFSYDTVRYVETKKLPFSNAPEDDRNLPDIHLGLYNDIVVFDHVEKK  224

Query  848   AFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKG  1027
               +IHWVR+D + S  +AY +GK QLEAL+S++  V+ P L++ SV  N  +FG +L K 
Sbjct  225   THVIHWVRVDCHESVDEAYEDGKNQLEALLSRLHSVNVPTLTAGSVKLNVGQFGSALQKS  284

Query  1028  NMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQ  1207
             +M+  +YK AV++AKEHILAGDIFQ+VLSQRFERRT ADPFEVYRALRIVNPSPYM Y+Q
Sbjct  285   SMSREDYKKAVVQAKEHILAGDIFQVVLSQRFERRTFADPFEVYRALRIVNPSPYMAYLQ  344

Query  1208  ARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTML  1387
             ARGCILVASSPEILTRV+K  +VNRPLAGT +RGK+  ED +LE LLL+D K+ AEH ML
Sbjct  345   ARGCILVASSPEILTRVEKRTIVNRPLAGTIRRGKSKAEDKVLEQLLLSDGKQCAEHIML  404

Query  1388  VDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGT  1567
             VDLGRNDVGKVSK GSV VE+LMN+ERYSHVMHISSTVTGEL D LTCWDALRAALPVGT
Sbjct  405   VDLGRNDVGKVSKPGSVKVEKLMNVERYSHVMHISSTVTGELRDDLTCWDALRAALPVGT  464

Query  1568  VSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-  1744
             VSGAPKV+AMELIDQ+E   RGPYSGGFGG+SF GDMDIALALRTIVF      DT+ S 
Sbjct  465   VSGAPKVRAMELIDQMEGKMRGPYSGGFGGVSFRGDMDIALALRTIVFPTGSRFDTMYSY  524

Query  1745  ----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                  R+EW+AHLQ+GAGIVADS PD E +EC NK AGL+RAIDLAES FV
Sbjct  525   TDKNARQEWVAHLQAGAGIVADSKPDDEHQECLNKAAGLARAIDLAESTFV  575



>emb|CAB87841.1| anthranilate synthase alpha-1 chain-like protein [Arabidopsis 
thaliana]
Length=526

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/524 (73%), Positives = 424/524 (81%), Gaps = 12/524 (2%)
 Frame = +2

Query  332   KFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRY  511
             KF E SK  NL+PL   IFSDHLTPVLAYRCLV EDD+E PSFLFESVEPG  SSTVGRY
Sbjct  2     KFAEGSKKENLVPLRHTIFSDHLTPVLAYRCLVKEDDQEAPSFLFESVEPGHHSSTVGRY  61

Query  512   SVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFC  691
             SVVGA P MEI+AKENKVT++DH  G  T + VEDPM + R ISE WKPQL  DLPD FC
Sbjct  62    SVVGAHPKMEIVAKENKVTVMDHVKGTKTTEEVEDPMMIPRRISETWKPQLIDDLPDVFC  121

Query  692   GGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVR  871
             GGWVGYFSYDTV Y EK+KLP + AP DDRNLPD+HLGLYD+V+VFDHV+KK  IIHWVR
Sbjct  122   GGWVGYFSYDTVPYAEKRKLPLSKAPVDDRNLPDMHLGLYDDVVVFDHVEKKIHIIHWVR  181

Query  872   LDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYK  1051
             L   SS    Y    K LE LVS+++ ++PP+L   SVD +T +FG  L K +MTS  YK
Sbjct  182   LSENSSFDDVYANAVKHLEELVSRIKCMNPPKLPYGSVDLHTNQFGTPLEKSSMTSDAYK  241

Query  1052  NAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVA  1231
             NAVL+AKEHILAGDIFQIVLSQRFER T A PFEVYRALRIVNPSP M Y+QARGCILVA
Sbjct  242   NAVLQAKEHILAGDIFQIVLSQRFERHTFAHPFEVYRALRIVNPSPSMCYLQARGCILVA  301

Query  1232  SSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDv  1411
             SSPEILTRVKKN++VNRPLAGTA+RGK+ EED MLE  LL DEK+ AEH MLVDLGRNDV
Sbjct  302   SSPEILTRVKKNKIVNRPLAGTARRGKSFEEDQMLEEALLKDEKQCAEHIMLVDLGRNDV  361

Query  1412  gkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVK  1591
             GKVSK+GSV VERLMNIERYSHVMHISSTV GEL ++LTCWD LRAALPVGT      VK
Sbjct  362   GKVSKNGSVKVERLMNIERYSHVMHISSTVIGELQENLTCWDTLRAALPVGT------VK  415

Query  1592  AMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSR------RK  1753
             AMELID+LE TRRGPYSGGFG +SF GDMDIALALRTIVF      DT+ S       R+
Sbjct  416   AMELIDELEVTRRGPYSGGFGSVSFTGDMDIALALRTIVFPTQARYDTMYSYKDKDTPRR  475

Query  1754  EWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             EWIA+LQ+GAGIVADS+P+ E +EC+NK AGL+RAIDLAESAFV
Sbjct  476   EWIAYLQAGAGIVADSDPEDEHRECQNKAAGLARAIDLAESAFV  519



>ref|XP_002463603.1| hypothetical protein SORBIDRAFT_01g002760 [Sorghum bicolor]
 gb|EER90601.1| hypothetical protein SORBIDRAFT_01g002760 [Sorghum bicolor]
Length=577

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/532 (70%), Positives = 430/532 (81%), Gaps = 6/532 (1%)
 Frame = +2

Query  311   SLDKEEAKF-IEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGS  487
             ++ +EE+KF + A++  NL+PL +CIFSDHLTPVLAYRCLV EDDRE PSFLFESVE GS
Sbjct  45    AVREEESKFRMAAAEGCNLLPLTRCIFSDHLTPVLAYRCLVKEDDREAPSFLFESVEQGS  104

Query  488   RSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLT  667
               + VGRYSVVGAQP MEI+AK N VT++DH+     E  V DPM + R+I E+W PQ+ 
Sbjct  105   EGTNVGRYSVVGAQPAMEIVAKANHVTVMDHEMKSRREHFVPDPMKIPRTIMEQWNPQIA  164

Query  668   ADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKK  847
               LP+AFCGGWVG+FSYDTVRYVE KKLPF+ AP DDRNLPDIHLGLY +VIVFDHV+KK
Sbjct  165   DGLPNAFCGGWVGFFSYDTVRYVETKKLPFSKAPLDDRNLPDIHLGLYSDVIVFDHVEKK  224

Query  848   AFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKG  1027
               +IHWVR D Y+S  +AY +G  +LEAL+S++  ++ P LSS S+  N    G  +   
Sbjct  225   THVIHWVRTDCYNSIDEAYEDGTTRLEALLSRLHCLNIPMLSSGSIKLNVGNTGSVMQNS  284

Query  1028  NMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQ  1207
              M+  EYKN V++AKEHILAGDIFQ+VLSQRFERRT ADPFE+YRALRIVNPSPYM Y+Q
Sbjct  285   TMSREEYKNIVVQAKEHILAGDIFQVVLSQRFERRTFADPFEIYRALRIVNPSPYMAYLQ  344

Query  1208  ARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTML  1387
             ARGCILVASSPEILTRV+K  VVNRPLAGT +RGKT  ED +LE LLL+DEK+RAEH ML
Sbjct  345   ARGCILVASSPEILTRVQKRTVVNRPLAGTIRRGKTKAEDKVLEQLLLSDEKQRAEHIML  404

Query  1388  VDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGT  1567
             +DLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGEL D LTCWDALRAALPVGT
Sbjct  405   IDLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVTGELRDDLTCWDALRAALPVGT  464

Query  1568  VSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-  1744
             VSGAPKV+AMELIDQLE   RGPYSGGFGGISF GDMDIAL LRTIVF      DT+ S 
Sbjct  465   VSGAPKVRAMELIDQLEVNMRGPYSGGFGGISFCGDMDIALDLRTIVFPTTSRFDTMYSY  524

Query  1745  ----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
                  R+EW+AHLQ+GAGIVADS PD E +EC NK AG +RAIDLAES F++
Sbjct  525   TDKKSRQEWVAHLQAGAGIVADSKPDDEHQECLNKAAGAARAIDLAESTFLE  576



>ref|XP_010923079.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
[Elaeis guineensis]
 ref|XP_010923080.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
[Elaeis guineensis]
Length=591

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/598 (66%), Positives = 474/598 (79%), Gaps = 27/598 (5%)
 Frame = +2

Query  131   AIANCQRLLPPSHLISELPITSIVSRRS--SGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             A++ C  L  P+      P  ++ +RRS  S + P L  R+  LKCS+            
Sbjct  5     AVSPCFSLRRPA---PTFPSAALCTRRSEASLHYP-LNRRSSSLKCSA----------IY  50

Query  305   PPSLDKEEA------KFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLF  466
             PPS   + A      KF EA+   NL+ LH+CIFSDHLTPVLAYRCLV EDDRE+PSFLF
Sbjct  51    PPSAAAQAADKEEAEKFAEAASKGNLVSLHRCIFSDHLTPVLAYRCLVKEDDRESPSFLF  110

Query  467   ESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISE  646
             ESVE GSR + +GRYSVVGA P ME+LAK++ VT++DH++G  TE+ V DPM + R I E
Sbjct  111   ESVEQGSRGTNMGRYSVVGAHPAMEVLAKQSTVTVIDHEAGNRTEEFVPDPMQIPRKIIE  170

Query  647   EWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIV  826
              WKPQ   +LPD FCGGW+GYFSYDTVRYVE KKLPF++AP+DDRNLPDIHLGLY++VIV
Sbjct  171   GWKPQFIDELPDIFCGGWLGYFSYDTVRYVETKKLPFSNAPEDDRNLPDIHLGLYNDVIV  230

Query  827   FDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREF  1006
             FDHV+KKA+IIHWVRLD YSS  KAY +GK  L  L+S+VQ+ + P+L+  SV+  TR+F
Sbjct  231   FDHVEKKAYIIHWVRLDQYSSIEKAYEDGKNCLGILLSRVQNANVPKLAPGSVNLYTRQF  290

Query  1007  GPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPS  1186
             G  L K +MTS EYK AV++AKEHILAGDIFQIVLSQRFERRT A+PFEVYRALRIVNPS
Sbjct  291   GTKLKKSSMTSEEYKEAVMQAKEHILAGDIFQIVLSQRFERRTFANPFEVYRALRIVNPS  350

Query  1187  PYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKE  1366
             P+M Y+QARGCI+VASSP+IL RVKK ++VNRPLAGTA+RGKT +ED +LE +LLNDEK+
Sbjct  351   PHMAYLQARGCIIVASSPQILARVKKRKIVNRPLAGTARRGKTDKEDELLEQILLNDEKQ  410

Query  1367  RAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALR  1546
              AEH MLVDLGRNDVG+VSK G+V VE+ MNIE+YSHVM+ISSTVTGEL DHL+CWDA+R
Sbjct  411   CAEHIMLVDLGRNDVGRVSKPGTVEVEKFMNIEKYSHVMYISSTVTGELCDHLSCWDAMR  470

Query  1547  AALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGM  1726
             AALPVGTVSGAPKV+AMELIDQLE  RRGPYSGGFGG+SF GDMD+A+ALRTIVF     
Sbjct  471   AALPVGTVSGAPKVRAMELIDQLEVRRRGPYSGGFGGVSFSGDMDVAVALRTIVFPTGSR  530

Query  1727  NDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
              +T+ S      R+EW+AHLQ+GAGIVADS PD EQ+ECENK A L+RAIDLAE+AFV
Sbjct  531   YNTMYSYREMDMRQEWVAHLQAGAGIVADSIPDDEQRECENKAAALARAIDLAEAAFV  588



>ref|NP_001049641.1| Os03g0264400 [Oryza sativa Japonica Group]
 sp|Q9XJ29.1|ASA2_ORYSJ RecName: Full=Anthranilate synthase alpha subunit 2, chloroplastic; 
Short=OsASA2; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAA82095.1| anthranilate synthase alpha 2 subunit [Oryza sativa Japonica 
Group]
 gb|ABF95122.1| anthranilate synthase component I family protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11555.1| Os03g0264400 [Oryza sativa Japonica Group]
 gb|EEC74914.1| hypothetical protein OsI_10855 [Oryza sativa Indica Group]
Length=606

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/527 (71%), Positives = 439/527 (83%), Gaps = 10/527 (2%)
 Frame = +2

Query  335   FIEA----SKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSST-  499
             F EA    S   NL+P+ +CI SDHLTPVLAYRCLV ED+ ETPSFLFESVE G   +T 
Sbjct  77    FFEAAERGSGKGNLVPMWECIVSDHLTPVLAYRCLVPEDNMETPSFLFESVEQGPEGTTN  136

Query  500   VGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLP  679
             VGRYS+VGA P ME++AKE+KVTI+DH+ GK+TE+VV+DPM + RS+ E W PQ    LP
Sbjct  137   VGRYSMVGAHPVMEVVAKEHKVTIMDHEKGKVTEQVVDDPMQIPRSMMEGWHPQQIDQLP  196

Query  680   DAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFII  859
             D+F GGWVG+FSYDTVRYVEKKKLPF+ APQDDRNLPD+HLGLYD+V+VFD+V+KK ++I
Sbjct  197   DSFTGGWVGFFSYDTVRYVEKKKLPFSGAPQDDRNLPDVHLGLYDDVLVFDNVEKKVYVI  256

Query  860   HWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTS  1039
             HWV LD +++   A+++GK +L  L+SKV + + P+LS   V  +TR+FG  L K  MTS
Sbjct  257   HWVNLDRHATTEDAFQDGKSRLNLLLSKVHNSNVPKLSPGFVKLHTRQFGTPLNKSTMTS  316

Query  1040  GEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGC  1219
              EYKNAV++AKEHI+AGDIFQIVLSQRFERRT A+PFEVYRALRIVNPSPYM Y+QARGC
Sbjct  317   DEYKNAVMQAKEHIMAGDIFQIVLSQRFERRTYANPFEVYRALRIVNPSPYMAYVQARGC  376

Query  1220  ILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLG  1399
             +LVASSPEILTRV+K +++NRPLAGT +RGKT +ED M E  LL+DEK+ AEH MLVDLG
Sbjct  377   VLVASSPEILTRVRKGKIINRPLAGTVRRGKTEKEDEMQEQQLLSDEKQCAEHIMLVDLG  436

Query  1400  RNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGA  1579
             RNDVGKVSK GSV VE+LMNIERYSHVMHISSTV+GEL DHL  WDALRAALPVGTVSGA
Sbjct  437   RNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVSGELDDHLQSWDALRAALPVGTVSGA  496

Query  1580  PKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----  1744
             PKVKAMELID+LE TRRGPYSGG GGISF GDM IALALRTIVF     ++T+ S     
Sbjct  497   PKVKAMELIDELEVTRRGPYSGGLGGISFDGDMLIALALRTIVFSTAPSHNTMYSYKDTE  556

Query  1745  RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             RR+EW+AHLQ+GAGIVADS+PD EQ+ECENK A L+RAIDLAESAFV
Sbjct  557   RRREWVAHLQAGAGIVADSSPDDEQRECENKAAALARAIDLAESAFV  603



>ref|XP_010521932.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic 
[Tarenaya hassleriana]
Length=613

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/525 (72%), Positives = 445/525 (85%), Gaps = 5/525 (1%)
 Frame = +2

Query  332   KFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRY  511
             KF EA+   NL+PL++C+FSDHLTPVLAYRCLV ED+R+ PSFLFESVEPG  +S +GRY
Sbjct  81    KFKEAAGKGNLVPLYRCVFSDHLTPVLAYRCLVKEDERDAPSFLFESVEPGLEASNIGRY  140

Query  512   SVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFC  691
             SVVGAQPT+EI+AK N VT++DH +G  TE+VVEDPM V + I E W PQ T +LP+AFC
Sbjct  141   SVVGAQPTIEIVAKGNVVTVMDHGAGHRTEEVVEDPMMVPQKIMEAWNPQRTDELPEAFC  200

Query  692   GGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVR  871
             GGWVGYFSYDTVRYVEKKKLPF++AP+DDRNLPD+HLGLYD+VIVFDHV+KKA++IHWV 
Sbjct  201   GGWVGYFSYDTVRYVEKKKLPFSNAPEDDRNLPDVHLGLYDDVIVFDHVEKKAYVIHWVL  260

Query  872   LDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYK  1051
             +D   S  + + +G  +LE+L+S++QD   PR+ S  +   T+ FGP L K +MT+  YK
Sbjct  261   IDKNRSIEENFTDGMSRLESLLSRIQDQKLPRMPSGLIKLQTQLFGPKLKKSSMTNEAYK  320

Query  1052  NAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVA  1231
              AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYM Y+QARGCILVA
Sbjct  321   KAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMAYLQARGCILVA  380

Query  1232  SSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDv  1411
             SSPEIL R K  ++ NRPLAGT +RGKTP+EDVMLE  LL+DEK+ AEH MLVDLGRNDV
Sbjct  381   SSPEILLRSKNRKITNRPLAGTVRRGKTPKEDVMLEKELLSDEKQCAEHIMLVDLGRNDV  440

Query  1412  gkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVK  1591
             GKVSK+GSV VE+LMNIERYSHVMHISSTVTGELLD LT WDALRAALPVGTVSGAPKVK
Sbjct  441   GKVSKAGSVKVEKLMNIERYSHVMHISSTVTGELLDDLTSWDALRAALPVGTVSGAPKVK  500

Query  1592  AMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKE  1756
             AMELID++E TRRGPYSGGFGGISF GDMDIALALRT+VF  +   D + S     +R+E
Sbjct  501   AMELIDEVEVTRRGPYSGGFGGISFSGDMDIALALRTMVFPTNSRFDIMYSYKHPQKRRE  560

Query  1757  WIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKT  1891
             WIAH+Q+GAG+VADS+PD EQ+ECENK AGL+RAIDLAES+F+ T
Sbjct  561   WIAHIQAGAGVVADSDPDDEQRECENKAAGLARAIDLAESSFLGT  605



>gb|EPS60768.1| hypothetical protein M569_14029, partial [Genlisea aurea]
Length=538

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/533 (73%), Positives = 454/533 (85%), Gaps = 5/533 (1%)
 Frame = +2

Query  302   SPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEP  481
             S P++ +   KF EA+K  NLIPL++ IFSDHLTPVLAYRCLV ED+R+ PSFLFESVEP
Sbjct  6     SSPAIAENCIKFKEAAKKGNLIPLYQPIFSDHLTPVLAYRCLVKEDERDAPSFLFESVEP  65

Query  482   GSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQ  661
             G ++STVGRYS+VGAQPTMEI+AKENKV I+DH  G+ TE+ VEDPM++ R I E+WKPQ
Sbjct  66    GLKASTVGRYSIVGAQPTMEIVAKENKVVIVDHREGRKTEEFVEDPMSIPRQIMEKWKPQ  125

Query  662   LTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVD  841
             L  +LP+AFCGGWVG+FSYDTVRYVEKKK+PF+ AP DDR+LPD+HLGLYD+VIVFDHV+
Sbjct  126   LIDELPEAFCGGWVGFFSYDTVRYVEKKKIPFSKAPVDDRSLPDLHLGLYDDVIVFDHVE  185

Query  842   KKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLA  1021
             KKAF+IHWVRLD +SS  +AY +G  +LE LV +  D+ PPR+ + S+  +T  FG SL+
Sbjct  186   KKAFVIHWVRLDQFSSIEEAYDDGMNRLEGLVLRFHDIVPPRIPAGSIKLHTGLFGSSLS  245

Query  1022  KGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTY  1201
             K +MTS EY+ AVLKAKEHI AGDIFQIVLSQRFERRT ADPFEVYRALR+VNPSPYMTY
Sbjct  246   KSSMTSDEYRTAVLKAKEHIKAGDIFQIVLSQRFERRTFADPFEVYRALRVVNPSPYMTY  305

Query  1202  MQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHT  1381
             +QARGCILVASSPEILTRV+K ++ NRPLAGT +RGKTP+ED MLE  LL+DEK+ AEH 
Sbjct  306   LQARGCILVASSPEILTRVRKGKITNRPLAGTLRRGKTPKEDEMLEKQLLSDEKQCAEHI  365

Query  1382  MLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPV  1561
             MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTV+GELL  LT WDALRAALPV
Sbjct  366   MLVDLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVSGELLPDLTSWDALRAALPV  425

Query  1562  GTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLS  1741
             GTVSGAPKVKAMELID+LE TRRGPYSGGFGGISF GDMD+ALALRTIVF      DT+ 
Sbjct  426   GTVSGAPKVKAMELIDELEVTRRGPYSGGFGGISFSGDMDMALALRTIVFPTGIRYDTMF  485

Query  1742  S-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             S     +R++WIAHLQ+GAGIVADS+P  EQ+ECENK A L RAIDLAES+F+
Sbjct  486   SYKDGGKRRDWIAHLQAGAGIVADSDPADEQRECENKAAALVRAIDLAESSFL  538



>ref|NP_001266525.1| anthranilate synthase component I-1 [Zea mays]
 gb|ACF78487.1| unknown [Zea mays]
 gb|ACG35280.1| anthranilate synthase component I-1 [Zea mays]
 gb|ACN27924.1| unknown [Zea mays]
 gb|ACN28584.1| unknown [Zea mays]
 gb|ACN34732.1| unknown [Zea mays]
 tpg|DAA44528.1| TPA: anthranilate synthase alpha subunit [Zea mays]
Length=604

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/579 (65%), Positives = 466/579 (80%), Gaps = 19/579 (3%)
 Frame = +2

Query  191   TSIVSRRSSGYAPSLRVRTLQLKCSSSLQIP----VTRSPYSPPSLDKEEAKFIEA----  346
             T + +RR+S      R  T  +KCS+++       ++RS  +  + ++++ +F EA    
Sbjct  28    TVVPTRRTSS-----RSGTSGVKCSAAVTPQASPVISRSAAAAKAAEEDKRRFFEAAARG  82

Query  347   SKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSST-VGRYSVVG  523
             S   NL+P+ +CI SDHLTPVLAYRCLV ED+ + PSFLFESVE G + +T VGRYS+VG
Sbjct  83    SGKGNLVPMWECIVSDHLTPVLAYRCLVPEDNVDAPSFLFESVEQGPQGTTNVGRYSMVG  142

Query  524   AQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWV  703
             A P MEI+AK++KVTI+DH+  ++TE+VV+DPM + R++ E W PQ   +LP++F GGWV
Sbjct  143   AHPVMEIVAKDHKVTIMDHEKSQVTEQVVDDPMQIPRTMMEGWHPQQIDELPESFSGGWV  202

Query  704   GYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSY  883
             G+FSYDTVRYVEKKKLPF+SAPQDDRNLPD+HLGLYD+V+VFD+V+KK ++IHWV +D +
Sbjct  203   GFFSYDTVRYVEKKKLPFSSAPQDDRNLPDVHLGLYDDVLVFDNVEKKVYVIHWVNVDRH  262

Query  884   SSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVL  1063
             +S  +AY++G+ +L  L+SKV + + P LS   V  +TR+FG  L K  MTS EYKNAVL
Sbjct  263   ASVEEAYQDGRSRLNMLLSKVHNSNVPTLSPGFVKLHTRKFGTPLNKSTMTSDEYKNAVL  322

Query  1064  KAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPE  1243
             +AKEHI+AGDIFQIVLSQRFERRT A+PFEVYRALRIVNPSPYM Y+QARGC+LVASSPE
Sbjct  323   QAKEHIMAGDIFQIVLSQRFERRTYANPFEVYRALRIVNPSPYMAYVQARGCVLVASSPE  382

Query  1244  ILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvs  1423
             ILTRV K +++NRPLAGT +RGKT +ED M E  LL+DEK+ AEH MLVDLGRNDVGKVS
Sbjct  383   ILTRVSKGKIINRPLAGTVRRGKTEKEDQMQEQQLLSDEKQCAEHIMLVDLGRNDVGKVS  442

Query  1424  ksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMEL  1603
             K GSV VE+LMNIERYSHVMHISSTV+G+L DHL  WDALRAALPVGTVSGAPKVKAMEL
Sbjct  443   KPGSVKVEKLMNIERYSHVMHISSTVSGQLDDHLQSWDALRAALPVGTVSGAPKVKAMEL  502

Query  1604  IDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAH  1768
             ID+LE TRRGPYSGG GGISF GDM IAL+LRTIVF     ++T+ S     RR+EW+AH
Sbjct  503   IDKLEVTRRGPYSGGLGGISFDGDMQIALSLRTIVFSTAPSHNTMYSYKDADRRREWVAH  562

Query  1769  LQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             LQ+GAGIVADS+PD EQ+ECENK A L+RAIDLAESAFV
Sbjct  563   LQAGAGIVADSSPDDEQRECENKAAALARAIDLAESAFV  601



>ref|XP_004984692.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like 
[Setaria italica]
Length=603

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/582 (65%), Positives = 464/582 (80%), Gaps = 14/582 (2%)
 Frame = +2

Query  170   LISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPPSLDKEEAKFIEA-  346
             L+    + S   RR SG +  +R R +    S+ +    +R   +  + ++E+ +F EA 
Sbjct  23    LVRAGAVVSAGMRRRSGRSGGMRCRAVTPLASAVM----SRGAVAAKAAEEEKRRFFEAA  78

Query  347   ---SKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSST-VGRYS  514
                S  SNL+P+ +CI SDHLTPVLAYRCLV ED+ + PSFLFESVE G + +T VGRYS
Sbjct  79    ARGSGKSNLVPMWECIVSDHLTPVLAYRCLVPEDNVDAPSFLFESVEQGPQGTTNVGRYS  138

Query  515   VVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCG  694
             +VGA P MEI+AKE+KVTI+DH+ G++TE+VV+DPM V R++ E W PQ   +LP++F G
Sbjct  139   MVGAHPVMEIVAKEHKVTIMDHEKGQVTEQVVDDPMQVPRNMMEGWHPQQIDELPESFTG  198

Query  695   GWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRL  874
             GWVG+FSYDTVRYVEKKKLPF+ APQDDRNLPD+HLGLYD+V+VFD+V+KK ++IHWV +
Sbjct  199   GWVGFFSYDTVRYVEKKKLPFSGAPQDDRNLPDVHLGLYDDVLVFDNVEKKVYVIHWVNV  258

Query  875   DSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKN  1054
             D ++S   AY++G+ +L+ L+SKV + + P LS   V  +TR+FG  L K  MTS EYKN
Sbjct  259   DRHASIEAAYQDGRSRLDQLLSKVHNSNVPTLSPGFVKLHTRQFGTPLNKSTMTSDEYKN  318

Query  1055  AVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVAS  1234
             AV++AKEHI+AGDIFQIVLSQRFERRT A+PFEVYRALRIVNPSPYM Y+QARGC+LVAS
Sbjct  319   AVMQAKEHIMAGDIFQIVLSQRFERRTYANPFEVYRALRIVNPSPYMAYVQARGCVLVAS  378

Query  1235  SPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvg  1414
             SPEILTRV K +++NRPLAGT +RGKT +ED M E  LL+DEK+ AEH MLVDLGRNDVG
Sbjct  379   SPEILTRVSKGKIINRPLAGTVRRGKTEKEDQMQEQQLLSDEKQCAEHIMLVDLGRNDVG  438

Query  1415  kvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKA  1594
             KVSK GSV VE+LMNIERYSHVMHISSTV+G+L D L  WDALRAALPVGTVSGAPKVKA
Sbjct  439   KVSKPGSVKVEKLMNIERYSHVMHISSTVSGQLDDRLQSWDALRAALPVGTVSGAPKVKA  498

Query  1595  MELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEW  1759
             MELID+LE TRRGPYSGG GGISF G+M IALALRTIVF     ++T+ S     RR+EW
Sbjct  499   MELIDELEVTRRGPYSGGLGGISFDGNMQIALALRTIVFSTAPSHNTMYSYKAADRRREW  558

Query  1760  IAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             +AHLQ+GAGIVADS+PD EQ+ECENK A L+RAIDLAESAFV
Sbjct  559   VAHLQAGAGIVADSSPDDEQRECENKAAALARAIDLAESAFV  600



>ref|XP_008644366.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
[Zea mays]
 gb|AFW67101.1| hypothetical protein ZEAMMB73_936172 [Zea mays]
Length=578

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/566 (67%), Positives = 443/566 (78%), Gaps = 10/566 (2%)
 Frame = +2

Query  221   YAPSLRVRTLQLKCSSSLQIPVTRSPY---SPPSLDKEEAKFIEAS-KTSNLIPLHKCIF  388
             +APS R   L  +   ++    T + +      ++ +EE+KF  A+ +  NL+P+ + IF
Sbjct  12    FAPSSRPLNLHRRRPDAVTCRATTATFHRLDAVAVREEESKFRRAAAEGCNLVPITRSIF  71

Query  389   SDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVT  568
             SDHLTPVLAYRCLV EDDRE PSFLFESVE GS  + +GRYSVV AQP ME+LAK NKVT
Sbjct  72    SDHLTPVLAYRCLVKEDDREAPSFLFESVEQGSEGTNMGRYSVVAAQPAMEVLAKANKVT  131

Query  569   ILDHDSGKLTEKVVEDPMTVARSISEEWKP-QLTADLPDAFCGGWVGYFSYDTVRYVEKK  745
             ++DH+     E +V DPM + R+I E+W P Q+T  LPDAFCGGWVG+FSYDTVRYVE K
Sbjct  132   VMDHELKSRREHLVPDPMKIPRTIMEQWNPPQVTDGLPDAFCGGWVGFFSYDTVRYVETK  191

Query  746   KLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQL  925
             KLPF+ AP DDRN+PD+HLGLY NVIVFDHV+KK  +IHWVR D Y S  +AY +G  +L
Sbjct  192   KLPFSKAPHDDRNIPDMHLGLYTNVIVFDHVEKKMHVIHWVRTDCYQSLDEAYEDGTNRL  251

Query  926   EALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQI  1105
             E+L+S++   + P LSS S+  N   FG +  K NM+  EYKN V++AKEHILAGDIFQ 
Sbjct  252   ESLLSRLHCFNVPTLSSGSIKLNVGGFGSATLKSNMSKEEYKNIVVQAKEHILAGDIFQA  311

Query  1106  VLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRP  1285
             VLSQR ERRT ADPFE+YRALRIVNPSPYM Y+QARGCILVASSPEILTRV+K  VVNRP
Sbjct  312   VLSQRLERRTFADPFEIYRALRIVNPSPYMAYLQARGCILVASSPEILTRVQKRTVVNRP  371

Query  1286  LAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIE  1465
             LAGT +RGKT  ED +LE LLL+DEK+RAEH MLVDLGRNDVGKVSK GSV VE+LMNIE
Sbjct  372   LAGTIRRGKTKAEDKVLEQLLLSDEKQRAEHIMLVDLGRNDVGKVSKPGSVKVEKLMNIE  431

Query  1466  RYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSG  1645
             RYSHVMHISSTVTGEL D LTCWDALRAALPVGTVSGAPKV+AMELID+LEA  RGPYSG
Sbjct  432   RYSHVMHISSTVTGELRDDLTCWDALRAALPVGTVSGAPKVRAMELIDELEADMRGPYSG  491

Query  1646  GFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPD  1810
             GFGGISF GDMDIALALRTIVF      DT+ S      R+EWIAHLQ+GAGIVADS PD
Sbjct  492   GFGGISFNGDMDIALALRTIVFPTASRFDTMYSYANGKSRQEWIAHLQAGAGIVADSKPD  551

Query  1811  SEQKECENKVAGLSRAIDLAESAFVK  1888
              E +EC NK AG +RAIDLAES F++
Sbjct  552   DEHQECLNKAAGAARAIDLAESTFLQ  577



>gb|AES62987.2| anthranilate synthase alpha 1 [Medicago truncatula]
Length=555

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/540 (73%), Positives = 441/540 (82%), Gaps = 19/540 (4%)
 Frame = +2

Query  281   PVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSF  460
             P+  +  S P +D  + KFIEASK  N+IPL++CIFSDHLTPVLAYRCLV ED+R+ PSF
Sbjct  28    PIKCAAQSLPLVDNAD-KFIEASKKGNVIPLYRCIFSDHLTPVLAYRCLVKEDERDAPSF  86

Query  461   LFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSI  640
             LFES EPG   S+ GRYSVVGAQP MEI+AKEN VTI+DH+ G+ TE++  DP+ + R I
Sbjct  87    LFESAEPGLHISSTGRYSVVGAQPCMEIVAKENMVTIMDHEEGRKTEEIALDPLVIPRRI  146

Query  641   SEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNV  820
              E+W PQL  DLP+AFCGGWVGYFSYDT+RYVEKKKLPFA+AP DDR LPD+HLGLYDNV
Sbjct  147   MEKWTPQLIDDLPEAFCGGWVGYFSYDTMRYVEKKKLPFANAPMDDRGLPDVHLGLYDNV  206

Query  821   IVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTR  1000
             IVFDHV+KKA++IHWVRLD YSS  KA  +G  +LE LVS+V D+  PRL + S+   TR
Sbjct  207   IVFDHVEKKAYVIHWVRLDRYSSPEKALNDGLDKLETLVSRVHDIITPRLPAGSIKLLTR  266

Query  1001  EFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVN  1180
              FGP L   NMT  EYK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVN
Sbjct  267   LFGPKLELSNMTKEEYKKAVLQAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVN  326

Query  1181  PSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDE  1360
             PSPYMTY+QARG ILVASSPEILTRVKK R             +TP+ED+MLE  LLNDE
Sbjct  327   PSPYMTYLQARGSILVASSPEILTRVKKKR-------------ETPKEDIMLEKDLLNDE  373

Query  1361  KERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDA  1540
             K+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGELLD LT WDA
Sbjct  374   KQCAEHVMLVDLGRNDVGKVSKPGSVQVEKLMNIERYSHVMHISSTVTGELLDGLTSWDA  433

Query  1541  LRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLND  1720
             LRAALPVGTVSGAPKVKAMELIDQLE  RRGPYSGGFGGISF GDMDIALALRT+VF  +
Sbjct  434   LRAALPVGTVSGAPKVKAMELIDQLEVARRGPYSGGFGGISFSGDMDIALALRTMVFPTN  493

Query  1721  GMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                DT+ S     +R+EWIAHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  494   TRFDTMYSYKDVNKRREWIAHLQAGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  553



>ref|XP_003558289.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic 
[Brachypodium distachyon]
Length=604

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/553 (68%), Positives = 447/553 (81%), Gaps = 11/553 (2%)
 Frame = +2

Query  260   CSSSLQI-PVTRSPYSPPSLDKEEAKFIEA----SKTSNLIPLHKCIFSDHLTPVLAYRC  424
             C++S  + P+     +  + +++  +F E+    S   NL+P+ +CI SDHLTPVLAYRC
Sbjct  49    CAASASVSPLINGSAAAKAEEEDRRRFFESAARGSGQGNLVPMWECIVSDHLTPVLAYRC  108

Query  425   LVDEDDRETPSFLFESVEPGSRSST-VGRYSVVGAQPTMEILAKENKVTILDHDSGKLTE  601
             LV EDD + PSFLFESVE G   +T VGRYS++GA P +EI+AKENKVTI+DH+ G +TE
Sbjct  109   LVPEDDMDAPSFLFESVEQGLEGTTNVGRYSILGAHPALEIVAKENKVTIMDHEKGVVTE  168

Query  602   KVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDR  781
             +VV+DPM V RSI E W PQ    LP+AF GGWVG+FSYDTVRYVEKKK+ F+ AP+DDR
Sbjct  169   QVVDDPMQVPRSIMEGWHPQQIDQLPEAFSGGWVGFFSYDTVRYVEKKKIAFSGAPEDDR  228

Query  782   NLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDP  961
             NLPD+HLGLYD+V+VFDHV+KK ++IHWV LD ++S   AY++GK +L+ L+SKV + + 
Sbjct  229   NLPDVHLGLYDDVLVFDHVEKKVYVIHWVSLDRHASTEDAYQDGKSRLKQLLSKVHNANV  288

Query  962   PRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTA  1141
             P+LS   V  +TR+FG  L K  MTS EYKNAV++AKEHILAG+IFQIVLSQRFERRT A
Sbjct  289   PKLSPGFVKLHTRQFGTPLNKSTMTSDEYKNAVIQAKEHILAGNIFQIVLSQRFERRTYA  348

Query  1142  DPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPE  1321
              PFEVYRALRIVNPSPYM Y+QARGCILVASSPEILT+V+K +V+NRPLAGT +RGKT  
Sbjct  349   TPFEVYRALRIVNPSPYMAYVQARGCILVASSPEILTKVQKGKVINRPLAGTTRRGKTES  408

Query  1322  EDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTV  1501
             ED + E  LL+D+K+ AEH MLVDLGRNDVGKVSKSGSV VE+LMNIERYSHVMHISSTV
Sbjct  409   EDKLQEEQLLSDQKQCAEHIMLVDLGRNDVGKVSKSGSVKVEKLMNIERYSHVMHISSTV  468

Query  1502  TGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMD  1681
             +G+L D L  WDALRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGG GGISF GDM 
Sbjct  469   SGQLDDQLQSWDALRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGLGGISFDGDMQ  528

Query  1682  IALALRTIVFLNDGMNDTL-----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAG  1846
             IALALRTIVF     ++T+     S RR+EW+AHLQ+GAGIVADS PD EQKECENK A 
Sbjct  529   IALALRTIVFSTAPSHNTMFSYKNSDRRREWVAHLQAGAGIVADSIPDDEQKECENKAAA  588

Query  1847  LSRAIDLAESAFV  1885
             L+RAIDLAESAFV
Sbjct  589   LARAIDLAESAFV  601



>ref|NP_001105813.1| LOC606722 [Zea mays]
 gb|AAZ43077.1| anthranilate synthase alpha subunit [Zea mays]
Length=604

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/579 (65%), Positives = 465/579 (80%), Gaps = 19/579 (3%)
 Frame = +2

Query  191   TSIVSRRSSGYAPSLRVRTLQLKCSSSLQIP----VTRSPYSPPSLDKEEAKFIEA----  346
             T + +RR+S      R  T  +KCS+++       ++RS  +  + ++++ +F EA    
Sbjct  28    TVVPTRRTSS-----RSGTSGVKCSAAVTPQASPVISRSAAAAKAAEEDKRRFFEAAARG  82

Query  347   SKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSST-VGRYSVVG  523
             S   N +P+ +CI SDHLTPVLAYRCLV ED+ + PSFLFESVE G + +T VGRYS+VG
Sbjct  83    SGKGNPVPMWECIVSDHLTPVLAYRCLVPEDNADAPSFLFESVEQGPQGTTNVGRYSMVG  142

Query  524   AQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWV  703
             A P MEI+AK++KVTI+DH+  ++TE+VV+DPM + R++ E W PQ   +LP++F GGWV
Sbjct  143   AHPVMEIVAKDHKVTIMDHEKSQVTEQVVDDPMQIPRTMMEGWHPQQIDELPESFSGGWV  202

Query  704   GYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSY  883
             G+FSYDTVRYVEKKKLPF+SAPQDDRNLPD+HLGLYD+V+VFD+V+KK ++IHWV +D +
Sbjct  203   GFFSYDTVRYVEKKKLPFSSAPQDDRNLPDVHLGLYDDVLVFDNVEKKVYVIHWVNVDRH  262

Query  884   SSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVL  1063
             +S  +AY++G+ +L  L+SKV + + P LS   V  +TR+FG  L K  MTS EYKNAVL
Sbjct  263   ASVEEAYQDGRSRLNMLLSKVHNSNVPTLSPGFVKLHTRKFGTPLNKSTMTSDEYKNAVL  322

Query  1064  KAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPE  1243
             +AKEHI+AGDIFQIVLSQRFERRT A+PFEVYRALRIVNPSPYM Y+QARGC+LVASSPE
Sbjct  323   QAKEHIMAGDIFQIVLSQRFERRTYANPFEVYRALRIVNPSPYMAYVQARGCVLVASSPE  382

Query  1244  ILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvs  1423
             ILTRV K +++NRPLAGT +RGKT +ED M E  LL+DEK+ AEH MLVDLGRNDVGKVS
Sbjct  383   ILTRVSKGKIINRPLAGTVRRGKTEKEDQMQEQQLLSDEKQCAEHIMLVDLGRNDVGKVS  442

Query  1424  ksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMEL  1603
             K GSV VE+LMNIERYSHVMHISSTV+G+L DHL  WDALRAALPVGTVSGAPKVKAMEL
Sbjct  443   KPGSVKVEKLMNIERYSHVMHISSTVSGQLDDHLQSWDALRAALPVGTVSGAPKVKAMEL  502

Query  1604  IDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAH  1768
             ID+LE TRRGPYSGG GGISF GDM IAL+LRTIVF     ++T+ S     RR+EW+AH
Sbjct  503   IDKLEVTRRGPYSGGLGGISFDGDMQIALSLRTIVFSTAPSHNTMYSYKDADRRREWVAH  562

Query  1769  LQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             LQ+GAGIVADS+PD EQ+ECENK A L+RAIDLAESAFV
Sbjct  563   LQAGAGIVADSSPDDEQRECENKAAALARAIDLAESAFV  601



>ref|XP_006651238.1| PREDICTED: anthranilate synthase component I-2, chloroplastic-like 
[Oryza brachyantha]
Length=514

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/511 (72%), Positives = 430/511 (84%), Gaps = 6/511 (1%)
 Frame = +2

Query  371   LHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSST-VGRYSVVGAQPTMEIL  547
             + +CI SDHLTPVLAYRCLV ED+ +TPSFLFESVE G   +T VGRYS+VGA P MEI+
Sbjct  1     MWECIVSDHLTPVLAYRCLVPEDNMDTPSFLFESVEQGPEGTTNVGRYSMVGAHPVMEIV  60

Query  548   AKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTV  727
             AKENKVTI+DH+ GK+TE+VV+DPM + RS+ E W PQ    LPD+F GGWVG+FSYDTV
Sbjct  61    AKENKVTIMDHEKGKVTEQVVDDPMQIPRSMMEGWHPQQIDQLPDSFTGGWVGFFSYDTV  120

Query  728   RYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYR  907
             RYVEKKKLPF+ APQDDRNLPD+HLGLYD+V+VFD+V+KK ++IHWV LD ++S   AY+
Sbjct  121   RYVEKKKLPFSGAPQDDRNLPDVHLGLYDDVLVFDNVEKKVYVIHWVNLDRHASTEDAYQ  180

Query  908   EGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILA  1087
             +G+ +L   +SKV + + P+LS   V  +TR+FG  L K  MTS EYKNAV++AKEHI+A
Sbjct  181   DGRSRLNLFLSKVHNSNVPKLSPGFVKLHTRQFGTPLNKSTMTSDEYKNAVMQAKEHIMA  240

Query  1088  GDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKN  1267
             GDIFQIVLSQRFERRT A+PFEVYRALRIVNPSPYM Y+QARGC+LVASSPEILTRV+K 
Sbjct  241   GDIFQIVLSQRFERRTYANPFEVYRALRIVNPSPYMAYVQARGCVLVASSPEILTRVRKG  300

Query  1268  RVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVE  1447
             +++NRPLAGT +RGKT +ED M E  LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE
Sbjct  301   KIINRPLAGTVRRGKTEKEDEMQEKQLLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVE  360

Query  1448  RLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATR  1627
             +LMNIERYSHVMHISSTV+GEL DHL  WDALRAALPVGTVSGAPKVKAMELID+LE TR
Sbjct  361   KLMNIERYSHVMHISSTVSGELDDHLQSWDALRAALPVGTVSGAPKVKAMELIDELEVTR  420

Query  1628  RGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIV  1792
             RGPYSGG GGISF GDM IALALRTIVF     ++T+ S     RR+EW+AHLQ+GAGIV
Sbjct  421   RGPYSGGLGGISFDGDMLIALALRTIVFSTAPSHNTMYSYKDTERRREWVAHLQAGAGIV  480

Query  1793  ADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             ADS+PD EQ+ECENK A L+RAIDLAESAFV
Sbjct  481   ADSSPDDEQRECENKAAALARAIDLAESAFV  511



>gb|EMT13435.1| Anthranilate synthase component I-2, chloroplastic [Aegilops 
tauschii]
Length=604

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/545 (69%), Positives = 445/545 (82%), Gaps = 10/545 (2%)
 Frame = +2

Query  281   PVTRSPYSPPSLDKEEAKFIEASK----TSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRE  448
             PV     +  + +++  +F EA+       NL+P+ +CI SDHLTPVLAYRCLV EDD +
Sbjct  57    PVINGSAAAKAEEEDRRRFFEAAARGTGKGNLVPVWECIVSDHLTPVLAYRCLVPEDDMD  116

Query  449   TPSFLFESVEPGSRSST-VGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMT  625
             TPSFLFESVE G   +T VGRYS+VGA P ME++AKENKVTI+DH+  ++TEK+++DPM 
Sbjct  117   TPSFLFESVEQGLEGTTNVGRYSMVGAHPVMEVVAKENKVTIMDHEKAEVTEKIMDDPMQ  176

Query  626   VARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLG  805
             V RSI E W PQ    LP+AF GGWVG+FSYDTVRYVEKKK+PF+ AP DDRNLPD+HLG
Sbjct  177   VPRSIMEGWHPQEIDQLPEAFSGGWVGFFSYDTVRYVEKKKIPFSGAPHDDRNLPDVHLG  236

Query  806   LYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASV  985
             LYD+V+VFD+V+KK ++IHWV +D ++S  +AY++G+ +L+ L+SKV + + P+LS   V
Sbjct  237   LYDDVLVFDNVEKKVYVIHWVSVDRHASTEEAYKDGRSRLKRLLSKVYNANVPKLSPGFV  296

Query  986   DFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRA  1165
               +TR+FG  L K  MTS EYK+AV++AKEHILAG+IFQIVLSQRFERRT A PFEVYRA
Sbjct  297   KLHTRQFGTPLNKSTMTSDEYKSAVMQAKEHILAGNIFQIVLSQRFERRTYATPFEVYRA  356

Query  1166  LRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEML  1345
             LRIVNPSPYM Y+QARGCILVASSPEILT+V+K +V+NRPLAGT +RGKT  ED + E  
Sbjct  357   LRIVNPSPYMAYVQARGCILVASSPEILTKVEKGKVINRPLAGTTRRGKTEHEDKLQEEQ  416

Query  1346  LLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHL  1525
             LLND+K+ AEH MLVDLGRNDVG+VSKSGSV VE+LMNIERYSHVMHISSTV+GEL DHL
Sbjct  417   LLNDQKQCAEHIMLVDLGRNDVGRVSKSGSVKVEKLMNIERYSHVMHISSTVSGELDDHL  476

Query  1526  TCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTI  1705
               WDALRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGG GGISF GDM IALALRTI
Sbjct  477   ESWDALRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGLGGISFDGDMLIALALRTI  536

Query  1706  VFLNDGMNDTL-----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLA  1870
             VF     ++T+     S RR+EW+AHLQ+GAGIVADS PD EQKECENK A L+RAIDLA
Sbjct  537   VFSTAPSHNTMYSYKSSDRRREWVAHLQAGAGIVADSIPDDEQKECENKAAALARAIDLA  596

Query  1871  ESAFV  1885
             ESAFV
Sbjct  597   ESAFV  601



>gb|EEE58750.1| hypothetical protein OsJ_10240 [Oryza sativa Japonica Group]
Length=724

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/527 (71%), Positives = 439/527 (83%), Gaps = 10/527 (2%)
 Frame = +2

Query  335   FIEA----SKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSST-  499
             F EA    S   NL+P+ +CI SDHLTPVLAYRCLV ED+ ETPSFLFESVE G   +T 
Sbjct  195   FFEAAERGSGKGNLVPMWECIVSDHLTPVLAYRCLVPEDNMETPSFLFESVEQGPEGTTN  254

Query  500   VGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLP  679
             VGRYS+VGA P ME++AKE+KVTI+DH+ GK+TE+VV+DPM + RS+ E W PQ    LP
Sbjct  255   VGRYSMVGAHPVMEVVAKEHKVTIMDHEKGKVTEQVVDDPMQIPRSMMEGWHPQQIDQLP  314

Query  680   DAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFII  859
             D+F GGWVG+FSYDTVRYVEKKKLPF+ APQDDRNLPD+HLGLYD+V+VFD+V+KK ++I
Sbjct  315   DSFTGGWVGFFSYDTVRYVEKKKLPFSGAPQDDRNLPDVHLGLYDDVLVFDNVEKKVYVI  374

Query  860   HWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTS  1039
             HWV LD +++   A+++GK +L  L+SKV + + P+LS   V  +TR+FG  L K  MTS
Sbjct  375   HWVNLDRHATTEDAFQDGKSRLNLLLSKVHNSNVPKLSPGFVKLHTRQFGTPLNKSTMTS  434

Query  1040  GEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGC  1219
              EYKNAV++AKEHI+AGDIFQIVLSQRFERRT A+PFEVYRALRIVNPSPYM Y+QARGC
Sbjct  435   DEYKNAVMQAKEHIMAGDIFQIVLSQRFERRTYANPFEVYRALRIVNPSPYMAYVQARGC  494

Query  1220  ILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLG  1399
             +LVASSPEILTRV+K +++NRPLAGT +RGKT +ED M E  LL+DEK+ AEH MLVDLG
Sbjct  495   VLVASSPEILTRVRKGKIINRPLAGTVRRGKTEKEDEMQEQQLLSDEKQCAEHIMLVDLG  554

Query  1400  RNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGA  1579
             RNDVGKVSK GSV VE+LMNIERYSHVMHISSTV+GEL DHL  WDALRAALPVGTVSGA
Sbjct  555   RNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVSGELDDHLQSWDALRAALPVGTVSGA  614

Query  1580  PKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----  1744
             PKVKAMELID+LE TRRGPYSGG GGISF GDM IALALRTIVF     ++T+ S     
Sbjct  615   PKVKAMELIDELEVTRRGPYSGGLGGISFDGDMLIALALRTIVFSTAPSHNTMYSYKDTE  674

Query  1745  RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             RR+EW+AHLQ+GAGIVADS+PD EQ+ECENK A L+RAIDLAESAFV
Sbjct  675   RRREWVAHLQAGAGIVADSSPDDEQRECENKAAALARAIDLAESAFV  721



>gb|ABF95120.1| anthranilate synthase component I family protein, expressed [Oryza 
sativa Japonica Group]
Length=514

 Score =   750 bits (1936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/511 (72%), Positives = 431/511 (84%), Gaps = 6/511 (1%)
 Frame = +2

Query  371   LHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSST-VGRYSVVGAQPTMEIL  547
             + +CI SDHLTPVLAYRCLV ED+ ETPSFLFESVE G   +T VGRYS+VGA P ME++
Sbjct  1     MWECIVSDHLTPVLAYRCLVPEDNMETPSFLFESVEQGPEGTTNVGRYSMVGAHPVMEVV  60

Query  548   AKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTV  727
             AKE+KVTI+DH+ GK+TE+VV+DPM + RS+ E W PQ    LPD+F GGWVG+FSYDTV
Sbjct  61    AKEHKVTIMDHEKGKVTEQVVDDPMQIPRSMMEGWHPQQIDQLPDSFTGGWVGFFSYDTV  120

Query  728   RYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYR  907
             RYVEKKKLPF+ APQDDRNLPD+HLGLYD+V+VFD+V+KK ++IHWV LD +++   A++
Sbjct  121   RYVEKKKLPFSGAPQDDRNLPDVHLGLYDDVLVFDNVEKKVYVIHWVNLDRHATTEDAFQ  180

Query  908   EGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILA  1087
             +GK +L  L+SKV + + P+LS   V  +TR+FG  L K  MTS EYKNAV++AKEHI+A
Sbjct  181   DGKSRLNLLLSKVHNSNVPKLSPGFVKLHTRQFGTPLNKSTMTSDEYKNAVMQAKEHIMA  240

Query  1088  GDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKN  1267
             GDIFQIVLSQRFERRT A+PFEVYRALRIVNPSPYM Y+QARGC+LVASSPEILTRV+K 
Sbjct  241   GDIFQIVLSQRFERRTYANPFEVYRALRIVNPSPYMAYVQARGCVLVASSPEILTRVRKG  300

Query  1268  RVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVE  1447
             +++NRPLAGT +RGKT +ED M E  LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE
Sbjct  301   KIINRPLAGTVRRGKTEKEDEMQEQQLLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVE  360

Query  1448  RLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATR  1627
             +LMNIERYSHVMHISSTV+GEL DHL  WDALRAALPVGTVSGAPKVKAMELID+LE TR
Sbjct  361   KLMNIERYSHVMHISSTVSGELDDHLQSWDALRAALPVGTVSGAPKVKAMELIDELEVTR  420

Query  1628  RGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIV  1792
             RGPYSGG GGISF GDM IALALRTIVF     ++T+ S     RR+EW+AHLQ+GAGIV
Sbjct  421   RGPYSGGLGGISFDGDMLIALALRTIVFSTAPSHNTMYSYKDTERRREWVAHLQAGAGIV  480

Query  1793  ADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             ADS+PD EQ+ECENK A L+RAIDLAESAFV
Sbjct  481   ADSSPDDEQRECENKAAALARAIDLAESAFV  511



>dbj|BAF30814.1| anthranilate synthase alpha 2 subunit [Avena sativa]
Length=611

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/532 (70%), Positives = 436/532 (82%), Gaps = 10/532 (2%)
 Frame = +2

Query  320   KEEAKFIEA----SKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGS  487
             ++  +F EA    S   NL+PL +CI SDHLTPVLAYRCLV EDD +TPSFLFESVE G 
Sbjct  77    EDRQRFFEAAARGSGKGNLVPLWECIVSDHLTPVLAYRCLVGEDDMDTPSFLFESVEQGL  136

Query  488   RSST-VGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
               +T VGRYS+VGA P MEI+AKE+KVT +DH+ G +TE++V+DPM V RSI E W PQ 
Sbjct  137   EGTTNVGRYSMVGAHPVMEIVAKEDKVTTMDHEKGTVTEQIVDDPMEVPRSIMEGWHPQQ  196

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               DLP+ F GGWVG+FSYDTVRYVEKKK+PF+ APQDDRNLPD+HLGLYD+V+VFD V+K
Sbjct  197   IDDLPETFSGGWVGFFSYDTVRYVEKKKIPFSGAPQDDRNLPDVHLGLYDDVLVFDSVEK  256

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             K ++IHWV LD ++S  +AY+ G+ +L   +SKV + + P+LS   V  +T++FG +L K
Sbjct  257   KVYVIHWVSLDRHASTEEAYKYGRSRLRRFLSKVHNTNVPKLSPGFVKLHTKQFGTALTK  316

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
               MTS EYKNAVL+AKEHILAG+IFQIVLSQRFERRT A PFEVYRALRIVNPSPYM Y+
Sbjct  317   STMTSDEYKNAVLQAKEHILAGNIFQIVLSQRFERRTYATPFEVYRALRIVNPSPYMAYV  376

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEILT+V+K +++NRPLAGT +RGKT  ED + E  LL+D+K+RAEH M
Sbjct  377   QARGCILVASSPEILTKVQKGKIINRPLAGTTRRGKTENEDKLQEEELLSDKKQRAEHIM  436

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVG+VSK GSV VE+LMNIERYSHVMHISSTV+GEL D L  WDALRAALPVG
Sbjct  437   LVDLGRNDVGRVSKPGSVKVEKLMNIERYSHVMHISSTVSGELDDDLQSWDALRAALPVG  496

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL--  1738
             TVSGAPKVKAMELIDQLE TRRGPYSGG GGISF GDM IALALRTIVF     ++T+  
Sbjct  497   TVSGAPKVKAMELIDQLEVTRRGPYSGGLGGISFNGDMMIALALRTIVFSTAPSHNTMFS  556

Query  1739  ---SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                S RR+EW+AHLQ+GAGIVADS P+ EQKECENK A L+RAIDLAESAFV
Sbjct  557   YKNSDRRREWVAHLQAGAGIVADSIPEDEQKECENKAAALARAIDLAESAFV  608



>dbj|BAF30812.1| anthranilate synthase alpha 2 subunit [Avena sativa]
Length=609

 Score =   752 bits (1942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/532 (70%), Positives = 436/532 (82%), Gaps = 10/532 (2%)
 Frame = +2

Query  320   KEEAKFIEA----SKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGS  487
             ++  +F EA    S   NL+PL +CI SDHLTPVLAYRCLV EDD +TPSFLFESVE G 
Sbjct  75    EDRQRFFEAAARGSGKGNLVPLWECIVSDHLTPVLAYRCLVGEDDMDTPSFLFESVEQGL  134

Query  488   RSST-VGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
               +T VGRYS+VGA P MEI+AKE+KVT +DH+ G +TE++V+DPM V RSI E W PQ 
Sbjct  135   EGTTNVGRYSMVGAHPVMEIVAKEDKVTTMDHEKGTVTEQIVDDPMEVPRSIMEGWHPQQ  194

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               DLP+ F GGWVG+FSYDTVRYVEKKK+PF+ APQDDRNLPD+HLGLYD+V+VFD V+K
Sbjct  195   IDDLPETFSGGWVGFFSYDTVRYVEKKKIPFSGAPQDDRNLPDVHLGLYDDVLVFDSVEK  254

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             K ++IHWV LD ++S  +AY+ G+ +L   +SKV + + P+LS   V  +T++FG +L K
Sbjct  255   KVYVIHWVSLDRHASTEEAYQYGRSRLRRFLSKVHNTNVPKLSPGFVKLHTKQFGTALTK  314

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
               MTS EYK+AVL+AKEHILAG+IFQIVLSQRFERRT A PFEVYRALRIVNPSPYM Y+
Sbjct  315   STMTSDEYKSAVLQAKEHILAGNIFQIVLSQRFERRTYATPFEVYRALRIVNPSPYMAYV  374

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEILT+V+K +++NRPLAGT +RGKT  ED + E  LL+D+K+RAEH M
Sbjct  375   QARGCILVASSPEILTKVQKGKIINRPLAGTTRRGKTENEDKLQEEELLSDKKQRAEHIM  434

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVG+VSK GSV VE+LMNIERYSHVMHISSTV+GEL D L  WDALRAALPVG
Sbjct  435   LVDLGRNDVGRVSKPGSVKVEKLMNIERYSHVMHISSTVSGELDDDLQSWDALRAALPVG  494

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL--  1738
             TVSGAPKVKAMELIDQLE TRRGPYSGG GGISF GDM IALALRTIVF     ++T+  
Sbjct  495   TVSGAPKVKAMELIDQLEVTRRGPYSGGLGGISFNGDMMIALALRTIVFSTAPSHNTMFS  554

Query  1739  ---SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                S RR+EW+AHLQ+GAGIVADS PD EQKECENK A L+RAIDLAESAFV
Sbjct  555   YKNSDRRREWVAHLQAGAGIVADSIPDDEQKECENKAAALARAIDLAESAFV  606



>dbj|BAF30813.1| anthranilate synthase alpha 2 subunit [Avena sativa]
Length=610

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/532 (70%), Positives = 437/532 (82%), Gaps = 10/532 (2%)
 Frame = +2

Query  320   KEEAKFIEA----SKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGS  487
             ++  +F EA    S   NL+PL +CI SDHLTPVLAYRCLV EDD +TPSFLFESVE G 
Sbjct  76    EDRQRFFEAAARGSGKGNLVPLWECIVSDHLTPVLAYRCLVGEDDMDTPSFLFESVEQGL  135

Query  488   RSST-VGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
               +T VGRYS+VGA P MEI+AKE+KVT +DH+ G +TE++V+DPM V RSI E W PQ 
Sbjct  136   EGTTNVGRYSMVGAHPVMEIVAKEDKVTTMDHEKGTVTEQIVDDPMEVPRSIMEGWHPQQ  195

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               DLP+ F GGWVG+FSYDTVRYVEKKK+PF+ APQDDRNLPD+HLGLYD+V+VFD V+K
Sbjct  196   IDDLPETFSGGWVGFFSYDTVRYVEKKKIPFSGAPQDDRNLPDVHLGLYDDVLVFDSVEK  255

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             K ++IHWV LD ++S  +AY+ G+ +L   +SKV + + P+LS   V  +T++FG +L K
Sbjct  256   KVYVIHWVSLDRHASTEEAYQYGRSRLRRFLSKVHNTNVPKLSPGFVKLHTKQFGTALTK  315

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
               MTS EYK+AVL+AKEHILAG+IFQIVLSQRFERRT A PFEVYRALRIVNPSPYM Y+
Sbjct  316   STMTSDEYKSAVLQAKEHILAGNIFQIVLSQRFERRTYATPFEVYRALRIVNPSPYMAYV  375

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEILT+V+K +++NRPLAGT +RGKT  ED + E  LL+D+K+RAEH M
Sbjct  376   QARGCILVASSPEILTKVQKGKIINRPLAGTTRRGKTENEDKLQEEELLSDKKQRAEHIM  435

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVG+VSK GSV VE+LMNIERYSHVMHISSTV+GEL D+L  WDALRAALPVG
Sbjct  436   LVDLGRNDVGRVSKPGSVKVEKLMNIERYSHVMHISSTVSGELDDNLQSWDALRAALPVG  495

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL--  1738
             TVSGAPKVKAMELIDQLE TRRGPYSGG GGISF GDM IALALRTIVF     ++T+  
Sbjct  496   TVSGAPKVKAMELIDQLEVTRRGPYSGGLGGISFNGDMMIALALRTIVFSTAPSHNTMFS  555

Query  1739  ---SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                S RR+EW+AHLQ+GAGIVADS P+ EQKECENK A L+RAIDLAESAFV
Sbjct  556   YKNSDRRREWVAHLQAGAGIVADSIPEDEQKECENKAAALARAIDLAESAFV  607



>gb|AAP06828.1| putative anthraniliate synthase alpha 2 subunit [Oryza sativa 
Japonica Group]
Length=616

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/537 (70%), Positives = 439/537 (82%), Gaps = 20/537 (4%)
 Frame = +2

Query  335   FIEA----SKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSST-  499
             F EA    S   NL+P+ +CI SDHLTPVLAYRCLV ED+ ETPSFLFESVE G   +T 
Sbjct  77    FFEAAERGSGKGNLVPMWECIVSDHLTPVLAYRCLVPEDNMETPSFLFESVEQGPEGTTN  136

Query  500   VGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLP  679
             VGRYS+VGA P ME++AKE+KVTI+DH+ GK+TE+VV+DPM + RS+ E W PQ    LP
Sbjct  137   VGRYSMVGAHPVMEVVAKEHKVTIMDHEKGKVTEQVVDDPMQIPRSMMEGWHPQQIDQLP  196

Query  680   DAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFII  859
             D+F GGWVG+FSYDTVRYVEKKKLPF+ APQDDRNLPD+HLGLYD+V+VFD+V+KK ++I
Sbjct  197   DSFTGGWVGFFSYDTVRYVEKKKLPFSGAPQDDRNLPDVHLGLYDDVLVFDNVEKKVYVI  256

Query  860   HWVRLDSYSSASKAYREGKKQLEALVSKVQDVD----------PPRLSSASVDFNTREFG  1009
             HWV LD +++   A+++GK +L  L+SKV + +           P+LS   V  +TR+FG
Sbjct  257   HWVNLDRHATTEDAFQDGKSRLNLLLSKVHNSNVFYILFHFHSRPKLSPGFVKLHTRQFG  316

Query  1010  PSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSP  1189
               L K  MTS EYKNAV++AKEHI+AGDIFQIVLSQRFERRT A+PFEVYRALRIVNPSP
Sbjct  317   TPLNKSTMTSDEYKNAVMQAKEHIMAGDIFQIVLSQRFERRTYANPFEVYRALRIVNPSP  376

Query  1190  YMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKER  1369
             YM Y+QARGC+LVASSPEILTRV+K +++NRPLAGT +RGKT +ED M E  LL+DEK+ 
Sbjct  377   YMAYVQARGCVLVASSPEILTRVRKGKIINRPLAGTVRRGKTEKEDEMQEQQLLSDEKQC  436

Query  1370  AEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRA  1549
             AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTV+GEL DHL  WDALRA
Sbjct  437   AEHIMLVDLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVSGELDDHLQSWDALRA  496

Query  1550  ALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMN  1729
             ALPVGTVSGAPKVKAMELID+LE TRRGPYSGG GGISF GDM IALALRTIVF     +
Sbjct  497   ALPVGTVSGAPKVKAMELIDELEVTRRGPYSGGLGGISFDGDMLIALALRTIVFSTAPSH  556

Query  1730  DTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             +T+ S     RR+EW+AHLQ+GAGIVADS+PD EQ+ECENK A L+RAIDLAESAFV
Sbjct  557   NTMYSYKDTERRREWVAHLQAGAGIVADSSPDDEQRECENKAAALARAIDLAESAFV  613



>ref|XP_009371549.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
[Pyrus x bretschneideri]
Length=530

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/526 (73%), Positives = 434/526 (83%), Gaps = 17/526 (3%)
 Frame = +2

Query  323   EEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTV  502
             E  KF+EA K  NLIP            VLAYRCLV EDDR+ PSFLFESVEPGS+ S V
Sbjct  15    ESEKFVEALKKGNLIP------------VLAYRCLVKEDDRDAPSFLFESVEPGSKDSNV  62

Query  503   GRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPD  682
             GRYSV+GAQP++EI+AKEN VTI+DH  G  TE++VEDPMTV + I E W PQL  +LP+
Sbjct  63    GRYSVIGAQPSIEIVAKENMVTIMDHREGCRTEEIVEDPMTVPQRIMEGWTPQLLDELPE  122

Query  683   AFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIH  862
             AFCGGWVGYFSYDTVRYVEKKKLPF SAP DDRNLPD+HLGLYD+VIVFD VDKKA +IH
Sbjct  123   AFCGGWVGYFSYDTVRYVEKKKLPFPSAPPDDRNLPDVHLGLYDDVIVFDQVDKKAHVIH  182

Query  863   WVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSG  1042
             WV+LD YSS  +A+ +G  +LE L+SKV D+  PRL + S++FNT+ FG  L   ++TS 
Sbjct  183   WVQLDQYSSVDEAFNDGINRLETLLSKVHDIITPRLPAGSIEFNTQLFGTKLEDSSLTSE  242

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
             EYK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+QARGCI
Sbjct  243   EYKEAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCI  302

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
             LVASSPEILTRVKK  + NRPLAGT +R KTP+ED+MLE  LLNDEK+ AEH MLVDLGR
Sbjct  303   LVASSPEILTRVKKKTITNRPLAGTVRREKTPKEDLMLEKQLLNDEKQCAEHIMLVDLGR  362

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             NDVGKVSK GSV VE LMNIERYSHVMHISSTVTGELLD LT WD LR ALPVGTVSGAP
Sbjct  363   NDVGKVSKPGSVKVEELMNIERYSHVMHISSTVTGELLDDLTSWDVLRTALPVGTVSGAP  422

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----R  1747
             KVKAMELID+LE TRRGPYSGGFGGISF G+MDIALALRTIVF      DT+ S     +
Sbjct  423   KVKAMELIDKLEVTRRGPYSGGFGGISFSGNMDIALALRTIVFPTSFRYDTMYSYKDANK  482

Query  1748  RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             R+EW+AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  483   RREWVAHLQAGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  528



>ref|XP_004138565.1| PREDICTED: anthranilate synthase component I-1, chloroplastic-like 
[Cucumis sativus]
Length=532

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/529 (71%), Positives = 429/529 (81%), Gaps = 9/529 (2%)
 Frame = +2

Query  314   LDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRS  493
             L  E A+FIEASK  NL+PL +CIF D L P+LAYRCLV E+D ++PSFLFESVE  S+ 
Sbjct  6     LGVEAAEFIEASKHGNLVPLSRCIFGDQLDPILAYRCLVKENDWDSPSFLFESVESNSQ-  64

Query  494   STVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTAD  673
                GRYSVVGAQPTMEI+AKENK+ ILDH  G+LTE+ V+DP T+   ISE+WKP+    
Sbjct  65    ---GRYSVVGAQPTMEIVAKENKINILDHKKGRLTEEFVDDPFTIPIKISEKWKPKSIGG  121

Query  674   LPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAF  853
             LPD FCGGWVGYFSYDT+RYVE KKLPF+ AP+DDRNL D HLGLYD V+VFDHV+KK  
Sbjct  122   LPDTFCGGWVGYFSYDTMRYVEGKKLPFSGAPKDDRNLADFHLGLYDEVVVFDHVEKKVC  181

Query  854   IIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNM  1033
             II WV LD + S   AY +G K+L+ L  K QD D PRLS   V+ NTR+FGPSL K NM
Sbjct  182   IILWVELDGFLSVENAYEDGVKRLDNLARKFQDGDHPRLSPGFVNLNTRQFGPSLKKSNM  241

Query  1034  TSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQAR  1213
             TS  YK AVL+AKEHILAGDIFQIVLSQRFE RT A+PFE+YRALRIVNPSPYM Y+QAR
Sbjct  242   TSDSYKEAVLRAKEHILAGDIFQIVLSQRFEYRTFANPFEIYRALRIVNPSPYMAYLQAR  301

Query  1214  GCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVD  1393
             GC LV SSPEILTRVKKN++VNRPLAGT +RGKT +ED MLE  LL+D K+ AEH MLVD
Sbjct  302   GCTLVGSSPEILTRVKKNKIVNRPLAGTVRRGKTEKEDEMLEKQLLDDAKQCAEHIMLVD  361

Query  1394  LGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVS  1573
             L RNDVGKVSK+ SV VE+LMNIERYSHVMHISSTVTGEL DHLT WD L+AALPVGTVS
Sbjct  362   LARNDVGKVSKNSSVKVEKLMNIERYSHVMHISSTVTGELHDHLTSWDVLQAALPVGTVS  421

Query  1574  GAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS---  1744
             GAPKVKAMELID+LE TRRGPYSGGFG +SF GDMDIALALRTIVF      DT+ S   
Sbjct  422   GAPKVKAMELIDELETTRRGPYSGGFGTVSFNGDMDIALALRTIVFPTSAHYDTMYSYKD  481

Query  1745  --RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
               +R+EWIAHLQ+GAGIVADS+P+ E +EC+NK A L+RAI LAESAFV
Sbjct  482   VNQRREWIAHLQAGAGIVADSSPEDEHQECQNKAAALARAIALAESAFV  530



>gb|EMS66757.1| Anthranilate synthase component I-1, chloroplastic [Triticum 
urartu]
Length=1049

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/516 (72%), Positives = 429/516 (83%), Gaps = 8/516 (2%)
 Frame = +2

Query  362   LIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTME  541
             L+PL +CIFSDHLTPVLAYRCLV EDDRE PSFLFESVE  S  + VGRYSVVGAQP ME
Sbjct  529   LLPLQRCIFSDHLTPVLAYRCLVREDDREAPSFLFESVEQASEGTNVGRYSVVGAQPAME  588

Query  542   ILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTAD-LPDAFCGGWVGYFSY  718
             I+AK N+VT++DH+     E+   DPMTV R I E+W PQ+T D LPDAFCGGWVG+FSY
Sbjct  589   IVAKANQVTVMDHEMRTKEEQYAADPMTVPRDIMEQWNPQITLDGLPDAFCGGWVGFFSY  648

Query  719   DTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASK  898
             DTVRYVE KKLPF+ AP+DDRNLPDIHLGLY++V+VFDHV+KK  +IHWVRLD Y S  +
Sbjct  649   DTVRYVETKKLPFSKAPEDDRNLPDIHLGLYNDVVVFDHVEKKTHVIHWVRLDCYHSIDE  708

Query  899   AYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEH  1078
             AY +GK +LEAL+S++   + P LS+ S+  N  +FG +L K  M+S +YK +V++AKEH
Sbjct  709   AYEDGKNRLEALLSRLHSSNVPTLSAGSIKLNVGQFGSALQKSTMSSEDYKKSVVQAKEH  768

Query  1079  ILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRV  1258
             ILAGDIFQ+VLSQRFERRT ADPFEVYRALRIVNPSPYM Y+QARGCILVASSPEILTRV
Sbjct  769   ILAGDIFQVVLSQRFERRTFADPFEVYRALRIVNPSPYMAYLQARGCILVASSPEILTRV  828

Query  1259  KKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsv  1438
              K  VVNRPLAGT +RGKT  ED +LE LLL+DEK+RAEH MLVDLGRNDVGKVSK G+V
Sbjct  829   AKRTVVNRPLAGTIRRGKTKAEDKVLEQLLLSDEKQRAEHIMLVDLGRNDVGKVSKPGTV  888

Query  1439  NVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLE  1618
              VE+LMNIERYSHVMHISSTVTGEL D LTCWDALRAALPVGTVSGAPKV+AMELID++E
Sbjct  889   KVEKLMNIERYSHVMHISSTVTGELCDDLTCWDALRAALPVGTVSGAPKVRAMELIDEME  948

Query  1619  ATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL-------SSRRKEWIAHLQS  1777
              T RGPYSGGFG ISF GDMDIALALRTIVF      DT+       S+ R+EW+AHLQ+
Sbjct  949   VTMRGPYSGGFGQISFHGDMDIALALRTIVFPTASRFDTMYSYAADSSNARQEWVAHLQT  1008

Query  1778  GAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             GAGIVADS PD EQ+EC+NK AGL+RAIDLAES F+
Sbjct  1009  GAGIVADSKPDDEQQECQNKAAGLARAIDLAESTFL  1044



>gb|AEX10582.1| anthranilate synthase alpha 1 subunit [Secale cereale]
Length=608

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/545 (68%), Positives = 443/545 (81%), Gaps = 10/545 (2%)
 Frame = +2

Query  281   PVTRSPYSPPSLDKEEAKFIEASK----TSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRE  448
             PV     +  +  ++  +F EA+       NL+P+ +CI SDHLTPVLAYRCLV EDD +
Sbjct  61    PVINGSAAAKAEVEDRRRFFEAAARGTGKGNLVPVWECIVSDHLTPVLAYRCLVPEDDMD  120

Query  449   TPSFLFESVEPGSRSST-VGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMT  625
             TPSFLFESVE G   +T VGRYS+VGA P ME++AKENKVTI+DH+  ++TEK+++DPM 
Sbjct  121   TPSFLFESVEQGLEGTTNVGRYSMVGAHPVMEVVAKENKVTIMDHEKAEVTEKIMDDPMQ  180

Query  626   VARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLG  805
             V RSI E W PQ    LP+AF GGWVG+FSYDTVRYVEKKK+PF+ AP DDRNLPD+HLG
Sbjct  181   VPRSIMEGWHPQEIDQLPEAFSGGWVGFFSYDTVRYVEKKKIPFSGAPHDDRNLPDVHLG  240

Query  806   LYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASV  985
             LYD+V+VFD+V+KK ++IHWV +D ++S  +AY++G+ +L+ L+SKV + + P+LS   V
Sbjct  241   LYDDVLVFDNVEKKVYVIHWVSVDRHASTEEAYKDGRSRLKRLLSKVHNTNVPKLSPGFV  300

Query  986   DFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRA  1165
               +TR+FG  L K  MTS EYK+AV++AKEHILAG+IFQIVLSQRFERRT A PFEVYRA
Sbjct  301   KLHTRQFGTPLNKSTMTSDEYKSAVVQAKEHILAGNIFQIVLSQRFERRTYATPFEVYRA  360

Query  1166  LRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEML  1345
             LRIVNPSPYM Y+QARGCILVASSPEILT+V+K +V+NRPLAGT +RGKT  ED + E  
Sbjct  361   LRIVNPSPYMAYVQARGCILVASSPEILTKVEKGKVINRPLAGTTRRGKTEHEDKLQEEQ  420

Query  1346  LLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHL  1525
             LL+D+K+ AEH MLVDLGRNDVGKVSKSGSV VE+LMNIERYSHVMHISSTV+GEL D L
Sbjct  421   LLSDQKQCAEHIMLVDLGRNDVGKVSKSGSVKVEKLMNIERYSHVMHISSTVSGELDDRL  480

Query  1526  TCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTI  1705
               WDALRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGG GGISF GDM IALALRTI
Sbjct  481   ESWDALRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGLGGISFDGDMLIALALRTI  540

Query  1706  VFLNDGMNDTL-----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLA  1870
             VF     ++T+     S RR+EW+AHLQ+GAGIVADS PD EQKECENK A L+RAIDLA
Sbjct  541   VFSTAPSHNTMYSYKNSDRRREWVAHLQAGAGIVADSIPDDEQKECENKAAALARAIDLA  600

Query  1871  ESAFV  1885
             ESAFV
Sbjct  601   ESAFV  605



>ref|XP_004160746.1| PREDICTED: anthranilate synthase component I-1, chloroplastic-like 
[Cucumis sativus]
Length=532

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/529 (71%), Positives = 428/529 (81%), Gaps = 9/529 (2%)
 Frame = +2

Query  314   LDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRS  493
             L  E A+FIEASK  NL+PL +CIF D L P+LAYRCLV E+D ++PSFLFESVE  S+ 
Sbjct  6     LGVEAAEFIEASKHGNLVPLSRCIFGDQLDPILAYRCLVKENDWDSPSFLFESVESNSQ-  64

Query  494   STVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTAD  673
                GRYSVVGAQPTMEI+AKENK+ ILDH  G+LTE+ V+DP TV   ISE+WKP+    
Sbjct  65    ---GRYSVVGAQPTMEIVAKENKINILDHKKGRLTEEFVDDPFTVPIKISEKWKPKSIGG  121

Query  674   LPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAF  853
             LPD FCGGWVGYFSYDT+RYVE KKLPF+ AP+DDRNL D HLGLYD V+VFDHV+KK  
Sbjct  122   LPDTFCGGWVGYFSYDTMRYVEGKKLPFSGAPKDDRNLADFHLGLYDEVVVFDHVEKKVC  181

Query  854   IIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNM  1033
             II WV LD + S   AY +G K+L+ L  K QD D PRLS   V+ NTR+FGPSL K NM
Sbjct  182   IILWVELDGFLSVENAYEDGVKRLDNLARKFQDGDHPRLSPGFVNLNTRQFGPSLKKSNM  241

Query  1034  TSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQAR  1213
             TS  YK AVL+AKEHILAGDIFQIVLSQRFE RT A+PFE+YRALRIVNPSPYM Y+QAR
Sbjct  242   TSDSYKEAVLRAKEHILAGDIFQIVLSQRFEYRTFANPFEIYRALRIVNPSPYMAYLQAR  301

Query  1214  GCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVD  1393
             GC LV SSPEILTRVKKN++VNRPLAGT +RGKT +ED MLE  LL+D K+ AEH MLVD
Sbjct  302   GCTLVGSSPEILTRVKKNKIVNRPLAGTVRRGKTEKEDEMLEKQLLDDAKQCAEHIMLVD  361

Query  1394  LGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVS  1573
             L RNDVGKVSK+ SV VE+LMNIERYSHVMHISSTVTGEL DHLT WD L+AALPVGTVS
Sbjct  362   LARNDVGKVSKNSSVKVEKLMNIERYSHVMHISSTVTGELHDHLTSWDVLQAALPVGTVS  421

Query  1574  GAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS---  1744
             GAPKVKAMELID+LE TRRGPYSGGFG +SF GDMDIALALRTIVF      DT+ S   
Sbjct  422   GAPKVKAMELIDELETTRRGPYSGGFGTVSFNGDMDIALALRTIVFPTSAHYDTMYSYKD  481

Query  1745  --RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
               +R+EWIAHLQ+GAGIVADS+ + E +EC+NK A L+RAI LAESAFV
Sbjct  482   VNQRREWIAHLQAGAGIVADSSSEDEHQECQNKAAALARAIALAESAFV  530



>ref|XP_008665704.1| PREDICTED: LOW QUALITY PROTEIN: anthranilate synthase alpha subunit 
1, chloroplastic-like [Zea mays]
Length=691

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/564 (66%), Positives = 441/564 (78%), Gaps = 9/564 (2%)
 Frame = +2

Query  224   APSLRVRTLQLKCSSSLQIPVTRSPY---SPPSLDKEEAKF-IEASKTSNLIPLHKCIFS  391
             APS R  +L+ + ++ +    T + +      ++ +EE++F   A++  NL+PL +CIFS
Sbjct  127   APSSRPLSLRRRGAAGVTCRATTATFHQLDAVAVREEESRFRTAAAEGRNLLPLTRCIFS  186

Query  392   DHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTI  571
             DHLTPVLAYRCLV ED+R+ PSFLFESVE GS  + VGRYSVVGAQP+ME++AK N VT+
Sbjct  187   DHLTPVLAYRCLVKEDERDAPSFLFESVEQGSEGTNVGRYSVVGAQPSMEVVAKANHVTV  246

Query  572   LDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKL  751
             +DH+     E  V DPM + R+I E+W PQ+   LPDAFCGGWVG+FSYDTVRYVE KKL
Sbjct  247   MDHEMKSRREHFVPDPMRIPRTIMEQWNPQIADSLPDAFCGGWVGFFSYDTVRYVETKKL  306

Query  752   PFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEA  931
             PF+ AP DDRNLPDIHLGLY +VIVFDHV+KK  +IHWVR D Y S  +AY +G+ +LEA
Sbjct  307   PFSKAPHDDRNLPDIHLGLYSDVIVFDHVEKKTHVIHWVRTDCYRSVDEAYEDGRNRLEA  366

Query  932   LVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVL  1111
             L+S++  ++ P LSS S+  N   FGP + K  M+S EYKN V++AKEHILAGDIFQ+VL
Sbjct  367   LLSRLHCLNVPTLSSGSIKLNVENFGPVMQKSTMSSEEYKNIVVQAKEHILAGDIFQVVL  426

Query  1112  SQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLA  1291
             SQRFERRT ADPFE+YRALRIVNPSPYM Y+QARGCILVASSPEILTRV+K  ++NRPLA
Sbjct  427   SQRFERRTFADPFEIYRALRIVNPSPYMAYLQARGCILVASSPEILTRVQKRTIINRPLA  486

Query  1292  GTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERY  1471
             GT +RGKT  ED  LE LLL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERY
Sbjct  487   GTIRRGKTKAEDKTLEQLLLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEKLMNIERY  546

Query  1472  SHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGF  1651
             SHVMHISSTVTGEL D LTCWDALRAALPVGTVSGAPKV+AMELIDQLE          F
Sbjct  547   SHVMHISSTVTGELRDDLTCWDALRAALPVGTVSGAPKVRAMELIDQLEXXXXXXXXXXF  606

Query  1652  GGISFVGDMDIALALRTIVFLNDGMNDTL-----SSRRKEWIAHLQSGAGIVADSNPDSE  1816
             GGISF GDMDIALALRTIVF      DT+     S  R+EW+AHLQ+GAGIVADS PD E
Sbjct  607   GGISFRGDMDIALALRTIVFPTASRFDTMYSYTDSKSRQEWVAHLQAGAGIVADSKPDDE  666

Query  1817  QKECENKVAGLSRAIDLAESAFVK  1888
              +EC NK AG++RAIDLAES F++
Sbjct  667   HQECINKAAGVARAIDLAESTFLE  690



>ref|XP_008441460.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic 
[Cucumis melo]
Length=602

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/526 (72%), Positives = 428/526 (81%), Gaps = 9/526 (2%)
 Frame = +2

Query  323   EEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTV  502
             E A+FIEASK  NL+PL +CIF D L P+LAYR LV E+D ++PSFLFESVE  S+    
Sbjct  79    EAAEFIEASKHGNLVPLSRCIFGDQLDPILAYRRLVKENDWDSPSFLFESVESNSQ----  134

Query  503   GRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPD  682
             GRYSV+GAQPTMEI+AKENK+TILDH  G+LTE+ V+DP  V   ISE+WKP+    LPD
Sbjct  135   GRYSVLGAQPTMEIVAKENKITILDHKKGRLTEEFVDDPFMVPIKISEKWKPKSIGGLPD  194

Query  683   AFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIH  862
              FCGGWVGYFSYDT+RYVE KKLPF+ AP+DDRNL D HLGLYD V+VFDHV+KK  II 
Sbjct  195   TFCGGWVGYFSYDTMRYVESKKLPFSGAPKDDRNLADFHLGLYDEVVVFDHVEKKVSIIL  254

Query  863   WVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSG  1042
             WV LD + S   AY +G K+L+ L  K QD D PRLS   V+ NTR+FGPSL K NMTS 
Sbjct  255   WVELDGFLSVENAYEDGVKRLDILAKKFQDGDHPRLSPGFVNLNTRQFGPSLKKSNMTSD  314

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
              YK AVL+AKEHILAGDIFQIVLSQRFE RT A+PFE+YRALRIVNPSPYM Y+QARGC 
Sbjct  315   SYKAAVLRAKEHILAGDIFQIVLSQRFEYRTFANPFEIYRALRIVNPSPYMAYLQARGCT  374

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
             LV SSPEILTRVKKN++VNRPLAGT +RGKT +ED MLE  LL+D K+ AEH MLVDL R
Sbjct  375   LVGSSPEILTRVKKNKIVNRPLAGTVRRGKTEKEDEMLEKQLLDDAKQCAEHIMLVDLAR  434

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             NDVGKVSK+ SV VE+LMNIERYSHVMHISSTVTGEL DHLT WDAL+AALPVGTVSGAP
Sbjct  435   NDVGKVSKNSSVKVEKLMNIERYSHVMHISSTVTGELHDHLTSWDALQAALPVGTVSGAP  494

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----R  1747
             KVKAMELID+LE TRRGPYSGGFG +SF GDMDIALALRTIVF      DT+ S     +
Sbjct  495   KVKAMELIDELETTRRGPYSGGFGTVSFNGDMDIALALRTIVFPTSAHYDTMYSYKDVNQ  554

Query  1748  RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             R+EWIAHLQ+GAGIVADS+P+ E +EC+NK A L+RAI LAESAFV
Sbjct  555   RREWIAHLQAGAGIVADSSPEDEHQECQNKAAALARAIALAESAFV  600



>gb|KGN45787.1| hypothetical protein Csa_6G011620 [Cucumis sativus]
Length=776

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/530 (72%), Positives = 430/530 (81%), Gaps = 9/530 (2%)
 Frame = +2

Query  311   SLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSR  490
             SL  E A+FIEASK  NL+PL +CIF D L P+LAYRCLV E+D ++PSFLFESVE  S+
Sbjct  249   SLGVEAAEFIEASKHGNLVPLSRCIFGDQLDPILAYRCLVKENDWDSPSFLFESVESNSQ  308

Query  491   SSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTA  670
                 GRYSVVGAQPTMEI+AKENK+ ILDH  G+LTE+ V+DP T+   ISE+WKP+   
Sbjct  309   ----GRYSVVGAQPTMEIVAKENKINILDHKKGRLTEEFVDDPFTIPIKISEKWKPKSIG  364

Query  671   DLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKA  850
              LPD FCGGWVGYFSYDT+RYVE KKLPF+ AP+DDRNL D HLGLYD V+VFDHV+KK 
Sbjct  365   GLPDTFCGGWVGYFSYDTMRYVEGKKLPFSGAPKDDRNLADFHLGLYDEVVVFDHVEKKV  424

Query  851   FIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGN  1030
              II WV LD + S   AY +G K+L+ L  K QD D PRLS   V+ NTR+FGPSL K N
Sbjct  425   CIILWVELDGFLSVENAYEDGVKRLDNLARKFQDGDHPRLSPGFVNLNTRQFGPSLKKSN  484

Query  1031  MTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQA  1210
             MTS  YK AVL+AKEHILAGDIFQIVLSQRFE RT A+PFE+YRALRIVNPSPYM Y+QA
Sbjct  485   MTSDSYKEAVLRAKEHILAGDIFQIVLSQRFEYRTFANPFEIYRALRIVNPSPYMAYLQA  544

Query  1211  RGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLV  1390
             RGC LV SSPEILTRVKKN++VNRPLAGT +RGKT +ED MLE  LL+D K+ AEH MLV
Sbjct  545   RGCTLVGSSPEILTRVKKNKIVNRPLAGTVRRGKTEKEDEMLEKQLLDDAKQCAEHIMLV  604

Query  1391  DLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTV  1570
             DL RNDVGKVSK+ SV VE+LMNIERYSHVMHISSTVTGEL DHLT WD L+AALPVGTV
Sbjct  605   DLARNDVGKVSKNSSVKVEKLMNIERYSHVMHISSTVTGELHDHLTSWDVLQAALPVGTV  664

Query  1571  SGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS--  1744
             SGAPKVKAMELID+LE TRRGPYSGGFG +SF GDMDIALALRTIVF      DT+ S  
Sbjct  665   SGAPKVKAMELIDELETTRRGPYSGGFGTVSFNGDMDIALALRTIVFPTSAHYDTMYSYK  724

Query  1745  ---RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                +R+EWIAHLQ+GAGIVADS+P+ E +EC+NK A L+RAI LAESAFV
Sbjct  725   DVNQRREWIAHLQAGAGIVADSSPEDEHQECQNKAAALARAIALAESAFV  774



>ref|XP_003635982.1| Anthranilate synthase alpha [Medicago truncatula]
Length=1359

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/526 (72%), Positives = 439/526 (83%), Gaps = 8/526 (2%)
 Frame = +2

Query  323   EEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTV  502
             E  KFIEASK  NLIPL++CIFSD LTPVLAYR LV E+DRE PSFLFES EP  + S V
Sbjct  835   ERKKFIEASKNGNLIPLYQCIFSDQLTPVLAYRSLVTENDREAPSFLFESAEPNFQGSNV  894

Query  503   GRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPD  682
             GRYSVVGAQPTMEI+AKENKVT+++H+SG+LTE++V+DPM + R IS++W+P L+ +LP 
Sbjct  895   GRYSVVGAQPTMEIVAKENKVTVMNHESGQLTEEIVDDPMEIPRKISQDWRPCLSDELPS  954

Query  683   AFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIH  862
                 GW GYFSYDTVRYVEKKKLPF+ AP+DDR+L DIHL LY+ VIVFDHV+KKA++I 
Sbjct  955   C---GWAGYFSYDTVRYVEKKKLPFSDAPKDDRHLADIHLSLYETVIVFDHVEKKAYVIL  1011

Query  863   WVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSG  1042
             WVR D YSS   AY +G  +L+ LV+K+QD   PRL+  +VD  TR+FGP L + NMT+ 
Sbjct  1012  WVRTDQYSSVESAYVDGTIRLKKLVAKLQDNKLPRLAPGAVDLQTRQFGPPLKESNMTAE  1071

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
              YK+AVL+AKEHI AGDIFQIVLSQRFERRT ADPFEVYRALR+VNPSPYMTY QARGCI
Sbjct  1072  AYKDAVLQAKEHIKAGDIFQIVLSQRFERRTFADPFEVYRALRVVNPSPYMTYFQARGCI  1131

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
             LVASSPEIL R+K N++VNRPLAGT+KRG T EED  L   LL DEK+ AEH MLVDLGR
Sbjct  1132  LVASSPEILARIKNNKIVNRPLAGTSKRGNTAEEDESLSAKLLKDEKQCAEHVMLVDLGR  1191

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             NDVGKV+KSGSV VE+LMN+ERYSHVMHISSTVTGEL DHLTCWDALRAALPVGTVSGAP
Sbjct  1192  NDVGKVAKSGSVKVEKLMNVERYSHVMHISSTVTGELQDHLTCWDALRAALPVGTVSGAP  1251

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----R  1747
             KV+AM+LID+LE  RRGPYSGGFG ISF GDMDIALALRTIVF      DT+ S     +
Sbjct  1252  KVRAMQLIDELEVARRGPYSGGFGYISFSGDMDIALALRTIVFPTGTRYDTMYSYKDLNK  1311

Query  1748  RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             R+EWIA+LQ+GAGIVADS+P  E +EC+NK AGL+R+IDLAESAFV
Sbjct  1312  RQEWIAYLQAGAGIVADSDPADEHQECQNKAAGLARSIDLAESAFV  1357



>ref|XP_003601171.1| Anthranilate synthase alpha [Medicago truncatula]
 gb|AES71422.1| anthranilate synthase alpha 1 [Medicago truncatula]
Length=604

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/586 (65%), Positives = 449/586 (77%), Gaps = 21/586 (4%)
 Frame = +2

Query  152   LLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPPSLDKEEA  331
             +LP    ++    T +    SS  +P      ++LK SS     + +  +       E  
Sbjct  30    ILPSGSRVTPAMFTGVSKGGSSSLSP------VKLKASSMTTAAIAQEVH-------ERK  76

Query  332   KFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRY  511
             KFIEASK  NLIPL++CIFSD LTPVLAYR LV E+DRE PSFLFES EP  + S VGRY
Sbjct  77    KFIEASKNGNLIPLYQCIFSDQLTPVLAYRSLVTENDREAPSFLFESAEPNFQGSNVGRY  136

Query  512   SVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFC  691
             SVVGAQP MEI+AKENKVT+++H+SG+LTE++V+DPM + R IS++W+P L+ +LPDAFC
Sbjct  137   SVVGAQPAMEIVAKENKVTVMNHESGQLTEEIVDDPMEIPRKISQDWRPCLSDELPDAFC  196

Query  692   G---GWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIH  862
                       S  T   +EKKKLPF+ AP+DDR+L DIHL LY+ VIVFDHV+KKA++I 
Sbjct  197   AHARACERVISLMTQFAMEKKKLPFSDAPKDDRHLADIHLSLYETVIVFDHVEKKAYVIL  256

Query  863   WVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSG  1042
             WVR D YSS   AY +G  +L+ LV+K+QD   PRL+  +VD  T  FG  L + NMT+ 
Sbjct  257   WVRTDQYSSVESAYVDGTVRLKKLVAKLQDNKLPRLAPGAVDLQTHHFGRPLKESNMTAE  316

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
              YK+AVL+AKEHI AGDIFQIVLSQRFERRT ADPFEVYRALR+VNPSPYMTY QARGCI
Sbjct  317   AYKDAVLQAKEHIKAGDIFQIVLSQRFERRTFADPFEVYRALRVVNPSPYMTYFQARGCI  376

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
             LVASSPEIL R+K N++VNRPLAGT+KRG T EED  L   LL DEK+ AEH MLVDLGR
Sbjct  377   LVASSPEILARIKNNKIVNRPLAGTSKRGNTAEEDESLSAKLLKDEKQCAEHVMLVDLGR  436

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             NDVGKV+KSGSV VE+LMN+ERYSHVMHISSTVTGEL DHLTCWDALRAALPVGTVSGAP
Sbjct  437   NDVGKVAKSGSVKVEKLMNVERYSHVMHISSTVTGELQDHLTCWDALRAALPVGTVSGAP  496

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----R  1747
             KV+AM+LID+LE  RRGPYSGGFG ISF GDMDIALALRTIVF      DT+ S     +
Sbjct  497   KVRAMQLIDELEVARRGPYSGGFGYISFSGDMDIALALRTIVFPTGTRYDTMYSYKDLNK  556

Query  1748  RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             R+EWIA+LQ+GAGIVADS+P  E +EC+NK AGL+R+IDLAESAFV
Sbjct  557   RQEWIAYLQAGAGIVADSDPADEHQECQNKAAGLARSIDLAESAFV  602



>ref|XP_006287444.1| hypothetical protein CARUB_v10000652mg [Capsella rubella]
 gb|EOA20342.1| hypothetical protein CARUB_v10000652mg [Capsella rubella]
Length=542

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/535 (68%), Positives = 430/535 (80%), Gaps = 15/535 (3%)
 Frame = +2

Query  113   NLPKMQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTR  292
             N+  MQ ++  +RL P   L S     +  S RSS Y PS R     +KC       V+ 
Sbjct  7     NVATMQPLSFSRRLFPSRGLSSSSVTVTGYSGRSSAYPPSFR----SIKC-------VSV  55

Query  293   SPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFES  472
             SP +  S+  +     +AS+++NLIP+++CIFSD LTPVLAYRCLV EDDRE PSFLFES
Sbjct  56    SPEA--SIVSDTKNLADASRSANLIPIYRCIFSDQLTPVLAYRCLVKEDDREAPSFLFES  113

Query  473   VEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEW  652
             VEPGS+ S+VGRYSVVGAQP MEI+AKENKV ++DH +  +TE+  EDPM + R ISE+W
Sbjct  114   VEPGSQMSSVGRYSVVGAQPAMEIVAKENKVIVMDHTNETMTEEYEEDPMEIPRKISEKW  173

Query  653   KPQ--LTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIV  826
              P   L  DLPDAFCGGWVG+FSYDTVRYVEK+KLPF+ AP+DDRNLPD+HLGLYD+VIV
Sbjct  174   NPDPLLVQDLPDAFCGGWVGFFSYDTVRYVEKRKLPFSKAPEDDRNLPDMHLGLYDDVIV  233

Query  827   FDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREF  1006
             FDHV+KKA++IHW+RLD      KAY  G + LE LV+K+ D++PP+L++ +V+  TR+F
Sbjct  234   FDHVEKKAYVIHWIRLDGSLPYEKAYSNGMQHLENLVAKLHDIEPPKLAAGNVNLQTRQF  293

Query  1007  GPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPS  1186
             GP+L   N+T  EYK AV+KAKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+VNPS
Sbjct  294   GPTLTNSNVTCEEYKEAVVKAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRVVNPS  353

Query  1187  PYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKE  1366
             PYM Y+QARGCI+VASSPEILT+VK+N++VNRPLAGT+KRGK   ED  LE  LL +EK+
Sbjct  354   PYMGYLQARGCIMVASSPEILTKVKQNKIVNRPLAGTSKRGKDEVEDKRLEKELLENEKQ  413

Query  1367  RAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALR  1546
              AEH MLVDLGRNDVGKV+K GSV VE+LMNIERYSHVMHISSTVTGEL D LTCWD LR
Sbjct  414   CAEHIMLVDLGRNDVGKVAKYGSVKVEKLMNIERYSHVMHISSTVTGELQDDLTCWDTLR  473

Query  1547  AALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVF  1711
             AALPVGTVSGAPKVKAMELID+LE TRRGPYSGGFGG+SF GDMDIAL+LRTIVF
Sbjct  474   AALPVGTVSGAPKVKAMELIDELEPTRRGPYSGGFGGVSFTGDMDIALSLRTIVF  528



>ref|XP_003592736.1| Anthranilate synthase alpha [Medicago truncatula]
Length=579

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/570 (69%), Positives = 440/570 (77%), Gaps = 49/570 (9%)
 Frame = +2

Query  281   PVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSF  460
             P+  +  S P +D  + KFIEASK  N+IPL++CIFSDHLTPVLAYRCLV ED+R+ PSF
Sbjct  22    PIKCAAQSLPLVDNAD-KFIEASKKGNVIPLYRCIFSDHLTPVLAYRCLVKEDERDAPSF  80

Query  461   LFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSI  640
             LFES EPG   S+ GRYSVVGAQP MEI+AKEN VTI+DH+ G+ TE++  DP+ + R I
Sbjct  81    LFESAEPGLHISSTGRYSVVGAQPCMEIVAKENMVTIMDHEEGRKTEEIALDPLVIPRRI  140

Query  641   SEEWKPQLTADLPDAFCG------------------------------GWVGYFSYDTVR  730
              E+W PQL  DLP+AFC                               GWVGYFSYDT+R
Sbjct  141   MEKWTPQLIDDLPEAFCAPKTLMMINDATQKQKLAVLLFLTIEVLFPCGWVGYFSYDTMR  200

Query  731   YVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYRE  910
             YVEKKKLPFA+AP DDR LPD+HLGLYDNVIVFDHV+KKA++IHWVRLD YSS  KA  +
Sbjct  201   YVEKKKLPFANAPMDDRGLPDVHLGLYDNVIVFDHVEKKAYVIHWVRLDRYSSPEKALND  260

Query  911   GKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAG  1090
             G  +LE LVS+V D+  PRL + S+   TR FGP L   NMT  EYK AVL+AKEHILAG
Sbjct  261   GLDKLETLVSRVHDIITPRLPAGSIKLLTRLFGPKLELSNMTKEEYKKAVLQAKEHILAG  320

Query  1091  DIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNR  1270
             DIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+QARG ILVASSPEILTRVKK R
Sbjct  321   DIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYLQARGSILVASSPEILTRVKKKR  380

Query  1271  VVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVER  1450
                          +TP+ED+MLE  LLNDEK+ AEH MLVDLGRNDVGKVSK GSV VE+
Sbjct  381   -------------ETPKEDIMLEKDLLNDEKQCAEHVMLVDLGRNDVGKVSKPGSVQVEK  427

Query  1451  LMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRR  1630
             LMNIERYSHVMHISSTVTGELLD LT WDALRAALPVGTVSGAPKVKAMELIDQLE  RR
Sbjct  428   LMNIERYSHVMHISSTVTGELLDGLTSWDALRAALPVGTVSGAPKVKAMELIDQLEVARR  487

Query  1631  GPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVA  1795
             GPYSGGFGGISF GDMDIALALRT+VF  +   DT+ S     +R+EWIAHLQ+GAGIVA
Sbjct  488   GPYSGGFGGISFSGDMDIALALRTMVFPTNTRFDTMYSYKDVNKRREWIAHLQAGAGIVA  547

Query  1796  DSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             DS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  548   DSDPADEQRECENKAAALARAIDLAESSFV  577



>gb|KFK34824.1| hypothetical protein AALP_AA5G197700 [Arabis alpina]
Length=556

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/545 (69%), Positives = 426/545 (78%), Gaps = 28/545 (5%)
 Frame = +2

Query  146   QRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPPSLDKE  325
              RLLPPS      P+T I S+R+S  + S+      +KC S L  P   S          
Sbjct  21    HRLLPPS------PVTGI-SKRTSSSSGSISFVLAPIKCGSILSCPFPLSE---------  64

Query  326   EAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVG  505
                  ++SKT NL+PL   IFSDHLTPVLAYRCLV EDDRE+PSFLFESVEPG+  STVG
Sbjct  65    -----DSSKTENLVPLRHTIFSDHLTPVLAYRCLVKEDDRESPSFLFESVEPGTHVSTVG  119

Query  506   RYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDA  685
             RYSVVGA PTMEI+AKENKV ++DH  G +T + V+DPM + RSISE WKPQL  DLPDA
Sbjct  120   RYSVVGANPTMEIVAKENKVRVMDHVRGTVTSEEVDDPMVIPRSISESWKPQLIDDLPDA  179

Query  686   FCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHW  865
             FCGGWVGYFSYDTVRY EK+KLPF+ AP DD+NLPD+HLGLYD+VIVFDHV+KK  IIHW
Sbjct  180   FCGGWVGYFSYDTVRYAEKRKLPFSKAPVDDQNLPDMHLGLYDDVIVFDHVEKKMHIIHW  239

Query  866   VRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGE  1045
             VRL   SS    Y  G K LE LVS+++ ++PP + S SVD +T +FG  L K +MTS  
Sbjct  240   VRLSGNSSLDNVYTNGLKHLEELVSRIKGINPPNIPSGSVDLHTSQFGTPLEKSSMTSDA  299

Query  1046  YKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCIL  1225
             Y NAVL+AKEHILAGDIFQIVLSQRFERRT A PFEVYRALRIVNPSP M Y+QARGCIL
Sbjct  300   YMNAVLEAKEHILAGDIFQIVLSQRFERRTFAHPFEVYRALRIVNPSPSMCYLQARGCIL  359

Query  1226  VASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRN  1405
             VASSPEILTRVKKN++VNRPLAGTA+RGKT EED MLE  LL DEK+ AEH MLVDLGRN
Sbjct  360   VASSPEILTRVKKNKIVNRPLAGTARRGKTFEEDQMLEKALLKDEKQCAEHIMLVDLGRN  419

Query  1406  DvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPK  1585
             DVGKVSK+GSV VERLM+IERYSHVMHISSTVTGEL ++LTCWD LRAALPVGTVSGAPK
Sbjct  420   DVGKVSKNGSVRVERLMDIERYSHVMHISSTVTGELQENLTCWDTLRAALPVGTVSGAPK  479

Query  1586  VKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-------  1744
             VKAMELID+LE TRRGPYSGGFG +SF GDMDIALALRTIVF     +DT+ S       
Sbjct  480   VKAMELIDELEVTRRGPYSGGFGSVSFTGDMDIALALRTIVFPTQARHDTMYSYKDKDMP  539

Query  1745  RRKEW  1759
             RR+EW
Sbjct  540   RRREW  544



>gb|ABF95123.1| anthranilate synthase component I family protein, expressed [Oryza 
sativa Japonica Group]
Length=593

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/527 (69%), Positives = 426/527 (81%), Gaps = 23/527 (4%)
 Frame = +2

Query  335   FIEA----SKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSST-  499
             F EA    S   NL+P+ +CI SDHLTPVLAYRCLV ED+ ETPSFLFESVE G   +T 
Sbjct  77    FFEAAERGSGKGNLVPMWECIVSDHLTPVLAYRCLVPEDNMETPSFLFESVEQGPEGTTN  136

Query  500   VGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLP  679
             VGRYS+VGA P ME+              GK+TE+VV+DPM + RS+ E W PQ    LP
Sbjct  137   VGRYSMVGAHPVMEV-------------KGKVTEQVVDDPMQIPRSMMEGWHPQQIDQLP  183

Query  680   DAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFII  859
             D+F GGWVG+FSYDTVRYVEKKKLPF+ APQDDRNLPD+HLGLYD+V+VFD+V+KK ++I
Sbjct  184   DSFTGGWVGFFSYDTVRYVEKKKLPFSGAPQDDRNLPDVHLGLYDDVLVFDNVEKKVYVI  243

Query  860   HWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTS  1039
             HWV LD +++   A+++GK +L  L+SKV + + P+LS   V  +TR+FG  L K  MTS
Sbjct  244   HWVNLDRHATTEDAFQDGKSRLNLLLSKVHNSNVPKLSPGFVKLHTRQFGTPLNKSTMTS  303

Query  1040  GEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGC  1219
              EYKNAV++AKEHI+AGDIFQIVLSQRFERRT A+PFEVYRALRIVNPSPYM Y+QARGC
Sbjct  304   DEYKNAVMQAKEHIMAGDIFQIVLSQRFERRTYANPFEVYRALRIVNPSPYMAYVQARGC  363

Query  1220  ILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLG  1399
             +LVASSPEILTRV+K +++NRPLAGT +RGKT +ED M E  LL+DEK+ AEH MLVDLG
Sbjct  364   VLVASSPEILTRVRKGKIINRPLAGTVRRGKTEKEDEMQEQQLLSDEKQCAEHIMLVDLG  423

Query  1400  RNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGA  1579
             RNDVGKVSK GSV VE+LMNIERYSHVMHISSTV+GEL DHL  WDALRAALPVGTVSGA
Sbjct  424   RNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVSGELDDHLQSWDALRAALPVGTVSGA  483

Query  1580  PKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----  1744
             PKVKAMELID+LE TRRGPYSGG GGISF GDM IALALRTIVF     ++T+ S     
Sbjct  484   PKVKAMELIDELEVTRRGPYSGGLGGISFDGDMLIALALRTIVFSTAPSHNTMYSYKDTE  543

Query  1745  RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             RR+EW+AHLQ+GAGIVADS+PD EQ+ECENK A L+RAIDLAESAFV
Sbjct  544   RRREWVAHLQAGAGIVADSSPDDEQRECENKAAALARAIDLAESAFV  590



>gb|ABF95124.1| anthranilate synthase component I family protein, expressed [Oryza 
sativa Japonica Group]
Length=595

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/527 (69%), Positives = 429/527 (81%), Gaps = 21/527 (4%)
 Frame = +2

Query  335   FIEA----SKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSST-  499
             F EA    S   NL+P+ +CI SDHLTPVLAYRCLV ED+ ETPSFLFESVE G   +T 
Sbjct  77    FFEAAERGSGKGNLVPMWECIVSDHLTPVLAYRCLVPEDNMETPSFLFESVEQGPEGTTN  136

Query  500   VGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLP  679
             VGRYS+VGA P ME++AKE+KVTI+DH+ GK+TE+VV+DPM + RS+ E W PQ    LP
Sbjct  137   VGRYSMVGAHPVMEVVAKEHKVTIMDHEKGKVTEQVVDDPMQIPRSMMEGWHPQQIDQLP  196

Query  680   DAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFII  859
             D+F           TVRYVEKKKLPF+ APQDDRNLPD+HLGLYD+V+VFD+V+KK ++I
Sbjct  197   DSF-----------TVRYVEKKKLPFSGAPQDDRNLPDVHLGLYDDVLVFDNVEKKVYVI  245

Query  860   HWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTS  1039
             HWV LD +++   A+++GK +L  L+SKV + + P+LS   V  +TR+FG  L K  MTS
Sbjct  246   HWVNLDRHATTEDAFQDGKSRLNLLLSKVHNSNVPKLSPGFVKLHTRQFGTPLNKSTMTS  305

Query  1040  GEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGC  1219
              EYKNAV++AKEHI+AGDIFQIVLSQRFERRT A+PFEVYRALRIVNPSPYM Y+QARGC
Sbjct  306   DEYKNAVMQAKEHIMAGDIFQIVLSQRFERRTYANPFEVYRALRIVNPSPYMAYVQARGC  365

Query  1220  ILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLG  1399
             +LVASSPEILTRV+K +++NRPLAGT +RGKT +ED M E  LL+DEK+ AEH MLVDLG
Sbjct  366   VLVASSPEILTRVRKGKIINRPLAGTVRRGKTEKEDEMQEQQLLSDEKQCAEHIMLVDLG  425

Query  1400  RNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGA  1579
             RNDVGKVSK GSV VE+LMNIERYSHVMHISSTV+GEL DHL  WDALRAALPVGTVSGA
Sbjct  426   RNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVSGELDDHLQSWDALRAALPVGTVSGA  485

Query  1580  PKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----  1744
             PKVKAMELID+LE TRRGPYSGG GGISF GDM IALALRTIVF     ++T+ S     
Sbjct  486   PKVKAMELIDELEVTRRGPYSGGLGGISFDGDMLIALALRTIVFSTAPSHNTMYSYKDTE  545

Query  1745  RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             RR+EW+AHLQ+GAGIVADS+PD EQ+ECENK A L+RAIDLAESAFV
Sbjct  546   RRREWVAHLQAGAGIVADSSPDDEQRECENKAAALARAIDLAESAFV  592



>ref|XP_009606078.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X3 [Nicotiana tomentosiformis]
Length=467

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/462 (77%), Positives = 397/462 (86%), Gaps = 5/462 (1%)
 Frame = +2

Query  515   VVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCG  694
             V+GAQPTMEI+AKEN VTI+DH  G+ TE+ VEDPM V R I E WKPQ   +LP+AFCG
Sbjct  3     VIGAQPTMEIVAKENMVTIMDHQEGRRTEEFVEDPMIVPRRIMERWKPQCIDELPEAFCG  62

Query  695   GWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRL  874
             GWVGYFSYDTVRYVEKKKLPF++AP DDRNLPD+HLGLYD+VIVFDHV+KKAF+IHWVRL
Sbjct  63    GWVGYFSYDTVRYVEKKKLPFSNAPVDDRNLPDLHLGLYDDVIVFDHVEKKAFVIHWVRL  122

Query  875   DSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKN  1054
             D ++S  +AY +G  +LEAL+S+V D+ PPRL+S S+  +T  FG SL K  MTS +Y+ 
Sbjct  123   DRFASVEEAYNDGMTRLEALMSRVHDIVPPRLASGSIKLHTSLFGTSLKKSTMTSEDYQK  182

Query  1055  AVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVAS  1234
             AVL AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+QARGCILVAS
Sbjct  183   AVLNAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYLQARGCILVAS  242

Query  1235  SPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvg  1414
             SPEILTRVKK  V NRPLAGT +RGKTPEED MLE  LL+DEK+ AEH MLVDLGRNDVG
Sbjct  243   SPEILTRVKKKTVTNRPLAGTIRRGKTPEEDYMLENQLLHDEKQCAEHIMLVDLGRNDVG  302

Query  1415  kvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKA  1594
             KVSK GSV VE+LMN+ERYSHVMHISSTVTGELLDHL+ WDALRAALPVGTVSGAPKVKA
Sbjct  303   KVSKPGSVKVEKLMNVERYSHVMHISSTVTGELLDHLSSWDALRAALPVGTVSGAPKVKA  362

Query  1595  MELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEW  1759
             MELIDQLE TRRGPYSGGFGGISF G+MDIALALRTIVF      DT+ S     RR++W
Sbjct  363   MELIDQLEVTRRGPYSGGFGGISFTGEMDIALALRTIVFPTGTRYDTMYSYKDVNRRRDW  422

Query  1760  IAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             IAHLQSGAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  423   IAHLQSGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  464



>ref|XP_009802666.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X3 [Nicotiana sylvestris]
Length=467

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/462 (77%), Positives = 397/462 (86%), Gaps = 5/462 (1%)
 Frame = +2

Query  515   VVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCG  694
             V+GAQPTMEI+AKEN VTI+DH  G+ TE+ VEDPM V R I E WKPQ   +LP+AFCG
Sbjct  3     VIGAQPTMEIVAKENMVTIMDHHEGRRTEEFVEDPMIVPRRIMERWKPQCIDELPEAFCG  62

Query  695   GWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRL  874
             GWVGYFSYDTVRYVEKKK+PF++AP DDRNLPD+HLGLYD+VIVFDHV+KKAF+IHWVRL
Sbjct  63    GWVGYFSYDTVRYVEKKKIPFSNAPMDDRNLPDLHLGLYDDVIVFDHVEKKAFVIHWVRL  122

Query  875   DSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKN  1054
             D +SS  +AY +G  +LEAL+S+V D+ PPRL+S S+  +T +FG SL K  MT  +Y+ 
Sbjct  123   DQFSSVEEAYNDGMTRLEALMSRVHDIIPPRLASGSIKLHTSQFGTSLKKSTMTREDYQK  182

Query  1055  AVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVAS  1234
             AVL AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+QARGCILVAS
Sbjct  183   AVLNAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYLQARGCILVAS  242

Query  1235  SPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvg  1414
             SPEILTRVKK  V NRPLAGT +RGKTPEED MLE  LL+DEK+ AEH MLVDLGRNDVG
Sbjct  243   SPEILTRVKKKTVTNRPLAGTIRRGKTPEEDYMLENQLLHDEKQCAEHIMLVDLGRNDVG  302

Query  1415  kvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKA  1594
             KVSK GSV VE+LMN+ERYSHVMHISSTVTGELLDHL+ WDALRAALPVGTVSGAPKVKA
Sbjct  303   KVSKPGSVKVEKLMNVERYSHVMHISSTVTGELLDHLSSWDALRAALPVGTVSGAPKVKA  362

Query  1595  MELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEW  1759
             MELIDQLE TRRGPYSGGFGGISF G+MDIALALRTIVF      DT+ S     +R++W
Sbjct  363   MELIDQLEVTRRGPYSGGFGGISFTGEMDIALALRTIVFPTGTRYDTMYSYKDANKRRDW  422

Query  1760  IAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             IAHLQSGAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  423   IAHLQSGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  464



>emb|CBI25503.3| unnamed protein product [Vitis vinifera]
Length=590

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/593 (63%), Positives = 439/593 (74%), Gaps = 26/593 (4%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             M+ +A   R +P S  IS + +   VS RSS   P  R      KC S           +
Sbjct  1     METLAVSYRSMPFSDRISHVLLAG-VSTRSSVSVPCQRA----FKCLS----------LA  45

Query  305   PPSL--DKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVE  478
              PSL  D    KF EAS+  N++PLH CIFSD LTP+LAYRCLV E D E PSF+FESV 
Sbjct  46    APSLGIDDNPVKFKEASRNGNIVPLHACIFSDQLTPILAYRCLVKEGDLEAPSFVFESVV  105

Query  479   PGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKP  658
             PGS+ S+VGRYSVVGAQP MEI+AKENKV  +DH+ G  TE++VEDPM + R I+E WKP
Sbjct  106   PGSQDSSVGRYSVVGAQPCMEIVAKENKVITMDHEEGLRTEELVEDPMVIPRRIAEGWKP  165

Query  659   QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHV  838
             QL  +LPD FCGGWVG+FSYDTV YVEKKKLPF+ A  DDRNL DIHL LYD+VIVFDHV
Sbjct  166   QLLDELPDTFCGGWVGFFSYDTVCYVEKKKLPFSKAQDDDRNLADIHLALYDDVIVFDHV  225

Query  839   DKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSL  1018
             +KK  +IHWVRLD +SS  KAY +G K+LE L+S+VQD+DPP+LS   V+ + + F  SL
Sbjct  226   EKKVHVIHWVRLDLHSSVEKAYVDGMKRLEILLSRVQDIDPPKLSPGCVESHIQSFSSSL  285

Query  1019  AKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMT  1198
              + NMTS  YK    KAKEHI AGDIFQI LSQ FERRT ADPFEVYRA R+VNPSP+M 
Sbjct  286   NESNMTSEAYK----KAKEHIRAGDIFQIGLSQCFERRTFADPFEVYRAFRVVNPSPFMA  341

Query  1199  YMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEH  1378
             Y+QARGC+LVASSPEILT VKKN +VNRPLAGT +RG T  ED MLE  LLNDEK+ AEH
Sbjct  342   YLQARGCVLVASSPEILTHVKKNNIVNRPLAGTVRRGTTIHEDEMLEGQLLNDEKQCAEH  401

Query  1379  TMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALP  1558
              MLVDLGRN+VGKV+K GS+ VE L  +E +SHVMHISSTVTGEL DHLT W+ALR+ L 
Sbjct  402   IMLVDLGRNNVGKVAKFGSLKVEDLKAVECFSHVMHISSTVTGELQDHLTSWNALRSILH  461

Query  1559  VGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL  1738
             VG VSGAPKVKAMELID+ E +RRGPY GGFG +SF GDM+I L LRTIVF      DTL
Sbjct  462   VGAVSGAPKVKAMELIDEWEESRRGPYGGGFGNVSFTGDMEIDLTLRTIVFPTGNRYDTL  521

Query  1739  SSR-----RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
              S      R+EW+A+ Q+GAGIVADS  D +Q++CE K A L+ AIDLAE+AF
Sbjct  522   FSYKDTKLRREWVAYFQAGAGIVADSVVDDKQRDCEGKAAALACAIDLAEAAF  574



>ref|XP_010685585.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=487

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/463 (76%), Positives = 397/463 (86%), Gaps = 5/463 (1%)
 Frame = +2

Query  515   VVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCG  694
             +VGAQP+MEI+AKEN VT++DH +GK TE+ VEDPM V R I E+WKPQL  +LPD FCG
Sbjct  23    IVGAQPSMEIVAKENLVTLMDHHAGKRTEEFVEDPMAVPRKIMEDWKPQLIDELPDVFCG  82

Query  695   GWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRL  874
             GWVGYFSYDTVRYVEKKKLPF+SAP DDRNLPD+HLGLYDNVIVFDHV+KKA++IHWVR+
Sbjct  83    GWVGYFSYDTVRYVEKKKLPFSSAPDDDRNLPDVHLGLYDNVIVFDHVEKKAYVIHWVRV  142

Query  875   DSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKN  1054
             D +SSA +AY +G  +LE L+S+V D+  P+L S S+   TR FG SL   NM+S EYK 
Sbjct  143   DRFSSAEEAYNDGMDRLEYLLSRVHDIVTPKLPSGSIKLQTRLFGSSLKTSNMSSEEYKA  202

Query  1055  AVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVAS  1234
             AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE YRALRIVNPSPYM Y+QARGCILVAS
Sbjct  203   AVLQAKEHILAGDIFQIVLSQRFERRTFADPFEAYRALRIVNPSPYMGYLQARGCILVAS  262

Query  1235  SPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvg  1414
             SPEILT VKK ++ NRPLAGT +RGKTP+ED MLE  LLND+K+ AEH MLVDLGRNDVG
Sbjct  263   SPEILTCVKKGKITNRPLAGTIRRGKTPKEDYMLENQLLNDQKQCAEHIMLVDLGRNDVG  322

Query  1415  kvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKA  1594
             KVSK GSV VE+LMNIERYSHVMHISSTVTGELLD+LT WDALRAALPVGTVSGAPKVKA
Sbjct  323   KVSKFGSVKVEKLMNIERYSHVMHISSTVTGELLDNLTSWDALRAALPVGTVSGAPKVKA  382

Query  1595  MELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEW  1759
             MELIDQLE  RRGPYSGGFGGISF GDMDIALALRT+VF      DT+ S     RR+EW
Sbjct  383   MELIDQLEVNRRGPYSGGFGGISFTGDMDIALALRTMVFSTATRYDTMYSYKDVDRRREW  442

Query  1760  IAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             +AHLQ+GAGIVADS+P  EQ+ECENK AGL+RAIDLAES+F++
Sbjct  443   VAHLQAGAGIVADSDPADEQRECENKAAGLARAIDLAESSFLE  485



>ref|XP_001772721.1| predicted protein [Physcomitrella patens]
 gb|EDQ62435.1| predicted protein [Physcomitrella patens]
Length=538

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/525 (67%), Positives = 428/525 (82%), Gaps = 5/525 (1%)
 Frame = +2

Query  329   AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGR  508
             ++F+EA++  NL+P+++ IF+DHLTPVLAYRCLV EDDRE PSFLFESVE G +S  +GR
Sbjct  13    SQFLEAAQRGNLVPVYRRIFADHLTPVLAYRCLVKEDDREAPSFLFESVENG-KSINMGR  71

Query  509   YSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAF  688
             YS+VGAQP+MEI+AKE+++TIL+H+ G   EK  ++P+   + I+ +W P     LPD F
Sbjct  72    YSMVGAQPSMEIIAKEDRITILNHEEGTRVEKQSDNPLNEPQEIASKWNPVKFDSLPDVF  131

Query  689   CGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWV  868
             CGGWVGYFSYDTVRYVEKKKLPF+SAP DDR LPDIHLGLY++V+VFDHV K  +++HWV
Sbjct  132   CGGWVGYFSYDTVRYVEKKKLPFSSAPIDDRGLPDIHLGLYNDVLVFDHVTKLVYVLHWV  191

Query  869   RLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEY  1048
              +D + +   AY +G K+L+ LV+++Q     +LSS SV+ +  ++G   AK N T  ++
Sbjct  192   HVDRFDNPESAYEDGCKRLDLLVARLQTPGRVKLSSGSVELSIEQYGQRTAKSNYTPEQF  251

Query  1049  KNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILV  1228
             KN++   KEHILAGDIFQ+VLSQRFERRT ADPFEVYRALRIVNPSPYM Y+QARG I+V
Sbjct  252   KNSISLVKEHILAGDIFQLVLSQRFERRTFADPFEVYRALRIVNPSPYMIYLQARGAIMV  311

Query  1229  ASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRND  1408
             ASSPEILTR+ +  VVNRPLAGT +RGKTPEED+ LE  LL DEKE AEH MLVDLGRND
Sbjct  312   ASSPEILTRIAEGTVVNRPLAGTRRRGKTPEEDMALERDLLADEKECAEHVMLVDLGRND  371

Query  1409  vgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKV  1588
             VGKVSK+G+V VE+LM +ERYSHVMHISSTVTGELLD L+ WDALRAALPVGTVSGAPKV
Sbjct  372   VGKVSKAGTVKVEKLMEVERYSHVMHISSTVTGELLDELSSWDALRAALPVGTVSGAPKV  431

Query  1589  KAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVF---LNDGMND-TLSSRRKE  1756
             +AMELID+LE TRRGPYSGG GG+SF G MDIALALRT+VF    ND M     ++ R+E
Sbjct  432   RAMELIDELEPTRRGPYSGGIGGVSFTGQMDIALALRTMVFPTQRNDAMYSYKQANSRRE  491

Query  1757  WIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKT  1891
             W+ HLQ+GAGIVADS+P+SE +E  NK AGL+RAIDLAESAFVKT
Sbjct  492   WVVHLQAGAGIVADSDPESEYQETVNKAAGLARAIDLAESAFVKT  536



>ref|XP_006344111.1| PREDICTED: anthranilate synthase component I-1, chloroplastic-like 
[Solanum tuberosum]
Length=587

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/529 (69%), Positives = 419/529 (79%), Gaps = 30/529 (6%)
 Frame = +2

Query  323   EEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTV  502
             +E +FIE SK+ NLIPLHK IFSDHLTPVLAYRCLV E+DR+ PSFL+ESVE     S+V
Sbjct  2     DEERFIEVSKSGNLIPLHKTIFSDHLTPVLAYRCLVKEEDRQAPSFLYESVE----GSSV  57

Query  503   GRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPD  682
             GRYSVVGAQP+MEI+ KE+ VTILDH +GKLT+K+VEDPMT+  SIS  WKP L  +LPD
Sbjct  58    GRYSVVGAQPSMEIVVKEHNVTILDHHAGKLTQKMVEDPMTIPASISNGWKPGLIDELPD  117

Query  683   AFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIH  862
              F GGW GYFSYDTVRYVE  KLPF  AP+DDRNL DI LGLY++VIVFDHV+KKA +IH
Sbjct  118   TFSGGWFGYFSYDTVRYVENNKLPFLRAPEDDRNLADIQLGLYEDVIVFDHVEKKAHVIH  177

Query  863   WVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSG  1042
             WVRLD YSS  +AY +GKK LE L+S+VQ ++ PRLS  SVDF   EFG SL   NMT  
Sbjct  178   WVRLDQYSSLPEAYLDGKKHLEMLMSRVQGIESPRLSPGSVDFCIDEFGTSLTTENMTRE  237

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
             EYKNA+L+AKEHI +GDI QIVLSQRFERRT ADPFEVYRALRIVNPS YMTY+QARGC 
Sbjct  238   EYKNAILQAKEHIASGDIHQIVLSQRFERRTFADPFEVYRALRIVNPSTYMTYLQARGCT  297

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
             LVASSPE LTR KK R+VNRPLAGT++RG+TP+ED+MLEM +L D K             
Sbjct  298   LVASSPETLTREKKRRIVNRPLAGTSRRGRTPDEDLMLEMQMLKDVK-------------  344

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
                      G VNVE LM++ERYS VMH+SSTV+GELLDHLTCWDALRAALPVGT+ G P
Sbjct  345   --------PGFVNVENLMSVERYSDVMHMSSTVSGELLDHLTCWDALRAALPVGTICGVP  396

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL-----SSR  1747
             KVKAMELIDQLE  RRGPYSGGFGGISF GDMDI LALRT+VF+N    DT+     +S+
Sbjct  397   KVKAMELIDQLEVGRRGPYSGGFGGISFSGDMDIGLALRTMVFMNGPRYDTMYSYTDASK  456

Query  1748  RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKTK  1894
             R+EW+AHLQS A IVADS+P  + KECENKVA L RAIDLAES FVK +
Sbjct  457   RQEWVAHLQSEARIVADSDPAEKHKECENKVACLCRAIDLAESTFVKGR  505



>ref|XP_001772772.1| predicted protein [Physcomitrella patens]
 gb|EDQ62486.1| predicted protein [Physcomitrella patens]
Length=538

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/535 (66%), Positives = 429/535 (80%), Gaps = 7/535 (1%)
 Frame = +2

Query  299   YSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVE  478
             Y P  +    ++F+EA++  NL+P+++ IF+DHLTPVLAYRCLV EDDRE PSFLFESVE
Sbjct  3     YLPFKIITGRSQFLEAAQRGNLVPVYRRIFADHLTPVLAYRCLVKEDDREAPSFLFESVE  62

Query  479   PGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKP  658
              G +S  +GR+S+VGAQP+MEI+ KE+++ IL+H+ G   EK  ++P+   + I+ +W P
Sbjct  63    NG-KSINMGRFSMVGAQPSMEIIGKEDRIIILNHEEGTRIEKQSDNPLNEPQEIASKWNP  121

Query  659   QLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHV  838
                  LPD FCGGWVGYFSYDTVRYVEKKKLPF+SAP DDR LPDIHLGLY++V+VFDHV
Sbjct  122   VKIDSLPDVFCGGWVGYFSYDTVRYVEKKKLPFSSAPNDDRGLPDIHLGLYNDVLVFDHV  181

Query  839   DKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSL  1018
              K  +++HWV +D + S   AY +G K+LE LV+++Q     +LSS SV+ +  + G   
Sbjct  182   TKLVYVLHWVHVDRFDSPESAYEDGCKRLELLVARLQTPGGVKLSSGSVELSIGQCGQRT  241

Query  1019  AKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMT  1198
             AK N T  ++K+++L+ KEHILAGDIFQ+VLSQRFERRT ADPFEVYRALRIVNPSPYM 
Sbjct  242   AKSNYTPEQFKDSILQVKEHILAGDIFQLVLSQRFERRTFADPFEVYRALRIVNPSPYMI  301

Query  1199  YMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEH  1378
             Y+QARG I+VASSPEILTR+ +  VVNRPLAGT +RGKTP+ED+ +E  LL DEKE AEH
Sbjct  302   YLQARGAIMVASSPEILTRIAERTVVNRPLAGTRRRGKTPDEDMAMEKDLLADEKECAEH  361

Query  1379  TMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALP  1558
              MLVDLGRNDVGKVSK+G+V VE+LM +ERYSHVMHISSTVTGELLD L+ WDALRAALP
Sbjct  362   VMLVDLGRNDVGKVSKAGTVKVEKLMEVERYSHVMHISSTVTGELLDELSSWDALRAALP  421

Query  1559  VGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL  1738
             VGTVSGAPKV+AMELID+LE TRRGPYSGG GG+SF G MDIALALRT+VF     NDT+
Sbjct  422   VGTVSGAPKVRAMELIDKLEPTRRGPYSGGIGGVSFTGQMDIALALRTMVFPTQ-RNDTM  480

Query  1739  SS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
              S      R+EW+ HLQ+GAGIVADS+P+SE +E  NK AGL+RAIDLAESAFVK
Sbjct  481   YSYKQANSRREWVVHLQAGAGIVADSDPESEYQETVNKAAGLARAIDLAESAFVK  535



>gb|KCW65661.1| hypothetical protein EUGRSUZ_G03047 [Eucalyptus grandis]
Length=481

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/449 (77%), Positives = 388/449 (86%), Gaps = 5/449 (1%)
 Frame = +2

Query  554   ENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRY  733
             ENKVT++DH+ G+LTE+VV+DPM + R ISE WKPQL  DLPDAFCGGWVGYFSYDTVRY
Sbjct  31    ENKVTVVDHEKGRLTEEVVDDPMMIPRRISESWKPQLIDDLPDAFCGGWVGYFSYDTVRY  90

Query  734   VEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREG  913
             VEKKKL F+SAPQDDRNL D+HLGLYD+VIVFDHV+KKA+ IHWVRLD +SS   AY +G
Sbjct  91    VEKKKLAFSSAPQDDRNLADLHLGLYDDVIVFDHVEKKAYAIHWVRLDQHSSVENAYNDG  150

Query  914   KKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGD  1093
              K+LE LVSKVQD  PP+LS  SV  NT  FGP+L K NMTS  YK AVL+AKEHI AGD
Sbjct  151   MKRLELLVSKVQDFAPPKLSPGSVVLNTNHFGPALNKSNMTSDAYKKAVLQAKEHIQAGD  210

Query  1094  IFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRV  1273
             IFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+QARGCI+VASSPEILTRVK+ ++
Sbjct  211   IFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYLQARGCIMVASSPEILTRVKQKKI  270

Query  1274  VNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERL  1453
             VNRPLAGT +RGKT EED +L++ LLND K+RAEH MLVDLGRNDVGKVSK GSVNVERL
Sbjct  271   VNRPLAGTVRRGKTFEEDEILKVQLLNDAKQRAEHIMLVDLGRNDVGKVSKYGSVNVERL  330

Query  1454  MNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRG  1633
             M++ERYSHVMHISSTVTGEL D  TCWDAL+AALPVGTVSGAPKV+AMELIDQLE TRRG
Sbjct  331   MDVERYSHVMHISSTVTGELDDQFTCWDALKAALPVGTVSGAPKVRAMELIDQLEVTRRG  390

Query  1634  PYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVAD  1798
             PYSGGFGGISF GDMDIALALRTIVF      DT+ S      R+EW+A+LQ+GAGIVAD
Sbjct  391   PYSGGFGGISFQGDMDIALALRTIVFPTGMRYDTMYSYKDANTRREWVAYLQAGAGIVAD  450

Query  1799  SNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             S+PD E +EC+NK AGL+RAIDLAESAFV
Sbjct  451   SDPDDEHQECQNKAAGLARAIDLAESAFV  479



>ref|XP_008349676.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
[Malus domestica]
Length=484

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/521 (68%), Positives = 400/521 (77%), Gaps = 53/521 (10%)
 Frame = +2

Query  323   EEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTV  502
             E  KF+EASK  NLIPL + IFSDHLTPVLAYRCLV EDDR+ PSFLFESVEPGS  S V
Sbjct  15    ESEKFVEASKKGNLIPLSRSIFSDHLTPVLAYRCLVKEDDRDAPSFLFESVEPGSNDSNV  74

Query  503   GRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPD  682
             GRYSV+GAQP++EI+AKEN VTI+DH  G  TE++VEDPMTV R I E W PQL  +LP+
Sbjct  75    GRYSVIGAQPSIEIVAKENMVTIMDHREGCRTEEIVEDPMTVPRRIMEGWTPQLLDELPE  134

Query  683   AFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIH  862
             AFCGGWVGYFSYDTVRYVEKKKLPF SAP DDRNLPD+HLGLYD+VIVFDHVDKKA +IH
Sbjct  135   AFCGGWVGYFSYDTVRYVEKKKLPFPSAPPDDRNLPDVHLGLYDDVIVFDHVDKKAHVIH  194

Query  863   WVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSG  1042
             WV+LD YSS  +A+ +G  +LE L+S+V D+  PRL + S++FNT+ FG  L   ++TS 
Sbjct  195   WVQLDQYSSVDEAFNDGINRLETLLSRVHDIITPRLPAGSIEFNTQLFGTKLEDSSLTSE  254

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
             EYK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+Q     
Sbjct  255   EYKEAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQ-----  309

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
                             + NRPLAGT +RGKTP+ED+MLE  LLNDEK+ AEH MLVDLGR
Sbjct  310   --------------KTITNRPLAGTVRRGKTPKEDLMLEKQLLNDEKQCAEHIMLVDLGR  355

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             NDVGKVSK GSV VE LMNIERYSHVMHISSTVTGELLD LT WD LR ALPVGTVSGAP
Sbjct  356   NDVGKVSKPGSVKVEELMNIERYSHVMHISSTVTGELLDDLTSWDVLRTALPVGTVSGAP  415

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSRRKEWI  1762
             KVKAMELID+LE TRRGPYSGG                                   EW+
Sbjct  416   KVKAMELIDKLEVTRRGPYSGGL----------------------------------EWV  441

Query  1763  AHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  442   AHLQAGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  482



>ref|XP_004240395.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
isoform X1 [Solanum lycopersicum]
Length=582

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/588 (65%), Positives = 439/588 (75%), Gaps = 56/588 (10%)
 Frame = +2

Query  149   RLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPPSLDKEE  328
             +LLP  H  + LPI+     RSS YA   R+      CSSSL+  +            +E
Sbjct  2     QLLPICHR-NILPIS-----RSSTYA---RLHC----CSSSLRHVI------------DE  36

Query  329   AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGR  508
              +FIE SKT NLIPL+  IFSDHLTPVLAYRCLV E+D E PSFL+ESVE     S+VGR
Sbjct  37    KRFIEVSKTGNLIPLYTTIFSDHLTPVLAYRCLVKEEDHEAPSFLYESVE----GSSVGR  92

Query  509   YSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTAD-LPDA  685
             YSVVGAQP+MEI+ KE+ VTILDH +GKLTEK VEDPMT+  SIS  WKP L  D LPD 
Sbjct  93    YSVVGAQPSMEIIVKEHNVTILDHHAGKLTEKTVEDPMTIPASISNGWKPGLIDDELPDT  152

Query  686   FCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHW  865
             FCGGW GYFSYDTVRYVE  K PF  AP+DDRNL DI LGLY++VIVFDHV+KKA +IHW
Sbjct  153   FCGGWFGYFSYDTVRYVENNKFPFLRAPEDDRNLADIQLGLYEDVIVFDHVEKKAHVIHW  212

Query  866   VRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGE  1045
             V LD YSS  +AY +GKK LE L+S+VQ +  PRLS  SVDF   EF  SL + NMT  E
Sbjct  213   VWLDQYSSLLEAYLDGKKHLEILMSRVQGIKSPRLSPGSVDFCIHEFETSLTQKNMTCVE  272

Query  1046  YKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCIL  1225
             YKNA+L+AKEHI +GDI QIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+QARGC L
Sbjct  273   YKNAILQAKEHIASGDIHQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYIQARGCTL  332

Query  1226  VASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRN  1405
             VASSPE L RVKK R+VNRPLA T  RG+TP+ED+MLEM +L D K              
Sbjct  333   VASSPETLARVKKRRIVNRPLARTTTRGRTPDEDLMLEMQMLKDIK--------------  378

Query  1406  DvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPK  1585
                     G VNVE+LM+++RYS VMH+SSTV+GELLDHLTCWDALRAALPVGT+ GAPK
Sbjct  379   -------PGFVNVEKLMSVKRYSDVMHMSSTVSGELLDHLTCWDALRAALPVGTICGAPK  431

Query  1586  VKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL-----SSRR  1750
             VKAMELIDQLE +RRGPYSGGFGGISF GDMDI LALR +VF+N    DT+     +S+R
Sbjct  432   VKAMELIDQLEVSRRGPYSGGFGGISFSGDMDIGLALRMMVFMNGPRYDTMYSYTDASKR  491

Query  1751  KEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKTK  1894
             +EW+AHLQS + IVADS+PD +QKECE+KVA L RAIDLAE  FVK +
Sbjct  492   QEWVAHLQSESRIVADSDPDEKQKECEDKVASLCRAIDLAELTFVKGR  539



>gb|EMS47524.1| Anthranilate synthase component I-1, chloroplastic [Triticum 
urartu]
Length=490

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/486 (71%), Positives = 407/486 (84%), Gaps = 6/486 (1%)
 Frame = +2

Query  446   ETPSFLFESVEPGSRSST-VGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPM  622
             +TPSFLFESVE G   +T VGRYS+VGA P ME++AKENKVTI+DH+  ++TEK+++DPM
Sbjct  2     DTPSFLFESVEQGLEGTTNVGRYSMVGAHPVMEVVAKENKVTIMDHEKAEVTEKIMDDPM  61

Query  623   TVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHL  802
              V RSI E W PQ    LP+AF GGWVG+FSYDTVRYVEKKK+PF+ AP DDRNLPD+HL
Sbjct  62    QVPRSIMEGWHPQEIDQLPEAFSGGWVGFFSYDTVRYVEKKKIPFSGAPHDDRNLPDVHL  121

Query  803   GLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSAS  982
             GLYD+V+VFD+V+KK ++IHWV +D ++S  +AY++G+ +L+ L+SKV + + P+LS   
Sbjct  122   GLYDDVLVFDNVEKKVYVIHWVSVDRHASTEEAYKDGRSRLKRLLSKVHNANVPKLSPGF  181

Query  983   VDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYR  1162
             V  +TR+FG  L K  MTS EYK+AV++AKEHILAG+IFQIVLSQRFERRT A PFEVYR
Sbjct  182   VKLHTRQFGTPLNKSTMTSDEYKSAVMQAKEHILAGNIFQIVLSQRFERRTYATPFEVYR  241

Query  1163  ALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEM  1342
             ALRIVNPSPYM Y+QARGCILVASSPEILT+V+K +V+NRPLAGT +RGKT  ED + E 
Sbjct  242   ALRIVNPSPYMAYVQARGCILVASSPEILTKVEKGKVINRPLAGTTRRGKTEHEDKLQEE  301

Query  1343  LLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDH  1522
              LL+D+K+ AEH MLVDLGRNDVGKVSKSGSV VE+LMNIERYSHVMHISSTV+GEL D 
Sbjct  302   QLLSDQKQCAEHIMLVDLGRNDVGKVSKSGSVKVEKLMNIERYSHVMHISSTVSGELHDR  361

Query  1523  LTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRT  1702
             L  WDALRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGG GGISF GDM IALALRT
Sbjct  362   LESWDALRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGLGGISFDGDMLIALALRT  421

Query  1703  IVFLNDGMNDTL-----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDL  1867
             IVF     ++T+     S RR+EW+AHLQ+GAGIVADS PD EQKECENK A L+RAIDL
Sbjct  422   IVFSTAPSHNTMYSYKSSDRRREWVAHLQAGAGIVADSIPDDEQKECENKAAALARAIDL  481

Query  1868  AESAFV  1885
             AESAFV
Sbjct  482   AESAFV  487



>ref|XP_001765555.1| predicted protein [Physcomitrella patens]
 gb|EDQ69605.1| predicted protein [Physcomitrella patens]
Length=538

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/525 (65%), Positives = 423/525 (81%), Gaps = 5/525 (1%)
 Frame = +2

Query  329   AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGR  508
             ++F+EA++  N++P+++ IFSDHLTPVLAYRCL+ EDDR+ PSFLFESVE G +S  +GR
Sbjct  13    SQFLEAAQRGNVVPVYRRIFSDHLTPVLAYRCLIKEDDRDAPSFLFESVENG-KSINMGR  71

Query  509   YSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAF  688
             YS+VG QP++EI+AKE+++ IL+H+ G   EK  +DP+   + I+ +W P     +PD F
Sbjct  72    YSIVGVQPSLEIIAKEDRIIILNHEKGTREEKQSDDPLNEPQEIASKWNPVKIDSIPDIF  131

Query  689   CGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWV  868
             CGGWVGYFSYDTVRYVEKKKL F+SAP+DDR LPDIHLGLY++V+VFDHV K  +++HWV
Sbjct  132   CGGWVGYFSYDTVRYVEKKKLAFSSAPKDDRGLPDIHLGLYNDVLVFDHVTKLLYVLHWV  191

Query  869   RLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEY  1048
              +D + S   A+ +G K+L+ LV+++Q  +   L SASV+ +  ++G S  K N T  ++
Sbjct  192   HVDQFDSLESAFEDGCKKLDHLVARLQAPEGVELPSASVEMSVEKYGQSATKSNFTPEQF  251

Query  1049  KNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILV  1228
             K+++L+ KEHILAGDIFQ+VLSQRFERRT A PFEVYRALRIVNPSPYM Y+QARG I+V
Sbjct  252   KDSILQVKEHILAGDIFQLVLSQRFERRTFAYPFEVYRALRIVNPSPYMIYLQARGAIMV  311

Query  1229  ASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRND  1408
             ASSPEILTR+ K  VVNRPLAGT KRGKTPEED+ +E  LL DEKE AEH MLVDLGRND
Sbjct  312   ASSPEILTRISKGTVVNRPLAGTRKRGKTPEEDMAMERDLLGDEKECAEHVMLVDLGRND  371

Query  1409  vgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKV  1588
             VGKVSK+G+V VE+ M IERYSHVMHISSTVTGELLD L+ WDALRAALPVGTVSGAPKV
Sbjct  372   VGKVSKAGTVKVEKFMEIERYSHVMHISSTVTGELLDELSSWDALRAALPVGTVSGAPKV  431

Query  1589  KAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVF---LNDGMNDTL-SSRRKE  1756
             +AMELID+LE TRRGPYSGG GG+SF G MDIALALRT+VF    ND M     ++ R+E
Sbjct  432   RAMELIDELEPTRRGPYSGGIGGVSFTGQMDIALALRTMVFPTQRNDAMYSYKDANSRRE  491

Query  1757  WIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKT  1891
             W+ HLQ+GAGIVADS+ +SE  E  NK AGL+RAIDLAE+AF KT
Sbjct  492   WVVHLQAGAGIVADSDAESEYLETINKAAGLARAIDLAEAAFCKT  536



>ref|XP_010427388.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
[Camelina sativa]
Length=492

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/463 (75%), Positives = 387/463 (84%), Gaps = 6/463 (1%)
 Frame = +2

Query  515   VVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCG  694
             VVGA P MEI+AKE+KVT +DH  G LT + VEDPMT+ R ISE WKPQL  DLPDAFCG
Sbjct  23    VVGAHPKMEIVAKESKVTFMDHVKGTLTTEEVEDPMTIPRRISETWKPQLIDDLPDAFCG  82

Query  695   GWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRL  874
             GWVGYFSYDTVRY EK+KLPF+ AP DDRNLPD+HLGLYD+VIVFDHV+KK  IIHWVRL
Sbjct  83    GWVGYFSYDTVRYAEKRKLPFSKAPVDDRNLPDMHLGLYDDVIVFDHVEKKMHIIHWVRL  142

Query  875   DSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKN  1054
                 S    Y  G K LE LVS+++ ++PP+L   SVD +T +FG  L K +MTS EYKN
Sbjct  143   SGNCSFDDVYANGVKHLEELVSRIKCINPPKLPYGSVDLHTNQFGTPLEKSSMTSDEYKN  202

Query  1055  AVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVAS  1234
             AVL+AKEHILAGDIFQIVLSQRFERRT A PFEVYRALRIVNPSP M Y+QARGCILVAS
Sbjct  203   AVLEAKEHILAGDIFQIVLSQRFERRTFAHPFEVYRALRIVNPSPSMCYLQARGCILVAS  262

Query  1235  SPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvg  1414
             SPEILTRVKKN++VNRPLAGTA+RGKT EED MLE  LL DEK+ AEH MLVDLGRNDVG
Sbjct  263   SPEILTRVKKNKIVNRPLAGTARRGKTFEEDQMLEETLLKDEKQCAEHIMLVDLGRNDVG  322

Query  1415  kvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKA  1594
             KVSK+GSV VERLMNIERYSHVMHISSTVTGEL ++LTCWD LRAALPVGTVSGAPKVKA
Sbjct  323   KVSKNGSVKVERLMNIERYSHVMHISSTVTGELQENLTCWDTLRAALPVGTVSGAPKVKA  382

Query  1595  MELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSR------RKE  1756
             MELID+LE TRRGPYSGGFG +SF GDMDIALALRTIVF      DT+ S       R+E
Sbjct  383   MELIDELEVTRRGPYSGGFGSVSFTGDMDIALALRTIVFPTQARYDTMYSYKGSDSPRRE  442

Query  1757  WIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             WIA+LQ+GAGIVADS+P+ E +EC+NK AGL+RAIDLAESAFV
Sbjct  443   WIAYLQAGAGIVADSDPEDEHRECQNKAAGLARAIDLAESAFV  485



>dbj|BAJ88369.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=490

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/486 (71%), Positives = 405/486 (83%), Gaps = 6/486 (1%)
 Frame = +2

Query  446   ETPSFLFESVEPGSRSST-VGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPM  622
             +TPSFLFESVE G   +T VGRYS+VGA P ME++AKENKVTI+DH+  ++TEK+++DPM
Sbjct  2     DTPSFLFESVEQGHEGTTNVGRYSMVGAHPVMEVVAKENKVTIMDHEKAEVTEKIMDDPM  61

Query  623   TVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHL  802
              V RSI E W PQ    LP+AF GGWVG+FSYDTVRYVEKKK+PF+ AP DDRNLPD+HL
Sbjct  62    EVPRSIMEGWHPQEIDQLPEAFSGGWVGFFSYDTVRYVEKKKIPFSGAPHDDRNLPDVHL  121

Query  803   GLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSAS  982
             GLYD+V+VFD+V+KK ++IHWV +D ++S  +AY+ G+ +L+ L+SKV + + P+LS   
Sbjct  122   GLYDDVLVFDNVEKKVYVIHWVSVDRHASTEEAYKHGRSRLKRLLSKVHNANVPKLSPGF  181

Query  983   VDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYR  1162
             V  +TR+FG  L K  MTS EYK+AV++AKEHILAG+IFQIVLSQRFERRT A PFEVYR
Sbjct  182   VKLHTRQFGTPLNKSTMTSDEYKSAVMQAKEHILAGNIFQIVLSQRFERRTYATPFEVYR  241

Query  1163  ALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEM  1342
             ALRIVNPSPYM Y+QARGCILVASSPEILT+V+K +V+NRPLAGT +RGKT  ED + E 
Sbjct  242   ALRIVNPSPYMAYVQARGCILVASSPEILTKVEKGKVINRPLAGTTRRGKTEHEDKLQEE  301

Query  1343  LLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDH  1522
              LL+D+K+ AEH MLVDLGRNDVGKVSKSGSV VE+LMNIERYSHVMHISSTV+GEL + 
Sbjct  302   QLLSDQKQCAEHIMLVDLGRNDVGKVSKSGSVKVEKLMNIERYSHVMHISSTVSGELDER  361

Query  1523  LTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRT  1702
             L  WD LRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGG GGISF GDM IALALRT
Sbjct  362   LESWDTLRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGLGGISFDGDMLIALALRT  421

Query  1703  IVFLNDGMNDTL-----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDL  1867
             IVF     ++T+     S RR+EW+AHLQ+GAGIVADS P+ EQKECENK A L+RAIDL
Sbjct  422   IVFSTAPSHNTMYSYKNSDRRREWVAHLQAGAGIVADSIPEDEQKECENKAAALARAIDL  481

Query  1868  AESAFV  1885
             AESAFV
Sbjct  482   AESAFV  487



>ref|XP_002974247.1| hypothetical protein SELMODRAFT_414586 [Selaginella moellendorffii]
 gb|EFJ24469.1| hypothetical protein SELMODRAFT_414586 [Selaginella moellendorffii]
Length=588

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/536 (65%), Positives = 415/536 (77%), Gaps = 5/536 (1%)
 Frame = +2

Query  275   QIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETP  454
             Q+   RS  +  +  + +A+F EA K  NL+PL + IFSDHLTPVLAYRCLV EDDRE P
Sbjct  25    QLTKWRSGSAVRASSQAQAQFHEACKRGNLVPLFQRIFSDHLTPVLAYRCLVKEDDREAP  84

Query  455   SFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVAR  634
             SFLFESVE  +  S VGRYS+VGAQP MEI+AKEN +TI+ H+ G   E++V+DPM    
Sbjct  85    SFLFESVEHTNGVSNVGRYSMVGAQPAMEIVAKENMLTIISHEDGYENERIVDDPMKEPE  144

Query  635   SISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYD  814
              I+ +W P     LP+ FCGGWVGYFSYDTVRY EKKK+PFASAP DDR LPD+HLGLY 
Sbjct  145   EITSDWSPVPVDGLPNVFCGGWVGYFSYDTVRYSEKKKIPFASAPLDDRGLPDMHLGLYK  204

Query  815   NVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFN  994
             +VIVFDHV K A+ +HWV +  Y   + A+++GKK+L+ L+ +VQ+ + PRLS  +V+ +
Sbjct  205   DVIVFDHVTKIAYAVHWVDIRRYEDPNTAFQDGKKRLQELIDRVQNTEVPRLSHGNVNLS  264

Query  995   TREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRI  1174
                +G  + K NM+  ++K AVL AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRI
Sbjct  265   VGHYGNRVNKSNMSLDQFKGAVLAAKEHILAGDIFQIVLSQRFERRTAADPFEVYRALRI  324

Query  1175  VNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLN  1354
             VNPSPYM Y+QARG ILVASSPEILTR+K  +V+NRPLAGT +RG + EED  LE  LL 
Sbjct  325   VNPSPYMIYLQARGSILVASSPEILTRIKHGKVINRPLAGTRRRGVSDEEDKKLEESLLK  384

Query  1355  DEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCW  1534
             DEKE AEH MLVDLGRNDVGKVSK+GSV VE+ M +ERYSHVMHISSTVTGEL + L+ W
Sbjct  385   DEKECAEHVMLVDLGRNDVGKVSKAGSVQVEKFMEVERYSHVMHISSTVTGELQEGLSSW  444

Query  1535  DALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFL  1714
             DALRAALPVGTVSGAPKV+AM+LID+LE TRRGPYSGG G ISF GDMD+ALALRT+VF 
Sbjct  445   DALRAALPVGTVSGAPKVRAMQLIDELELTRRGPYSGGIGSISFNGDMDVALALRTMVFP  504

Query  1715  NDGMNDTLSSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
                 +   S     W+AHLQ+GAG+VADS PD E  E  NK AGL RAIDLAE+AF
Sbjct  505   TRSQDKNGS-----WLAHLQAGAGVVADSIPDEEYNETVNKAAGLGRAIDLAETAF  555



>ref|XP_002985617.1| hypothetical protein SELMODRAFT_122876, partial [Selaginella 
moellendorffii]
 gb|EFJ13195.1| hypothetical protein SELMODRAFT_122876, partial [Selaginella 
moellendorffii]
Length=522

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/518 (66%), Positives = 405/518 (78%), Gaps = 5/518 (1%)
 Frame = +2

Query  329   AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGR  508
             A+F EA K  NL+PL + IFSDHLTPVLAYRCLV EDDRE PSFLFESVE  +  S VGR
Sbjct  1     AQFHEACKRGNLVPLFQRIFSDHLTPVLAYRCLVKEDDREAPSFLFESVEHTNGVSNVGR  60

Query  509   YSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAF  688
             YS+VGAQP MEI+AKEN +TI+ H+ G   E++V DPM     I+ +W P     LP+ F
Sbjct  61    YSMVGAQPAMEIVAKENMLTIISHEDGYENERIVNDPMKEPEEITSDWSPVPVDGLPNVF  120

Query  689   CGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWV  868
             CGGWVGYFSYDTVRY EKKK+PFASAP DDR LPD+HLGLY +VIVFDHV K A+ +HWV
Sbjct  121   CGGWVGYFSYDTVRYSEKKKIPFASAPLDDRGLPDMHLGLYKDVIVFDHVTKIAYAVHWV  180

Query  869   RLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEY  1048
              +  Y   + A+++GKK+L+ L+ +VQ+ + PRLS  +V+ +   +G  + K NM+  ++
Sbjct  181   DIRRYEDPNTAFQDGKKRLQELIDRVQNTEVPRLSHGNVNLSVGHYGNRVNKSNMSLDQF  240

Query  1049  KNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILV  1228
             K AVL AKEHILAGDIFQIVLSQRFERRT ADPF+VYRALRIVNPSPYM Y+QARG ILV
Sbjct  241   KGAVLAAKEHILAGDIFQIVLSQRFERRTAADPFDVYRALRIVNPSPYMIYLQARGSILV  300

Query  1229  ASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRND  1408
             ASSPEILTR+K  +V+NRPLAGT +RG + EED  LE  LL DEKE AEH MLVDLGRND
Sbjct  301   ASSPEILTRIKHGKVINRPLAGTRRRGVSDEEDKKLEESLLKDEKECAEHVMLVDLGRND  360

Query  1409  vgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKV  1588
             VGKVSK+GSV VE+ M +ERYSHVMHISSTVTGEL + L+ WDALRAALPVGTVSGAPKV
Sbjct  361   VGKVSKAGSVQVEKFMEVERYSHVMHISSTVTGELQEGLSSWDALRAALPVGTVSGAPKV  420

Query  1589  KAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSRRKEWIAH  1768
             +AM+LID+LE  RRGPYSGG G ISF GDMD+ALALRT+VF     +     +   W+AH
Sbjct  421   RAMQLIDELEVARRGPYSGGIGSISFNGDMDVALALRTMVFPTSSQD-----KNGSWLAH  475

Query  1769  LQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
             LQ+GAG+VADS PD E  E  NK AGL RAIDLAE+AF
Sbjct  476   LQAGAGVVADSIPDEEYNETVNKAAGLGRAIDLAETAF  513



>ref|XP_010504459.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=491

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/463 (75%), Positives = 384/463 (83%), Gaps = 6/463 (1%)
 Frame = +2

Query  515   VVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCG  694
             VVGA P MEI+AKENKVT++DH  G LT + V DPM + R ISE WKPQL  DLPDAFCG
Sbjct  23    VVGAHPKMEIVAKENKVTVMDHVKGTLTTEEVADPMMIPRRISETWKPQLIDDLPDAFCG  82

Query  695   GWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRL  874
             GWVGYFSYDTVRY E +KLPF+ AP DDRNLPD+HLGLYD+VIVFDHV+KK  IIHWVRL
Sbjct  83    GWVGYFSYDTVRYAEMRKLPFSKAPVDDRNLPDMHLGLYDDVIVFDHVEKKMHIIHWVRL  142

Query  875   DSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKN  1054
                 S    Y  G K LE LVS+++ ++PP+L   SVD +T +FG  L K +MTS EYKN
Sbjct  143   SGNCSFDDVYANGVKHLEELVSRIKCINPPKLPYGSVDLHTNQFGTPLEKSSMTSDEYKN  202

Query  1055  AVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVAS  1234
             AVL+AKEHILAGDIFQIVLSQRFERRT A PFEVYRALRIVNPSP M Y+QARGCILVAS
Sbjct  203   AVLEAKEHILAGDIFQIVLSQRFERRTFAHPFEVYRALRIVNPSPSMCYLQARGCILVAS  262

Query  1235  SPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvg  1414
             SPEILTRVKKN++VNRPLAGTA+RGKT EED MLE  LL DEK+ AEH MLVDLGRNDVG
Sbjct  263   SPEILTRVKKNKIVNRPLAGTARRGKTFEEDQMLEETLLKDEKQCAEHIMLVDLGRNDVG  322

Query  1415  kvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKA  1594
             KVSK+GSV VER MNIERYSHVMHISSTVTGEL ++LTCWD LRAALPVGTVSGAPKVKA
Sbjct  323   KVSKNGSVKVERFMNIERYSHVMHISSTVTGELQENLTCWDTLRAALPVGTVSGAPKVKA  382

Query  1595  MELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSR------RKE  1756
             MELID+LE TRRGPYSGGFG +SF GDMDIALALRTIVF      DT+ S       R+E
Sbjct  383   MELIDELEVTRRGPYSGGFGSVSFTGDMDIALALRTIVFPTQARYDTMYSYKGSDTPRRE  442

Query  1757  WIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             WIA+LQ+GAGIVADS+P+ E +EC+NK AGL+RAIDLAESAFV
Sbjct  443   WIAYLQTGAGIVADSDPEDEHRECQNKAAGLARAIDLAESAFV  485



>gb|ACF36172.1| anthranilate synthase alpha subunit 2 [Hordeum vulgare subsp. 
vulgare]
Length=490

 Score =   692 bits (1786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/486 (71%), Positives = 405/486 (83%), Gaps = 6/486 (1%)
 Frame = +2

Query  446   ETPSFLFESVEPGSRSST-VGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPM  622
             +TPSFLFESVE G   +T V RYS+VGA P ME++AKENKVTI+DH+  ++TEK+++DPM
Sbjct  2     DTPSFLFESVEQGHEGTTNVDRYSMVGAHPVMEVVAKENKVTIMDHEKAEVTEKIMDDPM  61

Query  623   TVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHL  802
              V RSI E W PQ    LP+AF GGWVG+FSYDTVRYVEKKK+PF+ AP DDRNLPD+HL
Sbjct  62    EVPRSIMEGWHPQEIDQLPEAFSGGWVGFFSYDTVRYVEKKKIPFSGAPHDDRNLPDVHL  121

Query  803   GLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSAS  982
             GLYD+V+VFD+V+KK ++IHWV +D ++S  +AY+ G+ +L+ L+SKV + + P+LS   
Sbjct  122   GLYDDVLVFDNVEKKVYVIHWVSVDRHASTEEAYKHGRSRLKWLLSKVHNANVPKLSPGF  181

Query  983   VDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYR  1162
             V  +TR+FG  L K  MTS EYK+AV++AKEHILAG+IFQIVLSQRFERRT A PFEVYR
Sbjct  182   VKLHTRQFGTPLNKSTMTSDEYKSAVMQAKEHILAGNIFQIVLSQRFERRTYATPFEVYR  241

Query  1163  ALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEM  1342
             ALRIVNPSPYM Y+QARGCILVASSPEILT+V+K +V+NRPLAGT +RGKT  ED + E 
Sbjct  242   ALRIVNPSPYMAYVQARGCILVASSPEILTKVEKGKVINRPLAGTTRRGKTEHEDKLQEE  301

Query  1343  LLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDH  1522
              LL+D+K+ AEH MLVDLGRNDVGKVSKSGSV VE+LMNIERYSHVMHISSTV+GEL + 
Sbjct  302   QLLSDQKQCAEHIMLVDLGRNDVGKVSKSGSVKVEKLMNIERYSHVMHISSTVSGELDER  361

Query  1523  LTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRT  1702
             L  WDALRAALPVGTVSGAPKVKAMELIDQLE TRRGPYSGG GGISF GDM IALALRT
Sbjct  362   LESWDALRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYSGGLGGISFDGDMLIALALRT  421

Query  1703  IVFLNDGMNDTL-----SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDL  1867
             IVF     ++T+     S RR+EW+AHLQ+GAGIVADS P+ EQKECENK A L+RAIDL
Sbjct  422   IVFSTAPSHNTMYSYKNSDRRREWVAHLQAGAGIVADSIPEDEQKECENKAAALARAIDL  481

Query  1868  AESAFV  1885
             AESAFV
Sbjct  482   AESAFV  487



>ref|XP_006292844.1| hypothetical protein CARUB_v10019104mg [Capsella rubella]
 gb|EOA25742.1| hypothetical protein CARUB_v10019104mg [Capsella rubella]
Length=492

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/463 (75%), Positives = 383/463 (83%), Gaps = 6/463 (1%)
 Frame = +2

Query  515   VVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCG  694
             VVGA P MEI+AKENKVT++DH  G LT + VEDPM + R ISE WKPQL  +LPDAFCG
Sbjct  23    VVGAHPKMEIVAKENKVTVMDHVKGTLTTEEVEDPMLIPRRISETWKPQLIDELPDAFCG  82

Query  695   GWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRL  874
             GWVGYFSYDTVRY EK+KLPF+ AP DDRNLPD+HLGLYD+VIVFDHV+KK  IIHWVRL
Sbjct  83    GWVGYFSYDTVRYAEKRKLPFSKAPIDDRNLPDMHLGLYDDVIVFDHVEKKMHIIHWVRL  142

Query  875   DSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKN  1054
                SS    Y  G K LE LVSK++ + PP+L   SVD +T +FG  L   +MTS  YKN
Sbjct  143   SDNSSLDDVYANGVKHLEELVSKIKCITPPKLPYGSVDLHTNQFGTPLENSSMTSDAYKN  202

Query  1055  AVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVAS  1234
             AVL+AKEHILAGDIFQIVLSQRFERRT A PFEVYRALRIVNPSP M Y+QARGCILVAS
Sbjct  203   AVLQAKEHILAGDIFQIVLSQRFERRTFAHPFEVYRALRIVNPSPSMCYLQARGCILVAS  262

Query  1235  SPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvg  1414
             SPEILTRVKKN++VNRPLAGTA+RGKT EED MLE  LL DEK+ AEH MLVDLGRNDVG
Sbjct  263   SPEILTRVKKNKIVNRPLAGTARRGKTFEEDQMLEEALLKDEKQCAEHIMLVDLGRNDVG  322

Query  1415  kvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKA  1594
             KVSK+GSV VER M+IERYSHVMHISSTVTGEL D+LTCWD LRAALPVGTVSGAPKVKA
Sbjct  323   KVSKNGSVKVERYMDIERYSHVMHISSTVTGELQDNLTCWDTLRAALPVGTVSGAPKVKA  382

Query  1595  MELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSR------RKE  1756
             MELID+LE TRRGPYSGGFG +SF GDMDIALALRT VF      DT+ S       R+E
Sbjct  383   MELIDELEVTRRGPYSGGFGSVSFTGDMDIALALRTTVFPTQARYDTMYSYKDSNTPRRE  442

Query  1757  WIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             WIA+LQ+GAGIVADS+P+ E +EC+NK AGL+RAIDLAESAFV
Sbjct  443   WIAYLQAGAGIVADSDPEDEHRECQNKAAGLARAIDLAESAFV  485



>ref|XP_002271164.2| PREDICTED: LOW QUALITY PROTEIN: anthranilate synthase alpha subunit 
1, chloroplastic [Vitis vinifera]
Length=576

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/596 (62%), Positives = 436/596 (73%), Gaps = 29/596 (5%)
 Frame = +2

Query  125   MQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYS  304
             M+ +A   R +P S  IS + +   VS RSS   P  R      KC S           +
Sbjct  1     METLAVSYRSMPFSDRISHVLLAG-VSTRSSVSVPCQRA----FKCLS----------LA  45

Query  305   PPSLDKEE-AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEP  481
              PSL K+   KF EAS+  N++PLH CIFSD LTP+LAYRCLV E D E PSF+FESV P
Sbjct  46    APSLVKDNPVKFKEASRNGNIVPLHACIFSDQLTPILAYRCLVKEGDLEAPSFVFESVVP  105

Query  482   GSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQ  661
             GS+ S+VGRYSVVGAQP MEI+AKENKV  +DH+ G  TE++VEDPM + R I+E WKPQ
Sbjct  106   GSQDSSVGRYSVVGAQPCMEIVAKENKVITMDHEEGLRTEELVEDPMVIPRRIAEGWKPQ  165

Query  662   LTADLPDAFCGGWVGYFSYDTVRYV--EKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDH  835
             L  +LPD FCGGWVG FS+  +R+V   +K   F+ A  DDRNL DIHL LYD+VIVFDH
Sbjct  166   LLDELPDTFCGGWVG-FSH-MIRFVMWRRKSCXFSKAQDDDRNLADIHLALYDDVIVFDH  223

Query  836   VDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPS  1015
             V+KK  +IHWVRLD +SS  KAY +G K+LE L+S+VQD+DPP+LS   V+ + + F  S
Sbjct  224   VEKKVHVIHWVRLDLHSSVEKAYVDGMKRLEILLSRVQDIDPPKLSPGCVESHIQSFSSS  283

Query  1016  LAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYM  1195
             L + NMTS  YK    KAKEHI AGDIFQI LSQ FERRT ADPFEVYRA R+VNPSP+M
Sbjct  284   LNESNMTSEAYK----KAKEHIRAGDIFQIGLSQCFERRTFADPFEVYRAFRVVNPSPFM  339

Query  1196  TYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAE  1375
              Y+QARGC+LVASSPEILT VKKN +VNRPLAGT +RG T  ED MLE  LLNDEK+ AE
Sbjct  340   AYLQARGCVLVASSPEILTHVKKNNIVNRPLAGTVRRGTTIHEDEMLEGQLLNDEKQCAE  399

Query  1376  HTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAAL  1555
             H MLVDLGRN+VGKV+K GS+ VE L  +E +SHVMHISSTVTGEL DHLT W+ALR+ L
Sbjct  400   HIMLVDLGRNNVGKVAKFGSLKVEDLKAVECFSHVMHISSTVTGELQDHLTSWNALRSIL  459

Query  1556  PVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDT  1735
              VG VSGAPKVKAMELID+ E +RRGPY GGFG +SF GDM+I L LRTIVF      DT
Sbjct  460   HVGAVSGAPKVKAMELIDEWEESRRGPYGGGFGNVSFTGDMEIDLTLRTIVFPTGNRYDT  519

Query  1736  LSSR-----RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             L S      R+EW+A+ Q+GAGIVADS  D +Q++CE K A L+ AIDLAE+AFVK
Sbjct  520   LFSYKDTKLRREWVAYFQAGAGIVADSVVDDKQRDCEGKAAALACAIDLAEAAFVK  575



>ref|XP_011032137.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X3 [Populus euphratica]
Length=486

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/463 (75%), Positives = 397/463 (86%), Gaps = 5/463 (1%)
 Frame = +2

Query  515   VVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCG  694
             VVGAQP MEI+AKEN VTI+DH  G+  E++VEDPM V R I E WKPQL  +LP+AFCG
Sbjct  23    VVGAQPRMEIVAKENMVTIMDHYDGRRMEEIVEDPMEVPRKIMEGWKPQLIDELPEAFCG  82

Query  695   GWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRL  874
             GWVGYFSYDTVRYVEKKKLPF+ AP DDRNLPD+HLGLYD+VIVFDHV+KKA +IHWV+L
Sbjct  83    GWVGYFSYDTVRYVEKKKLPFSGAPPDDRNLPDVHLGLYDDVIVFDHVEKKACVIHWVQL  142

Query  875   DSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKN  1054
             D +SS  +AY +G  +LE+++S+V D+ PPRL + S+   TR FGP L   +MTS EYK+
Sbjct  143   DRFSSVKEAYEDGMNRLESILSRVHDIAPPRLPAGSIKLFTRLFGPKLENSSMTSEEYKD  202

Query  1055  AVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVAS  1234
             AVL+AK+HILAGDIFQIVLSQRFERRT ADPFE+YRALR+VNPSPYMTY+QARGCILVAS
Sbjct  203   AVLQAKDHILAGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMTYLQARGCILVAS  262

Query  1235  SPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvg  1414
             SPEILTRVKK ++ NRPLAGT +RGKTP+ED+MLE  LLND+K+ AEH MLVDLGRNDVG
Sbjct  263   SPEILTRVKKEKITNRPLAGTVRRGKTPKEDLMLEKELLNDQKQCAEHIMLVDLGRNDVG  322

Query  1415  kvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKA  1594
             KVSK GSV VE+LMNIERYSHVMHISSTVTGELLD+LT WD LRAALPVGTVSGAPKVKA
Sbjct  323   KVSKPGSVKVEKLMNIERYSHVMHISSTVTGELLDNLTRWDVLRAALPVGTVSGAPKVKA  382

Query  1595  MELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEW  1759
             MELIDQLE TRRGPYSGGFGGISF GDMDIALALRTIVF      DT+ S      R+EW
Sbjct  383   MELIDQLEVTRRGPYSGGFGGISFSGDMDIALALRTIVFPTSTRYDTMYSYKDVNTRREW  442

Query  1760  IAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             +AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAESAF+K
Sbjct  443   VAHLQAGAGIVADSDPADEQRECENKAAALARAIDLAESAFLK  485



>gb|ABF95121.1| anthranilate synthase component I family protein, expressed [Oryza 
sativa Japonica Group]
Length=465

 Score =   680 bits (1755),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/462 (72%), Positives = 391/462 (85%), Gaps = 5/462 (1%)
 Frame = +2

Query  515   VVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCG  694
             +VGA P ME++AKE+KVTI+DH+ GK+TE+VV+DPM + RS+ E W PQ    LPD+F G
Sbjct  1     MVGAHPVMEVVAKEHKVTIMDHEKGKVTEQVVDDPMQIPRSMMEGWHPQQIDQLPDSFTG  60

Query  695   GWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRL  874
             GWVG+FSYDTVRYVEKKKLPF+ APQDDRNLPD+HLGLYD+V+VFD+V+KK ++IHWV L
Sbjct  61    GWVGFFSYDTVRYVEKKKLPFSGAPQDDRNLPDVHLGLYDDVLVFDNVEKKVYVIHWVNL  120

Query  875   DSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKN  1054
             D +++   A+++GK +L  L+SKV + + P+LS   V  +TR+FG  L K  MTS EYKN
Sbjct  121   DRHATTEDAFQDGKSRLNLLLSKVHNSNVPKLSPGFVKLHTRQFGTPLNKSTMTSDEYKN  180

Query  1055  AVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVAS  1234
             AV++AKEHI+AGDIFQIVLSQRFERRT A+PFEVYRALRIVNPSPYM Y+QARGC+LVAS
Sbjct  181   AVMQAKEHIMAGDIFQIVLSQRFERRTYANPFEVYRALRIVNPSPYMAYVQARGCVLVAS  240

Query  1235  SPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvg  1414
             SPEILTRV+K +++NRPLAGT +RGKT +ED M E  LL+DEK+ AEH MLVDLGRNDVG
Sbjct  241   SPEILTRVRKGKIINRPLAGTVRRGKTEKEDEMQEQQLLSDEKQCAEHIMLVDLGRNDVG  300

Query  1415  kvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKA  1594
             KVSK GSV VE+LMNIERYSHVMHISSTV+GEL DHL  WDALRAALPVGTVSGAPKVKA
Sbjct  301   KVSKPGSVKVEKLMNIERYSHVMHISSTVSGELDDHLQSWDALRAALPVGTVSGAPKVKA  360

Query  1595  MELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEW  1759
             MELID+LE TRRGPYSGG GGISF GDM IALALRTIVF     ++T+ S     RR+EW
Sbjct  361   MELIDELEVTRRGPYSGGLGGISFDGDMLIALALRTIVFSTAPSHNTMYSYKDTERRREW  420

Query  1760  IAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             +AHLQ+GAGIVADS+PD EQ+ECENK A L+RAIDLAESAFV
Sbjct  421   VAHLQAGAGIVADSSPDDEQRECENKAAALARAIDLAESAFV  462



>ref|XP_009371534.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=486

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/461 (75%), Positives = 392/461 (85%), Gaps = 5/461 (1%)
 Frame = +2

Query  518   VGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGG  697
             +GAQP++EI+AKEN VTI+DH  G  TE++VEDPMTV R I E W PQL  +LP+AFCGG
Sbjct  24    IGAQPSIEIVAKENMVTIMDHREGCRTEEIVEDPMTVPRRIMEGWTPQLLDELPEAFCGG  83

Query  698   WVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLD  877
             WVGYFSYDTVRYVEKKKLPF SAP DDRNLPD+HLGLYD+VIVFDHVDKKA +IHWV+LD
Sbjct  84    WVGYFSYDTVRYVEKKKLPFPSAPPDDRNLPDVHLGLYDDVIVFDHVDKKAHVIHWVQLD  143

Query  878   SYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNA  1057
              YSS  +A+ +G  +LE L+SKV D+  PRL + S++FNT+ FG  L   ++TS EYK A
Sbjct  144   QYSSVDEAFNDGINRLETLLSKVHDIITPRLPAGSIEFNTQLFGTKLEDSSLTSEEYKEA  203

Query  1058  VLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASS  1237
             VL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+QARGCILVASS
Sbjct  204   VLEAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCILVASS  263

Query  1238  PEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgk  1417
             PEILTRVKK  + NRPLAGT +RGKTP+ED+MLE  LLNDEK+ AEH MLVDLGRNDVGK
Sbjct  264   PEILTRVKKKTITNRPLAGTVRRGKTPKEDLMLEKQLLNDEKQCAEHIMLVDLGRNDVGK  323

Query  1418  vsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAM  1597
             VSK GSV VE LMNIERYSHVMHISSTVTGELLD LT WD LR ALPVGTVSGAPKVKAM
Sbjct  324   VSKPGSVKVEELMNIERYSHVMHISSTVTGELLDDLTSWDVLRTALPVGTVSGAPKVKAM  383

Query  1598  ELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWI  1762
             ELID+LE TRRGPYSGGFGGISF G+MDIALALRTIVF      DT+ S     +R+EW+
Sbjct  384   ELIDKLEVTRRGPYSGGFGGISFSGNMDIALALRTIVFPTSFRYDTMYSYKDTNKRREWV  443

Query  1763  AHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  444   AHLQAGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  484



>ref|NP_567028.1| anthranilate synthase component I-like protein [Arabidopsis thaliana]
 gb|AEE79451.1| anthranilate synthase component I-like protein [Arabidopsis thaliana]
Length=492

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/463 (73%), Positives = 380/463 (82%), Gaps = 6/463 (1%)
 Frame = +2

Query  515   VVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCG  694
             VVGA P MEI+AKENKVT++DH  G  T + VEDPM + R ISE WKPQL  DLPD FCG
Sbjct  23    VVGAHPKMEIVAKENKVTVMDHVKGTKTTEEVEDPMMIPRRISETWKPQLIDDLPDVFCG  82

Query  695   GWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRL  874
             GWVGYFSYDTV Y EK+KLP + AP DDRNLPD+HLGLYD+V+VFDHV+KK  IIHWVRL
Sbjct  83    GWVGYFSYDTVPYAEKRKLPLSKAPVDDRNLPDMHLGLYDDVVVFDHVEKKIHIIHWVRL  142

Query  875   DSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKN  1054
                SS    Y    K LE LVS+++ ++PP+L   SVD +T +FG  L K +MTS  YKN
Sbjct  143   SENSSFDDVYANAVKHLEELVSRIKCMNPPKLPYGSVDLHTNQFGTPLEKSSMTSDAYKN  202

Query  1055  AVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVAS  1234
             AVL+AKEHILAGDIFQIVLSQRFER T A PFEVYRALRIVNPSP M Y+QARGCILVAS
Sbjct  203   AVLQAKEHILAGDIFQIVLSQRFERHTFAHPFEVYRALRIVNPSPSMCYLQARGCILVAS  262

Query  1235  SPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvg  1414
             SPEILTRVKKN++VNRPLAGTA+RGK+ EED MLE  LL DEK+ AEH MLVDLGRNDVG
Sbjct  263   SPEILTRVKKNKIVNRPLAGTARRGKSFEEDQMLEEALLKDEKQCAEHIMLVDLGRNDVG  322

Query  1415  kvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKA  1594
             KVSK+GSV VERLMNIERYSHVMHISSTV GEL ++LTCWD LRAALPVGTVSGAPKVKA
Sbjct  323   KVSKNGSVKVERLMNIERYSHVMHISSTVIGELQENLTCWDTLRAALPVGTVSGAPKVKA  382

Query  1595  MELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSR------RKE  1756
             MELID+LE TRRGPYSGGFG +SF GDMDIALALRTIVF      DT+ S       R+E
Sbjct  383   MELIDELEVTRRGPYSGGFGSVSFTGDMDIALALRTIVFPTQARYDTMYSYKDKDTPRRE  442

Query  1757  WIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             WIA+LQ+GAGIVADS+P+ E +EC+NK AGL+RAIDLAESAFV
Sbjct  443   WIAYLQAGAGIVADSDPEDEHRECQNKAAGLARAIDLAESAFV  485



>gb|AAL11605.1|AF424611_1 AT3g55870/F27K19_50 [Arabidopsis thaliana]
 gb|AAN18182.1| At3g55870/F27K19_50 [Arabidopsis thaliana]
Length=492

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/463 (73%), Positives = 380/463 (82%), Gaps = 6/463 (1%)
 Frame = +2

Query  515   VVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCG  694
             VVGA P MEI+AKENKVT++DH  G  T + VEDPM + R ISE WKPQL  DLPD FCG
Sbjct  23    VVGAHPKMEIVAKENKVTVMDHVKGTKTTEEVEDPMMIPRRISETWKPQLIDDLPDVFCG  82

Query  695   GWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRL  874
             GWVGYFSYDTV Y EK+KLP + AP DDRNLPD+HLGLYD+V+VFDHV+KK  IIHWVRL
Sbjct  83    GWVGYFSYDTVPYAEKRKLPLSKAPVDDRNLPDMHLGLYDDVVVFDHVEKKIHIIHWVRL  142

Query  875   DSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKN  1054
                SS    Y    K LE LVS+++ ++PP+L   SVD +T +FG  L K +MTS  YKN
Sbjct  143   SENSSFDDVYANAVKHLEELVSRIKCMNPPKLPYGSVDLHTNQFGTPLEKSSMTSDAYKN  202

Query  1055  AVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVAS  1234
             AVL+AKEHILAGDIFQIVLSQRFER T A PFEVYRALRIVNPSP M Y+QARGCILVAS
Sbjct  203   AVLQAKEHILAGDIFQIVLSQRFERHTFAHPFEVYRALRIVNPSPSMCYLQARGCILVAS  262

Query  1235  SPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvg  1414
             SPEILTRVKKN++VNRPLAGTA+RGK+ EED MLE  LL DEK+ AEH MLVDLGRNDVG
Sbjct  263   SPEILTRVKKNKIVNRPLAGTARRGKSFEEDQMLEEALLKDEKQCAEHIMLVDLGRNDVG  322

Query  1415  kvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKA  1594
             KVSK+GSV VERLMNIERYSHVMHISSTV GEL ++LTCWD LRAALPVGTVSGAPKVKA
Sbjct  323   KVSKNGSVKVERLMNIERYSHVMHISSTVIGELQENLTCWDTLRAALPVGTVSGAPKVKA  382

Query  1595  MELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSR------RKE  1756
             MELID+LE TRRGPYSGGFG +SF GDMDIALALRTIVF      DT+ S       R+E
Sbjct  383   MELIDELEVTRRGPYSGGFGSVSFTGDMDIALALRTIVFPTQARYDTMYSYKDKDTPRRE  442

Query  1757  WIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             W+A+LQ+GAGIVADS+P+ E +EC+NK AGL+RAIDLAESAFV
Sbjct  443   WVAYLQAGAGIVADSDPEDEHRECQNKAAGLARAIDLAESAFV  485



>ref|XP_009371517.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X3 [Pyrus x bretschneideri]
Length=486

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/461 (75%), Positives = 392/461 (85%), Gaps = 5/461 (1%)
 Frame = +2

Query  518   VGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGG  697
             +GAQP++EI+AKEN VTI+DH  G  TE++VEDPMTV + I E W PQL  +LP+AFCGG
Sbjct  24    IGAQPSIEIVAKENMVTIMDHREGCRTEEIVEDPMTVPQRIMEGWTPQLLDELPEAFCGG  83

Query  698   WVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLD  877
             WVGYFSYDTVRYVEKKKLPF SAP DDRNLPD+HLGLYD+VIVFDHVDKKA +IHWV+LD
Sbjct  84    WVGYFSYDTVRYVEKKKLPFPSAPPDDRNLPDVHLGLYDDVIVFDHVDKKAHVIHWVQLD  143

Query  878   SYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNA  1057
              YSS  +A+ +G  +LE L+SKV D+  PRL + S++FNT+ FG  L   ++TS EYK A
Sbjct  144   QYSSVDEAFNDGINRLETLLSKVHDIITPRLPAGSIEFNTQLFGTKLEDSSLTSEEYKEA  203

Query  1058  VLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASS  1237
             VL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+QARGCILVASS
Sbjct  204   VLEAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCILVASS  263

Query  1238  PEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgk  1417
             PEILTRVKK  + NRPLAGT +RGKTP+ED+MLE  LLNDEK+ AEH MLVDLGRNDVGK
Sbjct  264   PEILTRVKKKTITNRPLAGTVRRGKTPKEDLMLEKQLLNDEKQCAEHIMLVDLGRNDVGK  323

Query  1418  vsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAM  1597
             VSK GSV VE LMNIERYSHVMHISSTVTGELLD LT WD LR ALPVGTVSGAPKVKAM
Sbjct  324   VSKPGSVKVEELMNIERYSHVMHISSTVTGELLDDLTSWDVLRTALPVGTVSGAPKVKAM  383

Query  1598  ELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWI  1762
             ELID+LE TRRGPYSGGFGGISF G+MDIALALRTIVF      DT+ S     +R+EW+
Sbjct  384   ELIDKLEVTRRGPYSGGFGGISFSGNMDIALALRTIVFPTSFRYDTMYSYKDTNKRREWV  443

Query  1763  AHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  444   AHLQAGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  484



>ref|XP_011082386.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
isoform X3 [Sesamum indicum]
Length=457

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/456 (75%), Positives = 393/456 (86%), Gaps = 5/456 (1%)
 Frame = +2

Query  536   MEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFS  715
             MEI+AKEN VTI+DH  G+ TE+ VEDPM + R I E+WKPQ   +LP+AFCGGWVGYFS
Sbjct  1     MEIVAKENVVTIVDHHEGQRTEEFVEDPMVIPRRIMEKWKPQRIDELPEAFCGGWVGYFS  60

Query  716   YDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSAS  895
             YDTVRYVEKKKLPF+ AP+DDRNLPD+HLGLYD+VIVFDHV+KKA++IHWVRLD +SS  
Sbjct  61    YDTVRYVEKKKLPFSKAPEDDRNLPDVHLGLYDDVIVFDHVEKKAYVIHWVRLDQFSSVE  120

Query  896   KAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKE  1075
             +AY +G  +LEALVS+V D+ PP+L++ S+   T  FGPSL+K  MTS EY+ AV++AKE
Sbjct  121   EAYDDGMNRLEALVSRVHDIVPPKLAAGSIKLYTSLFGPSLSKSTMTSEEYRKAVMQAKE  180

Query  1076  HILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTR  1255
             HILAGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+QARGCILVASSPEILTR
Sbjct  181   HILAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYLQARGCILVASSPEILTR  240

Query  1256  VKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgs  1435
             VKK +V+NRPLAGT +RGKTP+ED MLE  LL+DEK+ AEH MLVDLGRNDVGKVSKSGS
Sbjct  241   VKKGKVINRPLAGTVRRGKTPKEDYMLENQLLHDEKQCAEHIMLVDLGRNDVGKVSKSGS  300

Query  1436  vNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQL  1615
             V VE+L NIERYSHVMHISSTVTGEL  +LT WDALRAALPVGTVSGAPKVKAMELID L
Sbjct  301   VKVEKLKNIERYSHVMHISSTVTGELSSNLTSWDALRAALPVGTVSGAPKVKAMELIDHL  360

Query  1616  EATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL-----SSRRKEWIAHLQSG  1780
             E TRRGPYSGGFGGISF GDMDIALALRTIVF      DT+     S +R++W+AHLQ+G
Sbjct  361   EVTRRGPYSGGFGGISFSGDMDIALALRTIVFPTSTRYDTMYSYKDSGKRRDWVAHLQAG  420

Query  1781  AGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             AGIVADS+P  EQ+ECENK A L+RAIDLAES+FV+
Sbjct  421   AGIVADSDPADEQRECENKAAALARAIDLAESSFVE  456



>ref|XP_008220602.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic 
isoform X2 [Prunus mume]
Length=486

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/462 (75%), Positives = 393/462 (85%), Gaps = 5/462 (1%)
 Frame = +2

Query  515   VVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCG  694
             V+GAQP++EI+AKEN VTI+DH  G  TE++VEDPMTV + I E W PQL  +LP+AFCG
Sbjct  23    VIGAQPSIEIVAKENMVTIMDHREGCRTEEIVEDPMTVPQRIMEGWTPQLVDELPEAFCG  82

Query  695   GWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRL  874
             GWVGYFSYDTVRYVE KKLPFASAP DDRNLPD+HLGLYD+VIVFDHV+KKA +IHWV+L
Sbjct  83    GWVGYFSYDTVRYVETKKLPFASAPPDDRNLPDVHLGLYDDVIVFDHVEKKAHVIHWVQL  142

Query  875   DSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKN  1054
             D YSS  +A+ +G  +LE LVS+V D+  PRL + S++FNT+ FGP L   ++TS EYK 
Sbjct  143   DQYSSVEEAFNDGINRLETLVSRVHDIITPRLPAGSIEFNTQLFGPELEDSSLTSEEYKE  202

Query  1055  AVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVAS  1234
             AVLKAKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+QARGCILVAS
Sbjct  203   AVLKAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCILVAS  262

Query  1235  SPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvg  1414
             SPEILT VKK  + NRPLAGT +RGKT +ED++LE  LLNDEK+ AEH MLVDLGRNDVG
Sbjct  263   SPEILTHVKKRTITNRPLAGTVRRGKTAKEDLILEKQLLNDEKQCAEHIMLVDLGRNDVG  322

Query  1415  kvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKA  1594
             KVSK GSV VE+LMNIERYSHVMHISSTVTGEL D LT WDALR ALPVGTVSGAPKV+A
Sbjct  323   KVSKPGSVKVEKLMNIERYSHVMHISSTVTGELRDDLTSWDALRTALPVGTVSGAPKVRA  382

Query  1595  MELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEW  1759
             MELIDQLE TRRGPYSGGFGGISF G+MDIALALRTIVF      DT+ S     +R+EW
Sbjct  383   MELIDQLEVTRRGPYSGGFGGISFSGNMDIALALRTIVFPTSFRYDTMYSYKDVNKRREW  442

Query  1760  IAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             +AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  443   VAHLQAGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  484



>ref|XP_010650924.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic 
isoform X3 [Vitis vinifera]
Length=449

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/447 (76%), Positives = 387/447 (87%), Gaps = 5/447 (1%)
 Frame = +2

Query  563   VTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEK  742
             VTI+DH++G  TE++VEDPM++ R + E WKPQL  +LP+AFCGGWVGYFSYDTVRYVEK
Sbjct  2     VTIMDHEAGSRTEEIVEDPMSIPRRMMEGWKPQLLDELPEAFCGGWVGYFSYDTVRYVEK  61

Query  743   KKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQ  922
             KKLPF SAP+DDRNLPD+HLGLY++V+VFDHV K+ F+IHWVRLD YSS  +A+ +G  +
Sbjct  62    KKLPFLSAPKDDRNLPDVHLGLYEDVLVFDHVKKQVFVIHWVRLDQYSSVEEAFNDGMNR  121

Query  923   LEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQ  1102
             LEALVS+V D+ PP+L++ S+   T  FGPSL K  MT  EY  AVL+AKEHILAGDIFQ
Sbjct  122   LEALVSRVHDIVPPKLAAGSIKLQTGLFGPSLEKSTMTCDEYMKAVLEAKEHILAGDIFQ  181

Query  1103  IVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNR  1282
             IVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+QARGCILVASSPEILTRVKKNR++NR
Sbjct  182   IVLSQRFERRTFADPFEVYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKNRIINR  241

Query  1283  PLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNI  1462
             PLAGT +RGKTP+ED+MLE  L NDEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNI
Sbjct  242   PLAGTVRRGKTPKEDIMLENQLRNDEKQCAEHIMLVDLGRNDVGKVSKPGSVTVEKLMNI  301

Query  1463  ERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYS  1642
             ERYSHVMHISSTVTGELLDHLT WDALRAALPVGTVSGAPKVKAMELIDQLE TRRGPYS
Sbjct  302   ERYSHVMHISSTVTGELLDHLTSWDALRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYS  361

Query  1643  GGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNP  1807
             GGFGGISF GDMDIALALRTIVF +    DT+ S     +R+EW+AHLQ+GAGIVADS P
Sbjct  362   GGFGGISFSGDMDIALALRTIVFPSGSRFDTMFSYKDMNKRREWVAHLQAGAGIVADSVP  421

Query  1808  DSEQKECENKVAGLSRAIDLAESAFVK  1888
               EQ+ECENK A L+RAIDLAES+F++
Sbjct  422   ADEQRECENKAAALARAIDLAESSFIE  448



>ref|XP_007016135.1| Anthranilate synthase component I-2 isoform 4 [Theobroma cacao]
 gb|EOY33754.1| Anthranilate synthase component I-2 isoform 4 [Theobroma cacao]
Length=506

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/488 (69%), Positives = 389/488 (80%), Gaps = 19/488 (4%)
 Frame = +2

Query  149   RLLPPSHLISELPITSIVSRRSSGYAPSLR--------VRTLQLKCSSSLQIPVTRSPYS  304
             R LP + L     ++   + R SGY             +RTL  KCS+           S
Sbjct  14    RQLPSTPLCPSTTVSVNFNARLSGYRSRSLLLLSSTSRIRTL--KCSAL---------SS  62

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
             P SL  +  KF EASK  NL+PL +CIFSDHLTPV+AYRCLV EDDR+ PSFLFESVEPG
Sbjct  63    PSSLVDQSVKFREASKNGNLVPLFRCIFSDHLTPVIAYRCLVKEDDRDAPSFLFESVEPG  122

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
              ++S++GRYSVVGAQP++EI+AK N VTIL+H+ G  TE++VEDPM V R I E W+PQ 
Sbjct  123   WQTSSIGRYSVVGAQPSIEIVAKGNMVTILNHEEGCRTEEIVEDPMIVPRRIMEGWEPQR  182

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               +LP+ FCGGWVGYFSYDTVRYVEKKKLPF+SAP DDRNLPD+HLGLY +VIVFDHV+K
Sbjct  183   IDELPEVFCGGWVGYFSYDTVRYVEKKKLPFSSAPLDDRNLPDVHLGLYGDVIVFDHVEK  242

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             KAF+IHWVRLD YSS  +AY +G K+LE+LVS+V D+DPP+L + ++   TR FGP L  
Sbjct  243   KAFVIHWVRLDQYSSVDEAYNDGMKRLESLVSRVHDIDPPKLPAGAIKLYTRLFGPKLEI  302

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
              +MTS  YK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+
Sbjct  303   SSMTSEAYKEAVLQAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYL  362

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEILTRVKK +V NRPLAGT +RGKTP+ED+MLE  LL DEKE AEH M
Sbjct  363   QARGCILVASSPEILTRVKKGKVTNRPLAGTIRRGKTPKEDLMLEKELLADEKECAEHIM  422

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTVTGELLD L+ WDALRAALPVG
Sbjct  423   LVDLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVTGELLDDLSSWDALRAALPVG  482

Query  1565  TVSGAPKV  1588
             TVSGAPKV
Sbjct  483   TVSGAPKV  490



>gb|KCW85459.1| hypothetical protein EUGRSUZ_B02267 [Eucalyptus grandis]
Length=449

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/446 (76%), Positives = 379/446 (85%), Gaps = 5/446 (1%)
 Frame = +2

Query  563   VTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEK  742
             VTI+DH+ G  TE++VEDPM V R I E WKPQ+  +LP+AFCGGWVGYFSYDTVRYVEK
Sbjct  2     VTIMDHEKGSRTEEIVEDPMVVPRRIMEGWKPQMIDELPEAFCGGWVGYFSYDTVRYVEK  61

Query  743   KKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQ  922
             +KLPF SAP DDRNLPD+HLGLY +VIVFDHVDKKA++IHWVRLD Y S  +A+ +G  +
Sbjct  62    RKLPFCSAPSDDRNLPDVHLGLYVDVIVFDHVDKKAYVIHWVRLDQYPSVDEAFDDGMNR  121

Query  923   LEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQ  1102
             LE LVS+V D+DPPRL + S+   TR FGP L   +MTS EYK AVL+AKEHILAGDIFQ
Sbjct  122   LETLVSRVHDIDPPRLPAGSIKLFTRLFGPKLEMSSMTSEEYKKAVLQAKEHILAGDIFQ  181

Query  1103  IVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNR  1282
             IVLSQRFERRT ADPFEVYRALRIVNPSPYM Y+Q RGCILVASSPEILTRVKK RV NR
Sbjct  182   IVLSQRFERRTFADPFEVYRALRIVNPSPYMAYLQGRGCILVASSPEILTRVKKRRVTNR  241

Query  1283  PLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNI  1462
             PLAGT +RGKTP+ED+MLE  LL+DEK+ AEH MLVDLGRNDVGKVS  GSV VE+LMNI
Sbjct  242   PLAGTVRRGKTPKEDLMLEKELLSDEKQCAEHIMLVDLGRNDVGKVSIPGSVKVEKLMNI  301

Query  1463  ERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYS  1642
             ERYSHVMHISSTVTGELL++L+ WDALRAALPVGTVSGAPKVKAMELIDQLE TRRGPYS
Sbjct  302   ERYSHVMHISSTVTGELLENLSGWDALRAALPVGTVSGAPKVKAMELIDQLEVTRRGPYS  361

Query  1643  GGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNP  1807
             GGFGGISF GDMDIALALRTIVF      DT+ S      R+EW+AHLQ+GAGIVADS+P
Sbjct  362   GGFGGISFSGDMDIALALRTIVFPTGIRYDTMYSYKDMNNRREWVAHLQAGAGIVADSDP  421

Query  1808  DSEQKECENKVAGLSRAIDLAESAFV  1885
               EQ+ECENK A L+RAIDLAES+FV
Sbjct  422   ADEQRECENKAAALARAIDLAESSFV  447



>ref|XP_010321741.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
isoform X2 [Solanum lycopersicum]
Length=567

 Score =   664 bits (1713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/588 (63%), Positives = 425/588 (72%), Gaps = 71/588 (12%)
 Frame = +2

Query  149   RLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIPVTRSPYSPPSLDKEE  328
             +LLP  H  + LPI+     RSS YA   R+      CSSSL+  +            +E
Sbjct  2     QLLPICHR-NILPIS-----RSSTYA---RLHC----CSSSLRHVI------------DE  36

Query  329   AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGR  508
              +FIE SKT NLIPL+  IFSDHLTPVLAYRCLV E+D E PSFL+ESVE     S+VGR
Sbjct  37    KRFIEVSKTGNLIPLYTTIFSDHLTPVLAYRCLVKEEDHEAPSFLYESVE----GSSVGR  92

Query  509   YSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTAD-LPDA  685
             YSVVGAQP+MEI+ KE+ VTILDH +GKLTEK VEDPMT+  SIS  WKP L  D LPD 
Sbjct  93    YSVVGAQPSMEIIVKEHNVTILDHHAGKLTEKTVEDPMTIPASISNGWKPGLIDDELPDT  152

Query  686   FCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHW  865
             FC               E  K PF  AP+DDRNL DI LGLY++VIVFDHV+KKA +IHW
Sbjct  153   FC---------------ENNKFPFLRAPEDDRNLADIQLGLYEDVIVFDHVEKKAHVIHW  197

Query  866   VRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGE  1045
             V LD YSS  +AY +GKK LE L+S+VQ +  PRLS  SVDF   EF  SL + NMT  E
Sbjct  198   VWLDQYSSLLEAYLDGKKHLEILMSRVQGIKSPRLSPGSVDFCIHEFETSLTQKNMTCVE  257

Query  1046  YKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCIL  1225
             YKNA+L+AKEHI +GDI QIVLSQRFERRT ADPFEVYRALRIVNPSPYMTY+QARGC L
Sbjct  258   YKNAILQAKEHIASGDIHQIVLSQRFERRTFADPFEVYRALRIVNPSPYMTYIQARGCTL  317

Query  1226  VASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRN  1405
             VASSPE L RVKK R+VNRPLA T  RG+TP+ED+MLEM +L D K              
Sbjct  318   VASSPETLARVKKRRIVNRPLARTTTRGRTPDEDLMLEMQMLKDIK--------------  363

Query  1406  DvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPK  1585
                     G VNVE+LM+++RYS VMH+SSTV+GELLDHLTCWDALRAALPVGT+ GAPK
Sbjct  364   -------PGFVNVEKLMSVKRYSDVMHMSSTVSGELLDHLTCWDALRAALPVGTICGAPK  416

Query  1586  VKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL-----SSRR  1750
             VKAMELIDQLE +RRGPYSGGFGGISF GDMDI LALR +VF+N    DT+     +S+R
Sbjct  417   VKAMELIDQLEVSRRGPYSGGFGGISFSGDMDIGLALRMMVFMNGPRYDTMYSYTDASKR  476

Query  1751  KEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKTK  1894
             +EW+AHLQS + IVADS+PD +QKECE+KVA L RAIDLAE  FVK +
Sbjct  477   QEWVAHLQSESRIVADSDPDEKQKECEDKVASLCRAIDLAELTFVKGR  524



>ref|XP_007205190.1| hypothetical protein PRUPE_ppa005650mg [Prunus persica]
 gb|EMJ06389.1| hypothetical protein PRUPE_ppa005650mg [Prunus persica]
Length=449

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/446 (76%), Positives = 379/446 (85%), Gaps = 5/446 (1%)
 Frame = +2

Query  563   VTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEK  742
             VTI+DH  G  TE++VEDPMTV R I E W PQL  +LP+AFCGGWVGYFSYDTVRYVE 
Sbjct  2     VTIMDHREGCRTEEIVEDPMTVPRRIMEGWTPQLVDELPEAFCGGWVGYFSYDTVRYVET  61

Query  743   KKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQ  922
             KKLPFASAP DDRNLPD+HLGLYD+VIVFDHV+KKA +IHWV+LD YSS  +A+ +G  +
Sbjct  62    KKLPFASAPPDDRNLPDVHLGLYDDVIVFDHVEKKAHVIHWVQLDQYSSVEEAFNDGINR  121

Query  923   LEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQ  1102
             LE LVS+V D+  PRL + S++FNT+ FGP L   ++TS EYK AVLKAKEHILAGDIFQ
Sbjct  122   LETLVSRVHDIITPRLPAGSIEFNTQLFGPELENSSLTSEEYKEAVLKAKEHILAGDIFQ  181

Query  1103  IVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNR  1282
             IVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+QARGCILVASSPEILT VKK  + NR
Sbjct  182   IVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTHVKKRTITNR  241

Query  1283  PLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNI  1462
             PLAGT +RGKT +ED+MLE  LLNDEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNI
Sbjct  242   PLAGTVRRGKTAKEDLMLEKQLLNDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEKLMNI  301

Query  1463  ERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYS  1642
             ERYSHVMHISSTVTGELLD LT WDALR ALPVGTVSGAPKVKAMELIDQLE TRRGPYS
Sbjct  302   ERYSHVMHISSTVTGELLDDLTSWDALRTALPVGTVSGAPKVKAMELIDQLEVTRRGPYS  361

Query  1643  GGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNP  1807
             GGFGGISF G+MDIALALRTIVF      DT+ S     +R+EW+AHLQ+GAGIVADS+P
Sbjct  362   GGFGGISFSGNMDIALALRTIVFPTSFRYDTMYSYKDVNKRREWVAHLQAGAGIVADSDP  421

Query  1808  DSEQKECENKVAGLSRAIDLAESAFV  1885
               EQ+ECENK A L+RAIDLAES+FV
Sbjct  422   ADEQRECENKAAALARAIDLAESSFV  447



>ref|XP_010412791.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
[Camelina sativa]
Length=501

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/501 (68%), Positives = 385/501 (77%), Gaps = 15/501 (3%)
 Frame = +2

Query  107   VNNLPKMQAIANCQRLLPPS-HLISELPITSIVSRRSSGYAPSLRVRTLQLKCSSSLQIP  283
             ++ L  MQ+ A   R L PS H +S     + +++R S  +    V    +KC S L  P
Sbjct  1     MHALGMMQSPAGFHRRLSPSSHRLSPPSPVTFITKRCSSSSSISFV--TPIKCGSILSCP  58

Query  284   VTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFL  463
                   SP S   E  KF   +K  NL+PL   IFSDHLTPVLAYRCLV EDD+ETPSFL
Sbjct  59    ------SPSS---EAMKF---AKKENLVPLRHTIFSDHLTPVLAYRCLVKEDDQETPSFL  106

Query  464   FESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSIS  643
             FESVEPG  SSTVGRYSVVGA P MEI+AKENKVT++DH  G LT + VEDPM + R IS
Sbjct  107   FESVEPGHHSSTVGRYSVVGAHPKMEIVAKENKVTVMDHVKGTLTTEEVEDPMMIPRRIS  166

Query  644   EEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVI  823
             E WKPQL  DLPDAFCGGWVGYFSYDTVRY EK+KLPF+ AP DDRNLPD+HLGLYD+VI
Sbjct  167   ETWKPQLIDDLPDAFCGGWVGYFSYDTVRYAEKRKLPFSKAPVDDRNLPDMHLGLYDDVI  226

Query  824   VFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTRE  1003
             VFDHV+KK  IIHWVRL    S    Y  G K LE LVS+++ ++PP+L   SVD +T +
Sbjct  227   VFDHVEKKMHIIHWVRLSGNCSFDDVYANGVKHLEELVSRIKCINPPKLPYGSVDLHTNQ  286

Query  1004  FGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNP  1183
             FG  L K +MTS EYKNAVL+AKEHILAGDIFQIVLSQRFERRT A PFEVYRALRIVNP
Sbjct  287   FGTPLEKSSMTSDEYKNAVLEAKEHILAGDIFQIVLSQRFERRTFAHPFEVYRALRIVNP  346

Query  1184  SPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEK  1363
             SP M Y+QARGCILVASSPEILTRVKKN++VNRPLAGTA+RGKT EED MLE  LL DEK
Sbjct  347   SPSMCYLQARGCILVASSPEILTRVKKNKIVNRPLAGTARRGKTFEEDQMLEETLLKDEK  406

Query  1364  ERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDAL  1543
             + AEH MLVDLGRNDVGKVSK+GSV VER MNIERYSHVMHISSTVTGEL ++LTCWD L
Sbjct  407   QCAEHIMLVDLGRNDVGKVSKNGSVKVERFMNIERYSHVMHISSTVTGELQENLTCWDTL  466

Query  1544  RAALPVGTVSGAPKVKAMELI  1606
             RAALPVGTVSGAPK   + +I
Sbjct  467   RAALPVGTVSGAPKAYKLLII  487



>ref|XP_007016134.1| Anthranilate synthase component I-2 isoform 3 [Theobroma cacao]
 gb|EOY33753.1| Anthranilate synthase component I-2 isoform 3 [Theobroma cacao]
Length=465

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/463 (68%), Positives = 363/463 (78%), Gaps = 19/463 (4%)
 Frame = +2

Query  149   RLLPPSHLISELPITSIVSRRSSGYAPSLR--------VRTLQLKCSSSLQIPVTRSPYS  304
             R LP + L     ++   + R SGY             +RTL  KCS+           S
Sbjct  14    RQLPSTPLCPSTTVSVNFNARLSGYRSRSLLLLSSTSRIRTL--KCSAL---------SS  62

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
             P SL  +  KF EASK  NL+PL +CIFSDHLTPV+AYRCLV EDDR+ PSFLFESVEPG
Sbjct  63    PSSLVDQSVKFREASKNGNLVPLFRCIFSDHLTPVIAYRCLVKEDDRDAPSFLFESVEPG  122

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
              ++S++GRYSVVGAQP++EI+AK N VTIL+H+ G  TE++VEDPM V R I E W+PQ 
Sbjct  123   WQTSSIGRYSVVGAQPSIEIVAKGNMVTILNHEEGCRTEEIVEDPMIVPRRIMEGWEPQR  182

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               +LP+ FCGGWVGYFSYDTVRYVEKKKLPF+SAP DDRNLPD+HLGLY +VIVFDHV+K
Sbjct  183   IDELPEVFCGGWVGYFSYDTVRYVEKKKLPFSSAPLDDRNLPDVHLGLYGDVIVFDHVEK  242

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             KAF+IHWVRLD YSS  +AY +G K+LE+LVS+V D+DPP+L + ++   TR FGP L  
Sbjct  243   KAFVIHWVRLDQYSSVDEAYNDGMKRLESLVSRVHDIDPPKLPAGAIKLYTRLFGPKLEI  302

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
              +MTS  YK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+
Sbjct  303   SSMTSEAYKEAVLQAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYL  362

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEILTRVKK +V NRPLAGT +RGKTP+ED+MLE  LL DEKE AEH M
Sbjct  363   QARGCILVASSPEILTRVKKGKVTNRPLAGTIRRGKTPKEDLMLEKELLADEKECAEHIM  422

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGEL  1513
             LVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTV   L
Sbjct  423   LVDLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTVCSPL  465



>ref|XP_007016133.1| Anthranilate synthase component I-2 isoform 2 [Theobroma cacao]
 ref|XP_007016136.1| Anthranilate synthase component I-2 isoform 2 [Theobroma cacao]
 gb|EOY33752.1| Anthranilate synthase component I-2 isoform 2 [Theobroma cacao]
 gb|EOY33755.1| Anthranilate synthase component I-2 isoform 2 [Theobroma cacao]
Length=471

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/459 (68%), Positives = 362/459 (79%), Gaps = 19/459 (4%)
 Frame = +2

Query  149   RLLPPSHLISELPITSIVSRRSSGYAPSLR--------VRTLQLKCSSSLQIPVTRSPYS  304
             R LP + L     ++   + R SGY             +RTL  KCS+           S
Sbjct  14    RQLPSTPLCPSTTVSVNFNARLSGYRSRSLLLLSSTSRIRTL--KCSAL---------SS  62

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
             P SL  +  KF EASK  NL+PL +CIFSDHLTPV+AYRCLV EDDR+ PSFLFESVEPG
Sbjct  63    PSSLVDQSVKFREASKNGNLVPLFRCIFSDHLTPVIAYRCLVKEDDRDAPSFLFESVEPG  122

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
              ++S++GRYSVVGAQP++EI+AK N VTIL+H+ G  TE++VEDPM V R I E W+PQ 
Sbjct  123   WQTSSIGRYSVVGAQPSIEIVAKGNMVTILNHEEGCRTEEIVEDPMIVPRRIMEGWEPQR  182

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               +LP+ FCGGWVGYFSYDTVRYVEKKKLPF+SAP DDRNLPD+HLGLY +VIVFDHV+K
Sbjct  183   IDELPEVFCGGWVGYFSYDTVRYVEKKKLPFSSAPLDDRNLPDVHLGLYGDVIVFDHVEK  242

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             KAF+IHWVRLD YSS  +AY +G K+LE+LVS+V D+DPP+L + ++   TR FGP L  
Sbjct  243   KAFVIHWVRLDQYSSVDEAYNDGMKRLESLVSRVHDIDPPKLPAGAIKLYTRLFGPKLEI  302

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
              +MTS  YK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+
Sbjct  303   SSMTSEAYKEAVLQAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYL  362

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEILTRVKK +V NRPLAGT +RGKTP+ED+MLE  LL DEKE AEH M
Sbjct  363   QARGCILVASSPEILTRVKKGKVTNRPLAGTIRRGKTPKEDLMLEKELLADEKECAEHIM  422

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTV  1501
             LVDLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTV
Sbjct  423   LVDLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTV  461



>gb|EYU41273.1| hypothetical protein MIMGU_mgv1a005722mg [Erythranthe guttata]
Length=473

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/445 (68%), Positives = 348/445 (78%), Gaps = 25/445 (6%)
 Frame = +2

Query  80    SHTHKERLAVN--NLPKMQAIANCQRLLPPSHLISELPITSIVSRRSSGYAPSLRVRTLQ  253
             +HT  E   V+  N  +MQA+    R  P           ++     SG++   R+ T+Q
Sbjct  45    THTLTESKTVSRVNAMQMQALTFSHRTFP-----------TVSPASVSGFSGRNRINTIQ  93

Query  254   LKCSSSLQIPVTRSPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVD  433
              + S S            PSL  +E +FIEAS+  NLIPL+KCIFSDHLTPVLAYRCLV 
Sbjct  94    CRASES------------PSLVVDEKRFIEASEKGNLIPLYKCIFSDHLTPVLAYRCLVK  141

Query  434   EDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVE  613
             EDDRE PSFLFESVEPG RSS VGRYSVVGAQP +EI+AKENKVTILDH SGK+ EK V+
Sbjct  142   EDDREAPSFLFESVEPGFRSSCVGRYSVVGAQPAVEIVAKENKVTILDHGSGKIIEKFVD  201

Query  614   DPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPD  793
             DPMT+ RSISE W+PQL  DLP+AFCGGWVG+FSYDTVRYVEKKKLPF+SAP DDRNLPD
Sbjct  202   DPMTIPRSISEGWRPQLIQDLPEAFCGGWVGFFSYDTVRYVEKKKLPFSSAPIDDRNLPD  261

Query  794   IHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLS  973
             IHLGLYD+VI+FD VDKKA++IHWVRLD Y SA KAY +G  +LE LVSKVQD++PPRLS
Sbjct  262   IHLGLYDDVIIFDQVDKKAYVIHWVRLDEYPSAKKAYEDGINRLETLVSKVQDIEPPRLS  321

Query  974   SASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFE  1153
                +DF T +FG SL + +MT  EY  AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE
Sbjct  322   PGYIDFCTSDFGRSLDESSMTREEYMKAVLQAKEHILAGDIFQIVLSQRFERRTFADPFE  381

Query  1154  VYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVM  1333
             VYRALR+VNPSPYM+Y+QARGCI+VASSPEILTR+ K ++VNRPLAGTA+RGKT  ED M
Sbjct  382   VYRALRVVNPSPYMSYLQARGCIMVASSPEILTRLNKKKIVNRPLAGTARRGKTVHEDEM  441

Query  1334  LEMLLLNDEKERAEHTMLVDLGRND  1408
             LE+ LL DEK+ AEHTMLVDLGRND
Sbjct  442   LEINLLKDEKQCAEHTMLVDLGRND  466



>ref|XP_006379042.1| hypothetical protein POPTR_0009s04890g [Populus trichocarpa]
 gb|ERP56839.1| hypothetical protein POPTR_0009s04890g [Populus trichocarpa]
Length=463

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/397 (74%), Positives = 340/397 (86%), Gaps = 0/397 (0%)
 Frame = +2

Query  311   SLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSR  490
             S D + A+F EASK  NLIPL++ IFSDHLTPVLAYRCLV EDDR+ PSFLFESVEPG  
Sbjct  60    SGDNQVARFQEASKNGNLIPLYRYIFSDHLTPVLAYRCLVREDDRDAPSFLFESVEPGLD  119

Query  491   SSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTA  670
             +ST+GRYSVVGAQP MEI+AKEN VTI+DH  G+  E++VEDPM V R I E W+PQL  
Sbjct  120   ASTIGRYSVVGAQPRMEIVAKENMVTIMDHYEGRRMEEIVEDPMEVPRKIMEGWEPQLID  179

Query  671   DLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKA  850
             +LP+AFCGGWVGYFSYDTVRYVEKKKLPF+ AP DDRNLPD+HLGLYD+VIVFDHV+KKA
Sbjct  180   ELPEAFCGGWVGYFSYDTVRYVEKKKLPFSGAPPDDRNLPDVHLGLYDDVIVFDHVEKKA  239

Query  851   FIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGN  1030
              +IHWV+LD +SS  +AY +G  +LE ++S+V D+ PPRL + S+   TR FGP L   +
Sbjct  240   CVIHWVQLDRFSSVKEAYEDGMNRLENILSRVHDIAPPRLPAGSIKLFTRLFGPKLENSS  299

Query  1031  MTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQA  1210
             MTS EYK+AVL+AK+HILAGDIFQIVLSQRFERRT ADPFE+YRALR+VNPSPYMTY+QA
Sbjct  300   MTSEEYKDAVLQAKDHILAGDIFQIVLSQRFERRTFADPFEIYRALRVVNPSPYMTYLQA  359

Query  1211  RGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLV  1390
             RGCILVASSPEILTRVKK ++ NRPLAGT +RGKTP+ED+MLE  LLNDEK+ AEH MLV
Sbjct  360   RGCILVASSPEILTRVKKEKITNRPLAGTVRRGKTPKEDLMLEKELLNDEKQCAEHIMLV  419

Query  1391  DLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTV  1501
             DLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTV
Sbjct  420   DLGRNDVGKVSKPGSVKVEKLMNIERYSHVMHISSTV  456



>ref|XP_005845858.1| hypothetical protein CHLNCDRAFT_25481 [Chlorella variabilis]
 gb|EFN53756.1| hypothetical protein CHLNCDRAFT_25481 [Chlorella variabilis]
Length=526

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/521 (60%), Positives = 378/521 (73%), Gaps = 16/521 (3%)
 Frame = +2

Query  356   SNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPT  535
              NL+PL++ + +D LTPVLAYRCLV EDDRE PSFLFESV  GS+    GRYS VGA P 
Sbjct  3     GNLVPLYERVMADQLTPVLAYRCLVKEDDREAPSFLFESVTNGSQQ---GRYSFVGATPA  59

Query  536   MEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFS  715
             +E++A+  +V ++DH  G    + V DPM VA  +S  W+P  +  LP  F GGWVGY  
Sbjct  60    LEVVARGQQVHVMDHRRGTRDSQTVADPMQVAIDLSSHWRPVRSDGLPFVFTGGWVGYTG  119

Query  716   YDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSAS  895
             YDTVRYV   KLPF  AP+DDR L DIHL LY++V+VFDH  K A++I WV L  Y S  
Sbjct  120   YDTVRYVYSGKLPFEEAPEDDRGLADIHLALYNDVVVFDHATKLAYVISWVHLGDYGSVE  179

Query  896   KAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKE  1075
             +AY  GK++L A  +K+ + + P+L +  V  +  +  P  A  NM+  E+  AV   KE
Sbjct  180   EAYLAGKRRLAATAAKIANQNAPQLLNGKVSLSLSQR-PRTATSNMSKEEFLGAVEATKE  238

Query  1076  HILAGDIFQIVLSQRFERRTTADPFEVYR-----ALRIVNPSPYMTYMQARGCILVASSP  1240
             +I AGDIFQ+VLSQRFERRT ADPFE+YR     +LR+VNPSPYM Y+QARGCI+VASSP
Sbjct  239   YIQAGDIFQLVLSQRFERRTFADPFEIYRRGWAGSLRVVNPSPYMAYLQARGCIVVASSP  298

Query  1241  EILTRVKKN-RVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgk  1417
             EIL RV ++  V NRPLAGT +RGKTP++D  LE  LL DEKE AEH MLVDLGRNDVGK
Sbjct  299   EILCRVGEDGTVTNRPLAGTRRRGKTPQQDAELEADLLADEKECAEHVMLVDLGRNDVGK  358

Query  1418  vsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAM  1597
             VS++GSV VE+LM +ERYSHVMHISSTVTG L   LT WDALRAALP GTVSGAPKV+AM
Sbjct  359   VSQAGSVKVEKLMEVERYSHVMHISSTVTGSLSPGLTSWDALRAALPAGTVSGAPKVRAM  418

Query  1598  ELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSR-----RKEWI  1762
             ++ID+LE  RRGPY GG G +SF G MD+ALALRT+V +    +DTL S      R+EW+
Sbjct  419   QIIDELEVNRRGPYGGGIGHVSFTGGMDMALALRTMV-IPTAHHDTLYSYGGSKPRREWV  477

Query  1763  AHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
              HLQ+GAG+VADS P+SE +E  NK A L RAIDLAE AFV
Sbjct  478   VHLQAGAGLVADSVPESEWEETVNKSAALGRAIDLAEQAFV  518



>ref|XP_001418632.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO96925.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=526

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/526 (59%), Positives = 376/526 (71%), Gaps = 9/526 (2%)
 Frame = +2

Query  317   DKEEAKFIEA-SKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRS  493
             + + A F  A S  +N++PL++ IF D LTP+LAYR LV ED+RE PSFL ESV  G++ 
Sbjct  4     ETQRAAFDRALSLGNNVVPLYRRIFDDQLTPILAYRLLVKEDEREAPSFLLESVVGGTQ-  62

Query  494   STVGRYSVVGAQPTMEILAKENKVTILDHDSG-KLTEKVVE-DPMTVARSISEEWKPQLT  667
               +GRYS +G +P ME+ AK+ +VT+  H+ G   +E   E DPM V + I E W+   T
Sbjct  63    --IGRYSFLGRRPVMEVTAKDYEVTVTRHEGGGAASETTTERDPMEVMKRIGESWRACKT  120

Query  668   ADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKK  847
               LPD F GGWVG+  YDTVRY  + KL F  AP+DDR+LPDIHLGLY +V+VFD+  K+
Sbjct  121   PGLPDCFAGGWVGFTGYDTVRYQYQSKLGFEGAPKDDRSLPDIHLGLYKDVVVFDNATKQ  180

Query  848   AFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKG  1027
              + +HWV +D YSSA +AY  G   L+A++  +Q    P +    V+    +        
Sbjct  181   LYAVHWVMVDEYSSADEAYTTGMDALDAMIDDLQPSKSPPMKQGYVNLELNQRPSEPKDS  240

Query  1028  NMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQ  1207
              MT  E+  AV   KEHI AGDIFQ+VLS RF+R+T+ DPFEVYRALR+VNPSPYM Y Q
Sbjct  241   TMTKDEFLGAVAATKEHIKAGDIFQLVLSHRFQRKTSVDPFEVYRALRVVNPSPYMIYYQ  300

Query  1208  ARGCILVASSPEILTRVKKNR-VVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
              R CILVASSPEIL RV K R VVNRPLAGT  RGKTPEED  LE+ LL DEKERAEH M
Sbjct  301   GRDCILVASSPEILCRVDKARTVVNRPLAGTRMRGKTPEEDEALEVDLLADEKERAEHVM  360

Query  1385  LVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVG  1564
             LVDLGRNDVG+VSK+G+V VE+LM IERYSHVMHISSTVTG L+D L  WD LRAALP G
Sbjct  361   LVDLGRNDVGRVSKAGTVKVEKLMEIERYSHVMHISSTVTGNLVDDLGPWDVLRAALPAG  420

Query  1565  TVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS  1744
             TVSGAPKV+AM++ID LE TRRGPY GG G + F G+MD+ALALRT+V       +T  S
Sbjct  421   TVSGAPKVRAMQIIDNLEVTRRGPYGGGIGYVGFTGEMDMALALRTMVVPTRQAKETNGS  480

Query  1745  RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
             R  EW+ HLQ+GAGIVADSNP+SE +E  NK A L RAIDLAESAF
Sbjct  481   R--EWMIHLQAGAGIVADSNPESEYQETVNKAAALGRAIDLAESAF  524



>ref|XP_005644806.1| anthranilate synthase component [Coccomyxa subellipsoidea C-169]
 gb|EIE20262.1| anthranilate synthase component [Coccomyxa subellipsoidea C-169]
Length=589

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/518 (59%), Positives = 380/518 (73%), Gaps = 12/518 (2%)
 Frame = +2

Query  356   SNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPT  535
              NL+PL + IF+D LTPV AYRCLV EDDRE PSFLFESV  G+++   GRYS VGAQP 
Sbjct  71    GNLVPLFERIFADQLTPVTAYRCLVAEDDREAPSFLFESVVNGTQT---GRYSFVGAQPA  127

Query  536   MEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFS  715
             ME++A+ + VT++DH S + + ++ +DPM VA  +S +W+P  T  LP  F GGWVGY  
Sbjct  128   MEVVARGHSVTVIDHASQQRSTRIEDDPMEVAVRLSADWRPVPTDGLPAVFTGGWVGYCG  187

Query  716   YDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSAS  895
             YDTVRYV   KLPF SAP+D+  L D+HL LY+N+IVFDH  K A+ + WV + +++   
Sbjct  188   YDTVRYVYSGKLPFESAPKDEDGLLDLHLALYNNIIVFDHATKLAYCVAWVHMGAHAGVP  247

Query  896   KAYREGKKQLEALVSKVQDVDPPRLSSASVDFN-TREFGPSLAKGNMTSGEYKNAVLKAK  1072
             +AY  GK+ L A+  ++  +  P L       + TR+  P  A  NM+  +Y   V + K
Sbjct  248   EAYLAGKRALAAMTDRISPLRTPNLPLGKATLSLTRQPKPP-ATSNMSREQYIACVDEVK  306

Query  1073  EHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILT  1252
             EHI AGDIFQ+VLS RF+RRT ADPFEVYRALR+VNPSPYM Y+QARGCILVASSPEIL 
Sbjct  307   EHIQAGDIFQLVLSHRFKRRTFADPFEVYRALRVVNPSPYMIYLQARGCILVASSPEILC  366

Query  1253  RVKKNRVV-NRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsks  1429
              V ++RVV NRPLAGT +RGKTP+ED  LE  LL+DEKE AEH MLVDLGRNDVGKVS++
Sbjct  367   HVSEDRVVTNRPLAGTRRRGKTPDEDEALEGELLSDEKECAEHVMLVDLGRNDVGKVSEA  426

Query  1430  gsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELID  1609
             GSV VE+LM +ERYSHVMHISSTVTG L   L  WDALRAALP GTVSGAPKV+AM++ID
Sbjct  427   GSVRVEKLMEVERYSHVMHISSTVTGHLQPQLNAWDALRAALPAGTVSGAPKVRAMQIID  486

Query  1610  QLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL-----SSRRKEWIAHLQ  1774
             +LE  +RGPY GG G +SF G MD+ALALRT+V +     DTL        R+EW+ H+Q
Sbjct  487   ELECAKRGPYGGGIGHVSFTGGMDMALALRTMV-IPTAATDTLYDYGVDKSRREWVIHVQ  545

Query  1775  SGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             +GAG+VADS P +E +E  NK AGL RAIDLAE AF++
Sbjct  546   AGAGLVADSVPAAEYEETVNKAAGLGRAIDLAEQAFLQ  583



>ref|XP_008385064.1| PREDICTED: LOW QUALITY PROTEIN: anthranilate synthase alpha subunit 
1, chloroplastic-like [Malus domestica]
Length=761

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/406 (76%), Positives = 345/406 (85%), Gaps = 5/406 (1%)
 Frame = +2

Query  683   AFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIH  862
             +  GGWVGYFSYDTVRYVEKKKLPF SAP DDRNLPD+HLGLYD+VIVFDHVDKKA +IH
Sbjct  354   SLGGGWVGYFSYDTVRYVEKKKLPFPSAPPDDRNLPDVHLGLYDDVIVFDHVDKKAHVIH  413

Query  863   WVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSG  1042
             WV+LD YSS  +A+ +G  +LE L+S+V D+  PRL + S++FNT+ FG  L   ++TS 
Sbjct  414   WVQLDQYSSVDEAFNDGINRLETLLSRVHDIITPRLPAGSIEFNTQLFGTKLEDSSLTSE  473

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
             EYK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+QARGCI
Sbjct  474   EYKEAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCI  533

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
             LVASSPEILTRVK   + NRPLAGT +RGKTP+ED+MLE  LLNDEK+ AEH MLVDLGR
Sbjct  534   LVASSPEILTRVKNKTITNRPLAGTVRRGKTPKEDLMLEKQLLNDEKQCAEHIMLVDLGR  593

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             NDVGKVSK GSV VE LMNIERYSHVMHISSTVTGELLD LT WD LR ALPVGTVSGAP
Sbjct  594   NDVGKVSKPGSVKVEELMNIERYSHVMHISSTVTGELLDDLTSWDVLRTALPVGTVSGAP  653

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----R  1747
             KVKAMELID+LE TRRGPY GGFGGISF G+MDIALALRTIVF      DT+ S     +
Sbjct  654   KVKAMELIDKLEVTRRGPYXGGFGGISFSGNMDIALALRTIVFPTSFRYDTMYSYKDANK  713

Query  1748  RKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             R+EW+AHLQ+GAGIVADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  714   RREWVAHLQAGAGIVADSDPADEQRECENKAAALARAIDLAESSFV  759



>ref|XP_002500014.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61272.1| predicted protein [Micromonas sp. RCC299]
Length=526

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/524 (59%), Positives = 373/524 (71%), Gaps = 14/524 (3%)
 Frame = +2

Query  344   ASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVG  523
             A++  NLIPL++ +F+D LTP+LAYRCLV ED+R+ PSFL ESV  G+++   GR+S +G
Sbjct  4     AAEGHNLIPLYRRLFNDQLTPILAYRCLVKEDERDAPSFLLESVVGGTQT---GRFSFLG  60

Query  524   AQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWV  703
             ++P ME++AKEN V+ILDH  G+ T     DP+TVA  ISE W P  T  LP+ F GGWV
Sbjct  61    SRPYMEVMAKENHVSILDHLKGERTRSDETDPITVAGKISERWNPCRTNGLPECFTGGWV  120

Query  704   GYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSY  883
             GY  YDTVRY    KLPF  AP DDR LPD+ LGLY +V+VFDH  K+ + +HWV    +
Sbjct  121   GYMGYDTVRYQYLNKLPFEEAPGDDRALPDLCLGLYRDVVVFDHATKQLYAVHWVDTTLH  180

Query  884   SS-ASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAV  1060
                A+ A  EG++ L+ALV  +Q    P L    V  +  +     A   M+  E+  AV
Sbjct  181   DGDAAAALTEGEESLDALVRALQPDSVPTLPFGEVSMSLTQPPTPPADSTMSKEEFLAAV  240

Query  1061  LKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSP  1240
                KEHI AGDIFQ+VLS RF+R T ADPF+VYRALR+VNPSPYM Y+QARG ILVASSP
Sbjct  241   ADTKEHIKAGDIFQLVLSHRFQRSTYADPFDVYRALRVVNPSPYMIYLQARGSILVASSP  300

Query  1241  EILTRVKKNR-VVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgk  1417
             EIL R  K R VVNRPLAGT  RGKT EEDV LE+ LL D+KE+AEH MLVDLGRNDVG+
Sbjct  301   EILCRTDKERTVVNRPLAGTRMRGKTEEEDVALEVDLLADKKEKAEHVMLVDLGRNDVGR  360

Query  1418  vsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAM  1597
             VSK+G+V VE+LM IERYSHVMHISSTVTG LLD L  WD LRAALP GTVSGAPKV+AM
Sbjct  361   VSKAGTVKVEKLMEIERYSHVMHISSTVTGSLLDELGPWDVLRAALPAGTVSGAPKVRAM  420

Query  1598  ELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLS---------SRR  1750
             ++ID LE TRRGPY GG G + F G+MD+ALALRT+V      ++              +
Sbjct  421   QIIDDLEVTRRGPYGGGIGYVGFTGEMDMALALRTMVVPTAHTDNIYKFSKEASEPPRAK  480

Query  1751  KEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
             +EW+ HLQ+GAGIVADSNP+SE +E  NK A L RAIDLAE AF
Sbjct  481   REWVIHLQAGAGIVADSNPESEYQETVNKAAALGRAIDLAEEAF  524



>ref|XP_003080205.1| anthranilate synthase alpha subunit (ISS) [Ostreococcus tauri]
Length=533

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/511 (60%), Positives = 369/511 (72%), Gaps = 9/511 (2%)
 Frame = +2

Query  359   NLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTM  538
             N++P+++ IF D LTP+LAYR LV EDDRE PSFL ESV  GS+   VGR+S +G +P M
Sbjct  26    NVVPVYRRIFDDQLTPILAYRLLVKEDDREAPSFLLESVVGGSQ---VGRFSFLGRRPVM  82

Query  539   EILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSY  718
             E+ AK+ +VT   H +G+       DPM V + IS EW+    + LP+ F GGWVG+  Y
Sbjct  83    EVTAKDYEVTTTHHGTGRSETTTETDPMEVMKRISAEWRACTMSGLPECFSGGWVGFTGY  142

Query  719   DTVRYVEKKKLPFA-SAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSAS  895
             DTVRY  K KL F  +AP+DDR+LPDIHLGLY +V+VFD+  K+ + +HWV  D Y++  
Sbjct  143   DTVRYQYKSKLDFGEAAPKDDRSLPDIHLGLYRDVVVFDNATKQLYAVHWVMTDEYANVD  202

Query  896   KAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK-GNMTSGEYKNAVLKAK  1072
             +AY +G   ++AL+  +Q    P L    V+    +  PS+ K   MT  E+  AV + K
Sbjct  203   EAYHKGMDAVDALIDDLQPSKSPTLKQGFVNLQLDQR-PSVPKDSTMTKDEFLGAVAQTK  261

Query  1073  EHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILT  1252
             EHI AGDIFQ+VLS RF+R+T ADPFEVYRALR+VNPSPYM Y Q R CILVASSPEIL 
Sbjct  262   EHIKAGDIFQLVLSHRFQRQTHADPFEVYRALRVVNPSPYMIYYQGRDCILVASSPEILC  321

Query  1253  RVKKNR-VVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsks  1429
             RV K R VVNRPLAGT  RGKT EED  LE  LL D+KE AEH MLVDLGRNDVG+VSK+
Sbjct  322   RVNKERTVVNRPLAGTRMRGKTQEEDEALEADLLADQKECAEHVMLVDLGRNDVGRVSKA  381

Query  1430  gsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELID  1609
             G+V VE+LM IERYSHVMHISSTVTG L+D+L  WD LRAALP GTVSGAPKV+AM++ID
Sbjct  382   GTVKVEKLMEIERYSHVMHISSTVTGSLVDNLGPWDVLRAALPAGTVSGAPKVRAMQIID  441

Query  1610  QLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSRRKEWIAHLQSGAGI  1789
              LE TRRGPY GG G + F G+MD+ALALRT+V       D   SR  EW+ HLQ+GAGI
Sbjct  442   DLEVTRRGPYGGGIGYVGFTGEMDMALALRTMVVPTRQAKDVNGSR--EWMIHLQAGAGI  499

Query  1790  VADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
             VADSNP+SE +E  NK A L RAIDLAESAF
Sbjct  500   VADSNPESEYQETVNKAAALGRAIDLAESAF  530



>emb|CEF98618.1| Anthranilate synthase component I, PabB-like [Ostreococcus tauri]
Length=527

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/511 (60%), Positives = 369/511 (72%), Gaps = 9/511 (2%)
 Frame = +2

Query  359   NLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTM  538
             N++P+++ IF D LTP+LAYR LV EDDRE PSFL ESV  GS+   VGR+S +G +P M
Sbjct  20    NVVPVYRRIFDDQLTPILAYRLLVKEDDREAPSFLLESVVGGSQ---VGRFSFLGRRPVM  76

Query  539   EILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSY  718
             E+ AK+ +VT   H +G+       DPM V + IS EW+    + LP+ F GGWVG+  Y
Sbjct  77    EVTAKDYEVTTTHHGTGRSETTTETDPMEVMKRISAEWRACTMSGLPECFSGGWVGFTGY  136

Query  719   DTVRYVEKKKLPFA-SAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSAS  895
             DTVRY  K KL F  +AP+DDR+LPDIHLGLY +V+VFD+  K+ + +HWV  D Y++  
Sbjct  137   DTVRYQYKSKLDFGEAAPKDDRSLPDIHLGLYRDVVVFDNATKQLYAVHWVMTDEYANVD  196

Query  896   KAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK-GNMTSGEYKNAVLKAK  1072
             +AY +G   ++AL+  +Q    P L    V+    +  PS+ K   MT  E+  AV + K
Sbjct  197   EAYHKGMDAVDALIDDLQPSKSPTLKQGFVNLQLDQR-PSVPKDSTMTKDEFLGAVAQTK  255

Query  1073  EHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILT  1252
             EHI AGDIFQ+VLS RF+R+T ADPFEVYRALR+VNPSPYM Y Q R CILVASSPEIL 
Sbjct  256   EHIKAGDIFQLVLSHRFQRQTHADPFEVYRALRVVNPSPYMIYYQGRDCILVASSPEILC  315

Query  1253  RVKKNR-VVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsks  1429
             RV K R VVNRPLAGT  RGKT EED  LE  LL D+KE AEH MLVDLGRNDVG+VSK+
Sbjct  316   RVNKERTVVNRPLAGTRMRGKTQEEDEALEADLLADQKECAEHVMLVDLGRNDVGRVSKA  375

Query  1430  gsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELID  1609
             G+V VE+LM IERYSHVMHISSTVTG L+D+L  WD LRAALP GTVSGAPKV+AM++ID
Sbjct  376   GTVKVEKLMEIERYSHVMHISSTVTGSLVDNLGPWDVLRAALPAGTVSGAPKVRAMQIID  435

Query  1610  QLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSRRKEWIAHLQSGAGI  1789
              LE TRRGPY GG G + F G+MD+ALALRT+V       D   SR  EW+ HLQ+GAGI
Sbjct  436   DLEVTRRGPYGGGIGYVGFTGEMDMALALRTMVVPTRQAKDVNGSR--EWMIHLQAGAGI  493

Query  1790  VADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
             VADSNP+SE +E  NK A L RAIDLAESAF
Sbjct  494   VADSNPESEYQETVNKAAALGRAIDLAESAF  524



>ref|XP_007016137.1| Anthranilate synthase component I-2 isoform 6 [Theobroma cacao]
 gb|EOY33756.1| Anthranilate synthase component I-2 isoform 6 [Theobroma cacao]
Length=515

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/427 (67%), Positives = 332/427 (78%), Gaps = 19/427 (4%)
 Frame = +2

Query  149   RLLPPSHLISELPITSIVSRRSSGYAPSLR--------VRTLQLKCSSSLQIPVTRSPYS  304
             R LP + L     ++   + R SGY             +RTL  KCS+           S
Sbjct  14    RQLPSTPLCPSTTVSVNFNARLSGYRSRSLLLLSSTSRIRTL--KCSAL---------SS  62

Query  305   PPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPG  484
             P SL  +  KF EASK  NL+PL +CIFSDHLTPV+AYRCLV EDDR+ PSFLFESVEPG
Sbjct  63    PSSLVDQSVKFREASKNGNLVPLFRCIFSDHLTPVIAYRCLVKEDDRDAPSFLFESVEPG  122

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
              ++S++GRYSVVGAQP++EI+AK N VTIL+H+ G  TE++VEDPM V R I E W+PQ 
Sbjct  123   WQTSSIGRYSVVGAQPSIEIVAKGNMVTILNHEEGCRTEEIVEDPMIVPRRIMEGWEPQR  182

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               +LP+ FCGGWVGYFSYDTVRYVEKKKLPF+SAP DDRNLPD+HLGLY +VIVFDHV+K
Sbjct  183   IDELPEVFCGGWVGYFSYDTVRYVEKKKLPFSSAPLDDRNLPDVHLGLYGDVIVFDHVEK  242

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             KAF+IHWVRLD YSS  +AY +G K+LE+LVS+V D+DPP+L + ++   TR FGP L  
Sbjct  243   KAFVIHWVRLDQYSSVDEAYNDGMKRLESLVSRVHDIDPPKLPAGAIKLYTRLFGPKLEI  302

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
              +MTS  YK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+
Sbjct  303   SSMTSEAYKEAVLQAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYL  362

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTM  1384
             QARGCILVASSPEILTRVKK +V NRPLAGT +RGKTP+ED+MLE  LL DEKE AEH M
Sbjct  363   QARGCILVASSPEILTRVKKGKVTNRPLAGTIRRGKTPKEDLMLEKELLADEKECAEHIM  422

Query  1385  LVDLGRN  1405
             LVDLGRN
Sbjct  423   LVDLGRN  429


 Score =   114 bits (284),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 5/84 (6%)
 Frame = +2

Query  1652  GGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSE  1816
             GGISF GDMD+ALALRTIVF +    DT+ S     +R+EW+AHLQ+GAGIVADS P  E
Sbjct  431   GGISFSGDMDVALALRTIVFPSTTRFDTMYSYKDVNKRREWVAHLQAGAGIVADSVPADE  490

Query  1817  QKECENKVAGLSRAIDLAESAFVK  1888
             Q+ECENK A L+RAIDLAES+FV+
Sbjct  491   QRECENKAAALARAIDLAESSFVE  514



>ref|XP_007514975.1| anthranilate synthase component I [Bathycoccus prasinos]
 emb|CCO15215.1| anthranilate synthase component I [Bathycoccus prasinos]
Length=628

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/523 (57%), Positives = 370/523 (71%), Gaps = 19/523 (4%)
 Frame = +2

Query  356   SNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPT  535
             +N++P+ + IF D LTP+LAYR LV +D RE PSFLFESV  G++   +GRYS +G +P 
Sbjct  115   ANVVPVFRRIFDDQLTPILAYRLLVKDDAREAPSFLFESVVGGTQ---IGRYSFLGRRPK  171

Query  536   MEILAKENKVTILDHDSGKLTEK--VVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGY  709
             +E+LA EN+V I++H   +  ++    EDPMTV   + E WKP    DLPDAF GGWVG+
Sbjct  172   VEVLASENRVRIMNHAKPEENKEDYFEEDPMTVMAKLGEHWKPAKHPDLPDAFAGGWVGF  231

Query  710   FSYDTVRYVEKKKLPFASA-PQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYS  886
               YDTVRY    KLPF +   QDDR+LPD+H+GLY+ VIVFDH  K+ + + WV L+ Y+
Sbjct  232   AGYDTVRYQYINKLPFDNVREQDDRDLPDVHMGLYEEVIVFDHATKQVYGVKWVMLEDYT  291

Query  887   S------ASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEY  1048
             S      A KAY EG K L+ L+ ++Q      +   SVD         +   NM+   +
Sbjct  292   SKDGTVDAEKAYSEGIKGLDDLMKELQPETMGTIPFGSVDMRLSGKPEPMKDSNMSKESF  351

Query  1049  KNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILV  1228
              +AV   KEHI AGDIFQ+VLS RFER+T  DPFEVYRALR+VNPSPYM Y Q + CIL+
Sbjct  352   LDAVATTKEHIKAGDIFQLVLSHRFERKTKVDPFEVYRALRVVNPSPYMIYYQGKDCILI  411

Query  1229  ASSPEILTRVKKNR-VVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRN  1405
             ASSPEIL RV  +R VVNRPLAGT  RGKT  ED+ LE  LL DEKERAEH MLVDLGRN
Sbjct  412   ASSPEILCRVDDSRTVVNRPLAGTRARGKTQAEDLALEEDLLADEKERAEHVMLVDLGRN  471

Query  1406  DvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPK  1585
             DVG+VS+ G+V VE+LM IERYSHVMHISSTVTG+L++ L  WD LRAALPVGTVSGAPK
Sbjct  472   DVGRVSQMGTVKVEKLMEIERYSHVMHISSTVTGKLIEDLNPWDVLRAALPVGTVSGAPK  531

Query  1586  VKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSRRKEWIA  1765
             V+AM++ID LE ++RGPY GG G + F G+MDIALALRT+V        T   +  EW  
Sbjct  532   VRAMQIIDDLEVSKRGPYGGGIGYVGFAGEMDIALALRTMVV------PTKQKKGDEWTI  585

Query  1766  HLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKTK  1894
             H+Q+GAGIVADSNP+SE +E  NK A L R+IDLAE AF+K K
Sbjct  586   HVQAGAGIVADSNPESEYQETVNKSAALGRSIDLAERAFLKKK  628



>gb|KFM26929.1| Anthranilate synthase component I-1, chloroplastic [Auxenochlorella 
protothecoides]
Length=560

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/574 (53%), Positives = 378/574 (66%), Gaps = 57/574 (10%)
 Frame = +2

Query  275   QIPVTRSPYSPPSLDK----------EEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRC  424
             Q+ +   P +PP L++          E ++F EA+K+ NL+PL++ +FSD LTPV AYRC
Sbjct  12    QVYIPTHPMAPPELERALEADLSFSPEFSRFREAAKSGNLVPLYERVFSDQLTPVSAYRC  71

Query  425   LVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEK  604
             LV  DDRE PSFLFESV  G++    GRYS VGA P++EI+A  N VT+LD+++G     
Sbjct  72    LVRADDREAPSFLFESVINGTQQ---GRYSFVGAHPSLEIVAHANAVTVLDNEAGTTRSF  128

Query  605   VVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRN  784
                DP+     +   W P +   LP  F GGWVGY  YDTVRYV   KLPF++AP DDR 
Sbjct  129   EAPDPLQAREWMCSPWSPVIPEGLPPVFTGGWVGYAGYDTVRYVYPAKLPFSAAPPDDRG  188

Query  785   LPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPP  964
             LPD+HL LY++VIVFDH  K A++I WV L +++S   A+  G+++L A  + ++  + P
Sbjct  189   LPDLHLALYNDVIVFDHATKLAYVIAWVHLGAHASPEAAFLAGRERLAATAAAIRSENAP  248

Query  965   RLSSASVDFNTREFGPSL--AKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTT  1138
              +  A V+ +  +  P+L  A  NMT  ++  AV + KEHI AGD+FQ+V SQRFERRT 
Sbjct  249   AMLGARVNMSLGQR-PALSAATSNMTKAQFMAAVERTKEHIQAGDVFQLVGSQRFERRTF  307

Query  1139  ADPFEVYR-----------------ALRIVNPSPYMTYMQARGCILVASSPEILTRVK-K  1264
             ADPFE+YR                 +LR+VNPSPYMTY+QARGCILVASSPEIL RV   
Sbjct  308   ADPFEIYRQGGSGGKVGWVDGGGRGSLRVVNPSPYMTYLQARGCILVASSPEILCRVGLD  367

Query  1265  NRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNV  1444
               V NRPLAGT  RG T E D  LE  LL DEKE AEH MLVDLGRNDVG+V++ GSV V
Sbjct  368   GTVTNRPLAGTRPRGATQEADEALEADLLADEKELAEHIMLVDLGRNDVGRVARHGSVKV  427

Query  1445  ERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEAT  1624
             E LM +ERYSHVMHISSTVTG L   L  WDALRAALPVGT+SGAPKV+AM++ID+LE T
Sbjct  428   EALMEVERYSHVMHISSTVTGRLRPGLNAWDALRAALPVGTISGAPKVRAMQIIDELEVT  487

Query  1625  RRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSRRKEWIAHLQSGAGIVADSN  1804
             RRGPY GG G +SF G +D+ALALRT+                       SGAG VADS+
Sbjct  488   RRGPYGGGLGHVSFAGGLDMALALRTM-----------------------SGAGFVADSD  524

Query  1805  PDSEQKECENKVAGLSRAIDLAESAFVKTKRKPQ  1906
             P+ E +E  NK AGL RAIDLAE AFV    + Q
Sbjct  525   PEKEWEETVNKAAGLGRAIDLAEQAFVGQAGREQ  558



>ref|XP_003057912.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57863.1| predicted protein [Micromonas pusilla CCMP1545]
Length=632

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/517 (58%), Positives = 367/517 (71%), Gaps = 12/517 (2%)
 Frame = +2

Query  359   NLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTM  538
             NL+PL++ IF D LTP+LAYRCLV ED+R+ PSFL ESV  G+++   GR+S +G++P +
Sbjct  116   NLVPLYRRIFDDQLTPILAYRCLVKEDERDAPSFLLESVVGGTQT---GRFSFLGSRPYL  172

Query  539   EILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSY  718
             E++AKE+   +LDH +G  T     DPM VA+ I+ +W P  T  LP+ F GGWVGY  Y
Sbjct  173   EVIAKESSCVVLDHHAGTKTRSTESDPMAVAQQIATKWHPTRTEGLPECFTGGWVGYTGY  232

Query  719   DTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASK  898
             DTVRY    KLPF  AP DDR LPD+ LGLY +V+VFDH  K+ + +HWV    +    +
Sbjct  233   DTVRYQYLNKLPFGDAPTDDRALPDLCLGLYRDVVVFDHATKQVYAVHWVDTTVFGGDVE  292

Query  899   AYRE-GKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKE  1075
             A  E G++ L  LV  +Q    P L    V  +            MT   + NAV + KE
Sbjct  293   ASLEDGERCLHDLVKALQPSSAPTLPFGEVSMSLTAPPTPPKDSTMTKEAFLNAVAETKE  352

Query  1076  HILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTR  1255
             HI+AGDIFQ+VLS RF+R T ADPFEVYRALR+VNPSPYM Y+QARG I+VASSPEIL R
Sbjct  353   HIVAGDIFQLVLSHRFQRSTFADPFEVYRALRVVNPSPYMIYLQARGSIIVASSPEILCR  412

Query  1256  VKKNR-VVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksg  1432
               K+R VVNRPLAGT  RGKT EED  LE+ LL DEKE+AEH MLVDLGRNDVG+VSK+G
Sbjct  413   TDKHRTVVNRPLAGTRMRGKTKEEDDALELDLLADEKEKAEHVMLVDLGRNDVGRVSKAG  472

Query  1433  svNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQ  1612
             +V VE+LM IERYSHVMHISSTVTG LL+ L  WD L+AALPVGTVSGAPKV+AM++ID+
Sbjct  473   TVKVEKLMEIERYSHVMHISSTVTGSLLEDLGPWDVLKAALPVGTVSGAPKVRAMQIIDE  532

Query  1613  LEATRRGPYSGGFGGISFVGDMDIALALRTIVF-------LNDGMNDTLSSRRKEWIAHL  1771
             LE TRRGPY GG G + F+G+MD+ALALRT+V        L +  N      R+EW  HL
Sbjct  533   LETTRRGPYGGGVGYVGFMGEMDMALALRTMVIPTEHKENLYEFRNGIEGKSRREWTIHL  592

Query  1772  QSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
             Q+GAGIVADSNP+SE +E  NK A L RAIDLAE AF
Sbjct  593   QAGAGIVADSNPESEYQETVNKAAALGRAIDLAEEAF  629



>ref|XP_010685581.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=557

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/540 (52%), Positives = 357/540 (66%), Gaps = 40/540 (7%)
 Frame = +2

Query  293   SPYSPPSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFES  472
             S  S PS   +   F+E SK  NL+PL +CIFSDHLTPVLAYRCLV+E+D E PSFLFES
Sbjct  49    SVLSSPSQVNQSENFVEKSKKGNLVPLSQCIFSDHLTPVLAYRCLVNENDHEAPSFLFES  108

Query  473   VEPGSRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEW  652
             VE G  ++ VGRYS+VGA P MEI+AKEN VT ++H  G   E++ EDP+ + + I+++W
Sbjct  109   VETGLHTANVGRYSIVGANPAMEIIAKENLVTTINHREGWKREELSEDPLIIPQRITDKW  168

Query  653   KPQLTADLP-DAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVF  829
              PQ   +LP   FCGGWVGYFSYDT RY +  +L FASAP DDRNLPD+HLGLYD+V+VF
Sbjct  169   SPQCMDELPQQVFCGGWVGYFSYDTARYTD-TRLTFASAPADDRNLPDVHLGLYDDVLVF  227

Query  830   DHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFG  1009
             DHV+KK   IHWV+LD +SS   A   G K+L++L+SK+ ++  PRLSS S++ N +   
Sbjct  228   DHVEKKIHAIHWVQLDKFSSIEDALDNGTKRLDSLLSKIHNIVNPRLSSGSIELNAQRLR  287

Query  1010  PSLAKGNMTSGEYKNAVLKAKEHIL-AGDIFQIVLSQRFERRTTADPFEVYRALRIVNPS  1186
               L    MTS  YK A+LKAKE +L  GD  Q+VLSQRFERRT +DPFEVYR L +V P+
Sbjct  288   TQLEVSRMTSEAYKTAMLKAKEQMLTGGDTRQVVLSQRFERRTFSDPFEVYRVLSVVEPN  347

Query  1187  PYMTYMQARGCILVASSPEILTRV-KKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEK  1363
             P+M Y+Q RGCILVASSP ILT V K+ +  N+ L+GT +  +T  ED  L    +ND+K
Sbjct  348   PFMAYIQVRGCILVASSPHILTYVDKQGKFTNQTLSGTQRLSETYNEDAPLSKQFINDQK  407

Query  1364  ERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDAL  1543
                EH  + D   N   K             + + YS                 TCW+AL
Sbjct  408   HFGEHNRVADWVNNYTKK-------------STQEYS-----------------TCWEAL  437

Query  1544  RAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIA-LALRTIVFLND  1720
             R+ALP    +GAPK++AM+LID+LE  RRGPY G FG ISF  +MDIA LA +TIVF   
Sbjct  438   RSALPSEAFTGAPKIEAMQLIDKLELNRRGPYGGSFGCISFSKNMDIADLASKTIVFPTG  497

Query  1721  GMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
                DTL S     +R+EW+AHLQ+GA I  DS    EQ +CE + A ++RAIDLAES+F+
Sbjct  498   KAYDTLYSYKNLNKRREWVAHLQTGATIRVDSGHGDEQGQCERESAAVARAIDLAESSFL  557



>ref|XP_005537357.1| anthranilate synthase component I [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81321.1| anthranilate synthase component I [Cyanidioschyzon merolae strain 
10D]
Length=647

 Score =   520 bits (1340),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 277/516 (54%), Positives = 357/516 (69%), Gaps = 15/516 (3%)
 Frame = +2

Query  359   NLIPLHKCIFSDHLTPVLAYRCLV-DEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPT  535
              L+P+++ IF+D LTPV+AYR LV D      PSFLFESV  G +   +GR+S VG+ P 
Sbjct  118   TLLPVYRRIFADDLTPVMAYRRLVHDASGDPRPSFLFESVVGGDQ---IGRFSYVGSSPC  174

Query  536   MEILAKENKVTILDHDSGKLTEKV-VEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYF  712
             M+I+A +N + I+D  S  L  K+ V DP    R ++E+ K      +P+AFCGGWVG+ 
Sbjct  175   MQIIAYQNDIQIID-SSEHLQHKLHVPDPWVFMRQLTEQIKVAEKGPVPEAFCGGWVGFG  233

Query  713   SYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSA  892
              YDTVRY E KKLPF++AP+DDR LPD+H  LY  V++FD+V K  +I+ WV L+ + S 
Sbjct  234   GYDTVRYSEPKKLPFSAAPRDDRGLPDLHFALYQEVVIFDNVTKTVYIVVWVPLEDHRSI  293

Query  893   SKAYREGKKQLEALVS--KVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLK  1066
               A   G  + E LV      + D   L S+ V  +  E  P   + NMT  ++ +A+ +
Sbjct  294   EAARAHGWSRSEQLVRVLTCAERDHLLLPSSEVLLDPVE-KPEPMRSNMTKEQFFHALER  352

Query  1067  AKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEI  1246
               E+I  GD FQ V SQRFER T ADPF+VYRALRIVNPSPYM YM+AR CIL++SSPEI
Sbjct  353   ISEYIYLGDTFQTVFSQRFERDTFADPFQVYRALRIVNPSPYMLYMRARDCILISSSPEI  412

Query  1247  LTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsk  1426
             L + +  +V NRPLAGT  RG +PEED  LE  LL DEK+RAEH MLVDLGRNDVG++++
Sbjct  413   LCKTRGRKVWNRPLAGTRPRGSSPEEDARLEQELLADEKDRAEHVMLVDLGRNDVGRIAE  472

Query  1427  sgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELI  1606
              GSV VE+L  IERYSHVMHISSTVTG+L   L+CWDALRA LP GT+SGAPK+++M++I
Sbjct  473   LGSVQVEKLFEIERYSHVMHISSTVTGKLRAELSCWDALRATLPAGTISGAPKIRSMQII  532

Query  1607  DQLEATRRGPYSGGFGGISFVG-DMDIALALRTIVFLNDGMNDTLSSRRKEWIAHLQSGA  1783
             D+LE T+RGPY GG G +SF G +MD+ALALRT+V     +   + S    W  H+Q+GA
Sbjct  533   DELEPTKRGPYGGGIGYVSFDGNEMDVALALRTMV-----IPTAMRSSNGAWRVHIQAGA  587

Query  1784  GIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKT  1891
             GIV DSNP+SE  E  NK A L RAID+AE AFV++
Sbjct  588   GIVLDSNPESEYLETINKAAALGRAIDVAEHAFVQS  623



>gb|KDO66849.1| hypothetical protein CISIN_1g020099mg [Citrus sinensis]
 gb|KDO66850.1| hypothetical protein CISIN_1g020099mg [Citrus sinensis]
Length=331

 Score =   505 bits (1300),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 255/327 (78%), Positives = 283/327 (87%), Gaps = 5/327 (2%)
 Frame = +2

Query  920   QLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIF  1099
             +LE LV++V D+ PPRL   S+  +TR FGP L   +MTS  YK AVL+AKEHILAGDIF
Sbjct  3     RLENLVARVHDIVPPRLRKGSIKLHTRHFGPKLESSSMTSEAYKEAVLQAKEHILAGDIF  62

Query  1100  QIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVN  1279
             QIVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+QARGCILVASSPEILTRVKK ++ N
Sbjct  63    QIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCILVASSPEILTRVKKRKITN  122

Query  1280  RPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMN  1459
             RPLAGT +RGKTP+ED++ E  LLNDEK+ AEH MLVDLGRNDVGKVSKSGSV VE+LMN
Sbjct  123   RPLAGTVRRGKTPKEDLVFEKELLNDEKQCAEHIMLVDLGRNDVGKVSKSGSVKVEKLMN  182

Query  1460  IERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPY  1639
             IE YSHVMHISSTVTGELLDHLT WDALRAALPVGTVSGAPKVKAMELID+LE TRRGPY
Sbjct  183   IEHYSHVMHISSTVTGELLDHLTSWDALRAALPVGTVSGAPKVKAMELIDELEVTRRGPY  242

Query  1640  SGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSN  1804
             SGGFGGISF GDMDIALALRTIVF      DT+ S     +R+EWIAHLQ+GAGIVADS+
Sbjct  243   SGGFGGISFTGDMDIALALRTIVFPTATRYDTMYSYKDVDKRREWIAHLQAGAGIVADSD  302

Query  1805  PDSEQKECENKVAGLSRAIDLAESAFV  1885
             P+ EQKECENK AG++RAIDLAES+FV
Sbjct  303   PNDEQKECENKAAGIARAIDLAESSFV  329



>ref|XP_008349576.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
[Malus domestica]
Length=339

 Score =   500 bits (1287),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 235/314 (75%), Positives = 267/314 (85%), Gaps = 0/314 (0%)
 Frame = +2

Query  323   EEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTV  502
             E  KF+EASK  NLIPL + IFSDHLTPVLAYRCLV EDDR+ PSFLFESVEPGS  S V
Sbjct  15    ESEKFVEASKKGNLIPLSRSIFSDHLTPVLAYRCLVKEDDRDAPSFLFESVEPGSNDSNV  74

Query  503   GRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPD  682
             GRYSV+GAQP++EI+AKEN VTI+DH  G  TE++VEDPMTV R I E W PQL  +LP+
Sbjct  75    GRYSVIGAQPSIEIVAKENMVTIMDHREGCRTEEIVEDPMTVPRRIMEGWTPQLLDELPE  134

Query  683   AFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIH  862
             AFCGGWVGYFSYDTVRYVEKKKLPF SAP DDRNLPD+HLGLYD+VIVFDHVDKKA +IH
Sbjct  135   AFCGGWVGYFSYDTVRYVEKKKLPFPSAPPDDRNLPDVHLGLYDDVIVFDHVDKKAHVIH  194

Query  863   WVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSG  1042
             WV+LD YSS  +A+ +G  +LE L+S+V D+  PRL + S++FNT+ FG  L   ++TS 
Sbjct  195   WVQLDQYSSVDEAFNDGINRLETLLSRVHDIITPRLPAGSIEFNTQLFGTKLEDSSLTSE  254

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
             EYK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+QARGCI
Sbjct  255   EYKEAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGCI  314

Query  1223  LVASSPEILTRVKK  1264
             LVASSPEILTRVKK
Sbjct  315   LVASSPEILTRVKK  328



>gb|KHN37366.1| Anthranilate synthase component I-2, chloroplastic [Glycine soja]
Length=368

 Score =   498 bits (1281),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 260/392 (66%), Positives = 302/392 (77%), Gaps = 31/392 (8%)
 Frame = +2

Query  725   VRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAY  904
             +RYVEKKKLPF++AP DDRN PD+HLGLYD+VIVFDHV+KKA++IHWVR+D YSSA +A+
Sbjct  1     MRYVEKKKLPFSNAPADDRNPPDVHLGLYDSVIVFDHVEKKAYVIHWVRVDRYSSAEEAF  60

Query  905   REGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHIL  1084
             ++GK +LE+LVS       P L + S+   TR FGP L   NMT+ EYK AVL+AKEH+L
Sbjct  61    KDGKNRLESLVSL-----GPWLPAGSIKLYTRLFGPKLEMSNMTNEEYKRAVLQAKEHVL  115

Query  1085  AGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKK  1264
             AGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+QARG ILVASSPEILTR+KK
Sbjct  116   AGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYLQARGSILVASSPEILTRLKK  175

Query  1265  NRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNV  1444
              ++ NRPLAGT +R KTP+ED+MLE  LLNDEK+ AEH MLVDLGRNDVGKVSK  SV V
Sbjct  176   RKITNRPLAGTVRREKTPKEDIMLEKELLNDEKQCAEHVMLVDLGRNDVGKVSKPASVQV  235

Query  1445  ERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEAT  1624
             E+LMNIE  SHVMHISSTVTGELLD+LT WDALRAALPV     +     +         
Sbjct  236   EKLMNIEHCSHVMHISSTVTGELLDNLTSWDALRAALPVVGGPYSGGFGGL---------  286

Query  1625  RRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL-----SSRRKEWIAHLQSGAGI  1789
                         SF GDMDIALALRTIVF  +   DT        +R+EW+AHLQ+GAGI
Sbjct  287   ------------SFNGDMDIALALRTIVFPTNARYDTNVLLQDMKKRREWVAHLQAGAGI  334

Query  1790  VADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             VADS+P  EQ+ECENK A L+RAIDLAES+FV
Sbjct  335   VADSDPADEQRECENKAAALARAIDLAESSFV  366



>ref|XP_005714208.1| anthranilate synthase component I [Chondrus crispus]
 emb|CDF34389.1| anthranilate synthase component I [Chondrus crispus]
Length=600

 Score =   498 bits (1282),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 277/521 (53%), Positives = 359/521 (69%), Gaps = 21/521 (4%)
 Frame = +2

Query  362   LIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTME  541
             ++P+ + IFSD +TPV+AYRCLV E+D+ TPSFL ESV  G R   VGRYS+VGA+P  E
Sbjct  87    MVPVWRKIFSDQMTPVVAYRCLVAENDQTTPSFLLESVHTGER---VGRYSLVGARPVCE  143

Query  542   ILAKENKVTILDHD---SGKLTEKVVEDPMTVARSISEEWKPQLTADLPDA---FCGGWV  703
             ++A +  VT++ H+   + + TEKV +DP  V   ++   KP  +  LP A   F GGWV
Sbjct  144   VVAYKQNVTVVRHERTGTTRHTEKV-DDPWKVIAEMNNTLKPVSSCSLPAAEAFFSGGWV  202

Query  704   GYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSY  883
             GY  YDT+RY E K LPF++ P+DDR LPD+H GLY +V  FD V K  +I+HWV +  +
Sbjct  203   GYGGYDTMRYAELKSLPFSATPKDDRGLPDLHFGLYKDVFAFDQVAKVIYIVHWVDITDH  262

Query  884   SSA------SKAYREGKKQLEALVSKV-QDVDPPRLSSASVDFNTREFGPSLAKGNMTSG  1042
             S+A      ++A+  G K+L++LV  + +  +   +S  +V+ NT          NMT  
Sbjct  263   SNANGEALVAEAHAAGMKELDSLVETLHKGANLSTMSPGTVNLNTDAAAIRQYPSNMTKE  322

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
             E+  A+ K K HI+ GD FQ V SQRFER + ADPF VYRALRI+NPSPYM YMQ  G I
Sbjct  323   EFMEALSKIKYHIMVGDTFQTVFSQRFERWSEADPFSVYRALRIINPSPYMIYMQNEGSI  382

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
             LVASSPEILT+V+   + NRPLAGT +RG + EED +L   LL D K+R+EH MLVDLGR
Sbjct  383   LVASSPEILTKVENGTLTNRPLAGTRRRGASEEEDEVLAKELLADGKDRSEHMMLVDLGR  442

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             NDVGKVS  GSV  E++MN+E+YSHVMHISSTV G+L + LT WDALRA LP GT+SGAP
Sbjct  443   NDVGKVSAYGSVKAEQIMNVEKYSHVMHISSTVKGKLREGLTSWDALRATLPAGTISGAP  502

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVF-LNDGMNDTLSSRRKEW  1759
             K++AM++ID LE T+RGPY GG G ISF   M+IALALRT+V      MN   +  + EW
Sbjct  503   KIRAMQIIDDLEPTKRGPYGGGIGYISFHDSMNIALALRTMVVPTKPRMN---ADGKPEW  559

Query  1760  IAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
                LQ+GAGIV +S+P++E  E  NK   ++RAIDLAE+AF
Sbjct  560   QYFLQAGAGIVYESDPEAEYTETVNKAMAMNRAIDLAENAF  600



>ref|XP_008779452.1| PREDICTED: anthranilate synthase alpha subunit 1, chloroplastic-like 
[Phoenix dactylifera]
Length=380

 Score =   488 bits (1255),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 241/367 (66%), Positives = 284/367 (77%), Gaps = 20/367 (5%)
 Frame = +2

Query  224   APSLRVRTLQLKCS-----SSLQIPVTR----------SPYSPPSL----DKEEA-KFIE  343
             APS   R + L C+     SSL+ P +           + YSP       +KEE  KF E
Sbjct  12    APSSVRRPVSLSCTRTSGASSLRYPRSHRSSSSASRCCAVYSPSVAARGGEKEEVFKFTE  71

Query  344   ASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVG  523
             A+K  NL+PL++ IF DHLTPVLAYRCLV EDDR  PSFLFESVE GS  S VGRYSVVG
Sbjct  72    AAKRGNLLPLYQTIFCDHLTPVLAYRCLVKEDDRAAPSFLFESVEQGSSGSNVGRYSVVG  131

Query  524   AQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWV  703
             AQP +EI+AKEN VT++DH+SG+ TE+ VEDPM + R I E WKPQL  +LP+ FCGGWV
Sbjct  132   AQPAIEIVAKENMVTVMDHESGRRTEEFVEDPMQIPRKIMEGWKPQLIDELPNVFCGGWV  191

Query  704   GYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSY  883
             GYFSYDT+RYVE KKLPF++AP+DDRNLPD+HLGLY++VIVFDHV+KKA++IHWV LD Y
Sbjct  192   GYFSYDTMRYVETKKLPFSNAPEDDRNLPDVHLGLYNDVIVFDHVEKKAYVIHWVHLDQY  251

Query  884   SSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVL  1063
             SS  KAY +G+ +L  L+S+V +VD PRL++ SV   TR+FG  L K +MTS EYK AV+
Sbjct  252   SSIEKAYEDGRNRLGILLSRVHNVDVPRLTAGSVKLYTRQFGTPLKKSSMTSEEYKKAVI  311

Query  1064  KAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPE  1243
             +AKEHILAGDIFQIVLSQRFERRT ADPFEVYRALRIVNPSP M Y+QARGCILVASSPE
Sbjct  312   QAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRIVNPSPNMAYLQARGCILVASSPE  371

Query  1244  ILTRVKK  1264
             ILTRV K
Sbjct  372   ILTRVNK  378



>ref|WP_029756683.1| hypothetical protein, partial [Planctomycetes bacterium SCGC 
AAA282-C19]
Length=514

 Score =   490 bits (1262),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 264/522 (51%), Positives = 337/522 (65%), Gaps = 15/522 (3%)
 Frame = +2

Query  329   AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGR  508
             + F   S   N+IP+ + I +DHL+PVLAYR LV  DDR   SFLFESVE G     VGR
Sbjct  1     SSFESLSSKGNVIPVVRRIMADHLSPVLAYRRLVSADDRSAASFLFESVENGDE---VGR  57

Query  509   YSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEW---KPQLTADLP  679
             +S +GA P +EI+A  + V + +   G       E+P  + R  S  W   +P    DLP
Sbjct  58    FSFLGADPCLEIIAYGHDVLVKNVAQGTEERFQSENPFEIVRQESANWVVTEPVAPTDLP  117

Query  680   -DAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFI  856
               +F GGWVG+  YD+ RY E+  +PF SAP+DDRNLPD+H  LY  V+VFDHV K   +
Sbjct  118   FPSFLGGWVGFAGYDSARYFEESAIPFESAPKDDRNLPDLHFALYKTVVVFDHVAKVVHV  177

Query  857   IHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMT  1036
             IH   L    + ++ + E    L+ + + +Q  D   +   ++D +     P     N T
Sbjct  178   IHNAMLTEGGNEAE-WLEANASLDRVTNLLQQ-DVKNIPVGNIDLDLSSPPPEPENSNFT  235

Query  1037  SGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARG  1216
                +++AV + KE+I AGD FQIV+SQRFE R+  DPFEVYR L +VNPSPYM Y+QA G
Sbjct  236   RRAFESAVDRCKEYITAGDAFQIVISQRFEHRSHVDPFEVYRTLCVVNPSPYMIYLQAEG  295

Query  1217  CILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDL  1396
             CIL ASSPEIL R + N V N+PLAGT KRG T +ED+ +E  LL D KERAEH MLVDL
Sbjct  296   CILAASSPEILCRCRGNEVTNKPLAGTRKRGSTKDEDLAMENELLTDSKERAEHVMLVDL  355

Query  1397  GRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSG  1576
             GRND+G V + GS+ +ER+M++ERYSHVMH+SSTVTGEL       DAL A LPVGTVSG
Sbjct  356   GRNDLGTVCELGSIQIERIMDVERYSHVMHLSSTVTGELQSKKDSLDALAATLPVGTVSG  415

Query  1577  APKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSRRKE  1756
             APK++AM++ID+LE T+RGPY+GG G I F GDMD+A+ALRT+V        T     + 
Sbjct  416   APKIRAMQIIDELEPTKRGPYAGGIGMIGFNGDMDMAIALRTMVI------PTAMKTEEG  469

Query  1757  WIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
             W   +QSGAG+V DS    E +E  NK A L RAI LAESAF
Sbjct  470   WRFDIQSGAGVVIDSVSALEWEETVNKAAALGRAIQLAESAF  511



>gb|KDO69029.1| hypothetical protein CISIN_1g0076992mg, partial [Citrus sinensis]
Length=308

 Score =   480 bits (1236),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 238/308 (77%), Positives = 268/308 (87%), Gaps = 5/308 (2%)
 Frame = +2

Query  980   SVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVY  1159
             S+D +T  FGP L K NMTS  YKNAVL+AKEHI AGDIFQIVLSQRFERRT ADPFEVY
Sbjct  1     SIDLHTHHFGPPLKKSNMTSEAYKNAVLEAKEHIQAGDIFQIVLSQRFERRTFADPFEVY  60

Query  1160  RALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLE  1339
             RALR+VNPSPYMTY+QARGCILVASSPEILTRVKKN++VNRPLAGT +RG+T EED MLE
Sbjct  61    RALRVVNPSPYMTYLQARGCILVASSPEILTRVKKNKIVNRPLAGTVRRGRTTEEDEMLE  120

Query  1340  MLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLD  1519
               LL D K+ AEH MLVDLGRNDVGKV++SGSV VE+LMN+ERYSHVMHISST+TGEL D
Sbjct  121   TQLLKDAKQCAEHVMLVDLGRNDVGKVARSGSVKVEKLMNVERYSHVMHISSTITGELQD  180

Query  1520  HLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALR  1699
              L+CWDALRAALPVGTVSGAPKVKAMELID+LE  RRGPYSGGFGG+SF GDMDIALALR
Sbjct  181   RLSCWDALRAALPVGTVSGAPKVKAMELIDELEVNRRGPYSGGFGGVSFTGDMDIALALR  240

Query  1700  TIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAID  1864
             T+VF      DT+ S     +R+EW+A+LQ+GAGIVADS+PD E +EC+NK AGL+RAID
Sbjct  241   TMVFQTGTRYDTMYSYKDARKRREWVAYLQAGAGIVADSDPDDEHRECQNKAAGLARAID  300

Query  1865  LAESAFVK  1888
             LAESAF+K
Sbjct  301   LAESAFIK  308



>tpg|DAA44527.1| TPA: hypothetical protein ZEAMMB73_369527 [Zea mays]
Length=327

 Score =   474 bits (1220),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 242/323 (75%), Positives = 273/323 (85%), Gaps = 5/323 (2%)
 Frame = +2

Query  932   LVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVL  1111
             L+SKV + + P LS   V  +TR+FG  L K  MTS EYKNAVL+AKEHI+AGDIFQIVL
Sbjct  2     LLSKVHNSNVPTLSPGFVKLHTRKFGTPLNKSTMTSDEYKNAVLQAKEHIMAGDIFQIVL  61

Query  1112  SQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLA  1291
             SQRFERRT A+PFEVYRALRIVNPSPYM Y+QARGC+LVASSPEILTRV K +++NRPLA
Sbjct  62    SQRFERRTYANPFEVYRALRIVNPSPYMAYVQARGCVLVASSPEILTRVSKGKIINRPLA  121

Query  1292  GTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERY  1471
             GT +RGKT +ED M E  LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERY
Sbjct  122   GTVRRGKTEKEDQMQEQQLLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEKLMNIERY  181

Query  1472  SHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGF  1651
             SHVMHISSTV+G+L DHL  WDALRAALPVGTVSGAPKVKAMELID+LE TRRGPYSGG 
Sbjct  182   SHVMHISSTVSGQLDDHLQSWDALRAALPVGTVSGAPKVKAMELIDKLEVTRRGPYSGGL  241

Query  1652  GGISFVGDMDIALALRTIVFLNDGMNDTLSS-----RRKEWIAHLQSGAGIVADSNPDSE  1816
             GGISF GDM IAL+LRTIVF     ++T+ S     RR+EW+AHLQ+GAGIVADS+PD E
Sbjct  242   GGISFDGDMQIALSLRTIVFSTAPSHNTMYSYKDADRRREWVAHLQAGAGIVADSSPDDE  301

Query  1817  QKECENKVAGLSRAIDLAESAFV  1885
             Q+ECENK A L+RAIDLAESAFV
Sbjct  302   QRECENKAAALARAIDLAESAFV  324



>ref|XP_005707689.1| anthranilate synthase component I [Galdieria sulphuraria]
 gb|EME31169.1| anthranilate synthase component I [Galdieria sulphuraria]
Length=624

 Score =   470 bits (1210),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 267/532 (50%), Positives = 342/532 (64%), Gaps = 24/532 (5%)
 Frame = +2

Query  332   KFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRY  511
             +F   +K +NL+P+   +FSDHLTPV A+RC + E + + P FL ESV  G     VGR+
Sbjct  85    QFSSLAKEANLVPVFTRLFSDHLTPVSAFRCFISEQETQVPCFLLESVTGGE---NVGRF  141

Query  512   SVVGAQPTMEILAKENKVTILDHDSGKLTEKVV--------EDPMTVARSISEEWKPQLT  667
             S +G QP    LAK++++  +++ S   +++ V        EDP    R I+++      
Sbjct  142   SFLGLQPRFLFLAKQHEIQYIEYSSSGTSKRTVVDERRYSAEDPTLELRKIAQKISTASD  201

Query  668   ADLP--DAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVD  841
               LP   A  GGWVGYFSYDT+RY   KKLPF+SAP+DDRNLPDI +G Y  VI FD+V+
Sbjct  202   EQLPLESALSGGWVGYFSYDTMRYTSPKKLPFSSAPKDDRNLPDICMGQYREVIAFDNVN  261

Query  842   KKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQD-VDPPRLSSASVDFNTREFGPSL  1018
             K  +++ W     + S   AY      L+ L   + + +    LSSA +D NTR  GP  
Sbjct  262   KLVYVVVWEDWKEHKSLRDAYENAVSNLQRLSETISNGILRSPLSSAVMDINTRLRGPKN  321

Query  1019  AKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMT  1198
             +  NM+   +  ++ K  +HIL G+ FQ V SQRF R+T A PF +YRALR+VNPSPYM 
Sbjct  322   SVSNMSKEYFLESIDKIHKHILDGNSFQTVFSQRFRRKTEAHPFSIYRALRVVNPSPYMI  381

Query  1199  YMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEH  1378
             YMQ   CILVASSPEIL +V    ++NRPLAGT  RG T +ED  LE  LL DEK+ AEH
Sbjct  382   YMQCPSCILVASSPEILCKVTNRMMINRPLAGTRHRGVTEDEDAELEKELLGDEKDCAEH  441

Query  1379  TMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALP  1558
              MLVDLGRNDVGKV K G+V V +LM IE+YSHVMHISSTVTG L D    WDAL++ALP
Sbjct  442   VMLVDLGRNDVGKVCKYGTVKVPKLMEIEKYSHVMHISSTVTGILCDEYASWDALQSALP  501

Query  1559  VGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL  1738
              GTVSGAPKV++M++ID LE T RGPY GG G I+F  +M++ALALRTIV          
Sbjct  502   AGTVSGAPKVRSMQIIDSLEPTMRGPYGGGIGYITFQDNMNMALALRTIVI------PFQ  555

Query  1739  SSRRKE----WIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
             SSR  +    W   +Q+GAGIVADS P+ E +E ENK A L  A+D+AE  F
Sbjct  556   SSRGPDEEGLWTVDIQAGAGIVADSVPELEYQETENKAAALEVAVDVAERLF  607



>ref|XP_001691378.1| anthranilate synthase, alpha subunit [Chlamydomonas reinhardtii]
 gb|EDP05111.1| anthranilate synthase, alpha subunit [Chlamydomonas reinhardtii]
Length=556

 Score =   466 bits (1198),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 273/557 (49%), Positives = 344/557 (62%), Gaps = 37/557 (7%)
 Frame = +2

Query  311   SLDKEEAKFIEASKT-SNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGS  487
             S D    KF++A K+ +NL+PL + IFSDHLTPV AYRCLV E D + PSFL ESV  G 
Sbjct  6     SADAGFQKFLDAVKSGANLVPLSQRIFSDHLTPVSAYRCLVPEGDSQLPSFLLESVVNGD  65

Query  488   RSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLT  667
             +    GRYS +G+ P +E++A +++V +LDHD G  T   + DPM +   IS  W+P   
Sbjct  66    QQ---GRYSFLGSSPALEVVATQDRVVLLDHDKGSRTVTSMADPMQLPEEISRNWRPAAV  122

Query  668   ADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKK  847
               +P+ F GGWVGY  YDTVRYV   KLPF  AP+ DR +  + L +   + V    +  
Sbjct  123   DGIPNVFTGGWVGYAGYDTVRYVYGSKLPFDGAPEGDRGVGRVCLAVLSVLAVRGGSEGT  182

Query  848   AFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDP--------PRLS-----SASVD  988
              +    +     ++   AY  G+ +L AL +K+    P        P LS     + S+D
Sbjct  183   TYPT--MTASDPAALRSAYEAGQSRLAALTAKLA-AGPVAGAAFRLPALSGLLPGAISLD  239

Query  989   FNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRAL  1168
              N R   P     NMT  E+ +AV   KEHI AGDIFQ+VLSQRFERRT A PFE+YRAL
Sbjct  240   LNRRPEAP--GNSNMTKQEFMDAVGATKEHIQAGDIFQLVLSQRFERRTFATPFEIYRAL  297

Query  1169  RIVNPSPYMTYMQARGCILVASSPEI---LTRVKKNRVVNRPLAGTAKRGKTPEEDVMLE  1339
             R+VNPSPYM YMQARGC +V   P+     +              T    +T +      
Sbjct  298   RVVNPSPYMVYMQARGCHIVQPGPDPHAPGSTFPAPTRRLHTHRHTHTNTQTHKHTHAYT  357

Query  1340  MLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLD  1519
               LL D+KE AEH MLVDLGRNDVGKV+ SGSV V++LM +ERYSHVMHISSTVTGELL 
Sbjct  358   ADLLADQKEIAEHVMLVDLGRNDVGKVAVSGSVVVQKLMEVERYSHVMHISSTVTGELLP  417

Query  1520  HLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALR  1699
              L  WDALRAALP GTVSGAPKV+AM++ID+LE  +RGPY GG G +SF G MD+AL LR
Sbjct  418   QLDSWDALRAALPAGTVSGAPKVRAMQIIDELEVNKRGPYGGGVGHVSFTGAMDMALGLR  477

Query  1700  TIVFLNDGMNDTL-----------SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAG  1846
             T++ + D   DTL           +  R+EW  H+Q+GAGIVADS P++E +E  NK A 
Sbjct  478   TMI-IPDAAADTLYKYTSTPAAPGAPPRREWSVHIQAGAGIVADSKPEAEYEETVNKAAA  536

Query  1847  LSRAIDLAESAFVKTKR  1897
             L RA+DLAE AFV   R
Sbjct  537   LGRAVDLAEQAFVADGR  553



>ref|XP_002946825.1| hypothetical protein VOLCADRAFT_103239 [Volvox carteri f. nagariensis]
 gb|EFJ52051.1| hypothetical protein VOLCADRAFT_103239 [Volvox carteri f. nagariensis]
Length=460

 Score =   459 bits (1181),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 256/464 (55%), Positives = 303/464 (65%), Gaps = 42/464 (9%)
 Frame = +2

Query  608   VEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNL  787
             +EDPM +  S+S  W+P     +PD F GGWVGY  YDTVRYV   KLPF SAP DDR L
Sbjct  1     MEDPMQLPESLSRNWRPARVDGIPDVFTGGWVGYAGYDTVRYVYGNKLPFESAPTDDRQL  60

Query  788   PDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSAS-----KAYREGKKQLEALVSKVQD  952
             PD+HL LY +V+VFD   K  + I WV +    +AS      AY  G  +L  L +++  
Sbjct  61    PDMHLALYYDVVVFDQATKILYPISWVPVSEQDAASPEALRAAYDAGLARLGRLAARLSS  120

Query  953   VDPPRLS----SASVDFN--------------TREFGPSLAKGNMTSGEYKNAVLKAKEH  1078
               PP  S    + S+D N               R  GP   +  + + E+ +AV   KEH
Sbjct  121   A-PPAASLTPGAISLDLNKRPALPSNSNMTKQARAEGPPWGEEGLVAPEFMDAVAATKEH  179

Query  1079  ILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRV  1258
             I AGDIFQ+VLSQRFERRT A PFE+YRALR+VNPSPYM YMQARGC +V+SSPEIL RV
Sbjct  180   IQAGDIFQLVLSQRFERRTFASPFEIYRALRVVNPSPYMVYMQARGCHIVSSSPEILCRV  239

Query  1259  KKNRVV-NRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgs  1435
                RVV NRPLAGT  RGK PE D  LE  LL D KE AEH MLVDLGRNDVGKVS SGS
Sbjct  240   DNGRVVTNRPLAGTRPRGKDPEADKALEADLLADAKEIAEHVMLVDLGRNDVGKVSVSGS  299

Query  1436  vNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQL  1615
             V V +LM +ERYSHVMHISSTVTG+LL  L  WDALRAALP GT      V+AM++ID+L
Sbjct  300   VVVRKLMEVERYSHVMHISSTVTGQLLPQLDAWDALRAALPAGT------VRAMQIIDEL  353

Query  1616  EATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSR----------RKEWIA  1765
             EA +RGPY GG G +SF G MD+AL LRT++ + D   DTL             R+EW  
Sbjct  354   EANKRGPYGGGIGHVSFTGAMDMALGLRTMI-IPDSAADTLYKYDAPAAPGCPPRREWSV  412

Query  1766  HLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVKTKR  1897
             H+Q+GAGIVADS P+SE +E  NK A L RAIDLAE AFV+  +
Sbjct  413   HIQAGAGIVADSRPESEYEETVNKAAALGRAIDLAEQAFVEDGK  456



>tpg|DAA52290.1| TPA: hypothetical protein ZEAMMB73_012998 [Zea mays]
Length=393

 Score =   456 bits (1173),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 213/344 (62%), Positives = 265/344 (77%), Gaps = 4/344 (1%)
 Frame = +2

Query  224   APSLRVRTLQLKCSSSLQIPVTRSPY---SPPSLDKEEAKF-IEASKTSNLIPLHKCIFS  391
             APS R  +L+ + ++ +    T + +      ++ +EE++F   A++  NL+PL +CIFS
Sbjct  13    APSSRPLSLRRRGAAGVTCRATTATFHQLDAVAVREEESRFRTAAAEGRNLLPLTRCIFS  72

Query  392   DHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEILAKENKVTI  571
             DHLTPVLAYRCLV ED+R+ PSFLFESVE GS  + VGRYSVVGAQP+ME++AK N VT+
Sbjct  73    DHLTPVLAYRCLVKEDERDAPSFLFESVEQGSEGTNVGRYSVVGAQPSMEVVAKANHVTV  132

Query  572   LDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCGGWVGYFSYDTVRYVEKKKL  751
             +DH+     E  V DPM + R+I E+W PQ+   LPDAFCGGWVG+FSYDTVRYVE KKL
Sbjct  133   MDHEMKSRREHFVPDPMRIPRTIMEQWNPQIADSLPDAFCGGWVGFFSYDTVRYVETKKL  192

Query  752   PFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEA  931
             PF+ AP DDRNLPDIHLGLY +VIVFDHV+KK  +IHWVR D Y S  +AY +G+ +LEA
Sbjct  193   PFSKAPHDDRNLPDIHLGLYSDVIVFDHVEKKTHVIHWVRTDCYRSVDEAYEDGRNRLEA  252

Query  932   LVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVL  1111
             L+S++  ++ P LSS S+  N   FGP + K  M+S EYKN V++AKEHILAGDIFQ+VL
Sbjct  253   LLSRLHCLNVPTLSSGSIKLNVENFGPVMQKSTMSSEEYKNIVVQAKEHILAGDIFQVVL  312

Query  1112  SQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPE  1243
             SQRFERRT ADPFE+YRALRIVNPSPYM Y+QARGCILVASSPE
Sbjct  313   SQRFERRTFADPFEIYRALRIVNPSPYMAYLQARGCILVASSPE  356



>gb|KDP44800.1| hypothetical protein JCGZ_01300 [Jatropha curcas]
Length=292

 Score =   450 bits (1157),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 225/290 (78%), Positives = 255/290 (88%), Gaps = 5/290 (2%)
 Frame = +2

Query  1031  MTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQA  1210
             MTS EYK  VLKAKEHILAGDIFQIVLSQRFERRT ADPFEVYRALR+VNPSPYMTY+QA
Sbjct  1     MTSEEYKGIVLKAKEHILAGDIFQIVLSQRFERRTFADPFEVYRALRVVNPSPYMTYLQA  60

Query  1211  RGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLV  1390
             RGCILVASSPEILTRVKKN+++NRPLAGT +RGKT EED MLE+ LLND K+ AEH MLV
Sbjct  61    RGCILVASSPEILTRVKKNKIINRPLAGTIRRGKTTEEDKMLEVQLLNDPKQCAEHIMLV  120

Query  1391  DLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTV  1570
             DLGRNDVGKVSK GSV VE+LMNIERYSHVMHISSTV+GEL D L+ WDALRAALPVGTV
Sbjct  121   DLGRNDVGKVSKYGSVTVEKLMNIERYSHVMHISSTVSGELRDGLSTWDALRAALPVGTV  180

Query  1571  SGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTL----  1738
             SGAPKVKAMELIDQ E  RRGPYSGGFG +SF GDMD+ALALRT+VF     NDT+    
Sbjct  181   SGAPKVKAMELIDQFEVHRRGPYSGGFGSVSFNGDMDVALALRTMVFPTGARNDTMYLYK  240

Query  1739  -SSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
              + +R+EW+++LQ+GAGIVADS+P+ E +EC+NK AGL+RAIDLAE++F+
Sbjct  241   GAEQRREWVSYLQAGAGIVADSDPNDEHRECQNKAAGLARAIDLAEASFI  290



>ref|WP_014435663.1| anthranilate synthase component I [Phycisphaera mikurensis]
 ref|YP_005444340.1| anthranilate synthase component I [Phycisphaera mikurensis NBRC 
102666]
 dbj|BAM02443.1| anthranilate synthase component I [Phycisphaera mikurensis NBRC 
102666]
Length=542

 Score =   430 bits (1106),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 235/512 (46%), Positives = 317/512 (62%), Gaps = 18/512 (4%)
 Frame = +2

Query  365   IPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVVGAQPTMEI  544
             +P+ + +  D LTPVLAYR LV  + R  PSFL +SV  G    TVGRYS +G++P  E+
Sbjct  30    LPVVRRLLGDALTPVLAYRRLVRGERRLAPSFLLDSVTGGD---TVGRYSFLGSRPVAEV  86

Query  545   LAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQ---LTADLPDAFCGGWVGYFS  715
             +A+   + + DH +G    +  +DP+    +++ +  P      A LP  F GGWVGY  
Sbjct  87    IARGPVLEVRDHAAGTSASRPCDDPLRAMPALTRQLAPGRWVAPAGLP-PFAGGWVGYAG  145

Query  716   YDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSAS  895
             YDTVRY E   L     P DDR+LPD+H  LY  ++ FDH +    +I    L +   AS
Sbjct  146   YDTVRYTEPDAL--GPGPPDDRDLPDLHFQLYPELVAFDHAEGTLLLIGSAALPADRDAS  203

Query  896   KAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFG---PSLAKGNMTSGEYKNAVLK  1066
             +A+    + L+AL  ++   +P  +++       R  G   P L   ++ +G Y++AV +
Sbjct  204   EAFSAAVRGLDALQERLLGGEPEPVATPPRHAAGRRGGHAAPDLGPSSLGAGGYQDAVRR  263

Query  1067  AKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEI  1246
              KE++ AGD FQ+V SQRFE  T ADPF+VYRALR VNPSPY+ Y+QA G +LV SSPEI
Sbjct  264   VKEYVAAGDAFQVVPSQRFEVETAADPFDVYRALRAVNPSPYLFYLQAGGAVLVGSSPEI  323

Query  1247  LTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsk  1426
             L +V      +RPLAGT  RG+   ED  L   L  D K+ AEH+MLVDL RND+G+V++
Sbjct  324   LVKVVGGVAASRPLAGTRPRGRDAAEDDELSAQLRADPKDTAEHSMLVDLHRNDIGRVAE  383

Query  1427  sgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELI  1606
              GSV +  LM +ERYSHVMH+SS V G L + +  W+ALR +LPVGTVSGAPKV+AM++I
Sbjct  384   PGSVGLTELMAVERYSHVMHLSSEVRGRLREGVDAWEALRVSLPVGTVSGAPKVRAMQII  443

Query  1607  DQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSRRKEWIAHLQSGAG  1786
             D+LE  +RGPY G  G   F GD+D  +ALRT+V L          R   W  HLQ+G G
Sbjct  444   DELEPVKRGPYGGAVGHAGFNGDLDTCIALRTMVVLPP------RRRGGPWRVHLQAGGG  497

Query  1787  IVADSNPDSEQKECENKVAGLSRAIDLAESAF  1882
             +VADS+PD+E +E  NK AGL  A+ LAE  F
Sbjct  498   VVADSDPDAEHQETLNKAAGLLEAVRLAERLF  529



>ref|WP_020475120.1| hypothetical protein [Zavarzinella formosa]
Length=496

 Score =   413 bits (1062),  Expect = 4e-132, Method: Compositional matrix adjust.
 Identities = 242/518 (47%), Positives = 326/518 (63%), Gaps = 36/518 (7%)
 Frame = +2

Query  332   KFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRY  511
             +F + +  + ++P+++ + +D LTPV  +     +   E  +FLFESV  G R    GRY
Sbjct  9     EFCQLATGATVVPVYRRLLNDSLTPVHVFW----QFQHEKWAFLFESVVGGERH---GRY  61

Query  512   SVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFC  691
             S VG +P   I A +  V IL    G   E    DP+     I   +       LP  FC
Sbjct  62    SFVGGKPFQHIEAYDRHV-ILTTAKGDRHEFDTPDPLRKLEEILTAYHAPHVPGLP-RFC  119

Query  692   GGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVR  871
             GG VGY  YDTVRYVE+  LP  +AP+DDR LPD+   LYD ++VFDH +K    +    
Sbjct  120   GGAVGYAGYDTVRYVER--LP--NAPEDDRGLPDLSFALYDEMVVFDHANKTLMAVAHAN  175

Query  872   LDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREF-GPSLA--KGNMTSG  1042
             +D ++   + Y +   +++ +V K+  ++P    +A V     E  GP     + N T  
Sbjct  176   IDHHN-LKRCYADTCARVDRMVEKL--LEP----AAPVQLQDIELRGPITVPHQSNFTPD  228

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
              +K AV+K KE+I AGDIFQ+VLSQRF+ +TTA+ F++YRALR VNPSP+M +++   C 
Sbjct  229   AFKAAVVKCKEYINAGDIFQVVLSQRFQTKTTANAFDIYRALRAVNPSPFMFFVKTPSCT  288

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
             LV +SPEI+TRV+ N V  RPLAGT KRG TPEED  L   LL D KERAEH MLVDLGR
Sbjct  289   LVGASPEIMTRVENNEVTIRPLAGTRKRGATPEEDKALAEELLADPKERAEHIMLVDLGR  348

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             NDVG+V+K GSV +  L+ +ERYSHVMHISSTVTGEL    T +DALR+ LP GT+SGAP
Sbjct  349   NDVGRVAKFGSVRISELLTVERYSHVMHISSTVTGELDAGKTTFDALRSCLPAGTLSGAP  408

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSRRKEWI  1762
             K++AME+ID+LE  RRGPY G  G + F G+MD  +ALRT+V   D              
Sbjct  409   KIRAMEIIDELEPHRRGPYGGAVGYVDFTGNMDTCIALRTMVIQGD-------------T  455

Query  1763  AHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAES  1876
             A++Q+GAG+VADS+P++E +E  NK  GL RA+++AE+
Sbjct  456   AYIQAGAGLVADSDPEAEYQETVNKAMGLMRALEIAET  493



>ref|WP_010034549.1| anthranilate synthase subunit I [Gemmata obscuriglobus]
Length=500

 Score =   410 bits (1055),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 246/534 (46%), Positives = 325/534 (61%), Gaps = 51/534 (10%)
 Frame = +2

Query  308   PSLDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGS  487
             P+ D+    F   ++   ++P+++ + +D LTPV A+ C + E D    SFLFESV  G 
Sbjct  5     PTFDE----FAALAREHTVVPVYRRLTADTLTPVSAF-CKLQEGDW---SFLFESVVGGE  56

Query  488   RSSTVGRYSVVGAQP--TMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQ  661
             R   VGRYS +GA P  T E          +  +  K  E    DP+ V   +  E++  
Sbjct  57    R---VGRYSFLGAGPFRTFEAFGTRT----VTREGAKTVEGESADPLRVLEDMIGEFRAP  109

Query  662   LTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVD  841
                 LP  FCGG VGY  YDTVRYVE+  LP  +AP DDR LPD+  G YD ++VFDH  
Sbjct  110   HLPGLPR-FCGGAVGYAGYDTVRYVER--LP--NAPNDDRGLPDLSFGFYDRMVVFDHAA  164

Query  842   KKAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQ---------DVDPPRLSSASVDFN  994
             K    +   R  +      AY    +Q++ LV ++Q         D+DP    +A+    
Sbjct  165   KTILAVAHARTRANDDLRAAYAAACRQVDELVERLQRGVADLQLTDIDPKAPRAAAGARP  224

Query  995   TREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRI  1174
                    LA  N T   ++ AV KA+E+I AGD FQIVLSQRF   TTA PF++YRALR+
Sbjct  225   ------PLAS-NFTRAGFEAAVEKAREYINAGDAFQIVLSQRFRTETTARPFDIYRALRV  277

Query  1175  VNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLN  1354
             VNPSP+M Y++A    LV +SPEI+ RV+   + NRPLAGT +RG TPEED  L   LL 
Sbjct  278   VNPSPFMFYLRAGAVTLVGASPEIMCRVENGVITNRPLAGTRRRGATPEEDAQLATELLA  337

Query  1355  DEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCW  1534
             D KERAEH MLVDL RNDVG+V++ GSV +  L+ +ERYSHVMH+SSTVTG+L   LT +
Sbjct  338   DPKERAEHIMLVDLARNDVGRVAELGSVKISDLLTVERYSHVMHLSSTVTGKLRPELTAF  397

Query  1535  DALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFL  1714
             DA+RA+LP GT+SGAPKV+AME+ID+LE  RRGPY G  G + F G+MD  +ALRT+V L
Sbjct  398   DAMRASLPAGTLSGAPKVRAMEIIDELEPHRRGPYGGAVGYVDFGGNMDTCIALRTMVLL  457

Query  1715  NDGMNDTLSSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAES  1876
                             A++Q+GAG+VADS P +E +E  +K A L RAI++AE+
Sbjct  458   GQ-------------TAYVQAGAGLVADSVPATEYQETVDKAASLLRAIEVAET  498



>ref|WP_010587941.1| anthranilate synthase subunit I [Schlesneria paludicola]
Length=497

 Score =   410 bits (1053),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 247/517 (48%), Positives = 322/517 (62%), Gaps = 35/517 (7%)
 Frame = +2

Query  329   AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGR  508
             A F + +  +  +P+ + + SD LTPV AY C + +D     SFLFESV  G R   VGR
Sbjct  9     ATFRQLAAGARYVPVFRRLVSDTLTPVSAY-CRLQDDQN---SFLFESVIGGER---VGR  61

Query  509   YSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAF  688
             YS VGA P ++I A + ++ I DHDS K     VEDP+    S+   ++     +LP  F
Sbjct  62    YSFVGAGPFLQIDAFDREIVITDHDSVK--RYTVEDPLEHLHSMLANYQAPHLPELP-RF  118

Query  689   CGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWV  868
             CGG VGY  YDTVRY E+   P    P+DDR+LPD+   LYD ++VFD + K   ++  V
Sbjct  119   CGGAVGYAGYDTVRYTERLLNP----PEDDRHLPDMSFALYDRMVVFDQIQKTIQVV--V  172

Query  869   RLDSYSS-ASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLA-KGNMTSG  1042
               D + +    AY    ++++AL    Q +D P  +    D  T    P +A + N T  
Sbjct  173   HADVHETDLQAAYDAACRRVDALC---QQLDTPTETIHLTDI-TLTGDPQIAFQSNFTRS  228

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
              Y+ AV   KE+I AGDIFQ+VLSQR E  TTA P ++YRALR+VNPSP+M  ++     
Sbjct  229   GYEQAVENCKEYIRAGDIFQVVLSQRLELETTASPLDIYRALRVVNPSPFMFLVRTPVVT  288

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
             L+ SSPEI+ RV+  R   RPLAGT +RGKT  ED+ LE  LL DEKERAEH MLVDL R
Sbjct  289   LIGSSPEIMVRVEDGRTTIRPLAGTRRRGKTQAEDLALERELLADEKERAEHVMLVDLAR  348

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             NDVG+V++ GSV +  +M++ERYSHVMHISSTVTG+L    T  DALRA LP GT+SGAP
Sbjct  349   NDVGRVAEYGSVELSDIMHVERYSHVMHISSTVTGKLAPGKTALDALRAGLPAGTLSGAP  408

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSRRKEWI  1762
             KV+AME+ID+ E  RRGPY G  G + F G MD  +ALRTIV +                
Sbjct  409   KVRAMEIIDEQEPHRRGPYGGAVGYLDFTGHMDTCIALRTIVMVGQK-------------  455

Query  1763  AHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAE  1873
             A++Q+GAGIVADS P SE +E  +K  GL +AI++AE
Sbjct  456   AYVQAGAGIVADSVPASEYEETLSKARGLLKAIEIAE  492



>gb|AIU64772.1| anthranilate synthase alpha-subunit 2-like protein, partial [Eleusine 
coracana subsp. coracana]
Length=280

 Score =   400 bits (1028),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 198/275 (72%), Positives = 232/275 (84%), Gaps = 0/275 (0%)
 Frame = +2

Query  758   ASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALV  937
             A APQDDRNLPD+HLGLYD+V+VFD+V+KK ++IHWV L  ++S  +AY +G+ +L  L+
Sbjct  3     AGAPQDDRNLPDVHLGLYDDVLVFDNVEKKVYVIHWVNLGRHASTEEAYEDGRSRLNLLL  62

Query  938   SKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQ  1117
             SKV + + P LS   V   TR+FG  L K  MTS EYKNAVL AKEHI+AGDIFQIVLSQ
Sbjct  63    SKVHNSNVPMLSPGFVKLGTRQFGEPLNKSTMTSDEYKNAVLTAKEHIMAGDIFQIVLSQ  122

Query  1118  RFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGT  1297
             RFERRT A+PFEVYRALRIVNPSPYM Y+QARGC+LVASSPEILTRV+K +++NRPLAGT
Sbjct  123   RFERRTYANPFEVYRALRIVNPSPYMAYVQARGCVLVASSPEILTRVRKGKIINRPLAGT  182

Query  1298  AKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSH  1477
              +RG+T +ED+M E  LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSH
Sbjct  183   VRRGRTEKEDLMQEQQLLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEKLMNIERYSH  242

Query  1478  VMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             VMHISSTV+G+L DHL  WDALRAALPVGTVSGAP
Sbjct  243   VMHISSTVSGQLDDHLQSWDALRAALPVGTVSGAP  277



>gb|AIU64771.1| anthranilate synthase alpha-subunit 2-like protein, partial [Eleusine 
coracana subsp. coracana]
Length=281

 Score =   400 bits (1028),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 198/275 (72%), Positives = 232/275 (84%), Gaps = 0/275 (0%)
 Frame = +2

Query  758   ASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRLDSYSSASKAYREGKKQLEALV  937
             A APQDDRNLPD+HLGLYD+V+VFD+V+KK ++IHWV L  ++S  +AY +G+ +L  L+
Sbjct  3     AGAPQDDRNLPDVHLGLYDDVLVFDNVEKKVYVIHWVNLGRHASTEEAYEDGRSRLNLLL  62

Query  938   SKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQ  1117
             SKV + + P LS   V   TR+FG  L K  MTS EYKNAVL AKEHI+AGDIFQIVLSQ
Sbjct  63    SKVHNSNVPMLSPGFVKLGTRQFGEPLNKSTMTSDEYKNAVLTAKEHIMAGDIFQIVLSQ  122

Query  1118  RFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGT  1297
             RFERRT A+PFEVYRALRIVNPSPYM Y+QARGC+LVASSPEILTRV+K +++NRPLAGT
Sbjct  123   RFERRTYANPFEVYRALRIVNPSPYMAYVQARGCVLVASSPEILTRVRKGKIINRPLAGT  182

Query  1298  AKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSH  1477
              +RG+T +ED+M E  LL+DEK+ AEH MLVDLGRNDVGKVSK GSV VE+LMNIERYSH
Sbjct  183   VRRGRTEKEDLMQEQQLLSDEKQCAEHIMLVDLGRNDVGKVSKPGSVKVEKLMNIERYSH  242

Query  1478  VMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             VMHISSTV+G+L DHL  WDALRAALPVGTVSGAP
Sbjct  243   VMHISSTVSGQLDDHLQSWDALRAALPVGTVSGAP  277



>ref|XP_006403405.1| hypothetical protein EUTSA_v10011120mg, partial [Eutrema salsugineum]
 gb|ESQ44858.1| hypothetical protein EUTSA_v10011120mg, partial [Eutrema salsugineum]
Length=299

 Score =   391 bits (1004),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 214/327 (65%), Positives = 242/327 (74%), Gaps = 36/327 (11%)
 Frame = +2

Query  932   LVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSGEYKNAVLKAKEHILAGDIFQIVL  1111
             LV +++ ++PP L S SVD +T +FG  L K  MTS  YKNA               IVL
Sbjct  2     LVWRIKSINPPNLPSGSVDLHTSQFGTPLEKSTMTSDAYKNA---------------IVL  46

Query  1112  SQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLA  1291
             S RFER T A PFEVYRALRIVNPSP M Y+QARGCILVASSPEILTRVKKN++VNRPLA
Sbjct  47    SHRFERHTFAHPFEVYRALRIVNPSPSMCYLQARGCILVASSPEILTRVKKNKIVNRPLA  106

Query  1292  GTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERY  1471
             GT++RGK+ EED MLE  LL DEK+ A H MLVDLGRNDVGKVSK+GSV VERLMNIERY
Sbjct  107   GTSRRGKSYEEDQMLEKTLLKDEKQCAVHIMLVDLGRNDVGKVSKNGSVKVERLMNIERY  166

Query  1472  SHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGF  1651
             SHVMHISST+ G    +LTCWD LRAALPV T           LID+LE TRRGPYSGGF
Sbjct  167   SHVMHISSTLQG----NLTCWDTLRAALPVET-----------LIDKLEVTRRGPYSGGF  211

Query  1652  GGISFVGDMDIALALRTIVFLNDGMNDTLSSR------RKEWIAHLQSGAGIVADSNPDS  1813
             G +SF  DMDIALALRTIVF     +DT+ S       R+EWIA+LQ+GAGIVADS+P+ 
Sbjct  212   GSVSFTRDMDIALALRTIVFPTQARHDTMYSYKDKDMPRREWIAYLQAGAGIVADSDPED  271

Query  1814  EQKECENKVAGLSRAIDLAESAFVKTK  1894
             E  EC+NK AGL+RAIDLAESAFV  K
Sbjct  272   EHHECQNKAAGLTRAIDLAESAFVNKK  298



>ref|WP_013629736.1| anthranilate synthase subunit I [Planctomyces brasiliensis]
 ref|YP_004271039.1| anthranilate synthase, component I [Planctomyces brasiliensis 
DSM 5305]
 gb|ADY61017.1| anthranilate synthase, component I [Planctomyces brasiliensis 
DSM 5305]
Length=498

 Score =   396 bits (1017),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 238/523 (46%), Positives = 313/523 (60%), Gaps = 37/523 (7%)
 Frame = +2

Query  329   AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGR  508
             A F   +   +L+P+++   +D L+PV AYR L    D+   SFLFESV  G R   VGR
Sbjct  8     ATFQTQADGYDLVPVYRQFTADSLSPVEAYRRL----DKGDYSFLFESVIGGER---VGR  60

Query  509   YSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAF  688
             YS +G+ P + + A  N V I + D  + + +   DP+     I  +++      LP  F
Sbjct  61    YSFLGSHPFLIVEAAGNDVVIREGD--QESRETSPDPLARLGEILTDYRMAPHPQLP-RF  117

Query  689   CGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWV  868
             CGG VGY  YDTVRY E   LP  +AP+DDR +PD+  GL+D +++FDH+ K   ++   
Sbjct  118   CGGAVGYAGYDTVRYAES--LP--NAPEDDRKIPDLLFGLFDQMVIFDHIRKTMLVVVLA  173

Query  869   RLDSY---SSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTS  1039
             R + +    S + A     K  E L++      P  +    +D N      +  K N   
Sbjct  174   RTNGHDLQESYAAAVERLDKFCEQLLTNPAPTPPEEIR---LDQNVE----AEWKSNFAE  226

Query  1040  GEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGC  1219
             GEY+ AV   +E+I AGDIFQ+VLSQR E  T A    +YRALR+VNPSP+M  +     
Sbjct  227   GEYQKAVDACREYIKAGDIFQVVLSQRLEMETDASELAIYRALRVVNPSPFMFLVNTPAA  286

Query  1220  ILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLG  1399
              LV SSPEI+TRV+   V  RPLAGT  RGKTP ED  LE  LL D KERAEH MLVDL 
Sbjct  287   QLVGSSPEIMTRVENGTVTVRPLAGTRPRGKTPAEDNELERELLADPKERAEHVMLVDLA  346

Query  1400  RNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGA  1579
             RNDVG+V+   S+ ++ +M +ERYSHVMHI+S VTG+L   LT  DALRAALP GTVSGA
Sbjct  347   RNDVGRVADYNSIELKDVMVVERYSHVMHITSNVTGQLRKDLTALDALRAALPAGTVSGA  406

Query  1580  PKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSRRKEW  1759
             PKV+AME+ID+ E  RRGPY+G  G I F GDMD  +ALRT+V             RK +
Sbjct  407   PKVRAMEIIDEFEKHRRGPYAGAVGYIDFTGDMDTCIALRTLV----------KQGRKVY  456

Query  1760  IAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             +   Q+GAG+VADS+P++E +E  NK  GL  A+ +AE    K
Sbjct  457   V---QAGAGLVADSDPETEYQETLNKARGLLTAVAIAEQQLSK  496



>ref|WP_002646958.1| anthranilate synthase subunit I [Planctomyces maris]
 gb|EDL58838.1| anthranilate synthase component I [Planctomyces maris DSM 8797]
Length=507

 Score =   396 bits (1017),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 232/517 (45%), Positives = 316/517 (61%), Gaps = 32/517 (6%)
 Frame = +2

Query  335   FIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYS  514
             F   S   NL+P+++ +  D LTPV AY+ L    ++   SFLFESV  G +   + RYS
Sbjct  10    FKSLSGQVNLVPVYRQLTGDTLTPVSAYQLL----EKGPYSFLFESVVGGEQ---ISRYS  62

Query  515   VVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCG  694
              +GA P + + A E +V I     G+  E+ VEDP+    +I  +++      LP  FCG
Sbjct  63    FLGANPFLTVDAYEQRVVI--QQQGQTEERSVEDPLQELETILGQYQAAELPGLP-RFCG  119

Query  695   GWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRL  874
             G VGY  YD VRY E   LP   AP++DR LPD+   LYD+++VFD ++K   ++    L
Sbjct  120   GAVGYAGYDVVRYSEH--LP--HAPENDRQLPDLSFALYDHMVVFDQINKTVLVVAHAHL  175

Query  875   DSYSSASK---AYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLA-KGNMTSG  1042
              +  S ++   AYR    +++    + Q  DP  L  A +  +T    P L    N T  
Sbjct  176   GADLSEAELKDAYRRACDKIDQTCQRFQTGDPSALQMADISVDTHA-EPDLNWTSNFTQQ  234

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
             ++++AV   KE+I+AGDIFQ+VLSQR +  T+A P ++YR+LR+VNPSP+M  ++     
Sbjct  235   KFESAVDACKEYIVAGDIFQVVLSQRLKLETSASPLDIYRSLRVVNPSPFMFLLKTPEVD  294

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
             LV SSPEI+ RV+      RPLAGT KRGKT  ED  L   LL D KERAEH ML+DL R
Sbjct  295   LVGSSPEIMVRVEDRVTTIRPLAGTRKRGKTEAEDKRLAEELLADPKERAEHVMLIDLAR  354

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             NDVG+V + GSV +  +M +ERYSHVMHI+S VTG L +  +  DALRA LP GTVSGAP
Sbjct  355   NDVGRVCEFGSVELSDVMVVERYSHVMHITSNVTGTLTEDRSALDALRAGLPAGTVSGAP  414

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSRRKEWI  1762
             KV+AME+ID+ E  RRGPY+G  G + F G+MD  +ALRT+V              +   
Sbjct  415   KVRAMEIIDEFEPHRRGPYAGAVGYLDFTGNMDTCIALRTLVM-------------QGST  461

Query  1763  AHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAE  1873
             A++Q+GAGIVADS P++E  E  NK  GL +AI++AE
Sbjct  462   AYVQAGAGIVADSVPETEYHETLNKAKGLLKAIEVAE  498



>ref|XP_008349680.1| PREDICTED: anthranilate synthase alpha subunit 2, chloroplastic-like 
[Malus domestica]
Length=330

 Score =   389 bits (1000),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 185/268 (69%), Positives = 217/268 (81%), Gaps = 0/268 (0%)
 Frame = +2

Query  485   SRSSTVGRYSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQL  664
             SR   V R+SV+GAQP++EI+AKE+ VTI+D+  G  TE+ VEDPMTV R I E W P L
Sbjct  59    SREVNVCRHSVIGAQPSIEIVAKEDMVTIMDNKEGCRTEEFVEDPMTVLRRIMEGWTPXL  118

Query  665   TADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDK  844
               + P+AFCGGWVGYFSYDTVRYVEKK LPF SAP DDRNL D+HLG YD+VIVFDHVDK
Sbjct  119   LDEFPEAFCGGWVGYFSYDTVRYVEKKNLPFPSAPPDDRNLXDVHLGXYDDVIVFDHVDK  178

Query  845   KAFIIHWVRLDSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAK  1024
             KA +IHWV+LD YSS  +A+ +G  +LE L+S+V D+  PRL + S++FNT+ FG  L  
Sbjct  179   KAHVIHWVQLDQYSSVDEAFNDGINRLETLLSRVHDIITPRLPAGSIEFNTQLFGTKLED  238

Query  1025  GNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYM  1204
              ++TS EYK AVL+AKEHILAGDIFQIVLSQRFERRT ADPFE+YRALRIVNPSPYMTY+
Sbjct  239   SSLTSEEYKEAVLEAKEHILAGDIFQIVLSQRFERRTFADPFEIYRALRIVNPSPYMTYL  298

Query  1205  QARGCILVASSPEILTRVKKNRVVNRPL  1288
             QARGCILVASSPEILTRVKK   V + L
Sbjct  299   QARGCILVASSPEILTRVKKAMSVCKEL  326



>ref|WP_008691647.1| anthranilate synthase component I [Rhodopirellula maiorica]
 gb|EMI22320.1| anthranilate synthase component I [Rhodopirellula maiorica SM1]
Length=506

 Score =   394 bits (1012),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 234/527 (44%), Positives = 318/527 (60%), Gaps = 40/527 (8%)
 Frame = +2

Query  314   LDKEEAKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRS  493
             L  E A F + S   + +P+++ + SD LTPV A+R L    D   P+ LFESV  G + 
Sbjct  2     LTPESADFDQLSIHHDFVPVYRRLLSDSLTPVTAFRLL----DDGGPACLFESVIGGEK-  56

Query  494   STVGRYSVVGAQPTMEILAKENKVTILD------HDSGKLTEKVVEDPMTVARSISEEWK  655
               VGRYS + A P     A+ N+VTI +       D GK  E    DP+   R+   +++
Sbjct  57    --VGRYSFLAADPIKRFSARGNQVTISNLGSSAAADGGKTEELESADPLETFRA-HVKYR  113

Query  656   PQLTADLPDAFCGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDH  835
                 A LP  F GG +GY  YD VRYVE   LP  ++P+DDR LPD+    Y  + VFDH
Sbjct  114   VAEVAGLP-PFVGGAIGYAGYDVVRYVEN--LP--NSPEDDRQLPDLDFAFYHTLCVFDH  168

Query  836   VDKKAFIIHWVRLDSYSSAS---KAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREF  1006
             VDK   ++        ++A+   +A+ E  +Q++  ++K+     P   +   +F T + 
Sbjct  169   VDKTITVVSLADCRDVTNAAESQQAFSEASQQIDKTIAKLSQ---PTAHTPE-EFTTEKP  224

Query  1007  GPSL-AKGNMTSGEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNP  1183
              P L  + N T   ++ AVL+  E+I AGDIFQ+V SQR   +T  DPFE+YR+LR+VNP
Sbjct  225   SPPLNIESNFTRESFRKAVLECVEYIRAGDIFQVVPSQRLSVKTDVDPFEIYRSLRVVNP  284

Query  1184  SPYMTYMQARGCILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEK  1363
             SP+M +++   C+LV  SPEI+ RV  N V  RPLAGT +RGKT +ED  LE  LL D K
Sbjct  285   SPFMFFVRTPDCMLVGCSPEIMCRVADNVVTVRPLAGTRRRGKTEKEDKALEKELLADPK  344

Query  1364  ERAEHTMLVDLGRNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDAL  1543
             E AEH MLVDLGRNDVG+V++ G+V +  +M +ERYSHVMHISS V G L + L  +DAL
Sbjct  345   EIAEHVMLVDLGRNDVGRVAQFGTVELTEVMVVERYSHVMHISSEVQGRLREGLDAFDAL  404

Query  1544  RAALPVGTVSGAPKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDG  1723
             +A LP GTVSGAPKV+AME+ID +E  RRGPY G  G + + G+MD  +ALRT+V     
Sbjct  405   KACLPAGTVSGAPKVRAMEVIDSIEPHRRGPYGGAVGYVDYRGNMDTCIALRTMV-----  459

Query  1724  MNDTLSSRRKEWIAHLQSGAGIVADSNPDSEQKECENKVAGLSRAID  1864
                      KE + ++Q+G G+VADS+PDSE  E  NK   L  AI+
Sbjct  460   --------AKEGVVYVQAGCGVVADSDPDSEYDETMNKARALISAIE  498



>ref|WP_002651708.1| anthranilate synthase subunit I [Blastopirellula marina]
 gb|EAQ80125.1| anthranilate synthase component I [Blastopirellula marina DSM 
3645]
Length=501

 Score =   388 bits (997),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 229/517 (44%), Positives = 313/517 (61%), Gaps = 32/517 (6%)
 Frame = +2

Query  329   AKFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGR  508
             A+F + +   +++P+ + + SD LTPV A+  L    D   P+ LFESV  G +   +GR
Sbjct  8     AQFSKLAADHDMVPVFRRLISDSLTPVSAFHKL----DEGRPACLFESVIGGEK---IGR  60

Query  509   YSVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAF  688
             YS +G +P   + A  ++VT+   D  K+ +   E+P+   R    + +      LP  F
Sbjct  61    YSFLGFEPDYHLAATRSEVTVTTGD--KIEKFTCENPLEELRRRLADVRVAHLDGLP-PF  117

Query  689   CGGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWV  868
              GG +GY  YD +RYVE   LP  +AP+DDR LPD+  G Y  ++VFD+V K   +I   
Sbjct  118   TGGAIGYAGYDVIRYVEN--LP--NAPEDDRGLPDLSFGFYHQLVVFDNVAKTVDVIVLA  173

Query  869   RLDSYSSAS--KAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTSG  1042
             R D+   A   K +     +++ +V+K+   D   + +   D +T        + N T  
Sbjct  174   RCDAKDDAGLKKIFATACSEVDRIVAKLATFDAQLVPT---DIDTGGAVTLKYESNFTQD  230

Query  1043  EYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCI  1222
             E++NAV    E+I AGDIFQ+V+SQR +   + DPFE+YR LRIVNPSP+M +++     
Sbjct  231   EFENAVRGCVEYIRAGDIFQVVISQRLQTAISCDPFEIYRTLRIVNPSPFMFFLRTAETT  290

Query  1223  LVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGR  1402
             LV SSPEI+ RV    V  RPLAGT  RGK  EED  L   LL D KERAEH MLVDLGR
Sbjct  291   LVGSSPEIMVRVVDGHVTVRPLAGTRPRGKNEEEDNALAEELLADPKERAEHVMLVDLGR  350

Query  1403  NDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAP  1582
             NDVG+V++  SV +  +M IERYSHVMHI+S VTG+L D    +DAL A LP GTVSGAP
Sbjct  351   NDVGRVAQYRSVEISDVMVIERYSHVMHITSNVTGQLRDDCDAFDALAACLPAGTVSGAP  410

Query  1583  KVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSRRKEWI  1762
             KV+AME+IDQ E  RRGPY+G  G I + G+MD  +ALRTIV + DG            +
Sbjct  411   KVRAMEIIDQFETRRRGPYAGAVGYIDYSGNMDTCIALRTIV-IQDG------------V  457

Query  1763  AHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAE  1873
             A++Q+GAG+V DS+P SE +E  NK  GL +AI++ E
Sbjct  458   AYVQAGAGMVVDSDPSSEYQETLNKARGLLKAIEITE  494



>ref|WP_022812490.1| anthranilate synthase subunit I [Poribacteria bacterium WGA-3G]
Length=500

 Score =   385 bits (990),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 223/518 (43%), Positives = 309/518 (60%), Gaps = 28/518 (5%)
 Frame = +2

Query  335   FIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYS  514
             F E +K  N +P+++ I +D  TPV A+  L+  +     +FL ESVE G    T+ RYS
Sbjct  9     FKEKAKLGNTVPVYRPILADMETPVSAFYKLMPNN----YAFLLESVEGGE---TLARYS  61

Query  515   VVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFCG  694
              +G QP+M   +K ++VTI D  +G+   +  EDP+     + + ++P    DLP  F G
Sbjct  62    FLGTQPSMLFHSKGHQVTIEDLATGETISQECEDPLRALEEMLQNYQPVEVEDLPQ-FHG  120

Query  695   GWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVRL  874
             G VGY SYD VR+VE+  LP   + +DD  LPD    + + ++VFDHV+ +  ++   R+
Sbjct  121   GAVGYMSYDMVRFVEE--LP--DSTEDDLQLPDCFFMITETILVFDHVNHQIKVVANARV  176

Query  875   DSYSSASKAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPS-LAKGNMTSGEYK  1051
             +       AY +    +EALV K+  V   +L+  + D   +   P    + N T   Y+
Sbjct  177   NG--DVDAAYADAIANIEALVEKLTTVSEVQLTDNNADRQAQPANPPPELQSNFTKDAYE  234

Query  1052  NAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGCILVA  1231
               V +AK +I AGDI Q+V SQR  R  + D F+VYRALR+VNPSPYM Y++     +V 
Sbjct  235   AVVRRAKTYIAAGDIIQVVPSQRLSRPVSVDAFDVYRALRVVNPSPYMYYLKFDAFDIVG  294

Query  1232  SSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLGRNDv  1411
             +SPE++ RV+   V   P+AGT  RG TPEED  LE +LL D KERAEH MLVDLGRND+
Sbjct  295   ASPEMMVRVEDGIVQTVPIAGTRPRGTTPEEDKELERMLLADPKERAEHVMLVDLGRNDL  354

Query  1412  gkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGAPKVK  1591
             G+V +  +V V  LM +ER+SHVMHI S V G+L +  T +D LRA LP GT+SGAPKV+
Sbjct  355   GRVCEYHTVEVTELMIVERFSHVMHIVSYVVGQLREEFTAFDVLRACLPAGTLSGAPKVR  414

Query  1592  AMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSRRKEWIAHL  1771
             AME+ID+LE+TRR  Y G  G  SF G  D A+ +RT V              K+  A++
Sbjct  415   AMEIIDELESTRRATYGGAVGYFSFSGSADTAITIRTAVI-------------KDGTAYV  461

Query  1772  QSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFV  1885
             Q+G GIVADS P +E  E  NK   +  AI+LAE  F+
Sbjct  462   QAGGGIVADSVPQNEYYETLNKARAMFTAIELAEQGFL  499



>ref|WP_008675689.1| anthranilate synthase component I [Rhodopirellula sallentina]
 gb|EMI57213.1| anthranilate synthase component I [Rhodopirellula sallentina 
SM41]
Length=503

 Score =   384 bits (985),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 226/515 (44%), Positives = 301/515 (58%), Gaps = 33/515 (6%)
 Frame = +2

Query  332   KFIEASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRY  511
             +F E ++  + +P+++ + SD LTPV A++ L    D   P+FL ESV  G +   VGRY
Sbjct  8     EFAELARRYDFVPVYRRLLSDALTPVTAFKLL----DDGGPAFLIESVIGGEK---VGRY  60

Query  512   SVVGAQPTMEILAKENKVTILDHDSGKLTEKVVEDPMTVARSISEEWKPQLTADLPDAFC  691
             S +G++P     AK   V   +  +G++ E   +DP+   R    +    L A  P  F 
Sbjct  61    SFLGSKPLARFTAKGKTVWQTETSTGEVRESTCDDPLDEFRKHFRDRTATLDALPP--FI  118

Query  692   GGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVR  871
             GG +GY  YD VRYVE   LP   + +DDRNLPD+    Y  + VFDHVDK   I+    
Sbjct  119   GGAIGYAGYDVVRYVED--LP--DSTEDDRNLPDLDFAFYHTLCVFDHVDKTITIVSLAD  174

Query  872   LDSYSSAS----KAYREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKGNMTS  1039
                 S        AY E   Q++     ++ +D P            +      + N T 
Sbjct  175   CREISETGGDIESAYAEAAGQVD---QTIEQLDQPLPHQCEEILEADQRHQLSVESNFTR  231

Query  1040  GEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGC  1219
               + +AV K  E+I AGDIFQ+V SQR    +  DP  VYR+LR+VNPSP+M ++++  C
Sbjct  232   ESFCDAVRKCVEYIRAGDIFQVVPSQRLSVHSDVDPLAVYRSLRVVNPSPFMFFVRSPSC  291

Query  1220  ILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLG  1399
             +LV  SPEI+ RVK   V  RPLAGT  RG T  ED+ LE  LL D KERAEH MLVDLG
Sbjct  292   VLVGCSPEIMCRVKNGTVTVRPLAGTRPRGATEAEDIALEKELLADPKERAEHVMLVDLG  351

Query  1400  RNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGA  1579
             RND+G+V++ G+V++  +M IERYSHVMHISS V G+L + L  +DAL+A LP GTVSGA
Sbjct  352   RNDIGRVAEFGTVDLTEIMVIERYSHVMHISSEVRGKLREGLDAFDALKACLPAGTVSGA  411

Query  1580  PKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSRRKEW  1759
             PKV+AME+ID++E  RRGPY G  G I + G+MD  LALRTIVF ND             
Sbjct  412   PKVRAMEVIDEIEPHRRGPYGGAVGYIDYRGNMDTCLALRTIVFQNDTY-----------  460

Query  1760  IAHLQSGAGIVADSNPDSEQKECENKVAGLSRAID  1864
               H+Q+G G+VADS+PD E +E  NK   L  AI+
Sbjct  461   --HVQAGCGVVADSDPDMEYQETLNKARALIAAIE  493



>ref|WP_013109037.1| anthranilate synthase subunit I [Planctomyces limnophilus]
 ref|YP_003628805.1| anthranilate synthase component I [Planctomyces limnophilus DSM 
3776]
 gb|ADG66606.1| anthranilate synthase component I [Planctomyces limnophilus DSM 
3776]
Length=539

 Score =   382 bits (980),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 231/523 (44%), Positives = 317/523 (61%), Gaps = 41/523 (8%)
 Frame = +2

Query  341   EASKTSNLIPLHKCIFSDHLTPVLAYRCLVDEDDRETPSFLFESVEPGSRSSTVGRYSVV  520
             E    + ++P+++ +FSD LTPV AY  +       T SFLFESV  G +   VGRYS  
Sbjct  51    EGKPFAVMVPVYRQLFSDTLTPVSAYSRI----RSSTCSFLFESVVGGEQ---VGRYSFS  103

Query  521   GAQPTMEILAKENKVTILDHDSGKL---TEKVVEDPMTVARSISEEWKPQLTADLPDAFC  691
             GA P + I A    V I    S  +   T    +DP+    ++   +      +LP  F 
Sbjct  104   GANPFLTISASGESVVIETDPSRTMEVPTTYTSQDPLGELEALLGRYPGVHLPELPR-FI  162

Query  692   GGWVGYFSYDTVRYVEKKKLPFASAPQDDRNLPDIHLGLYDNVIVFDHVDKKAFIIHWVR  871
             GG VGY  YDTVRYVE   LP   AP DDR LPD+   +YD +++FDH+ K   ++  V 
Sbjct  163   GGAVGYAGYDTVRYVEH--LP--KAPYDDRQLPDLVFSIYDLMVIFDHIQKTVLVVAHVP  218

Query  872   LDSYSSASKA-YREGKKQLEALVSKVQDVDPPRLSSASVDFNTREFGPSLAKG---NMTS  1039
             +  Y   S A Y    ++++ LV K+    P +L+ A V    +  GP +++G   N + 
Sbjct  219   V--YGKVSLADYESACERIDLLVEKLSQ--PDQLAIADV----KPLGP-VSEGYTSNFSQ  269

Query  1040  GEYKNAVLKAKEHILAGDIFQIVLSQRFERRTTADPFEVYRALRIVNPSPYMTYMQARGC  1219
               ++  V KAKE+I +GDIFQ+VLSQR  RR+ A P ++YRALR+VNPSP+M  ++    
Sbjct  270   AGFEEIVEKAKEYIRSGDIFQVVLSQRLTRRSKASPLDIYRALRVVNPSPFMFLLETADS  329

Query  1220  ILVASSPEILTRVKKNRVVNRPLAGTAKRGKTPEEDVMLEMLLLNDEKERAEHTMLVDLG  1399
              L+ +SPEI+ RV++     RPLAGT +RG+T EED  LE+ LL DEKE AEH MLVDL 
Sbjct  330   QLIGASPEIMVRVEEGETTIRPLAGTRRRGRTIEEDRALEIELLADEKELAEHIMLVDLA  389

Query  1400  RNDvgkvsksgsvNVERLMNIERYSHVMHISSTVTGELLDHLTCWDALRAALPVGTVSGA  1579
             RNDVG+V+  G++ +  +M +ERYSHVMHI+S V+G+L +  T  DALR+ LP GTVSGA
Sbjct  390   RNDVGRVAAFGTIRLSDMMRVERYSHVMHITSNVSGQLAEGKTPLDALRSGLPAGTVSGA  449

Query  1580  PKVKAMELIDQLEATRRGPYSGGFGGISFVGDMDIALALRTIVFLNDGMNDTLSSRRKEW  1759
             PKV+AM++ID+LE  RRGPY G  G I F G++D  +ALRT+V              K+ 
Sbjct  450   PKVRAMQIIDELEPHRRGPYGGAVGYIDFSGNLDTCIALRTLVV-------------KDG  496

Query  1760  IAHLQSGAGIVADSNPDSEQKECENKVAGLSRAIDLAESAFVK  1888
             + +LQ+GAGIVADS P  E +E  NK   L RAI++AE    +
Sbjct  497   VVYLQAGAGIVADSVPALEYEETLNKAKALLRAIEVAEKQLTQ  539



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6982778187766