BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16491_g2_i1 len=1278 path=[2877:0-1277]

Length=1278
                                                                      Score     E

emb|CDP15553.1|  unnamed protein product                                195   2e-51   
ref|XP_002275098.1|  PREDICTED: BEL1-like homeodomain protein 1         186   1e-48   Vitis vinifera
emb|CAN69527.1|  hypothetical protein VITISV_027380                     184   9e-48   Vitis vinifera
ref|XP_009629592.1|  PREDICTED: BEL1-like homeodomain protein 1         181   1e-46   
ref|XP_009778869.1|  PREDICTED: BEL1-like homeodomain protein 1         179   6e-46   
ref|XP_007150022.1|  hypothetical protein PHAVU_005G119300g             163   1e-40   
ref|XP_007015671.1|  BEL1 homeodomain 1, putative                       157   2e-38   
ref|XP_002299773.2|  hypothetical protein POPTR_0001s22430g             151   2e-36   Populus trichocarpa [western balsam poplar]
gb|KHN17979.1|  BEL1-like homeodomain protein 1                         149   2e-36   
ref|XP_003539486.1|  PREDICTED: BEL1-like homeodomain protein 1-like    149   2e-36   
ref|XP_010247184.1|  PREDICTED: BEL1-like homeodomain protein 1         147   6e-35   
ref|XP_011021429.1|  PREDICTED: BEL1-like homeodomain protein 1         147   9e-35   
ref|XP_003543416.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    144   5e-34   
ref|XP_008230296.1|  PREDICTED: BEL1-like homeodomain protein 1         143   9e-34   
ref|XP_007208166.1|  hypothetical protein PRUPE_ppa002583mg             142   1e-33   
ref|XP_011003835.1|  PREDICTED: BEL1-like homeodomain protein 1         143   2e-33   
ref|XP_006373820.1|  hypothetical protein POPTR_0016s07040g             142   3e-33   
ref|XP_002266838.1|  PREDICTED: BEL1-like homeodomain protein 1         140   1e-32   Vitis vinifera
emb|CAN63083.1|  hypothetical protein VITISV_015358                     140   1e-32   Vitis vinifera
ref|XP_007150021.1|  hypothetical protein PHAVU_005G119300g             140   1e-32   
ref|XP_011042587.1|  PREDICTED: BEL1-like homeodomain protein 1         138   5e-32   
ref|XP_006381943.1|  hypothetical protein POPTR_0006s21950g             135   6e-31   
ref|XP_011046419.1|  PREDICTED: BEL1-like homeodomain protein 1         133   2e-30   
ref|XP_010685441.1|  PREDICTED: BEL1-like homeodomain protein 1         133   3e-30   
ref|XP_010263012.1|  PREDICTED: BEL1-like homeodomain protein 1         133   3e-30   
ref|NP_001274921.1|  BEL1-related homeotic protein 5                    132   4e-30   
ref|NP_001234599.1|  bell-like homeodomain protein 2                    132   5e-30   
gb|ACD39468.1|  BEL5 protein                                            132   9e-30   Solanum etuberosum
gb|ACD39464.1|  BEL5 protein                                            131   1e-29   Solanum palustre
ref|XP_006361091.1|  PREDICTED: BEL1-related homeotic protein 5         130   2e-29   
gb|KDO70617.1|  hypothetical protein CISIN_1g005514mg                   126   8e-28   
ref|XP_006430060.1|  hypothetical protein CICLE_v10011201mg             125   9e-28   
gb|KDP36113.1|  hypothetical protein JCGZ_08757                         125   1e-27   
gb|AFV46214.1|  hypothetical protein                                    120   1e-27   
gb|KHG11905.1|  BEL1-like homeodomain protein 1                         125   1e-27   
ref|XP_006481599.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    125   1e-27   
gb|KHG11906.1|  BEL1-like homeodomain protein 1                         125   1e-27   
emb|CBI24428.3|  unnamed protein product                                124   1e-27   
ref|XP_009773899.1|  PREDICTED: BEL1-like homeodomain protein 1         124   2e-27   
ref|XP_002524053.1|  bel1 homeotic protein, putative                    124   2e-27   Ricinus communis
ref|XP_010107001.1|  BEL1-like homeodomain protein 1                    119   3e-26   
gb|KHN48417.1|  BEL1-like homeodomain protein 1                         118   6e-26   
ref|XP_003535815.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    118   3e-25   
gb|KDO46590.1|  hypothetical protein CISIN_1g005901mg                   118   3e-25   
ref|XP_007027982.1|  BEL1-like homeodomain protein 1 isoform 1          118   3e-25   
ref|XP_006424091.1|  hypothetical protein CICLE_v10027955mg             117   7e-25   
ref|XP_006494895.1|  PREDICTED: BEL1-like homeodomain protein 1-like    116   1e-24   
gb|KHN10043.1|  BEL1-like homeodomain protein 1                         114   1e-24   
ref|XP_008241058.1|  PREDICTED: BEL1-like homeodomain protein 1         116   1e-24   
ref|XP_007204250.1|  hypothetical protein PRUPE_ppa002158mg             116   2e-24   
ref|XP_003519115.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    115   3e-24   
ref|XP_007132496.1|  hypothetical protein PHAVU_011G099100g             114   7e-24   
gb|KHG01894.1|  BEL1-like homeodomain protein 1                         109   2e-22   
gb|AAN03622.1|AF406698_1  BEL1-related homeotic protein 11              105   2e-21   Solanum tuberosum [potatoes]
ref|XP_006362847.1|  PREDICTED: BEL1-like homeodomain protein 1-like    106   3e-21   
gb|KHN21192.1|  BEL1-like homeodomain protein 1                         105   3e-21   
ref|XP_003540818.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    105   4e-21   
ref|XP_009348973.1|  PREDICTED: BEL1-like homeodomain protein 1         105   6e-21   
gb|KHN33154.1|  BEL1-like homeodomain protein 1                         102   2e-20   
ref|XP_007145789.1|  hypothetical protein PHAVU_007G267900g             103   3e-20   
ref|XP_009613053.1|  PREDICTED: BEL1-like homeodomain protein 1         102   3e-20   
ref|XP_008360598.1|  PREDICTED: BEL1-like homeodomain protein 1         102   3e-20   
ref|XP_008391977.1|  PREDICTED: BEL1-like homeodomain protein 1         102   3e-20   
ref|XP_010059079.1|  PREDICTED: BEL1-like homeodomain protein 1         102   3e-20   
ref|XP_003521496.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    102   5e-20   
ref|XP_009787672.1|  PREDICTED: BEL1-like homeodomain protein 1         102   5e-20   
gb|KHF99976.1|  BEL1-like homeodomain protein 1                         101   1e-19   
ref|XP_009628712.1|  PREDICTED: BEL1-like homeodomain protein 1         100   2e-19   
ref|XP_007162972.1|  hypothetical protein PHAVU_001G195800g           99.0    7e-19   
gb|KHG12855.1|  BEL1-like homeodomain protein 1                       98.6    8e-19   
gb|KHG12856.1|  BEL1-like homeodomain protein 1                       98.6    9e-19   
ref|XP_008387112.1|  PREDICTED: BEL1-like homeodomain protein 1       98.2    1e-18   
gb|ACD39466.1|  BEL29 protein                                         97.4    2e-18   Solanum palustre
ref|XP_004228612.1|  PREDICTED: BEL1-like homeodomain protein 1       96.3    6e-18   
ref|XP_010313381.1|  PREDICTED: BEL1-like homeodomain protein 1       94.7    2e-17   
gb|KHN19925.1|  BEL1-like homeodomain protein 1                       94.4    2e-17   
gb|AAN03626.1|AF406702_1  BEL1-related homeotic protein 29            94.4    2e-17   Solanum tuberosum [potatoes]
ref|XP_003539151.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  94.0    3e-17   
dbj|BAE71188.1|  BEL1-like homeodomain transcription factor           93.6    4e-17   Trifolium pratense [peavine clover]
ref|XP_004303380.1|  PREDICTED: BEL1-like homeodomain protein 1-like  93.6    4e-17   
ref|XP_010093716.1|  BEL1-like homeodomain protein 1                  92.0    6e-17   
ref|XP_010089795.1|  BEL1-like homeodomain protein 1                  92.4    1e-16   
gb|KEH29763.1|  BEL1-related homeotic protein                         90.9    3e-16   
gb|ACD39469.1|  BEL29 protein                                         89.4    7e-16   Solanum etuberosum
ref|XP_006348466.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  89.4    9e-16   
ref|XP_011094236.1|  PREDICTED: BEL1-like homeodomain protein 1       88.6    2e-15   
ref|XP_004494251.1|  PREDICTED: BEL1-like homeodomain protein 1-like  87.8    4e-15   
ref|XP_008784116.1|  PREDICTED: BEL1-like homeodomain protein 1       85.9    1e-14   
ref|XP_010543869.1|  PREDICTED: BEL1-like homeodomain protein 1 i...  85.1    2e-14   
ref|XP_010543867.1|  PREDICTED: BEL1-like homeodomain protein 1 i...  84.7    3e-14   
gb|KEH24245.1|  BEL1-related homeotic protein                         82.4    2e-13   
ref|XP_010557975.1|  PREDICTED: BEL1-like homeodomain protein 1       82.0    2e-13   
emb|CDP10596.1|  unnamed protein product                              82.0    2e-13   
ref|XP_011090301.1|  PREDICTED: BEL1-like homeodomain protein 1       81.3    4e-13   
ref|XP_003554466.1|  PREDICTED: BEL1-like homeodomain protein 1-l...  80.5    9e-13   
gb|KHN08605.1|  BEL1-like homeodomain protein 1                       80.1    9e-13   
ref|XP_009133059.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...  79.3    2e-12   
ref|XP_002313498.2|  hypothetical protein POPTR_0009s02250g           79.3    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_004171976.1|  PREDICTED: BEL1-like homeodomain protein 1-like  79.3    2e-12   
ref|XP_004136516.1|  PREDICTED: BEL1-like homeodomain protein 1-like  79.3    2e-12   
ref|XP_008367359.1|  PREDICTED: BEL1-like homeodomain protein 1       78.2    2e-12   
emb|CDX84585.1|  BnaA03g16450D                                        78.6    3e-12   
ref|XP_008442920.1|  PREDICTED: BEL1-like homeodomain protein 1       78.2    5e-12   
ref|XP_004140170.1|  PREDICTED: BEL1-like homeodomain protein 1-like  76.6    1e-11   
ref|XP_008449596.1|  PREDICTED: BEL1-like homeodomain protein 1       76.3    2e-11   
ref|XP_006854627.1|  hypothetical protein AMTR_s00030p00173920        75.1    4e-11   
gb|EPS58511.1|  hypothetical protein M569_16303                       72.8    6e-11   
ref|XP_010031566.1|  PREDICTED: BEL1-like homeodomain protein 1       74.7    6e-11   
gb|ACC77468.1|  BEL1                                                  74.3    7e-11   Kalanchoe x houghtonii
emb|CDX79646.1|  BnaC03g19820D                                        74.3    8e-11   
gb|EYU18114.1|  hypothetical protein MIMGU_mgv1a010011mg              72.0    1e-10   
emb|CDY32069.1|  BnaC04g44970D                                        72.8    2e-10   
ref|XP_010521016.1|  PREDICTED: BEL1-like homeodomain protein 1       72.0    4e-10   
ref|XP_010912386.1|  PREDICTED: BEL1-like homeodomain protein 1       71.6    5e-10   
ref|XP_004506223.1|  PREDICTED: BEL1-like homeodomain protein 1-like  70.1    2e-09   
gb|AFK35661.1|  unknown                                               67.0    3e-09   
emb|CDX84171.1|  BnaC04g09330D                                        67.4    1e-08   
emb|CDX75085.1|  BnaA05g08310D                                        66.6    2e-08   
gb|KEH41936.1|  BEL1-related homeotic protein                         66.6    2e-08   
ref|XP_008799712.1|  PREDICTED: BEL1-like homeodomain protein 1       64.3    1e-07   
ref|XP_010507571.1|  PREDICTED: BEL1-like homeodomain protein 1       61.6    2e-07   
ref|XP_006293790.1|  hypothetical protein CARUB_v10022772mg           62.8    4e-07   
ref|XP_010676226.1|  PREDICTED: BEL1-like homeodomain protein 1 i...  62.4    5e-07   
ref|XP_010505121.1|  PREDICTED: BEL1-like homeodomain protein 1       61.6    8e-07   
ref|XP_002881420.1|  hypothetical protein ARALYDRAFT_482564           61.2    9e-07   
gb|AAK43836.1|AF353094_1  BEL1-like homeodomain 1                     61.2    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181138.1|  BEL1-like homeodomain 1                             60.8    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010509532.1|  PREDICTED: BEL1-like homeodomain protein 1       60.5    2e-06   
emb|CDY40420.1|  BnaA04g20970D                                        59.7    3e-06   
ref|XP_009141535.1|  PREDICTED: BEL1-like homeodomain protein 1       59.7    3e-06   
gb|AEW08020.1|  hypothetical protein 0_17161_01                       55.5    7e-06   
ref|XP_004497655.1|  PREDICTED: BEL1-like homeodomain protein 1-like  58.5    8e-06   
gb|AEW08021.1|  hypothetical protein 0_17161_01                       55.1    9e-06   
gb|AFB32720.1|  hypothetical protein 0_17161_01                       55.1    9e-06   
gb|AFB32721.1|  hypothetical protein 0_17161_01                       53.9    2e-05   
gb|AEW09251.1|  hypothetical protein UMN_1142_01                      53.5    2e-05   
ref|XP_006410764.1|  hypothetical protein EUTSA_v10016349mg           57.0    2e-05   
gb|AEW09250.1|  hypothetical protein UMN_1142_01                      52.8    4e-05   
ref|XP_010516801.1|  PREDICTED: BEL1-like homeodomain protein 1       54.3    6e-05   
ref|XP_009420594.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...  54.3    1e-04   
gb|AFB32724.1|  hypothetical protein 0_17161_01                       51.2    2e-04   



>emb|CDP15553.1| unnamed protein product [Coffea canephora]
Length=725

 Score =   195 bits (495),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 181/291 (62%), Gaps = 42/291 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNI-----  1112
             LWKPMVEEMY EE K  EQ G            +E+NKE+GS ++T K+   + I     
Sbjct  461   LWKPMVEEMYLEETKNHEQDG------------SESNKELGSTSTTAKENNVARIDQRSI  508

Query  1111  ----QDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGK  944
                 Q+     +A+  EISTS +T SPTG S   PQ  GG  F  I  LNME   E+N K
Sbjct  509   LQSKQEKQIAQDATHAEISTSSLTPSPTGTS---PQARGG--FGLIGALNMEANVEKNSK  563

Query  943   KPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMA--AAN  770
             K R + +Q+SPSSILSVDM+MK   GE  KG+++   T+ R      + F  LM   A +
Sbjct  564   KMRTE-MQNSPSSILSVDMEMK--FGEPRKGFDNKFSTSQR--ETNKDGF-SLMVNNAGH  617

Query  769   TggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVS-GSQQNYLSTHQDME  593
               GFG F +G+ G+FNPE LT GFH GN VSLTLGLPPSENLA+S G+QQNYLS  Q+ME
Sbjct  618   GNGFGAFNLGELGQFNPEQLTTGFH-GNSVSLTLGLPPSENLALSAGTQQNYLSD-QNME  675

Query  592   LGRRLEMGRMG--IDN-NPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFV  449
             L  RLEMG M    D  N   +SHS++  GYETI+F N KRFAAQLLPDFV
Sbjct  676   LEDRLEMGTMDGHYDRVNKTQTSHSSL--GYETINFDNRKRFAAQLLPDFV  724



>ref|XP_002275098.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
Length=728

 Score =   186 bits (473),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 140/293 (48%), Positives = 181/293 (62%), Gaps = 38/293 (13%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNI-----  1112
             LWKPMVEEMY EE+K QE + GS +NA+    ++EANKE+GS ++  ++   + +     
Sbjct  458   LWKPMVEEMYLEEIKDQE-HNGSQDNAS----KSEANKELGSKSTAAQESGATRVDQTND  512

Query  1111  ----QDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGK  944
                 Q+ +   NASP E+S S M+ SP G  SLQ Q G    F+ I +  +E   +R+ K
Sbjct  513   FQSKQEKSTTQNASPAELSNSTMSTSPMG-GSLQVQAG----FNLIGSSEIEGMVQRSPK  567

Query  943   KPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTg  764
             KPR+ +IQSSPSSILS+DM+MK             KF ++R    A + +P +  A N G
Sbjct  568   KPRSYDIQSSPSSILSMDMEMKPGGTSREISM---KFGSERQ---AKDGYPLITGAINNG  621

Query  763   --gfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMEL  590
                     IGD GRFNPE L   FH GN VSLTLGLP  ENL++SGSQQ+YLS + +++L
Sbjct  622   GGFGAYSPIGDIGRFNPEQLAPRFH-GNSVSLTLGLPHCENLSLSGSQQSYLS-NPNVQL  679

Query  589   GRRLEMG-----RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             GRRLEMG       GI N  QP SHS  N  Y++I+ QN KRFAAQLLPDFVA
Sbjct  680   GRRLEMGNGEPDYCGI-NAAQP-SHS--NAAYDSINIQNRKRFAAQLLPDFVA  728



>emb|CAN69527.1| hypothetical protein VITISV_027380 [Vitis vinifera]
Length=728

 Score =   184 bits (466),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 139/293 (47%), Positives = 180/293 (61%), Gaps = 38/293 (13%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNI-----  1112
             LWKPMVEEMY EE+K QE + GS +N +    ++EANKE+GS ++  ++   + +     
Sbjct  458   LWKPMVEEMYLEEIKDQE-HNGSQDNXS----KSEANKELGSKSTAAQESGATRVDQTND  512

Query  1111  ----QDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGK  944
                 Q+ +   NASP E+S S M+ SP G  SLQ Q G    F+ I +  +E   +R+ K
Sbjct  513   FQSKQEKSTTQNASPAELSNSTMSTSPMG-GSLQVQAG----FNLIGSSEIEGMVQRSPK  567

Query  943   KPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTg  764
             KPR+ +IQSSPSSILS+DM+MK             KF ++R    A + +P +  A N G
Sbjct  568   KPRSYDIQSSPSSILSMDMEMKPGGTSREISM---KFGSERQ---AKDGYPLITGAINNG  621

Query  763   --gfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMEL  590
                     IGD GRFNPE L   FH GN VSLTLGLP  ENL++SGSQQ+YLS + +++L
Sbjct  622   GGFGAYXPIGDIGRFNPEQLAPRFH-GNSVSLTLGLPHCENLSLSGSQQSYLS-NPNVQL  679

Query  589   GRRLEMG-----RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             GRRLEMG       GI N  QP SHS  N  Y++I+ QN KRFAAQLLPDFVA
Sbjct  680   GRRLEMGNGEPDYCGI-NAAQP-SHS--NAAYDSINIQNRKRFAAQLLPDFVA  728



>ref|XP_009629592.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009629593.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=730

 Score =   181 bits (458),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 137/286 (48%), Positives = 175/286 (61%), Gaps = 42/286 (15%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNI----Q  1109
             LWKPMVEEMY EE+K  ++  G  ENA       E NKE+ + +S+ ++  T+N+    Q
Sbjct  478   LWKPMVEEMYLEEVKNNQEQNGLEENANNI----EPNKEMRTKSSSPQE--TTNLRKDKQ  531

Query  1108  DnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENA-GERNGKKPRN  932
              ++   +ASPTEIS S ++ SPT   SL  Q  G   FSFI +LNMEN+  ERN KKPRN
Sbjct  532   ISSILQDASPTEISCSTISTSPTA-GSLPAQAAG---FSFIGSLNMENSTSERNNKKPRN  587

Query  931   DNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfgg  752
             D +Q+S SSILS++ +MK  AG   KG    KF  D    A  +++P LM A +T G  G
Sbjct  588   D-MQNSSSSILSMETEMK--AGNTRKG---EKFNGDNR-QARDQSYP-LMTAYSTMGEFG  639

Query  751   ftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEM  572
                      NPE   A    GNGVSLTLGLPPSENL +SG+Q N+L    +  +G  +EM
Sbjct  640   RF-------NPEQQMATRFQGNGVSLTLGLPPSENLVLSGNQHNFLP---NQNIG--IEM  687

Query  571   GRMGID----NNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             GR+        NPQP SH +I   YE IDFQ+GKR+AAQLLPDFV+
Sbjct  688   GRIETHYNRMTNPQP-SHPSIT--YENIDFQSGKRYAAQLLPDFVS  730



>ref|XP_009778869.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009778870.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009778871.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
Length=732

 Score =   179 bits (453),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 141/286 (49%), Positives = 179/286 (63%), Gaps = 41/286 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNI----Q  1109
             LWKPMVEEMY EE+K  ++  G  ENA    K NE NKE+ + +S  ++  T+N+    Q
Sbjct  479   LWKPMVEEMYLEEVKNNQEQNGLEENA---NKNNEPNKEMCTKSSAPQE--TTNLRKDKQ  533

Query  1108  DnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENA-GERNGKKPRN  932
              ++   +ASPTEIS+S ++ SPTG  SL  Q  G   FSFI +LNMEN+  ERN KK RN
Sbjct  534   ISSILQDASPTEISSSTISTSPTG-GSLPAQAAG---FSFIGSLNMENSTSERNNKKARN  589

Query  931   DNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfgg  752
             D +Q+S SSILS++ +MK  AG+  KG    KF  D    A  +++P LM A +T G  G
Sbjct  590   D-MQNSSSSILSMETEMK--AGDTRKG---EKFNGDNR-QARDQSYP-LMTAYSTMGEFG  641

Query  751   ftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEM  572
                      NPE   A    GNGVSLTLGLPPSENL +SGSQ N+L    +  +G  +EM
Sbjct  642   RF-------NPEQQMATSFQGNGVSLTLGLPPSENLVLSGSQHNFLP---NQNIG--IEM  689

Query  571   GRMGID----NNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             GR+       +NPQP SH NI   YE IDFQ+GKR+AAQLLPDFV+
Sbjct  690   GRIETHYNRMSNPQP-SHPNIT--YENIDFQSGKRYAAQLLPDFVS  732



>ref|XP_007150022.1| hypothetical protein PHAVU_005G119300g [Phaseolus vulgaris]
 gb|ESW22016.1| hypothetical protein PHAVU_005G119300g [Phaseolus vulgaris]
Length=702

 Score =   163 bits (412),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 129/290 (44%), Positives = 163/290 (56%), Gaps = 36/290 (12%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQE---KTSNIQ-  1109
             LWKPMVEEMY EEMK  EQ  GS EN+    +  E +KE+GS  +   +    K  N+Q 
Sbjct  436   LWKPMVEEMYLEEMKDHEQANGS-ENS----RSKELSKELGSTANVAPESGAIKLDNLQS  490

Query  1108  --DnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPR  935
               D+ NN N SP EIST+         SS+ P GG   + S  +     +  +R+  KPR
Sbjct  491   KQDSFNNQNTSPNEISTN---------SSMSPIGGSLQSHSGFHLAGSSDV-QRSPNKPR  540

Query  934   NDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfg  755
             +  +Q+SPSSILSVDM+MK     AN    + KF+ +R      + +P LM+     G G
Sbjct  541   SLEMQNSPSSILSVDMEMKHNGEHANTREANTKFSIER---HHKDGYP-LMSGNTNQGGG  596

Query  754   gftigdfgrFNPENLT----AGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELG  587
                       N  N+T    A   HGNGVSLTLGLP +ENL++SG+Q  +LS  Q++ LG
Sbjct  597   FGAFAMEDIGNRFNVTTEQLASRFHGNGVSLTLGLPHNENLSISGTQHGFLS--QNIHLG  654

Query  586   RRLEMGRMG---IDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             RRLEMG  G      N  PSSHS     YE+ID QN KRF AQLLPDFVA
Sbjct  655   RRLEMGTTGNEFCAINTPPSSHSGTT--YESIDIQNRKRFVAQLLPDFVA  702



>ref|XP_007015671.1| BEL1 homeodomain 1, putative [Theobroma cacao]
 gb|EOY33290.1| BEL1 homeodomain 1, putative [Theobroma cacao]
Length=732

 Score =   157 bits (396),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 130/290 (45%), Positives = 172/290 (59%), Gaps = 33/290 (11%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTE---KQEKTSNIQD  1106
             LWKPMVEEMY EE+K +E+  GS EN   + ++   +       S      Q KT +  D
Sbjct  463   LWKPMVEEMYLEEVKERER-NGSEENGNKSEQKESGSSSSAQQESAALKMDQVKTQSKPD  521

Query  1105  nnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNME-NAGERNGKKPRND  929
              + N N SPTE S S ++ SP G  SL PQ     AF+ I + +++  A  R+ KKPR  
Sbjct  522   KSINQNTSPTEFSNSTISTSPMG-GSLLPQT----AFNLIGSSDLDGTAARRSPKKPRGI  576

Query  928   N-IQSSPSSILSVDMDMKSA-AGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTg--g  761
             N + +SPSSILS+DMDMK     E N  +   + + D        ++  L   AN G   
Sbjct  577   NDMHNSPSSILSMDMDMKQGETREINIKFGEERLSKD--------SYSLLTGTANHGGGF  628

Query  760   fggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRR  581
                 T+G+ GRF+PE LT  F  GN VSLTLGLP  +NL++SG+QQN+LS +Q+++LGRR
Sbjct  629   GTYSTMGEIGRFDPEQLTPRFP-GNSVSLTLGLPHCDNLSLSGNQQNFLS-NQNIQLGRR  686

Query  580   LEMG-----RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             LE+G       GI+N  Q +SHS+   GYE I+ QN KRFAAQLLPDFVA
Sbjct  687   LELGPSESDFCGINN--QQASHSST--GYENIEMQNRKRFAAQLLPDFVA  732



>ref|XP_002299773.2| hypothetical protein POPTR_0001s22430g [Populus trichocarpa]
 gb|EEE84578.2| hypothetical protein POPTR_0001s22430g [Populus trichocarpa]
Length=732

 Score =   151 bits (382),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 129/293 (44%), Positives = 173/293 (59%), Gaps = 40/293 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQ----  1109
             LWKPMVEEMY EE+K +E+ G     +  +G +NE NKE GS++S   +  T ++     
Sbjct  464   LWKPMVEEMYLEEIKEREKDG-----SEESGGKNE-NKESGSHSSAPGESSTHHMDQLKG  517

Query  1108  --------DnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGER  953
                     +   N N SPT  S   ++ SP G +S Q Q G    F+ I    ME   + 
Sbjct  518   VVLQSKQPEKPTNQNGSPTRFSNPTISMSPMG-ASFQQQAG----FTLIGPAEMEGIAQ-  571

Query  952   NGKKPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAA  773
             + KKPR+ ++Q+SPSSILS+DMD+K        G N   F  DR      + +P L+  +
Sbjct  572   SSKKPRSGDMQNSPSSILSMDMDVKHGETSREIGVN---FGGDRL---TKDGYP-LITGS  624

Query  772   NTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDME  593
             N G FG + +GD GRFN E LT  F  GN VSLTLGLP  ENL++SG+QQNYLS+ Q+++
Sbjct  625   N-GSFGAYPMGDLGRFNIEQLTPRFS-GNSVSLTLGLPHCENLSLSGTQQNYLSS-QNIQ  681

Query  592   L-GRRLEMGRMGIDN---NPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             L GRR+E+G    D    N   +SHS  + G+E++D QN KRF AQLLPDFVA
Sbjct  682   LGGRRIEIGTSEPDFSGINTSQNSHS--SSGFESVDIQNRKRFPAQLLPDFVA  732



>gb|KHN17979.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=517

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 126/295 (43%), Positives = 165/295 (56%), Gaps = 39/295 (13%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTE------KQEKTSN  1115
             LWKPMVEEMY EE+K  EQ G + EN     K  E++KE+GS  +        K +   +
Sbjct  244   LWKPMVEEMYLEEIKEHEQ-GNASENT----KSKESSKELGSTANVAPESGAIKLDHLQS  298

Query  1114  IQDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPR  935
              Q++  + N SPTEIST+         SS+ P GG   + S  +     +   R+ KKPR
Sbjct  299   KQESFKHQNTSPTEISTN---------SSMSPMGGSLQSPSGFHLAGSSDMQIRSPKKPR  349

Query  934   NDNIQSSPSSILSVDMDMK---SAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN--  770
             +  IQ+SPSSILSV M+MK   +     N+  N+ KF  +R      + +P + + AN  
Sbjct  350   SSEIQNSPSSILSVGMEMKHNNNGDHANNREANNTKFGNER--HHQKDGYPLMTSNANHG  407

Query  769   --TggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQN-YLSTHQD  599
                G F    +G       E L + F HGNGVSLTLGLP +ENL++ G+QQ+ +LS  Q+
Sbjct  408   GGFGAFTMEDMGSRFNVTTEQLASRF-HGNGVSLTLGLPHNENLSMPGTQQHGFLS--QN  464

Query  598   MELGRRLEMGRMG---IDNNPQPSSHSNINGGYETIDFQNGKRFAA-QLLPDFVA  446
             + LGRRLEMG  G      N  PSSHS     YE+ID QN KRF A QLLPDFVA
Sbjct  465   IHLGRRLEMGTNGNEFCAINTPPSSHSGTT--YESIDIQNRKRFVAHQLLPDFVA  517



>ref|XP_003539486.1| PREDICTED: BEL1-like homeodomain protein 1-like, partial [Glycine 
max]
Length=526

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 128/295 (43%), Positives = 167/295 (57%), Gaps = 39/295 (13%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTE------KQEKTSN  1115
             LWKPMVEEMY EE+K  EQ G + EN     K  E++KE+GS  +        K +   +
Sbjct  253   LWKPMVEEMYLEEIKEHEQ-GNASENT----KSKESSKELGSTANVAPESGAIKLDHLQS  307

Query  1114  IQDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPR  935
              Q++  + N SPTEIST+  + SP G S   P G     F    + +M+    R+ KKPR
Sbjct  308   KQESFKHQNTSPTEISTN-SSMSPMGGSLQSPSG-----FHLAGSSDMQI---RSPKKPR  358

Query  934   NDNIQSSPSSILSVDMDMK---SAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN--  770
             +  IQ+SPSSILSV M+MK   +     N+  N+ KF  +R      + +P + + AN  
Sbjct  359   SSEIQNSPSSILSVGMEMKHNNNGDHANNREANNTKFGNER--HHQKDGYPLMTSNANHG  416

Query  769   --TggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQN-YLSTHQD  599
                G F    +G       E L + F HGNGVSLTLGLP +ENL++ G+QQ+ +LS  Q+
Sbjct  417   GGFGAFTMEDMGSRFNVTTEQLASRF-HGNGVSLTLGLPHNENLSMPGTQQHGFLS--QN  473

Query  598   MELGRRLEMGRMG---IDNNPQPSSHSNINGGYETIDFQNGKRFAA-QLLPDFVA  446
             + LGRRLEMG  G      N  PSSHS     YE+ID QN KRF A QLLPDFVA
Sbjct  474   IHLGRRLEMGTNGNEFCAINTPPSSHSGTT--YESIDIQNRKRFVAHQLLPDFVA  526



>ref|XP_010247184.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247191.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247201.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247208.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247219.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247226.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247233.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
Length=729

 Score =   147 bits (371),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 121/293 (41%), Positives = 167/293 (57%), Gaps = 40/293 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNS---------TEKQEK  1124
             LWKPMVEEMY EE+K QEQ G   + +     R+E N++ GS ++         T++ + 
Sbjct  461   LWKPMVEEMYLEEIKEQEQNGSEEKTS-----RSELNEDSGSKSTAPHENSPARTDQGKN  515

Query  1123  TSNIQDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGK  944
              S+ QDN+ N NA PT IS S  TA   G+  ++ Q G    FS I + +M+   + + K
Sbjct  516   FSSKQDNSTNPNAVPTAISNSSTTAIMGGI--MRSQTG----FSLIGSSDMDGLIQGSPK  569

Query  943   KPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTg  764
             KP +  +Q+SPSSI  +DMD+K   G++N+     KF   R    + + +  +    N G
Sbjct  570   KPCSTEMQNSPSSISVMDMDVK--PGDSNRDL-FAKFQNGR---QSRDGYSLITGTTNNG  623

Query  763   gfggftigdfg-rFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELG  587
                         RF+PE  T  F  GNGVSLTLGLP  ENL++SG+QQ +LS +Q+++LG
Sbjct  624   EAFDTYSIGELGRFDPEQFTPRFS-GNGVSLTLGLPHCENLSLSGTQQTFLS-NQNIQLG  681

Query  586   RRLEMG------RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             RRLEMG        G+     PS HS  +  YE I+ QN KRFAAQLLPD+VA
Sbjct  682   RRLEMGGGEPNDFCGLST---PSPHS--SAAYENINIQNRKRFAAQLLPDYVA  729



>ref|XP_011021429.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011021430.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011021431.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=732

 Score =   147 bits (370),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 123/302 (41%), Positives = 164/302 (54%), Gaps = 58/302 (19%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQ----  1109
             LWKPMVEEMY EE+K +E+ G     +  +G +NE  K+ GS++S   +  T ++     
Sbjct  464   LWKPMVEEMYLEEIKEREKDG-----SEDSGGKNE-KKDSGSHSSAPGESSTHHMDQLKG  517

Query  1108  --------DnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGER  953
                     +   N N SPT  S   ++ SP G +S Q Q G    F+ I    ME   + 
Sbjct  518   VVLQSKQPEKPTNQNGSPTRFSNPTISMSPMG-ASFQQQAG----FTLIGQAEMEGIAQ-  571

Query  952   NGKKPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNH--HKFTADRTPAAAAEN-----F  794
             + KKPR+ ++Q+SPSSILS+DMD+K        G N    + T D  P     N     +
Sbjct  572   SSKKPRSGDMQNSPSSILSMDMDVKHGETSREIGVNFGGERLTKDGYPLITGSNGSFGAY  631

Query  793   P--DLMAAANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQN  620
             P  DL                 GRFN E LT  F  GN VSLTLGLP  ENL++SG+QQN
Sbjct  632   PMGDL-----------------GRFNIEQLTPRFS-GNSVSLTLGLPHCENLSLSGTQQN  673

Query  619   YLSTHQDMEL-GRRLEMGRMGIDN---NPQPSSHSNINGGYETIDFQNGKRFAAQLLPDF  452
             YLS+ Q+++L GRR+E+G    D    N   +SHS  + G+E++D QN KRF AQLLPDF
Sbjct  674   YLSS-QNIQLGGRRIEIGTSEPDFSGINTSQNSHS--SSGFESVDIQNRKRFPAQLLPDF  730

Query  451   VA  446
             VA
Sbjct  731   VA  732



>ref|XP_003543416.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006594920.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006594921.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
 ref|XP_006594922.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Glycine 
max]
Length=702

 Score =   144 bits (363),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 127/287 (44%), Positives = 162/287 (56%), Gaps = 31/287 (11%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K  EQ  GS EN     K  E++KE+ S  +       S   ++ N
Sbjct  437   LWKPMVEEMYLEEIKEHEQGNGS-ENT----KSKESSKELASTANVALDHLQSK-HESFN  490

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQS  917
             N N SPTEISTS  ++      SLQ   G    F    + +M+    R+  KPR+  +Q+
Sbjct  491   NQNTSPTEISTS--SSMSPMGGSLQSHSG----FHLAGSSDMQ---IRSPNKPRSSEMQN  541

Query  916   SPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN----Tggfggf  749
             SPSSILSVDM+MK +    N    + KF  +R      + +P + +  N     G F   
Sbjct  542   SPSSILSVDMEMKHSGDHGNNRDANTKFGIERH-HQQKDGYPLMTSNPNHGGGFGAFTME  600

Query  748   tigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQN-YLSTHQDMELGRRLEM  572
              IG       E L + F HGNGVSLTLGLP +ENL++SG+QQ+ +LS  Q++ LGRRLEM
Sbjct  601   DIGSRFNVTTEQLASRF-HGNGVSLTLGLPHNENLSMSGTQQHGFLS--QNIHLGRRLEM  657

Query  571   GRMGID----NNPQPSSHSNINGGYETIDFQNGKRFAA-QLLPDFVA  446
             G  G +    N   PSSHS     YE+ID QN KRF A QLLPDFVA
Sbjct  658   GTNGNEFCTINTAPPSSHSGTT--YESIDIQNRKRFVAHQLLPDFVA  702



>ref|XP_008230296.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008230304.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
Length=655

 Score =   143 bits (360),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 119/290 (41%), Positives = 150/290 (52%), Gaps = 56/290 (19%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENA-----AAAGKRNEANKEIGSNNSTEKQEKTSNI  1112
             LWKPMVEEMY EE K QE+  GSG NA      +   R  A+  I         E  SN 
Sbjct  409   LWKPMVEEMYVEETKEQEK-NGSGNNANYKESGSTTPRESASTRIDDQMFRSTHENFSN-  466

Query  1111  QDnnnnnNASPTEIST-SIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPR  935
                    + SP E S  S ++ASP    SLQ Q G    F+ +   NM+ +     KK +
Sbjct  467   ------QHPSPNEKSNNSSLSASPMA-GSLQSQSG----FNLVGMSNMQGSP----KKRK  511

Query  934   NDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfg  755
             +  I++SPSSILSVD DMK  A E N+     + TAD          P++          
Sbjct  512   SSEIENSPSSILSVDADMK--ANETNR-----EITADHANGFGTYPIPEI----------  554

Query  754   gftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDM----ELG  587
                       NPE+L   FH GNGVSLTLGLP  EN ++SG+QQ++LS H  +    +LG
Sbjct  555   -----GRFDMNPEHLAQRFH-GNGVSLTLGLPHRENSSLSGTQQSFLSNHGQINIHDQLG  608

Query  586   RRLEMG---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             RR   G        N+PQP SHS I+  YE +D ++ KRFAAQLLPDFVA
Sbjct  609   RRFNTGGEADFCAINHPQP-SHSGID--YEDMDMRSRKRFAAQLLPDFVA  655



>ref|XP_007208166.1| hypothetical protein PRUPE_ppa002583mg [Prunus persica]
 gb|EMJ09365.1| hypothetical protein PRUPE_ppa002583mg [Prunus persica]
Length=655

 Score =   142 bits (359),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 118/294 (40%), Positives = 155/294 (53%), Gaps = 64/294 (22%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEAN-KEIGSNNSTEKQEKTSNIQDnn  1100
             LWKPMVEEMY EE K QE+           G RN AN KE GS  +T ++  ++ I D  
Sbjct  409   LWKPMVEEMYVEETKEQEK----------NGSRNTANYKESGS--TTPRESASTRIDDQM  456

Query  1099  nnnN--------ASPTEIST-SIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNG  947
               +          SP E S  S ++ASP    SLQ Q G    F+ +   NM+ +     
Sbjct  457   FRSTHENFSNQHPSPNEKSNNSSLSASPMA-GSLQSQSG----FNLVGMSNMQGSP----  507

Query  946   KKPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANT  767
             KK ++  I++SPSSILS+D DMK  A E N+     + T D          P++      
Sbjct  508   KKRKSSEIENSPSSILSMDTDMK--ANETNR-----EITTDHANGFGTYPIPEI------  554

Query  766   ggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDM---  596
                      +    NPE+L   FH GNGVSLTLGLP  EN+++SG+QQ++LS H  +   
Sbjct  555   ---------ERFDMNPEHLAQRFH-GNGVSLTLGLPHRENISLSGTQQSFLSNHGQINIH  604

Query  595   -ELGRRLEMG---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
              +LGRR   G        N+PQP SHS I+  YE +D ++ KRFAAQLLPDFVA
Sbjct  605   DQLGRRFNTGGEADFCAINHPQP-SHSGID--YEDMDMRSRKRFAAQLLPDFVA  655



>ref|XP_011003835.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003836.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003838.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003839.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003840.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003841.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=734

 Score =   143 bits (360),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 127/303 (42%), Positives = 160/303 (53%), Gaps = 60/303 (20%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKT--------  1121
             LWKPMVEEMY EE+KGQE+  GS E A     +NE NKE  S++S   +  T        
Sbjct  466   LWKPMVEEMYVEEIKGQEK-TGSEETA----NKNE-NKESRSHSSAPGESSTLQMDQLKG  519

Query  1120  ---SNIQDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERN  950
                S   +   N N SP   S   ++ SP G + LQ Q G    F+ I    ME    R+
Sbjct  520   VLHSKQVEKPRNQNTSPPRFSYPAISMSPMG-APLQQQAG----FTLIGPAEMEGISHRS  574

Query  949   GKKPRNDNIQSSPSSILSVDMDMKS--AAGEANKGYNHHKFTADRTPAAAAEN----FP-  791
              KKP +D +Q+SPSSILS+DMD+K    + E +  +   +   D  P   +      +P 
Sbjct  575   SKKPSSD-MQNSPSSILSMDMDVKQGETSREISANFGGERLIKDGYPLITSSGGFGAYPM  633

Query  790   -DLMAAANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYL  614
              DL                 GRFN E +T  F  GN VSLTLGLP  ENL++SG+QQNYL
Sbjct  634   GDL-----------------GRFNLEQMTPRFS-GNSVSLTLGLPHCENLSLSGTQQNYL  675

Query  613   STHQDMEL-GRRLEMGR------MGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPD  455
             S     +L GRRLE+G        GI  N   +SHS+   G+E+ID QN KRF AQLLPD
Sbjct  676   SNQNINQLAGRRLEIGSGTEPDFSGI--NTSQNSHSST--GFESIDIQNRKRFPAQLLPD  731

Query  454   FVA  446
             FVA
Sbjct  732   FVA  734



>ref|XP_006373820.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 ref|XP_002323384.2| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 ref|XP_006373821.1| BEL1-like homeodomain 1 family protein [Populus trichocarpa]
 ref|XP_006373822.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 gb|ERP51617.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 gb|EEF05145.2| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 gb|ERP51618.1| BEL1-like homeodomain 1 family protein [Populus trichocarpa]
 gb|ERP51619.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
Length=679

 Score =   142 bits (357),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 118/282 (42%), Positives = 169/282 (60%), Gaps = 23/282 (8%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMYTEE+K QEQ G   + + +    + A++ +     +  + +T N +  +N
Sbjct  416   LWKPMVEEMYTEEIKEQEQDGSEDKTSKSDHNEDSASRSVLQEKGSASENQTRNFKSLDN  475

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPR-NDNIQ  920
             + +A P+EIS    + SP G  +++ Q G    FSFI +  +E   +R+ KK R ND IQ
Sbjct  476   SPDA-PSEISMPTASTSPVG-GNVRNQSG----FSFIGSSELEGITQRSPKKRRSNDFIQ  529

Query  919   SSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-Tggfggfti  743
             SS +S+ S++MD+K   GEAN      KF ++R    + + +  +    N  GGFG + I
Sbjct  530   SS-TSVPSINMDIK--PGEANDEQVSVKFGSER---QSRDGYSFMGGQTNFIGGFGQYPI  583

Query  742   gdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMG--  569
             G+ GRF+ E  T  F  GNGVSL+LGLP  ENL++SG+ Q +L  +Q+++LGRR+E+G  
Sbjct  584   GEIGRFDGEQFTPRF-SGNGVSLSLGLPHCENLSLSGTHQTFLP-NQNIQLGRRVEIGEP  641

Query  568   -RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
                G  N   P S +     YE+ID QN KRF AQLLPDFVA
Sbjct  642   NEFGAINTSTPHSST----AYESIDIQNRKRFLAQLLPDFVA  679



>ref|XP_002266838.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653287.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653288.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653289.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653290.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653292.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
Length=696

 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 112/282 (40%), Positives = 158/282 (56%), Gaps = 22/282 (8%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K  E+  GSGE  + +   N  +  + S+   EK   + N   +  
Sbjct  424   LWKPMVEEMYMEEVKDHEE-NGSGEKTSKSEDNNLEDSALKSSGQQEKSPGSENQARSFK  482

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGA----FSFINTLNMENAGERNGKKPRND  929
             +   +PT  S   + +  T  +S  P GGG       F+ +    ME   + + KKPR+ 
Sbjct  483   SKPDNPTNKSAPPVISMATAATS--PIGGGNARNQPRFTLMGPSEMEGMAQGSPKKPRST  540

Query  928   NIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-Tggfgg  752
             ++  SPSS+ S+DMD+K   GEAN  +   KF+ +R      + +P +    N  GGF  
Sbjct  541   DVLHSPSSVPSMDMDVK--PGEANHHHISMKFSNERQ---GRDGYPLMAGPTNFIGGFES  595

Query  751   ftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEM  572
             +++G+ GRF+ E  T  F  GNGVSLTLGLP  ENL++SG+ Q +L  +Q+++LGRR++M
Sbjct  596   YSLGEIGRFDAEQFTPRFS-GNGVSLTLGLPHCENLSLSGTHQTFLP-NQNIQLGRRVDM  653

Query  571   G---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPD  455
             G     G  N   P S       YE I+ QNGKRFAAQLLPD
Sbjct  654   GEPNEYGTINTTTPHS----TAAYENINMQNGKRFAAQLLPD  691



>emb|CAN63083.1| hypothetical protein VITISV_015358 [Vitis vinifera]
Length=709

 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 112/282 (40%), Positives = 158/282 (56%), Gaps = 22/282 (8%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K  E+  GSGE  + +   N  +  + S+   EK   + N   +  
Sbjct  437   LWKPMVEEMYMEEVKDHEE-NGSGEKTSKSEDNNLEDSALKSSGQQEKSPGSENQARSFK  495

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGA----FSFINTLNMENAGERNGKKPRND  929
             +   +PT  S   + +  T  +S  P GGG       F+ +    ME   + + KKPR+ 
Sbjct  496   SKPDNPTNKSAPPVISMATAATS--PIGGGNARNQPRFTLMGPSEMEGMAQGSPKKPRST  553

Query  928   NIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-Tggfgg  752
             ++  SPSS+ S+DMD+K   GEAN  +   KF+ +R      + +P +    N  GGF  
Sbjct  554   DVLHSPSSVPSMDMDVK--PGEANHHHISMKFSNERQ---GRDGYPLMAGPTNFIGGFES  608

Query  751   ftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEM  572
             +++G+ GRF+ E  T  F  GNGVSLTLGLP  ENL++SG+ Q +L  +Q+++LGRR++M
Sbjct  609   YSLGEIGRFDAEQFTPRFS-GNGVSLTLGLPHCENLSLSGTHQTFLP-NQNIQLGRRVDM  666

Query  571   G---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPD  455
             G     G  N   P S       YE I+ QNGKRFAAQLLPD
Sbjct  667   GEPNEYGTINTTTPHS----TAAYENINMQNGKRFAAQLLPD  704



>ref|XP_007150021.1| hypothetical protein PHAVU_005G119300g [Phaseolus vulgaris]
 gb|ESW22015.1| hypothetical protein PHAVU_005G119300g [Phaseolus vulgaris]
Length=708

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 119/279 (43%), Positives = 153/279 (55%), Gaps = 36/279 (13%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQE---KTSNIQ-  1109
             LWKPMVEEMY EEMK  EQ  GS EN+    +  E +KE+GS  +   +    K  N+Q 
Sbjct  436   LWKPMVEEMYLEEMKDHEQANGS-ENS----RSKELSKELGSTANVAPESGAIKLDNLQS  490

Query  1108  --DnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPR  935
               D+ NN N SP EIST+         SS+ P GG   + S  +     +  +R+  KPR
Sbjct  491   KQDSFNNQNTSPNEISTN---------SSMSPIGGSLQSHSGFHLAGSSDV-QRSPNKPR  540

Query  934   NDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfg  755
             +  +Q+SPSSILSVDM+MK     AN    + KF+ +R      + +P LM+     G G
Sbjct  541   SLEMQNSPSSILSVDMEMKHNGEHANTREANTKFSIER---HHKDGYP-LMSGNTNQGGG  596

Query  754   gftigdfgrFNPENLT----AGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELG  587
                       N  N+T    A   HGNGVSLTLGLP +ENL++SG+Q  +LS  Q++ LG
Sbjct  597   FGAFAMEDIGNRFNVTTEQLASRFHGNGVSLTLGLPHNENLSISGTQHGFLS--QNIHLG  654

Query  586   RRLEMGRMG---IDNNPQPSSHSNINGGYETIDFQNGKR  479
             RRLEMG  G      N  PSSHS     YE+ID QN KR
Sbjct  655   RRLEMGTTGNEFCAINTPPSSHSGTT--YESIDIQNRKR  691



>ref|XP_011042587.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042589.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042590.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042591.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042592.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042593.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=679

 Score =   138 bits (348),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 111/281 (40%), Positives = 167/281 (59%), Gaps = 21/281 (7%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMYTEE+K QEQ G   + + +    + A++ +     +  + +T N +  +N
Sbjct  416   LWKPMVEEMYTEEIKEQEQDGSEDKTSKSDHNEDSASRSVLQEKGSASENQTRNFKSLDN  475

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQS  917
             + +A P+ IS    + SP G  +++ Q G    FSFI +  +E   +R+ KK R++++  
Sbjct  476   SPDA-PSAISMPTASTSPVG-GNVRNQSG----FSFIGSSELEGITQRSPKKRRSNDLIQ  529

Query  916   SPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-Tggfggftig  740
             S +S+ S++MD+K   GEAN      KF ++R    + + +  +    N  GGFG + IG
Sbjct  530   SSTSVPSINMDIK--PGEANNEQVSVKFGSERQ---SRDGYSFMGGQTNFIGGFGQYPIG  584

Query  739   dfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMG---  569
             + GRF+ E  T  F  GNGVSL+LGLP  ENL++SG+ Q +L  +Q+++LGRR+E+G   
Sbjct  585   EIGRFDGEQFTPRF-SGNGVSLSLGLPHCENLSLSGTHQTFL-PNQNIQLGRRVEIGEAN  642

Query  568   RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
               G  N   P S +     Y++ID QN KRF AQLLPDFVA
Sbjct  643   EFGAINTSTPHSST----AYDSIDMQNRKRFIAQLLPDFVA  679



>ref|XP_006381943.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381944.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381945.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_002308323.2| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381946.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381947.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381948.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59740.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59741.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59742.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|EEE91846.2| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59743.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59744.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59745.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
Length=678

 Score =   135 bits (339),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 110/281 (39%), Positives = 164/281 (58%), Gaps = 21/281 (7%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QEQ G   + + +    + A++ +     +    +T + +  +N
Sbjct  415   LWKPMVEEMYMEEIKEQEQNGSEDKTSKSEHNEDAASRSVLQEKGSVNGNQTRSFKSLDN  474

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQS  917
             + +A P+ IS    + SP G  +L+ Q G    FSF+ +  ++   + + KKPR+ ++  
Sbjct  475   SPDA-PSAISIPTSSTSPVG-GNLRNQSG----FSFMGSSELDGITQGSPKKPRSHDLIQ  528

Query  916   SPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-Tggfggftig  740
             SP+S+ S++MD+K   GEAN      KF  +R    + + +  +    N  GGFG + +G
Sbjct  529   SPTSVPSINMDIK--PGEANNEQVSMKFGDER---QSRDGYSFIGGQTNFIGGFGQYPMG  583

Query  739   dfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMG---  569
             + GRF+ E  T  F  GNGVSLTLGLP  ENL++SG+ Q +L  +Q+++LGRR+E+G   
Sbjct  584   EIGRFDGEQFTPRF-SGNGVSLTLGLPHCENLSLSGTHQTFLP-NQNIQLGRRVEIGEPN  641

Query  568   RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
               G  N   P S +     YE+ID QN KRF AQLLPDFVA
Sbjct  642   EYGALNTSTPHSST----AYESIDIQNRKRFIAQLLPDFVA  678



>ref|XP_011046419.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046420.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046421.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046422.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046423.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=679

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 110/281 (39%), Positives = 164/281 (58%), Gaps = 21/281 (7%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QEQ G   + + +    + A++ +     +    +T + +  +N
Sbjct  416   LWKPMVEEMYMEEIKEQEQNGSDDKTSKSEHNEDAASRSVLQEKGSVNGNQTRSFKSLDN  475

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQS  917
             + +A P+ IS    + SP G  +L+ Q G    FSF+ +  ++   + + KKPR+ ++  
Sbjct  476   SPDA-PSAISIPTSSTSPVG-GNLRNQSG----FSFMGSSELDGITQGSPKKPRSHDLIQ  529

Query  916   SPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-Tggfggftig  740
             SP+S+ S++MD+K   GEAN      KF  +R    + + +  +    N  GGFG + IG
Sbjct  530   SPTSVPSINMDIK--PGEANNEQVSMKFGDERQ---SRDGYSFMGGQTNFIGGFGQYPIG  584

Query  739   dfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMG---  569
             + GRF+ E  T  F  GNGVSLTLGLP  ENL++SG+ Q +L  +Q+++LGRR+E+G   
Sbjct  585   EIGRFDGEQFTPRF-SGNGVSLTLGLPHCENLSLSGTHQTFLP-NQNIQLGRRVEIGEPN  642

Query  568   RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
               G  N   P S +     YE+ID QN KR+ AQLLPDFVA
Sbjct  643   EYGALNTSTPHSST----AYESIDIQNRKRYIAQLLPDFVA  679



>ref|XP_010685441.1| PREDICTED: BEL1-like homeodomain protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=747

 Score =   133 bits (335),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 110/296 (37%), Positives = 151/296 (51%), Gaps = 40/296 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQY-GGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnn  1100
             LWKPMVEEMY EE+K QEQ   G+ E+          N     N+++ K+E T   Q   
Sbjct  470   LWKPMVEEMYLEEIKTQEQQNSGNSEDNTTNTITTNKNSNSSKNDASTKKETTLVGQQAQ  529

Query  1099  nnnNASPT------------EISTSIMTASPTGVSSLQPQGGGGGAFSFINTL-NMENAG  959
                    T            + +T+ M ++ + +S+   QG     F+ I T  +ME+  
Sbjct  530   QQAEHGGTIIHPHQQHHHVADQTTNDMISNLSAMSTTSSQG-----FTLIGTSSDMESLM  584

Query  958   ERNGKKPR-NDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLM  782
              R+ KK R N ++Q+SPSSILS+DM+MK         +  H F       A     P ++
Sbjct  585   ARSPKKQRSNSDMQNSPSSILSMDMEMKPVDHHQQHQHQRHSFLMTNHGDADTGFNPYIV  644

Query  781   AAANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQ  602
                             GRFNP+ +TA  +HGN VSLTLGLP  ENL++   QQN+L    
Sbjct  645   ----------NNHDLAGRFNPDQMTAHPYHGNAVSLTLGLPHCENLSLGNHQQNFLQNQP  694

Query  601   DMELGRRLEMG------RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDF  452
             +++LGRRLE+G        GI +  QP   S+ N G+ETID QN KRFAAQL+ DF
Sbjct  695   NIQLGRRLELGPGDQPDFCGI-SMAQP---SHPNNGFETIDIQNRKRFAAQLVHDF  746



>ref|XP_010263012.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010263013.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
Length=739

 Score =   133 bits (335),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 121/295 (41%), Positives = 159/295 (54%), Gaps = 42/295 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSN------NSTEKQEKTSN  1115
             LWKPMVEEMY EE K QEQ G   + +     R+E N++ GS       NS  + ++  N
Sbjct  469   LWKPMVEEMYLEETKDQEQNGSEDKTS-----RSEVNEDSGSKSNAAQENSPARTDQIKN  523

Query  1114  I---QDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGE-RNG  947
                 QDN  N NA  T IS S  +A   G  +++ Q G    FS I + ++E   +  + 
Sbjct  524   FSSKQDNTTNLNAISTAISNSSTSAIMGG--NIRTQAG----FSLIGSSDVEGFMQGTSP  577

Query  946   KKPRNDNIQ-SSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN  770
             KK R+  +Q +SPSSI S+D D+K A        N   FT   T   +   +P +    N
Sbjct  578   KKLRSTELQQNSPSSIPSMDTDVKPA------DTNRDLFTKFDTGRQSRGGYPLITNTTN  631

Query  769   Tggfggftigdfg-rFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDME  593
              GG           RF+PE     F  GNGVSLTLGLP  ENL++SG+QQ YLS +Q+++
Sbjct  632   HGGAFSAYSLGELGRFDPEQFAPRFS-GNGVSLTLGLPHCENLSLSGTQQTYLS-NQNIQ  689

Query  592   LGRRLEMG------RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             LGRRLE+G        G+ + P  SS       YE ++ QNGKRFAAQLLPDFVA
Sbjct  690   LGRRLEIGGGEPNDFCGMSSPPPHSS-----AAYENMNIQNGKRFAAQLLPDFVA  739



>ref|NP_001274921.1| BEL1-related homeotic protein 5 [Solanum tuberosum]
 gb|AAN03621.1|AF406697_1 BEL1-related homeotic protein 5 [Solanum tuberosum]
Length=688

 Score =   132 bits (333),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 123/285 (43%), Positives = 147/285 (52%), Gaps = 61/285 (21%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNI-QDnn  1100
             LWKPMVEEMY EE+K QEQ   +  N +   K  E N  I + N  +    TS++ QD  
Sbjct  450   LWKPMVEEMYLEEVKNQEQ---NSTNTSGDNKNKETN--ISAPNEEKHPIITSSLLQDGI  504

Query  1099  nnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAG------ERNGKKP  938
                 A   EISTS ++ SPT  +SL         FSF+ + NM+N        E N KK 
Sbjct  505   TTTQA---EISTSTISTSPTAGASLH----HAHNFSFLGSFNMDNTTTTVDHIENNAKKQ  557

Query  937   RNDNIQSSPSSILS-VDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTgg  761
             RND  + SPSSILS VDM+ K A   +NKG+ +        P  AA    D         
Sbjct  558   RNDMHKFSPSSILSSVDMEAK-ARESSNKGFTN--------PLMAAYAMGDF--------  600

Query  760   fggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRR  581
                         + + +TA FH  NGVSLTLGLPPSENLA+  SQQNYLS     +LG R
Sbjct  601   -------GRFDPHDQQMTANFHGNNGVSLTLGLPPSENLAMPVSQQNYLSN----DLGSR  649

Query  580   LEMGRMGIDNNPQPSSHSNINGGYETIDFQNG-KRFAAQLLPDFV  449
              EMG           SH N   GYE IDFQ+G KRF  QLLPDFV
Sbjct  650   SEMG-----------SHYN-RMGYENIDFQSGNKRFPTQLLPDFV  682



>ref|NP_001234599.1| bell-like homeodomain protein 2 [Solanum lycopersicum]
 ref|XP_010322314.1| PREDICTED: bell-like homeodomain protein 2 isoform X1 [Solanum 
lycopersicum]
 gb|AAP47025.1|AF375966_1 bell-like homeodomain protein 2 [Solanum lycopersicum]
Length=699

 Score =   132 bits (333),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 123/287 (43%), Positives = 147/287 (51%), Gaps = 66/287 (23%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGG--SGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDn  1103
             LWKPMVEEMY EE+K QEQ     SG+N          NKE  +N S   +EK   I  +
Sbjct  462   LWKPMVEEMYLEEVKNQEQNSSNTSGDNK---------NKE--TNISAPNEEKQPIITSS  510

Query  1102  nnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAG------ERNGKK  941
                +  +  EISTS ++ SPT  +SL         FSF+ + NMEN        E N KK
Sbjct  511   LLQDGTTQAEISTSTISTSPTAGASLH----HAHNFSFLGSFNMENTTTTVDHIENNAKK  566

Query  940   PRNDNIQS-SPSSILS-VDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANT  767
             PRN ++   SPSSILS V+M+ K A    NKG+ +        P  AA    D       
Sbjct  567   PRNHDMHKFSPSSILSSVEMEAK-ARESTNKGFTN--------PLMAAYAMGDF------  611

Query  766   ggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELG  587
                           + + +TA FH  NGVSLTLGLPPSENLA+  SQQNYLS     ELG
Sbjct  612   ---------GRFDPHDQQMTANFHGNNGVSLTLGLPPSENLAMPVSQQNYLSN----ELG  658

Query  586   RRLEMGRMGIDNNPQPSSHSNINGGYETIDFQNG-KRFAAQLLPDFV  449
              R E+G           SH N   GYE IDFQ+G KRF  QLLPDFV
Sbjct  659   SRPEIG-----------SHYN-RMGYENIDFQSGNKRFPTQLLPDFV  693



>gb|ACD39468.1| BEL5 protein [Solanum etuberosum]
Length=698

 Score =   132 bits (331),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 120/287 (42%), Positives = 149/287 (52%), Gaps = 64/287 (22%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNI-QDnn  1100
             LWKPMVEEMY EE+K QEQ      N+  +G        I + N  ++   TS++ QD  
Sbjct  459   LWKPMVEEMYLEEVKNQEQ------NSTTSGDNKNKETNISAPNEEKQPIITSSLLQDGT  512

Query  1099  nnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAG--------ERNGK  944
                 A   EISTS ++ SPT  +SL         FSF+ + NMEN          E N K
Sbjct  513   TTTQA---EISTSTISTSPTAGASLH----HAHNFSFLGSFNMENTTTTNTVDHIENNAK  565

Query  943   KPRNDNIQSSPSSILSVDMDMKSAAGEA-NKGYNHHKFTADRTPAAAAENFPDLMAAANT  767
             KPRND  + SPSSILS+ +DM++ A E+ NKG+ +        P  AA    D       
Sbjct  566   KPRNDMQKFSPSSILSL-VDMEAKARESSNKGFTN--------PLMAAYAMGDF------  610

Query  766   ggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELG  587
                           + + +TA FH  NGVSLTLGLPPSENLA+  +QQNYLS     ELG
Sbjct  611   ---------GRFDPHDQQMTANFHVNNGVSLTLGLPPSENLAMPVNQQNYLSN----ELG  657

Query  586   RRLEMGRMGIDNNPQPSSHSNINGGYETIDFQNG-KRFAAQLLPDFV  449
              R EMG           SH N   GYE I+FQ+G KRF  +LLPDFV
Sbjct  658   SRPEMG-----------SHYN-RMGYENIEFQSGNKRFPTRLLPDFV  692



>gb|ACD39464.1| BEL5 protein [Solanum palustre]
Length=698

 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 120/287 (42%), Positives = 149/287 (52%), Gaps = 64/287 (22%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNI-QDnn  1100
             LWKPMVEEMY EE+K QEQ      N+  +G        I + N  ++   TS++ QD  
Sbjct  459   LWKPMVEEMYLEEVKNQEQ------NSTTSGDNKNKETNISAPNEEKQPIITSSLLQDGT  512

Query  1099  nnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAG--------ERNGK  944
                 A   EISTS ++ SPT  +SL         FSF+ + NM+N          E N K
Sbjct  513   TTTQA---EISTSTISTSPTAGASLH----HAHNFSFLGSFNMKNTTTTNTVDHIENNAK  565

Query  943   KPRNDNIQSSPSSILSVDMDMKSAAGEA-NKGYNHHKFTADRTPAAAAENFPDLMAAANT  767
             KPRND  + SPSSILS+ +DM++ A E+ NKG+ +        P  AA    D       
Sbjct  566   KPRNDMQKFSPSSILSL-VDMEAKARESSNKGFTN--------PLMAAYAMGDF------  610

Query  766   ggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELG  587
                           + + +TA FH  NGVSLTLGLPPSENLA+  +QQNYLS     ELG
Sbjct  611   ---------GRFDPHDQQMTANFHGNNGVSLTLGLPPSENLAMPVNQQNYLSN----ELG  657

Query  586   RRLEMGRMGIDNNPQPSSHSNINGGYETIDFQNG-KRFAAQLLPDFV  449
              R EMG           SH N   GYE I+FQ+G KRF  QLLPDFV
Sbjct  658   SRPEMG-----------SHYN-RMGYENIEFQSGNKRFPTQLLPDFV  692



>ref|XP_006361091.1| PREDICTED: BEL1-related homeotic protein 5 [Solanum tuberosum]
Length=684

 Score =   130 bits (328),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 122/287 (43%), Positives = 143/287 (50%), Gaps = 68/287 (24%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQ--YGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDn  1103
             LWKPMVEEMY EE+K QEQ     SG+N        E +  I S          S +QD 
Sbjct  449   LWKPMVEEMYLEEVKNQEQNSTNTSGDNKNKEAPNEEKHPIITS----------SLLQDG  498

Query  1102  nnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAG-------ERNGK  944
                  A   EISTS ++ SPT  +SL         FSF+ + NM+N         E N K
Sbjct  499   ITTTQA---EISTSTISTSPTAGASLH----HAHNFSFLGSFNMDNTTTTTVDHIENNAK  551

Query  943   KPRNDNIQSSPSSILS-VDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANT  767
             K RND  + SPSSILS VDM+ K A   +NKG+ +        P  AA    D       
Sbjct  552   KQRNDMHKFSPSSILSSVDMEAK-ARESSNKGFTN--------PLMAAYAMGDF------  596

Query  766   ggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELG  587
                           + + +TA FH  NGVSLTLGLPPSENLA+  SQQNYLS     +LG
Sbjct  597   ---------GRFDPHDQQITANFHGNNGVSLTLGLPPSENLAMPVSQQNYLSN----DLG  643

Query  586   RRLEMGRMGIDNNPQPSSHSNINGGYETIDFQNG-KRFAAQLLPDFV  449
              R EMG           SH N   GYE IDFQ+G KRF  QLLPDFV
Sbjct  644   SRPEMG-----------SHYN-RMGYENIDFQSGNKRFPTQLLPDFV  678



>gb|KDO70617.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70618.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70619.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70620.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
Length=693

 Score =   126 bits (316),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 154/289 (53%), Gaps = 26/289 (9%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEK--TSNIQDn  1103
             LWKPMVEEMY EE+K QEQ G   + + +    + A+K      ST  QEK      Q++
Sbjct  419   LWKPMVEEMYLEEIKDQEQNGSEDKTSKSEHNEDSASK------STAAQEKNLVKETQNS  472

Query  1102  nnnnNASPTEISTSIMTASPTGVSSLQPQGGGGG----AFSFINTLNMENAGERNGKKPR  935
              +  ++     + ++ +       +  P GGG       FS I +  +E   + + KKPR
Sbjct  473   KSFKSSEDNLTNQNVHSMISMSTIATSPIGGGNARNHSGFSLIGSSELEGLTQGSPKKPR  532

Query  934   ND--NIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-Tg  764
             N   N+  SPS++ S+ +D+K    EA       KF  D   +    +F  +    N   
Sbjct  533   NSDMNMMLSPSNVPSISIDVKPGGNEATNDLMPMKFDDDDRQSRDGYSF--IGNQMNFIQ  590

Query  763   gfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGR  584
             GFG + IG+ GRF+ E  T  F  GNGVSLTLGLP  ENL++S + QN+L + Q+++LGR
Sbjct  591   GFGQYPIGEIGRFDAEQFTPRFS-GNGVSLTLGLPHCENLSLSATHQNFLPS-QNIQLGR  648

Query  583   RLEMG---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             R+E+G     G  N   P +    +  YE ++ QN KRFAAQLLPDFVA
Sbjct  649   RVEIGEPNEFGTINTQSPHA----SAAYENMNIQNRKRFAAQLLPDFVA  693



>ref|XP_006430060.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
 ref|XP_006430061.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
 gb|ESR43300.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
 gb|ESR43301.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
Length=693

 Score =   125 bits (315),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 112/289 (39%), Positives = 156/289 (54%), Gaps = 26/289 (9%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QEQ G   + + +    + A+K      ST  QEK    +  N+
Sbjct  419   LWKPMVEEMYLEEIKDQEQNGSEDKTSKSEHNEDSASK------STAAQEKNLVKETQNS  472

Query  1096  nnNASPTEISTSIMTASPTGVSSL--QPQGGGGG----AFSFINTLNMENAGERNGKKPR  935
              +  S  +  T+    S   +S++   P GGG       FS I +  +E   + + KKPR
Sbjct  473   KSFKSSEDNLTNQNVHSMISMSTIATSPIGGGNARNHSGFSLIGSSELEGLTQGSPKKPR  532

Query  934   ND--NIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-Tg  764
             N   N+  SPS++ S+ +D+K    EA       KF  D   +    +F  +    N   
Sbjct  533   NSDMNMMLSPSNVPSISIDVKPGGNEATNDLMPMKFDDDDRQSRDGYSF--IGNQMNFIQ  590

Query  763   gfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGR  584
             GFG + IG+ GRF+ E  T  F  GNGVSLTLGLP  ENL++S + QN+L + Q+++LGR
Sbjct  591   GFGQYPIGEIGRFDAEQFTPRFS-GNGVSLTLGLPHCENLSLSATHQNFLPS-QNIQLGR  648

Query  583   RLEMG---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             R+E+G     G  N   P +    +  YE ++ QN KRFAAQLLPDFVA
Sbjct  649   RVEIGEPNEFGTINTQSPHA----SAAYENMNIQNRKRFAAQLLPDFVA  693



>gb|KDP36113.1| hypothetical protein JCGZ_08757 [Jatropha curcas]
Length=676

 Score =   125 bits (315),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 96/282 (34%), Positives = 147/282 (52%), Gaps = 25/282 (9%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QE+ G   + + +  K N  +K +G    +  + +T + +  ++
Sbjct  415   LWKPMVEEMYMEEIKEQERNGSDDKKSKSEQKENSTSKSVGHEKGSVNENQTKSFKSLDS  474

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQS  917
             + N +   ISTS +        +++ Q G    FS I +  +E   + + K+ R+  +  
Sbjct  475   STNQNAPAISTSPVAG------NVRNQSG----FSLIGSSELEGLTQASPKRHRSTELIQ  524

Query  916   SPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTg--gfggfti  743
             SP+S+ S++MD+K   GE N      KF ++R    + + +  + A  N           
Sbjct  525   SPNSVPSINMDVK--PGETNNEQISMKFGSER---QSRDGYSFIGAQTNFIGGFGQYPIG  579

Query  742   gdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMG--  569
                     +  T     GN VSLTLGLP  ENL++S + Q +L  +Q+++LGRR+EMG  
Sbjct  580   ELGRFDTEQQFTPPRFSGNAVSLTLGLPHCENLSLSATHQTFLP-NQNIQLGRRVEMGEP  638

Query  568   -RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
                G  N   P S +     Y++ID QN KRFAAQLLPDFVA
Sbjct  639   NEFGGINTSTPHSST----AYDSIDIQNRKRFAAQLLPDFVA  676



>gb|AFV46214.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=262

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 133/283 (47%), Gaps = 82/283 (29%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKT----SNIQ  1109
             LWKPMVEEMY EE K QEQ                       NNST ++  T    SN  
Sbjct  56    LWKPMVEEMYLEETKNQEQ----------------------DNNSTLQENPTHQLHSNSI  93

Query  1108  DnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRND  929
             D    +   PT+I  S                  GG    I++LN+E    +N KKPRND
Sbjct  94    DAQQESINPPTKIPAST-----------------GGFAQLISSLNLE----KNPKKPRND  132

Query  928   NIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfggf  749
                 SPSSILS +MD+K   G+++KG++               N+   MAAAN     G 
Sbjct  133   T--DSPSSILSAEMDVK--VGDSSKGFS---------------NYLSSMAAANHATRYGI  173

Query  748   tigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMG  569
                       + L  GFH  N  SL+L LPP+E  +    QQN+LS+    E G R+E G
Sbjct  174   GD--------QQLATGFHGNNNFSLSLALPPTET-SQGLHQQNFLSS---FEFGTRIEPG  221

Query  568   RMGIDN--NPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
              +   +  N    SHS+I  GYE +DFQN K F AQLLPDFVA
Sbjct  222   NVESSSRINQAVDSHSSI--GYEILDFQNRKPFPAQLLPDFVA  262



>gb|KHG11905.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=653

 Score =   125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 139/289 (48%), Gaps = 54/289 (19%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QEQ G                       S +K  KT N +D+ +
Sbjct  407   LWKPMVEEMYLEEIKEQEQNG----------------------TSDDKTSKTENHEDSAS  444

Query  1096  nnNASPTE-----ISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRN  932
              + A   +        S+M+ S    S L         FS I +  +E   + + KKPR+
Sbjct  445   KSTAPSCQNPGENQKVSLMSISTASTSPLAGNAHQQSRFSLIGSSELEGINQGSPKKPRS  504

Query  931   DNIQSSPSSILSVDMDM--KSAAGEANKGYNH--HKFTADRTPAAAAENFPDLMAAANTg  764
             + +  SPSS+ S++MDM    A+ E +  ++   + F    T         D M      
Sbjct  505   NELLQSPSSVPSMNMDMNQSEASNEVSMKFSKDGYSFMGTNT---------DFMGGLGQY  555

Query  763   gfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGR  584
               G     D  +F P         GNGVSLTLGLP  ENL++SG+ QN+L  +Q M++GR
Sbjct  556   PIGEIGRFDAEQFAPR------FPGNGVSLTLGLPHCENLSLSGTHQNFLP-NQTMQMGR  608

Query  583   RLEM---GRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             RL++      G  N P P S    +  YE+I+ QN KRF AQLLPDFVA
Sbjct  609   RLDIDEPNEFGAINPPTPHS----SAAYESINLQNRKRFVAQLLPDFVA  653



>ref|XP_006481599.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006481600.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Citrus 
sinensis]
Length=693

 Score =   125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 112/294 (38%), Positives = 158/294 (54%), Gaps = 36/294 (12%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QEQ G   + + +    + A+K      ST  QEK   +++  N
Sbjct  419   LWKPMVEEMYLEEIKDQEQNGSEDKTSKSEHNEDSASK------STAAQEKNL-VKETQN  471

Query  1096  nnNASPTE-----------ISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERN  950
             + +   +E           IS S +  SP G  + + Q G    FS I +  +E   + +
Sbjct  472   SKSFKSSEDNLTNQNVHSMISMSTIATSPIGGGNARNQSG----FSLIGSSELEGLTQGS  527

Query  949   GKKPRND--NIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAA  776
              KKPRN   N+  SPS++ S+ +D+K    EA       KF  D   +    +F  +   
Sbjct  528   PKKPRNSDMNMMLSPSNVPSISIDVKPGGNEATNDLMPMKFDDDDRQSRDGYSF--IGNQ  585

Query  775   AN-TggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQD  599
              N   GFG + IG+ GRF+ E  T  F  GNGVSLTLGLP  ENL++S + Q++L + Q+
Sbjct  586   MNFIQGFGQYPIGEIGRFDAEQFTPRFS-GNGVSLTLGLPHCENLSLSATHQSFLPS-QN  643

Query  598   MELGRRLEMG---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             ++LGRR+E+G     G  N   P +    +  YE ++ QN KRFAAQLLPDFVA
Sbjct  644   IQLGRRVEIGEPNEFGTINTQSPHA----SAAYENMNIQNRKRFAAQLLPDFVA  693



>gb|KHG11906.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=680

 Score =   125 bits (313),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 103/287 (36%), Positives = 138/287 (48%), Gaps = 50/287 (17%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QEQ G                       S +K  KT N +D+ +
Sbjct  434   LWKPMVEEMYLEEIKEQEQNG----------------------TSDDKTSKTENHEDSAS  471

Query  1096  nnNASPTE-----ISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRN  932
              + A   +        S+M+ S    S L         FS I +  +E   + + KKPR+
Sbjct  472   KSTAPSCQNPGENQKVSLMSISTASTSPLAGNAHQQSRFSLIGSSELEGINQGSPKKPRS  531

Query  931   DNIQSSPSSILSVDMDM--KSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggf  758
             + +  SPSS+ S++MDM    A+ E +      KF+ D           D M        
Sbjct  532   NELLQSPSSVPSMNMDMNQSEASNEVSM-----KFSKDGYSFMGTNT--DFMGGLGQYPI  584

Query  757   ggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRL  578
             G     D  +F P         GNGVSLTLGLP  ENL++SG+ QN+L  +Q M++GRRL
Sbjct  585   GEIGRFDAEQFAPR------FPGNGVSLTLGLPHCENLSLSGTHQNFLP-NQTMQMGRRL  637

Query  577   EM---GRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             ++      G  N P P S    +  YE+I+ QN KRF AQLLPDFVA
Sbjct  638   DIDEPNEFGAINPPTPHS----SAAYESINLQNRKRFVAQLLPDFVA  680



>emb|CBI24428.3| unnamed protein product [Vitis vinifera]
Length=573

 Score =   124 bits (311),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 108/282 (38%), Positives = 130/282 (46%), Gaps = 100/282 (35%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QE                               EK++       
Sbjct  387   LWKPMVEEMYLEEIKDQEH-----------------------------NEKSTT------  411

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQS  917
               NASP E+S S M+ SP G  SLQ Q G    F+ I +  +E   +R+ KKPR+ +IQS
Sbjct  412   -QNASPAELSNSTMSTSPMG-GSLQVQAG----FNLIGSSEIEGMVQRSPKKPRSYDIQS  465

Query  916   SPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfggftigd  737
             SPSSILS+DM+MK A      G+  +      +P      F                   
Sbjct  466   SPSSILSMDMEMKPAINNGG-GFGAY------SPIGDIGRF-------------------  499

Query  736   fgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMG----  569
                 NPE L   FH GN VSLTLGLP  ENL++                   LEMG    
Sbjct  500   ----NPEQLAPRFH-GNSVSLTLGLPHCENLSL-------------------LEMGNGEP  535

Query  568   -RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
                GI N  QPS HSN    Y++I+ QN KRFAAQLLPDFVA
Sbjct  536   DYCGI-NAAQPS-HSN--AAYDSINIQNRKRFAAQLLPDFVA  573



>ref|XP_009773899.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009773900.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
Length=645

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 119/284 (42%), Positives = 148/284 (52%), Gaps = 79/284 (28%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKG-QEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnn  1100
             LWKPMVEEMY EEMK  QEQ   S EN      +NE+NKE   + S+  QE         
Sbjct  429   LWKPMVEEMYLEEMKNNQEQNSSSEENK----NKNESNKEKMVSKSSAPQE---------  475

Query  1099  nnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQ  920
                + +PTEI+TS ++  PT   S   Q      FSF+ +LNMEN      KKPRN ++ 
Sbjct  476   ---SGTPTEIATSTISTPPTACGS-SFQAAQAHNFSFLGSLNMEN--NTTTKKPRNHDMH  529

Query  919   S-SPSSILS-VDM-DMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfggf  749
             + SPS+ILS VDM + K+   ++ KG+N                 P + AAA       +
Sbjct  530   NNSPSNILSSVDMAETKARDHQSKKGFN-----------------PLMDAAA------VY  566

Query  748   tigdfgrFNPENLTAG--FHHGNGVSLTLGLPP-SENLAVSGSQQNYLSTHQDMELGRRL  578
             T+G+FGRFNP    A   FH  NGVSLTLGLPP SENL    SQQ+Y +T         +
Sbjct  567   TMGEFGRFNPHEQMAATNFHGNNGVSLTLGLPPNSENL----SQQSYQNT---------I  613

Query  577   EMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             E  RM                 YE IDFQN KRF +Q+LPDFVA
Sbjct  614   EFNRM----------------SYENIDFQN-KRFPSQILPDFVA  640



>ref|XP_002524053.1| bel1 homeotic protein, putative [Ricinus communis]
 gb|EEF38263.1| bel1 homeotic protein, putative [Ricinus communis]
Length=679

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 112/283 (40%), Positives = 163/283 (58%), Gaps = 23/283 (8%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEI--GSNNSTEKQEKTSNIQDn  1103
             LWKPMVEEMY EE+K QE+ G   + + +    N A K +     ++ E Q K+    D 
Sbjct  414   LWKPMVEEMYLEEIKEQERNGSDDKTSKSEQNENAAPKSVLQEKGSAVENQTKSFKSLDG  473

Query  1102  nnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNI  923
             + N+NA P+ +S S  + SP G  +++ Q G    FS I +  +E   + + K+ R+  +
Sbjct  474   SPNHNA-PSAVSVSTASTSPIG-GNVRNQSG----FSLIGSSELEGITQGSPKRHRSTEM  527

Query  922   QSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-Tggfggft  746
               SP+S+ S++MD+K   GE N      KF ++R      + +  +    N  GGFG + 
Sbjct  528   IQSPTSVPSINMDIK--PGEMNNDQISMKFGSERQ---NRDGYSFIGGQTNFIGGFGQYP  582

Query  745   igdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMG-  569
             IGD GRF+ E  T  F  GNGVSLTLGLP  ENL++SG+ +++L + Q+++LGRR+E+  
Sbjct  583   IGDLGRFDTEQFTPRFS-GNGVSLTLGLPHCENLSMSGTHESFLPS-QNIQLGRRVEISE  640

Query  568   --RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
                 G  N   P S +     YE+I+ QN KRFAAQLLPDFVA
Sbjct  641   PNEFGGINTSTPHSST----AYESINIQNRKRFAAQLLPDFVA  679



>ref|XP_010107001.1| BEL1-like homeodomain protein 1 [Morus notabilis]
 gb|EXC12999.1| BEL1-like homeodomain protein 1 [Morus notabilis]
Length=441

 Score =   119 bits (297),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 112/294 (38%), Positives = 164/294 (56%), Gaps = 38/294 (13%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAA---AGKRNEANKEIGSNNSTEKQEKTSNIQD  1106
             LWKPMVEEMY EE+K QEQ G + + + +   +  ++ A KE    +++    +T+N   
Sbjct  169   LWKPMVEEMYLEEIKEQEQNGCAEKISKSNDDSDSKSTAPKEKSPASASATDNQTANFNS  228

Query  1105  nnnnnNAS----PTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKP  938
                N+ A+    P+ IS S  + SPTG +   P+   G  FS I +  ++   + + KKP
Sbjct  229   KQENSTAAAQFIPSAISMSTPSTSPTGGNP--PRNHSG--FSLIGSSELDGITQGSPKKP  284

Query  937   RNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-Tgg  761
             RND +QS P+SI S+ MD+K      N   +  KF  +R    + + +  +    N   G
Sbjct  285   RNDMMQS-PNSIPSITMDVKPGK-MGNDHISSMKFGDERQ---SRDGYSFMGGQTNFISG  339

Query  760   fggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRR  581
             FG + IG+ GRF+ E  T  F  GNGVSLTLGLP  ENL++SG+ Q+++S +Q ++LGR 
Sbjct  340   FGQYPIGEIGRFDAEQFTPRFS-GNGVSLTLGLPHCENLSLSGAHQSFVS-NQSIQLGR-  396

Query  580   LEMGRMGIDNNPQPSSHSNIN---------GGYETIDFQNGKRFAAQLLPDFVA  446
                      N  +P+ +S IN           +ETI+ QN KRFAAQLLPD+VA
Sbjct  397   ---------NIGEPNEYSAINTSAPHSSAAAAFETINIQNPKRFAAQLLPDYVA  441



>gb|KHN48417.1| BEL1-like homeodomain protein 1, partial [Glycine soja]
Length=471

 Score =   118 bits (296),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 158/285 (55%), Gaps = 28/285 (10%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEK--TSNIQDn  1103
             LWKPMVEEMY EEMK  E   GS E ++ +G       E  +  +T  QEK  +S I+  
Sbjct  207   LWKPMVEEMYLEEMKEHE-LNGSEEKSSKSG-------EDPATKTTSPQEKRTSSEIESK  258

Query  1102  nnnnNASPTEIS--TSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRND  929
             + N+    ++ S  T I+  SP  +S +         FSF+ +  ++   + + KKPRN 
Sbjct  259   SFNSKQDVSKQSQNTPILPTSPPSISPIGGSVKNQSGFSFMGSSELDGITQGSPKKPRNH  318

Query  928   NIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-Tggfgg  752
              I  SP+ + S++MD+K     AN+  N  + + D       +++  +    N   GFG 
Sbjct  319   EILHSPNRVPSINMDVK-----ANEANNEQQLSMDHERQNNRDSYSFMGNQTNFISGFGQ  373

Query  751   ftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEM  572
             + I + GRF+ E  T  F   NGVSLTLGLP  + L  SG+ Q++L  +Q+++LGR L++
Sbjct  374   YPIEEIGRFDAEQFTPRFSGKNGVSLTLGLPHCDTL--SGTHQSFL-PNQNIQLGRGLDI  430

Query  571   G---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             G   + G  NN    S+S+ +  +E+I+ QN KRFAAQLLPDFVA
Sbjct  431   GEPNQFGALNN----SNSHNSAAFESINMQNPKRFAAQLLPDFVA  471



>ref|XP_003535815.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006588872.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=661

 Score =   118 bits (295),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 106/285 (37%), Positives = 157/285 (55%), Gaps = 28/285 (10%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEK--TSNIQDn  1103
             LWKPMVEEMY EEMK  E   GS E ++ +G       E  +  +T  QEK  +S I+  
Sbjct  397   LWKPMVEEMYLEEMKEHE-LNGSEEKSSKSG-------EDPATKTTSPQEKRTSSEIESK  448

Query  1102  nnnnNASPTEIS--TSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRND  929
             + N+    ++ S  T I+  SP  +S +         FSF+ +  ++   + + KKPRN 
Sbjct  449   SFNSKQDVSKQSQNTPILPTSPPSISPIGGSVKNQSGFSFMGSSELDGITQGSPKKPRNH  508

Query  928   NIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-Tggfgg  752
              I  SP+ + S++MD+K     AN+  N  + + D       +++  +    N   GFG 
Sbjct  509   EILHSPNRVPSINMDVK-----ANEANNEQQLSMDHERQNNRDSYSFMGNQTNFISGFGQ  563

Query  751   ftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEM  572
             + I + GRF+ E  T  F   NGVSLTLGLP  + L  SG+ Q++L   Q+++LGR L++
Sbjct  564   YPIEEIGRFDAEQFTPRFSGKNGVSLTLGLPHCDTL--SGTHQSFLPN-QNIQLGRGLDI  620

Query  571   G---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             G   + G  NN    S+S+ +  +E+I+ QN KRFAAQLLPDFVA
Sbjct  621   GEPNQFGALNN----SNSHNSAAFESINMQNPKRFAAQLLPDFVA  661



>gb|KDO46590.1| hypothetical protein CISIN_1g005901mg [Citrus sinensis]
 gb|KDO46591.1| hypothetical protein CISIN_1g005901mg [Citrus sinensis]
 gb|KDO46592.1| hypothetical protein CISIN_1g005901mg [Citrus sinensis]
Length=671

 Score =   118 bits (295),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 136/283 (48%), Gaps = 67/283 (24%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QE+  GS EN +    + E+ + +    S + + + S  Q    
Sbjct  448   LWKPMVEEMYMEELKEQEK-NGSAENISKTESK-ESPQLLEQIKSLQAKAEKSTTQ----  501

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFI--NTLNMENAGERNGKKPRNDNI  923
                 SPTE+S S M+ SP G +  Q  G     F+ I  +  ++E   +R+ KKPRN  +
Sbjct  502   ---ISPTELSNSTMSTSPMGGNFRQQTG-----FNLIGPSDHHLEGFVQRSQKKPRNAEM  553

Query  922   QSSPSSI-----LSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggf  758
             Q+S SSI           M    G  N   +HH                    AA T   
Sbjct  554   QNSRSSINDPGGGFGMFSMGPEIGRFNPDNHHHHH----------------QLAAPT---  594

Query  757   ggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRL  578
                                FH  NGVSLTLGLP  ENL++SGSQ N LS+ Q++E     
Sbjct  595   -------------------FHGNNGVSLTLGLPHCENLSLSGSQHNLLSSGQNIEPDHFC  635

Query  577   EMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFV  449
                  GI+  PQ +SHS     YE+ID Q+ KRFAAQLLPDFV
Sbjct  636   -----GIE-TPQHNSHSGT--AYESIDIQSRKRFAAQLLPDFV  670



>ref|XP_007027982.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007027983.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007027984.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08484.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08485.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08486.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
Length=668

 Score =   118 bits (295),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 112/287 (39%), Positives = 156/287 (54%), Gaps = 37/287 (13%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNI---QD  1106
             LWKPMVEEMY EE+K  EQ G   +++ +    + A+K      S   +    ++   QD
Sbjct  409   LWKPMVEEMYLEEVKEHEQNGSEDKSSKSQNNEDSASKSTAPEKSPANENHVKSLNSKQD  468

Query  1105  nnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDN  926
             N  + NAS   IST+  + SP    +++ Q G    FS I +  +E   + + KKPR+  
Sbjct  469   NLTSQNASSMSISTA--STSPFA-GNVRNQSG----FSLIGSSELEGITQGSPKKPRSTE  521

Query  925   IQSSPSSILSVDMDMKSAAGEANK------GYNHHKFTADRTPAAAAENFPDLMAAANTg  764
             +  SPSS+ S+++D+K +  EAN       G   + F    T      NF         G
Sbjct  522   LLQSPSSVPSINIDIKQS--EANNEVSMKFGKEGYSFMGTNT------NF--------MG  565

Query  763   gfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGR  584
             GFG + IG+ GRF+ E  T  F  GNGVSLTLGLP  ENL++SG+ Q  L  + ++++GR
Sbjct  566   GFGQYPIGEIGRFDAEQFTPRFS-GNGVSLTLGLPHCENLSLSGTHQTLL-PNPNLQMGR  623

Query  583   RLEMGRMGIDNNPQPSS-HSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             RL++G         PS+ HS+    YE I  QN KRFAAQLLPDFVA
Sbjct  624   RLDIGEPNEFATINPSAPHSS--AAYENISIQNRKRFAAQLLPDFVA  668



>ref|XP_006424091.1| hypothetical protein CICLE_v10027955mg [Citrus clementina]
 gb|ESR37331.1| hypothetical protein CICLE_v10027955mg [Citrus clementina]
Length=671

 Score =   117 bits (292),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 104/283 (37%), Positives = 136/283 (48%), Gaps = 67/283 (24%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K Q++  GS EN +    + E+ + +    S + + + S  Q    
Sbjct  448   LWKPMVEEMYMEELKEQDK-NGSAENISKTESK-ESPQLLEQIKSLQAKAEKSTTQ----  501

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFI--NTLNMENAGERNGKKPRNDNI  923
                 SPTE+S S M+ SP G +  Q  G     F+ I  +  ++E   +R+ KKPRN  +
Sbjct  502   ---ISPTELSNSTMSTSPMGGNFRQQTG-----FNLIGPSDHHLEGFVQRSQKKPRNAEM  553

Query  922   QSSPSSI-----LSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggf  758
             Q+S SSI           M    G  N   +HH                    AA T   
Sbjct  554   QNSRSSINDPGGGFGMFSMGPEIGRFNPDNHHHHH----------------QLAAPT---  594

Query  757   ggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRL  578
                                FH  NGVSLTLGLP  ENL++SGSQ N LS+ Q++E     
Sbjct  595   -------------------FHGNNGVSLTLGLPHCENLSLSGSQHNLLSSGQNIEPDHFC  635

Query  577   EMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFV  449
                  GI+  PQ +SHS     YE+ID Q+ KRFAAQLLPDFV
Sbjct  636   -----GIE-TPQHNSHSGT--AYESIDIQSRKRFAAQLLPDFV  670



>ref|XP_006494895.1| PREDICTED: BEL1-like homeodomain protein 1-like [Citrus sinensis]
Length=672

 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 104/283 (37%), Positives = 136/283 (48%), Gaps = 67/283 (24%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QE+  GS EN +    + E+ + +    S + + + S  Q    
Sbjct  449   LWKPMVEEMYMEELKEQEK-NGSAENISKTESK-ESPQLLEQIKSLQAKAEKSATQ----  502

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFI--NTLNMENAGERNGKKPRNDNI  923
                 +PTE+S S M+ SP G +  Q  G     F+ I  +  ++E   +R+ KKPRN  +
Sbjct  503   ---IAPTELSNSTMSTSPMGGNFRQQTG-----FNLIGPSDHHLEGFVQRSQKKPRNAEM  554

Query  922   QSSPSSI-----LSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggf  758
             Q+S SSI           M    G  N   +HH                    AA T   
Sbjct  555   QNSRSSINDPGGGFGMFSMGPEIGRFNPDNHHHHH----------------QLAAPT---  595

Query  757   ggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRL  578
                                FH  NGVSLTLGLP  ENL++SGSQ N LS+ Q++E     
Sbjct  596   -------------------FHGNNGVSLTLGLPHCENLSLSGSQHNLLSSGQNIEPDHFC  636

Query  577   EMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFV  449
                  GI+  PQ +SHS     YE+ID Q+ KRFAAQLLPDFV
Sbjct  637   -----GIE-TPQHNSHSGT--AYESIDIQSRKRFAAQLLPDFV  671



>gb|KHN10043.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=431

 Score =   114 bits (285),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 106/295 (36%), Positives = 155/295 (53%), Gaps = 50/295 (17%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAG----------KRNEANKEIGSNNSTEKQE  1127
             LWKPMVEEMY EEMK  E   GS E ++  G          +   A  EI S +   KQ+
Sbjct  169   LWKPMVEEMYLEEMKDHE-LNGSEEKSSKNGEDPATKTSTPQEKRAASEIESKSFNSKQD  227

Query  1126  KTSNIQDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNG  947
              + N          +P  +ST+  + SP G  S++ Q G    FSF+ +  ++   + + 
Sbjct  228   VSKN--------QNTPI-VSTTPPSTSPVG-GSVKNQSG----FSFMGSSELDGITQGSP  273

Query  946   KKPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTAD-----RTPAAAAENFPDLM  782
             KKPRN  I  SP+ + S++MD+K     AN+  N  + + D     R       N  + +
Sbjct  274   KKPRNHEILRSPNRVPSINMDVK-----ANEANNEQQLSMDLERQNRDGYTFMGNQTNFI  328

Query  781   AAANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQ  602
             +         + + + GRF+ E  T  F   NGVSLTLGLP  + L  SG+ Q++L  +Q
Sbjct  329   SGFG-----QYPMEEIGRFDAEQFTPRFSGNNGVSLTLGLPHCDTL--SGTHQSFLP-NQ  380

Query  601   DMELGRRLEMG---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             +++LGR L++G   + G  NN   +SHS+    +E+I+ QN KRFAAQLLPDFVA
Sbjct  381   NIQLGRGLDIGEPNQFGALNNS--TSHSS--AAFESINMQNPKRFAAQLLPDFVA  431



>ref|XP_008241058.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241059.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241060.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241062.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
Length=710

 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 161/294 (55%), Gaps = 41/294 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGS------GENAAA---AGKRNEANKEIGSNNSTEKQEK  1124
             LWKPMVEEMY EE+K  EQ G S       E++A+   A +  E N+   + NS  KQE 
Sbjct  441   LWKPMVEEMYLEEVKEHEQNGSSEKMSKSNEDSASKSTAPQDTENNQTTSTFNS--KQEN  498

Query  1123  TSNIQDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGK  944
             ++N     +NN A+P  +S S  + SPT +    P G     FS I +  ++   + + K
Sbjct  499   STN-----HNNIAAPPSMSISTPSTSPTNMVR-NPSG-----FSLIGSSELDGITQGSPK  547

Query  943   KPRNDNIQSSP-SSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-  770
             KPR+     SP SS+  ++MD K  A E N      KF  +R      + +  +    N 
Sbjct  548   KPRSTEFMQSPNSSVPCMNMDHK--AQEVNNEQVSMKFGDERQ---GRDGYSFMGGQTNF  602

Query  769   TggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQ--QNYLSTHQDM  596
              G FG + IG+ GRF+ +  T  F  GNGVSLTLGLP  ENL++SG+   QN+L  +Q++
Sbjct  603   IGSFGQYPIGEIGRFDADQFTPRFS-GNGVSLTLGLPHCENLSLSGAHHHQNFL-PNQNI  660

Query  595   ELGRRLEMG----RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             +LGRR+++G    + G  N   P S    +  +E ID QN KRF AQLLPDFVA
Sbjct  661   QLGRRVDIGEANDQFGTINTSAPHS----SAAFENIDIQNRKRFVAQLLPDFVA  710



>ref|XP_007204250.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 ref|XP_007204251.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 gb|EMJ05449.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 gb|EMJ05450.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
Length=707

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 161/294 (55%), Gaps = 41/294 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGS------GENAAA---AGKRNEANKEIGSNNSTEKQEK  1124
             LWKPMVEEMY EE+K  EQ G S       E++A+   A +  E N+   + NS  KQE 
Sbjct  438   LWKPMVEEMYLEEVKEHEQNGSSEKMSKSNEDSASKSTAPQDTENNQTTSTFNS--KQEN  495

Query  1123  TSNIQDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGK  944
             ++N     +NN A+P  +S S  + SPT +    P G     FS I +  ++   + + K
Sbjct  496   STN-----HNNIAAPPSMSISTPSTSPTNMVR-NPSG-----FSLIGSSELDGITQGSPK  544

Query  943   KPRNDNIQSSP-SSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-  770
             KPR+     SP SS+  ++MD K  A E N      KF  +R      + +  +    N 
Sbjct  545   KPRSTEFMQSPNSSVPCMNMDHK--AQEVNNEQLSMKFGDERQ---GRDGYSFMGGQTNF  599

Query  769   TggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQ--QNYLSTHQDM  596
              G FG + IG+ GRF+ +  T  F  GNGVSLTLGLP  ENL++SG+   QN+L  +Q++
Sbjct  600   IGSFGQYPIGEIGRFDADQFTPRFS-GNGVSLTLGLPHCENLSLSGAHHHQNFL-PNQNI  657

Query  595   ELGRRLEMG----RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             +LGRR+++G    + G  N   P S    +  +E ID QN KRF AQLLPDFVA
Sbjct  658   QLGRRVDIGEANDQFGTINTSAPHS----SAAFENIDIQNRKRFVAQLLPDFVA  707



>ref|XP_003519115.1| PREDICTED: BEL1-like homeodomain protein 1-like isoformX1 [Glycine 
max]
 ref|XP_006575286.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006575287.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
Length=664

 Score =   115 bits (288),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 107/294 (36%), Positives = 156/294 (53%), Gaps = 48/294 (16%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGG------SGENAA---AAGKRNEANKEIGSNNSTEKQEK  1124
             LWKPMVEEMY EEMK  E  G       +GE+ A   +  +   A  EI S +   KQ+ 
Sbjct  402   LWKPMVEEMYLEEMKDHELNGSEEKSSKNGEDPATKTSTPQEKRAASEIESKSFNSKQDV  461

Query  1123  TSNIQDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGK  944
             + N          +P  +STS  + SP G  S++ Q G    FSF+ +  ++   + + K
Sbjct  462   SKN--------QNTPI-VSTSPPSTSPVG-GSVKNQSG----FSFMGSSELDGITQGSPK  507

Query  943   KPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTAD-----RTPAAAAENFPDLMA  779
             KPRN  I  SP+ + S++MD+K     AN+  N  + + D     R       N  + ++
Sbjct  508   KPRNHEILRSPNRVPSINMDVK-----ANEANNEQQLSMDLERQNRDGYTFMGNQTNFIS  562

Query  778   AANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQD  599
                      + + + GRF+ E  T  F   NGVSLTLGLP  + L  SG+ Q++L  +Q+
Sbjct  563   GFG-----QYPMEEIGRFDAEQFTPRFSGNNGVSLTLGLPHCDTL--SGTHQSFLP-NQN  614

Query  598   MELGRRLEMG---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             ++LGR L++G   + G  NN   +SHS  +  +E+I+ QN KRFAAQLLPDFVA
Sbjct  615   IQLGRGLDIGEPNQFGALNN--STSHS--SAAFESINMQNPKRFAAQLLPDFVA  664



>ref|XP_007132496.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
 ref|XP_007132497.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
 gb|ESW04490.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
 gb|ESW04491.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
Length=733

 Score =   114 bits (285),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 120/297 (40%), Positives = 148/297 (50%), Gaps = 59/297 (20%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEK---------  1124
             LWKPMVEEMY EE+K QE   GS +N     K N  NKE+ S  +    E          
Sbjct  476   LWKPMVEEMYLEEVK-QEPNNGSQDNNTNRSKEN--NKELWSEANAATHESGGLRLNQIN  532

Query  1123  --TSNIQDnnnnnNASPTEISTS-IMTASP---TGVSSLQPQGGGGGAFSFINTLNMENA  962
                S  +  NNN   SPTEIS S  ++ SP    G  SLQ         S  +  +M++ 
Sbjct  533   VLQSKAESFNNNQTTSPTEISNSNSLSTSPMGGGGGGSLQ---------SGFHLGDMQSP  583

Query  961   GERNGKKPRNDN-IQSSPSSILSVDMDMKSAAGEAN--KGYNHHKFTADRTPAAAAENFP  791
                  K+PR+ + +Q+SP SILSVDM+MK   GE N  +G N      + +    A    
Sbjct  584   -----KRPRSTSEMQNSPGSILSVDMEMK-PHGETNTREGTNTKFGIENHSGGFGAFPME  637

Query  790   DLMAAANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLS  611
             D+    +                 E L   F HGNGVSLTLGLP SENL +SG+Q  +LS
Sbjct  638   DIGRFHHVS---------------EQLAPRF-HGNGVSLTLGLPHSENLTLSGTQHGFLS  681

Query  610   THQDMELGRRL--EMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
                +M LG R   E    G  N P PSSHS  +  Y+ ID QN KRFAAQLL DFVA
Sbjct  682   P--NMHLGMRTTNENEFCGAINTP-PSSHSATS--YDNIDIQNRKRFAAQLLRDFVA  733



>gb|KHG01894.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=634

 Score =   109 bits (272),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 131/280 (47%), Gaps = 51/280 (18%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QEQ G   + + +    +  +K    + ++ + ++ +NI     
Sbjct  403   LWKPMVEEMYLEEIKEQEQNGSEKKTSKSHNNEDSTSKSTAPDKTSTENKQDNNI-----  457

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQS  917
                  P +   S M+ S   + S  P  G    FSFI +  +E   + + KKPR +N   
Sbjct  458   -----PNQNGCSSMSVS---MGSASPLIGNQSGFSFIGSSELEGITQGSPKKPRTNN---  506

Query  916   SPSSILSVDMDMKSAAGEANKGYNHHKFTAD--RTPAAAAENFPDLMAAANTggfggfti  743
                  +  D D  +  G    G  ++ F     + P      F                 
Sbjct  507   --EVTMKFDKDGYTFMG----GTTNNDFMGGFGQYPIGEITRF-----------------  543

Query  742   gdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRM  563
                   + E  T  F  GNGVSLTLGLP  ENL++SG+       +Q M++GRR+++G  
Sbjct  544   ------DTEQFTPRFS-GNGVSLTLGLPHCENLSLSGTPHQTFLPNQAMQMGRRVDIGEP  596

Query  562   GIDNNPQPSS-HSNINGGYETIDFQNGKRFAAQLLPDFVA  446
                 +  PS+ HS  +  Y+ I+ QN KRFAAQLLPDFVA
Sbjct  597   NEFGSINPSTPHS--SAAYDNINIQNRKRFAAQLLPDFVA  634



>gb|AAN03622.1|AF406698_1 BEL1-related homeotic protein 11, partial [Solanum tuberosum]
Length=535

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 141/291 (48%), Gaps = 68/291 (23%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEK---TSNIQD  1106
             LWKPMVEEMY EE+K   Q      N          N EI  + S+  QEK   +SNI  
Sbjct  299   LWKPMVEEMYMEEVKKNNQEQNIEPN----------NNEIVGSKSSVPQEKLPISSNI--  346

Query  1105  nnnnnNASPTEISTSIMTASPTGVSSLQPQGGGG------GAFSFINTLNMENAG-ERNG  947
                 +NASP +ISTS ++ SPTG       GGG         FSFI +LNMEN   +RN 
Sbjct  347   ---IHNASPNDISTSTISTSPTG-------GGGSIPTQTVAGFSFIRSLNMENIDDQRNN  396

Query  946   KKPRNDNIQSSPSSILSVDMDM--KSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAA  773
             KK RN+    S S+ILS++ ++  K    E  K     KF   +T    +     LM   
Sbjct  397   KKARNEMQNCSTSTILSMEREIINKVVQDETIKS---EKFNNTQTRECYS-----LMTPN  448

Query  772   NTggfggftigdfgrFNPENLTAGFHHGNG-VSLTLGLPPSENLAVSGSQQNYLSTHQDM  596
              T      T  +         T  FH GNG VSLTLGLPP+     S +Q NY+      
Sbjct  449   YTMDDQFGTRFNNQNHEQLATTTTFHQGNGHVSLTLGLPPN-----SENQHNYI------  497

Query  595   ELGRRLEMGRMGIDNNP-QPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
                        G++N+  QP+ H NI   YE IDFQ+GKR+A QLL DFV+
Sbjct  498   -----------GLENHYNQPTHHPNI--SYENIDFQSGKRYATQLLQDFVS  535



>ref|XP_006362847.1| PREDICTED: BEL1-like homeodomain protein 1-like [Solanum tuberosum]
Length=706

 Score =   106 bits (264),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 111/290 (38%), Positives = 143/290 (49%), Gaps = 68/290 (23%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEK---TSNIQD  1106
             LWKPMVEEMY EE+K   Q      N          N EI  + S+  QEK   +SNI  
Sbjct  472   LWKPMVEEMYMEEVKKNNQEQNIEPN----------NNEIVGSKSSVPQEKLPISSNI--  519

Query  1105  nnnnnNASPTEISTSIMTASPTGVSSLQPQGGGG------GAFSFINTLNMENAG-ERNG  947
                 +NASP +ISTS ++ SPTG       GGG         FSFI +LNMEN   +RN 
Sbjct  520   ---IHNASPNDISTSTISTSPTG-------GGGSIPAQTVAGFSFIRSLNMENIDDQRNN  569

Query  946   KKPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANT  767
             KK RN+    S S+ILS++ ++ +   + ++     KF   +T    +   P+       
Sbjct  570   KKARNEMQNCSTSTILSMEREIMNKVVQ-DETIKSEKFNNTQTRECYSLMTPNY------  622

Query  766   ggfggftigdfgrFNPENLTAGFHHGNG-VSLTLGLPP-SENLAVSGSQQNYLSTHQDME  593
                       F   N E L   FH GNG VSLTLGLPP SEN      Q NY+       
Sbjct  623   -TMDDQFGTRFNNQNHEQLATTFHQGNGHVSLTLGLPPNSEN------QHNYI-------  668

Query  592   LGRRLEMGRMGIDNNP-QPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
                       G++N+  QP+ H NI+  YE IDFQ+GKR+A QLL DFV+
Sbjct  669   ----------GLENHYNQPTHHPNIS--YENIDFQSGKRYATQLLQDFVS  706



>gb|KHN21192.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=584

 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 146/289 (51%), Gaps = 40/289 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QE    S +N    G  NE++KE+ S  +   QE +  ++ +  
Sbjct  324   LWKPMVEEMYLEEVK-QEPNNSSQDNNNTKGS-NESSKELWSEANAAAQE-SGAMRFDQI  380

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQS  917
             N   S  E   +  T SPT +S+         + S  +  ++ +    N  K  ++  Q+
Sbjct  381   NILQSKAESFKNNQTTSPTEISN---------SNSLQSGFHLADMQSPNKPKSTSEMHQN  431

Query  916   SPSSILSVDMDMK-SAAGEAN----KGYNHHKFT--ADRTPAAAAENFPDLMAAANTggf  758
             SP SILSVDM+MK    GE N    +G N++  T     +       FP++         
Sbjct  432   SPGSILSVDMEMKPHHHGETNNITREGQNNNTTTKFGIESHGGGFGAFPNMEDIGRFHHH  491

Query  757   ggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSE--NLAVSGSQQN-YLSTHQDMELG  587
                          E L   F HGNGVSLTLGLP S   NL++SG+ Q+ +LS  Q+M LG
Sbjct  492   VT-----------EQLAPRF-HGNGVSLTLGLPHSTENNLSLSGTTQHGFLS--QNMHLG  537

Query  586   RRLEMGR--MGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
              R        G  N   PSSHS I+  YE+ID QN KRFAAQLL DFVA
Sbjct  538   MRNSENDEFCGAINTTPPSSHSGIS--YESIDIQNRKRFAAQLLRDFVA  584



>ref|XP_003540818.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006592357.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=741

 Score =   105 bits (263),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 144/289 (50%), Gaps = 40/289 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QE    S +N    G  NE++KE+ S  +   QE  + ++ +  
Sbjct  481   LWKPMVEEMYLEEVK-QEPNNSSQDNNNTKGS-NESSKELWSEANAAAQESGA-MRFDQI  537

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQS  917
             N   S  E   +  T SPT +S+      G          ++ +    N  K  ++  Q+
Sbjct  538   NILQSKAESFKNNQTTSPTEISNSNSLQSG---------FHLADMQSPNKPKSTSEMHQN  588

Query  916   SPSSILSVDMDMK-SAAGEAN----KGYNHHKFT--ADRTPAAAAENFPDLMAAANTggf  758
             SP SILSVDM+MK    GE N    +G N++  T     +       FP++         
Sbjct  589   SPGSILSVDMEMKPHHHGETNNITREGQNNNTTTKFGIESHGGGFGAFPNMEDIGRFHHH  648

Query  757   ggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSE--NLAVSGSQQN-YLSTHQDMELG  587
                          E L   F HGNGVSLTLGLP S   NL++SG+ Q+ +LS  Q+M LG
Sbjct  649   VT-----------EQLAPRF-HGNGVSLTLGLPHSTENNLSLSGTTQHGFLS--QNMHLG  694

Query  586   RRLEMGR--MGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
              R        G  N   PSSHS I+  YE+ID QN KRFAAQLL DFVA
Sbjct  695   MRNSENDEFCGAINTTPPSSHSGIS--YESIDIQNRKRFAAQLLRDFVA  741



>ref|XP_009348973.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
 ref|XP_009348980.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
 ref|XP_009348985.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
Length=710

 Score =   105 bits (261),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 154/292 (53%), Gaps = 40/292 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE K QE+ G S     +    + A+K     ++  +   T N +  N+
Sbjct  444   LWKPMVEEMYLEEAKEQEKNGSS--EKMSKSNEDSASKSTAPQDTENQTTSTFNSKQENS  501

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNI-Q  920
              N+   T  S SI T S +  + ++ Q G    F+ I +  ++   + + KKPR+  I  
Sbjct  502   VNHNVATHPSMSISTPSTSPTNMVRNQSG----FTLIGSSELDGITQGSPKKPRSTEIMH  557

Query  919   SSPSSILSVDMDMKSAA--------GEANKGYNHHKFTADRTPAAAAENFPDLMAAANTg  764
             SS S++  ++M+ +  +        G+  +G + + F   +T      NF         G
Sbjct  558   SSNSTVPCMNMESQEVSNEQVSMKFGDERQGRDGYSFMGGQT------NF--------IG  603

Query  763   gfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQ--QNYLSTHQDMEL  590
              FG + IG+ GRF+ +  T  F  GNGVSLTLGLP  ENL++SG+   Q +L  +Q+++L
Sbjct  604   NFGQYPIGEIGRFDADQFTPRFS-GNGVSLTLGLPHCENLSLSGAHHHQTFLP-NQNIQL  661

Query  589   GRRLEMG----RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             GRR+++G    + G  N   P S +     +E ID QN KRF AQLLPDFVA
Sbjct  662   GRRVDIGETNDQFGAINTSAPHSSA---AAFENIDIQNRKRFVAQLLPDFVA  710



>gb|KHN33154.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=428

 Score =   102 bits (253),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 108/294 (37%), Positives = 152/294 (52%), Gaps = 53/294 (18%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANK-----EIGSNNSTEKQEKTSNI  1112
             LWKPMVEEMYTEEMK  EQ     E+ ++    + A+K     + G +N TE +   S  
Sbjct  169   LWKPMVEEMYTEEMKDHEQ--NRSEDKSSKSNEDSASKMSAPQDKGPSNETEAKSFNSKH  226

Query  1111  QDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRN  932
             + + + N A    +S S  + SP GV +++ Q G    FSF+ +  ++   + + KKPRN
Sbjct  227   EVSKSQNTAM---VSVSRPSTSPLGV-NVRSQSG----FSFMGSSELDGITQGSPKKPRN  278

Query  931   DNIQSSPSSILSVDMDMKS----------AAGEANKGYNHHKFTADRTPAAAAENFPDLM  782
               +  SP+S+ S+ MD+K             G   +G N   F  ++T      NF    
Sbjct  279   HEMMHSPNSVPSMSMDVKPNDENNEQLSMKFGVERQGRNESSFMGNQT------NF----  328

Query  781   AAANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQ  602
                  GGFG + IGD GRF+ E  T     GNGVSLTLGL      ++ G+ Q +L  +Q
Sbjct  329   ----NGGFGQYPIGDIGRFDTEQFTPRL-SGNGVSLTLGLD-----SLPGTHQTFL-PNQ  377

Query  601   DMELGRRLEMG---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFV  449
             +++LGR L++G     G  +   P S       YE+I  QN KRFAAQLLPDFV
Sbjct  378   NIQLGRSLDIGEPNEFGAISTSSPHS----TAAYESISMQNPKRFAAQLLPDFV  427



>ref|XP_007145789.1| hypothetical protein PHAVU_007G267900g [Phaseolus vulgaris]
 gb|ESW17783.1| hypothetical protein PHAVU_007G267900g [Phaseolus vulgaris]
Length=649

 Score =   103 bits (256),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 106/283 (37%), Positives = 158/283 (56%), Gaps = 35/283 (12%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EEMK  E   GS E ++ +G+ + A K    N++  ++  TS I+    
Sbjct  396   LWKPMVEEMYLEEMKEHE-LNGSEEKSSKSGE-DPAMK----NSTPREKHPTSEIES---  446

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGG--GAFSFINTLNMENAGERNGKKPRNDNI  923
              + +S  ++S S   +  +   S  P GG      FSFI +     + + + KK RN  I
Sbjct  447   KSFSSKQDVSKSQNNSMASTSPSTSPIGGRNVKNQFSFIGS-----STQGSPKKARNHEI  501

Query  922   QSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-Tggfggft  746
               SP+   S++MD+K      N+G N  + + D   +    +F  + +  N T GFG + 
Sbjct  502   LPSPNRASSMNMDVK-----MNEGNNEQQVSMDERQSRDGYSF--MGSQTNFTSGFGQYP  554

Query  745   igdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMG-  569
             + + GRF+ E  T  F  GNGVSLTLGLP  + L  SG+ Q +L  +Q+++LGR L++G 
Sbjct  555   MEEIGRFDAEQFTPRF-SGNGVSLTLGLPHCDTL--SGTHQTFLP-NQNIQLGRGLDIGQ  610

Query  568   --RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
               + G+ NN   +SHS  +  YE+++ QN KRFAAQL+ DFVA
Sbjct  611   PNQFGVLNN--STSHS--SAAYESMNMQNPKRFAAQLVLDFVA  649



>ref|XP_009613053.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=643

 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 112/287 (39%), Positives = 133/287 (46%), Gaps = 88/287 (31%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMK-GQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnn  1100
             LWKPMVEEMY EE+K  QEQ   S EN      +NE NKE   + S+  QE         
Sbjct  430   LWKPMVEEMYLEEVKNNQEQNTSSEENK----NKNELNKEKVVSKSSAPQEN--------  477

Query  1099  nnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQ  920
                  +PTEISTS ++ SPT   S   Q      FSFI +LNMEN      KKPRN ++ 
Sbjct  478   ----GTPTEISTSTISTSPTAGGSF--QAVQAHNFSFIGSLNMEN--NTIAKKPRNHDMH  529

Query  919   SSPSSILSVDMDM---KSAAGEANKGYNHHKFTADRTPAAAAENF-----PDLMAAANTg  764
             +S  S +   +DM   K+   ++NK +N      D T A     F      + MAA N  
Sbjct  530   NSSPSSILSSVDMAETKARNHQSNKRFNP---LMDATAAYTMGEFGRFNPHEQMAATN--  584

Query  763   gfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPP-SENLAVSGSQQNYLSTHQDMELG  587
                                  FH  NGVSLTLGLPP SENL    SQQNY          
Sbjct  585   ---------------------FHGNNGVSLTLGLPPNSENL----SQQNY----------  609

Query  586   RRLEMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
              ++E  RM                 YE IDFQN KRF +QLLPDFVA
Sbjct  610   -QIEFNRM----------------SYENIDFQN-KRFPSQLLPDFVA  638



>ref|XP_008360598.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008360599.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=710

 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 152/292 (52%), Gaps = 40/292 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE K QE+ G S     +    + A+K     ++  +   T N +  N+
Sbjct  444   LWKPMVEEMYLEEAKEQEKNGSS--EKMSKSNEDSASKSTAPQDTENQTTSTFNSKQENS  501

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNI-Q  920
              N+   T  S SI T S +  + ++ Q G    F+ I +  ++   + + KKPR+  I  
Sbjct  502   VNHNVATHPSRSISTPSTSPTNMVRNQSG----FTLIGSSELDGITQGSPKKPRSTEIMH  557

Query  919   SSPSSILSVDMDMKSAA--------GEANKGYNHHKFTADRTPAAAAENFPDLMAAANTg  764
             SS S +  ++M+ +  +        G   +G + + F   +T      NF         G
Sbjct  558   SSNSGVPCMNMESQEVSNEQVSMKFGNERQGRDGYSFMGGQT------NF--------IG  603

Query  763   gfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQ--QNYLSTHQDMEL  590
              FG + IG+ GRF+ +  T  F  GNGVSLTLGLP  ENL++SG+   Q +L  +Q+++L
Sbjct  604   NFGQYPIGEIGRFDADQFTPRFS-GNGVSLTLGLPHCENLSLSGAHHHQTFLP-NQNIQL  661

Query  589   GRRLEMG----RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             GRR+++G    + G  N   P S +     +E ID QN KRF AQLLPDFVA
Sbjct  662   GRRVDIGETNDQFGAINTSAPHSSA---AAFENIDIQNRKRFVAQLLPDFVA  710



>ref|XP_008391977.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008391978.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=708

 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 152/292 (52%), Gaps = 40/292 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE K QE+ G S     +    + A+K     ++  +   T N +  N+
Sbjct  442   LWKPMVEEMYLEEAKEQEKNGSS--EKMSKSNEDSASKSTAPQDTENQTTSTFNSKQENS  499

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNI-Q  920
              N+   T  S SI T S +  + ++ Q G    F+ I +  ++   + + KKPR+  I  
Sbjct  500   VNHNVATHPSRSISTPSTSPTNMVRNQSG----FTLIGSSELDGITQGSPKKPRSTEIMH  555

Query  919   SSPSSILSVDMDMKSAA--------GEANKGYNHHKFTADRTPAAAAENFPDLMAAANTg  764
             SS S +  ++M+ +  +        G   +G + + F   +T      NF         G
Sbjct  556   SSNSGVPCMNMESQEVSNEQVSMKFGNERQGRDGYSFMGGQT------NF--------IG  601

Query  763   gfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQ--QNYLSTHQDMEL  590
              FG + IG+ GRF+ +  T  F  GNGVSLTLGLP  ENL++SG+   Q +L  +Q+++L
Sbjct  602   NFGQYPIGEIGRFDADQFTPRFS-GNGVSLTLGLPHCENLSLSGAHHHQTFLP-NQNIQL  659

Query  589   GRRLEMG----RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             GRR+++G    + G  N   P S +     +E ID QN KRF AQLLPDFVA
Sbjct  660   GRRVDIGETNDQFGAINTSAPHSSA---AAFENIDIQNRKRFVAQLLPDFVA  708



>ref|XP_010059079.1| PREDICTED: BEL1-like homeodomain protein 1 [Eucalyptus grandis]
 gb|KCW90459.1| hypothetical protein EUGRSUZ_A02588 [Eucalyptus grandis]
 gb|KCW90460.1| hypothetical protein EUGRSUZ_A02588 [Eucalyptus grandis]
Length=703

 Score =   102 bits (255),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 98/287 (34%), Positives = 145/287 (51%), Gaps = 22/287 (8%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMYTEE+K QEQ GG  E      K +++ +E  ++ S+  Q+K  N  + N+
Sbjct  429   LWKPMVEEMYTEEIKEQEQNGGGAEE-----KPSKSEREDSASKSSGLQDKAPN-SNENS  482

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGG----GGGAFSFINTLNMENAGERNGKKPRND  929
               +  P EI++          +S    GG        F+ +    +E   + + KKPR+ 
Sbjct  483   TKSFKPKEITSRNHDTPAISTNSASSIGGNVRSSSSGFTLVGPSELEGLTQGSPKKPRSA  542

Query  928   NIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAA--ENFPDLMAAANTggfg  755
              +  + S++ S++++ K     + K  +  +   D  P       NF         G  G
Sbjct  543   ELLQNLSNVSSLNVNPKLGEAISMKFIDEGQ-GRDGYPIIGGGPANFIGGFGQYPMGEIG  601

Query  754   gftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLE  575
              F    F      N  +    GNGVSLTLGLP SENL++SG+ Q++L + Q+++LGRR++
Sbjct  602   RFGADQFAPSFSGNGVSPTFSGNGVSLTLGLPHSENLSLSGAHQSFLPS-QNIQLGRRVD  660

Query  574   MG---RMGIDNNPQ-PSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             +G     G  N P  P S S     YET++ QN KRF  QLL DFVA
Sbjct  661   IGEANEFGAMNTPTIPHSSS----AYETMNIQNRKRFPVQLLQDFVA  703



>ref|XP_003521496.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006577097.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006577098.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
 ref|XP_006577099.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Glycine 
max]
Length=679

 Score =   102 bits (254),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 108/294 (37%), Positives = 152/294 (52%), Gaps = 53/294 (18%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANK-----EIGSNNSTEKQEKTSNI  1112
             LWKPMVEEMYTEEMK  EQ     E+ ++    + A+K     + G +N TE +   S  
Sbjct  420   LWKPMVEEMYTEEMKDHEQ--NRSEDKSSKSNEDSASKMSAPQDKGPSNETEAKSFNSKH  477

Query  1111  QDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRN  932
             + + + N A    +S S  + SP GV +++ Q G    FSF+ +  ++   + + KKPRN
Sbjct  478   EVSKSQNTAM---VSVSRPSTSPLGV-NVRSQSG----FSFMGSSELDGITQGSPKKPRN  529

Query  931   DNIQSSPSSILSVDMDMKS----------AAGEANKGYNHHKFTADRTPAAAAENFPDLM  782
               +  SP+S+ S+ MD+K             G   +G N   F  ++T      NF    
Sbjct  530   HEMMHSPNSVPSMSMDVKPNDENNEQLSMKFGVERQGRNESSFMGNQT------NF----  579

Query  781   AAANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQ  602
                  GGFG + IGD GRF+ E  T     GNGVSLTLGL      ++ G+ Q +L  +Q
Sbjct  580   ----NGGFGQYPIGDIGRFDTEQFTPRL-SGNGVSLTLGLD-----SLPGTHQTFL-PNQ  628

Query  601   DMELGRRLEMG---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFV  449
             +++LGR L++G     G  +   P S       YE+I  QN KRFAAQLLPDFV
Sbjct  629   NIQLGRSLDIGEPNEFGAISTSSPHS----TAAYESISMQNPKRFAAQLLPDFV  678



>ref|XP_009787672.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009787673.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009787674.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
Length=707

 Score =   102 bits (254),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 152/296 (51%), Gaps = 40/296 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKT--SNIQDn  1103
             LWKPMVEEMY EE+K QEQ G   E  +   ++NE +    ++ S   QEK+  S+ Q+ 
Sbjct  433   LWKPMVEEMYLEEIKEQEQNGSELEKTSKLREQNEDS----TSRSIAPQEKSPRSDSQNK  488

Query  1102  nnnnN----------ASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNME--NAG  959
             +  +           AS   IS +  + SPTG+     +     +F+ I +  ++  N G
Sbjct  489   SFLSKQDNNLANHNPASTIPISNTT-SISPTGL-----RIRNNTSFNLIGSPEIKSINIG  542

Query  958   ERNGKKPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMA  779
             + + KKPR++ I  SP+S+ S++MD+K      N+     KF  DR      + F  +  
Sbjct  543   QGSPKKPRSNEILHSPNSVPSINMDVK-----PNEEQMLIKFGDDR---QNRDGFSLMGG  594

Query  778   AANTggfggftigdfg-rFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLST-H  605
               N  G  G        RF+ E  +A +     VSLTLGLP SENL++S +  ++L    
Sbjct  595   PTNFMGGFGSYPIGEIGRFSTEQFSAPYSTSGTVSLTLGLPHSENLSMSATHHSFLPIPT  654

Query  604   QDMELGRRLEMGR---MGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             Q +++GR +E+G     G  N P  S+HS     YE  + QN KRFAA LLPDFVA
Sbjct  655   QSIQMGRGVEIGEANEFGSLNTPT-SAHST--SVYENFNIQNRKRFAAPLLPDFVA  707



>gb|KHF99976.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=693

 Score =   101 bits (251),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 137/283 (48%), Gaps = 52/283 (18%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EEMK  E  GG  EN   + +     KE GS +S       SN Q    
Sbjct  457   LWKPMVEEMYLEEMKEHEMKGGE-ENTNKSEQ-----KESGSTSSK------SNAQQQEM  504

Query  1096  nnNASPT-EISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENA---GERNGKKPRN-  932
             N  ASPT + S S ++ SP   S + PQ     +F+ I +   +N     +R  KK RN 
Sbjct  505   N--ASPTHQFSNSTISTSPMEGSLMPPQT----SFNLIGSSEFDNGVGLAQRASKKSRNA  558

Query  931   -DNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfg  755
              D +Q+SP       M+MK   GE  +  N +             +F  L   A +    
Sbjct  559   NDELQNSP-------MEMK--PGETWET-NINMIKLGDEERLLKHSFSYLSGTAYSSMGE  608

Query  754   gftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLE  575
                  +  +  P+       HGN VSLTLGLP  ENL++SG+ QN+LS H +++LG    
Sbjct  609   IGRFNEEQQLPPK------FHGNSVSLTLGLPHCENLSLSGNPQNFLSNH-NIQLG----  657

Query  574   MGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
                    N P  +SHSN  G     + QN +RFAAQLLPDFVA
Sbjct  658   ------INTPH-ASHSNAAGFDNIHEMQNRQRFAAQLLPDFVA  693



>ref|XP_009628712.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628714.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628715.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=700

 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 105/295 (36%), Positives = 149/295 (51%), Gaps = 37/295 (13%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNE--ANKEIGSNNSTEKQE--------  1127
             LWKPMVEEMY EE+K QEQ G   E  +  G++NE   ++ IG    + + +        
Sbjct  425   LWKPMVEEMYLEEIKEQEQNGSDLEKTSKLGEQNEDSTSRSIGPQEKSPRSDSQNKSFLS  484

Query  1126  KTSNIQDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNME--NAGER  953
             K  N   N+N  +  P   ++SI   SPTG+S     G     F+ I +   E  N  + 
Sbjct  485   KHDNNLANHNPASTIPKSNTSSI---SPTGLSIRNNTG-----FNLIGSPEKESINVAQG  536

Query  952   NGKKPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAA  773
             + KKPR++ +  SP+S+ S++MD+K      N+     KF  DR      + F  +    
Sbjct  537   SQKKPRSNEMLHSPNSVPSINMDVK-----PNEEQMSIKFGDDR---QNRDGFSLMGGPT  588

Query  772   NTggfggftigdfg-rFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLST-HQD  599
             N  G  G        RF+ E  +A +     VSLTLGLP SENL++S +  ++L    Q 
Sbjct  589   NFMGGFGSYPIGEIGRFSTEQFSAPYSTSGTVSLTLGLPHSENLSMSATHHSFLPIPTQS  648

Query  598   MELGR-RLEMGR---MGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             +++GR  +E+G     G  N P  S+HS     YE  + QN KRFAA LLPDFVA
Sbjct  649   IQMGRGVVEIGEANEFGSLNTPT-SAHST--SVYENFNIQNRKRFAAPLLPDFVA  700



>ref|XP_007162972.1| hypothetical protein PHAVU_001G195800g [Phaseolus vulgaris]
 gb|ESW34966.1| hypothetical protein PHAVU_001G195800g [Phaseolus vulgaris]
Length=679

 Score = 99.0 bits (245),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 105/288 (36%), Positives = 144/288 (50%), Gaps = 41/288 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAA---AGKRNEANKEIGSNNSTEKQEKTSNIQD  1106
             LWKPMVEEMY EEMK  EQ G   +++ +   +  +  A  E G +N TE   K+ N   
Sbjct  420   LWKPMVEEMYLEEMKDHEQNGSEDKSSKSNEDSSTKMAAPPERGPSNETEA--KSFN---  474

Query  1105  nnnnnNASPTEIS----TSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKP  938
                    S  E+S    T++++ S    S L         FSF+ +  +E   + + KK 
Sbjct  475   -------SKQEVSKSQNTAMVSVSRPSTSQLGGNVRNQSGFSFMGSSELEGITQGSPKKA  527

Query  937   RNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTgg-  761
             RN  +  SP+S+ S+++D+K    EAN      KF  DR       N    M        
Sbjct  528   RNHEMMHSPNSVPSMNIDVK--PNEANNEQLSMKFGDDRQ----GRNESSFMVNQTNFIG  581

Query  760   -fggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGR  584
              FG + IGD GRF+ E     F  GNGVSLTLGL      ++ G+ Q +L  +Q+++LGR
Sbjct  582   GFGQYPIGDIGRFDAEQFAPRF-SGNGVSLTLGLD-----SLPGTHQTFL-PNQNIQLGR  634

Query  583   RLEMG---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFV  449
              L++G     G  N   P S    +  YE+I  QN KRFAAQLLPDFV
Sbjct  635   SLDIGEPNEFGSINTSSPHS----SAAYESISMQNPKRFAAQLLPDFV  678



>gb|KHG12855.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=644

 Score = 98.6 bits (244),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 98/281 (35%), Positives = 142/281 (51%), Gaps = 40/281 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QEQ   + E++A+        K    + S+ KQ+ ++N      
Sbjct  400   LWKPMVEEMYLEEIKEQEQ---NNEDSASKSTGPTPAKNQAKSLSSSKQDNSAN------  450

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNI-Q  920
                 + + +S S+ + SP    + Q Q G    +SFI +  +E   + + KKPR+  +  
Sbjct  451   ---QNASSMSISMASTSPLA-GNAQNQSG----YSFIGSSELEGITQGSPKKPRSTEVLL  502

Query  919   SSPSSILSVDMDMKS--AAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfggft  746
              SP     +DMD K   AA + +  +    ++   T       F     A          
Sbjct  503   QSP-----IDMDTKQREAADDVSIKFGKEGYSFMGTDTNFIGGFGQYPIA----------  547

Query  745   igdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGR  566
               +  RF+ E+    F  GNGVSLTLGLP  ENL++S + Q +L  +Q +++GRRL++G 
Sbjct  548   --EMARFDAEHFAPRF-PGNGVSLTLGLPHCENLSLSATHQTFLP-NQTLQMGRRLDIGE  603

Query  565   MGIDNNPQPSS-HSNINGGYETIDFQNGKRFAAQLLPDFVA  446
                     PS+ HS+     E ID QN KRFAAQLLPDFVA
Sbjct  604   PNEYGAINPSTPHSSAAYEIENIDVQNRKRFAAQLLPDFVA  644



>gb|KHG12856.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=763

 Score = 98.6 bits (244),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 98/281 (35%), Positives = 142/281 (51%), Gaps = 40/281 (14%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QEQ   + E++A+        K    + S+ KQ+ ++N      
Sbjct  519   LWKPMVEEMYLEEIKEQEQ---NNEDSASKSTGPTPAKNQAKSLSSSKQDNSAN------  569

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNI-Q  920
                 + + +S S+ + SP    + Q Q G    +SFI +  +E   + + KKPR+  +  
Sbjct  570   ---QNASSMSISMASTSPLA-GNAQNQSG----YSFIGSSELEGITQGSPKKPRSTEVLL  621

Query  919   SSPSSILSVDMDMKS--AAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfggft  746
              SP     +DMD K   AA + +  +    ++   T       F     A          
Sbjct  622   QSP-----IDMDTKQREAADDVSIKFGKEGYSFMGTDTNFIGGFGQYPIA----------  666

Query  745   igdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGR  566
               +  RF+ E+    F  GNGVSLTLGLP  ENL++S + Q +L  +Q +++GRRL++G 
Sbjct  667   --EMARFDAEHFAPRF-PGNGVSLTLGLPHCENLSLSATHQTFLP-NQTLQMGRRLDIGE  722

Query  565   MGIDNNPQPSS-HSNINGGYETIDFQNGKRFAAQLLPDFVA  446
                     PS+ HS+     E ID QN KRFAAQLLPDFVA
Sbjct  723   PNEYGAINPSTPHSSAAYEIENIDVQNRKRFAAQLLPDFVA  763



>ref|XP_008387112.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008387113.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008387114.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=703

 Score = 98.2 bits (243),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 96/284 (34%), Positives = 143/284 (50%), Gaps = 24/284 (8%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QEQ G S + + + G  + A+K     ++  +   T N +  N+
Sbjct  437   LWKPMVEEMYMEEVKEQEQNGSSEKMSKSNG--DSASKSTAPQDTENQTTSTFNFKQENS  494

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNI-Q  920
              N+      S SI  AS +  + ++ Q G    F+ I +  ++   + + KKPR+  I  
Sbjct  495   VNHNLAAHPSISISQASTSPTNMVRNQSG----FTLIGSSELDGITQGSPKKPRSTEIMH  550

Query  919   SSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfggftig  740
             SS  S+  ++++    A E N      KF  +R      + +  +    N  G  G    
Sbjct  551   SSNGSVPRMNIE----AQEVNNEQVSMKFGDERQ---GRDGYSFMGGQTNFIGNFGQYPI  603

Query  739   dfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGS--QQNYLSTHQDMELGRRLEMG-  569
                     +  A    GNGVSLTLGLP  ENL++SG+   Q +L  +Q+++LGRR++ G 
Sbjct  604   GEIGRFDADQFAPRFSGNGVSLTLGLPHCENLSMSGAHRHQTFLP-NQNIQLGRRVDTGE  662

Query  568   ---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
                + G  N    S+  +    +E ID QN KRF AQLLPDFVA
Sbjct  663   TNDQFGAINT---SASHSSAAAFENIDIQNRKRFVAQLLPDFVA  703



>gb|ACD39466.1| BEL29 protein [Solanum palustre]
Length=516

 Score = 97.4 bits (241),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 108/295 (37%), Positives = 163/295 (55%), Gaps = 33/295 (11%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNE---ANKEIGSNNS---TEKQEKT-S  1118
             LWKP+VEEMY EE+K  EQ G   E  +  G++NE    ++ I + +    ++ Q K+  
Sbjct  237   LWKPVVEEMYLEEIKEHEQNGLDQEKTSKLGEQNEDSTTSRSIATQDKSPGSDSQNKSFV  296

Query  1117  NIQDnnnnnN--ASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNG-  947
             + QDN+   +  ASP  +S + M+  P G+ +++ Q  G   F+ I +  +E+     G 
Sbjct  297   SKQDNHLRQHNPASPMPMSNA-MSIPPNGM-NIRNQSAG---FNLIGSPEIESINITQGS  351

Query  946   -KKPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN  770
              KKPR++ +  SP+SI S++MD+K      N+     KF  DR      + F  +    N
Sbjct  352   PKKPRSNEMLHSPNSIPSINMDVK-----PNEEQMSMKFGDDR---QDRDGFSLMGGPMN  403

Query  769   -TggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLST-HQDM  596
               GGFG + IG+  RF+ E  +A +  G  VSLTLGLP +ENL++S +  ++L    Q++
Sbjct  404   FMGGFGAYPIGEIARFSTEQFSAPYSTGGTVSLTLGLPHNENLSMSATHHSFLPIPTQNI  463

Query  595   ELGR-RLEMG----RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             ++GR   E+G      G  N P  S+HS  +  YE  + QN KRFAA LLPDFVA
Sbjct  464   QIGRGGAEIGEPNHEFGSLNTPT-SAHST-SSVYENFNIQNRKRFAAPLLPDFVA  516



>ref|XP_004228612.1| PREDICTED: BEL1-like homeodomain protein 1 [Solanum lycopersicum]
Length=700

 Score = 96.3 bits (238),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 105/284 (37%), Positives = 155/284 (55%), Gaps = 31/284 (11%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKT--SNIQDn  1103
             LWKPMVEEMY EE+K  EQ     E  +  G++NE +    ++ S   Q+K+  S+ Q  
Sbjct  439   LWKPMVEEMYLEEIKEHEQNTLGQEKTSKVGEQNEDST---TSRSIATQDKSPGSDSQKQ  495

Query  1102  nnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNG--KKPR-N  932
             +N  ++ P   +TSI    P G+ +++ Q  G   F+ I + ++E+     G  KKPR N
Sbjct  496   DNPASSIPMSNATSI---PPIGM-NIRNQSAG---FNLIGSPDIESINVTQGSPKKPRSN  548

Query  931   DNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTg-gfg  755
             + +Q SP+SI S++MD+K      N+     KF  DR      + F  +    N   GFG
Sbjct  549   EMLQHSPNSIPSINMDVK-----PNEEQMSMKFGDDR---QDRDGFSLMGGPMNFMGGFG  600

Query  754   gftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLST-HQDMELGR-R  581
              + IG+  RF+ E  +A +     VSLTLGLP +ENL++S +  ++L    Q++++G   
Sbjct  601   AYPIGEIARFSTEQFSAPYSTSGTVSLTLGLPHNENLSMSATHHSFLPIPTQNVQIGEPN  660

Query  580   LEMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFV  449
              E G +   N P  S+HS  N  YE  + QN KRFAA LLPDFV
Sbjct  661   HEFGSL---NTPT-SAHSTSN-VYENFNIQNRKRFAAPLLPDFV  699



>ref|XP_010313381.1| PREDICTED: BEL1-like homeodomain protein 1 [Solanum lycopersicum]
Length=703

 Score = 94.7 bits (234),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 134/292 (46%), Gaps = 72/292 (25%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEK---TSNIQD  1106
             LWKPMVEEMY EE+K   Q     +N          N EI  + S+  QEK   +SNI  
Sbjct  469   LWKPMVEEMYMEEVKKNNQ----EQNGLDQKIIEPNNNEIVGSKSSAPQEKLPISSNI--  522

Query  1105  nnnnnNASPTEISTSIMTASPTGVSSLQPQGGGG-------GAFSFINTLNMENAG-ERN  950
                        I  +      T   S  P GGGG       G FS I +LNM+N   +RN
Sbjct  523   -----------IHDATSNDISTSTISTSPTGGGGSMPAQTVGGFSLIRSLNMDNIDDQRN  571

Query  949   GKKPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN  770
              KK RN+ +QSS  +I+S++ ++ +            KF   +T          LM  + 
Sbjct  572   NKKARNE-MQSS--TIISMEREIMNKVKSE-------KFNNTQTRECYT-----LMTPSY  616

Query  769   TggfggftigdfgrFNPENLTAGFHHG-NG-VSLTLGLPP-SENLAVSGSQQNYLSTHQD  599
             T          F   N E L   FH G NG VSLTLGLPP SEN      Q NY+     
Sbjct  617   TMDDDQQFGTRFNNQNHEQLATTFHQGSNGHVSLTLGLPPNSEN------QHNYI-----  665

Query  598   MELGRRLEMGRMGIDNNP-QPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
                         G++++  QP+ H NI+  YE IDFQ+GKR+A QLL D+V+
Sbjct  666   ------------GLESHYNQPTHHPNIS--YENIDFQSGKRYATQLLQDYVS  703



>gb|KHN19925.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=767

 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 108/308 (35%), Positives = 142/308 (46%), Gaps = 53/308 (17%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDn--  1103
             LWKPMVEEMY EE+K QE    S +N     K  E++KE+ S  +   QE  +   D+  
Sbjct  482   LWKPMVEEMYLEEVK-QEPNNSSQDNTTKRSK--ESSKELWSEANATAQESGAMRLDHIN  538

Query  1102  nnnnNASPTEISTSIMTASPTGVS-----SLQPQGGGGGAFSFINTLNMENAGERNGKKP  938
                + A     + +  T SPT +S     SLQ  G            ++ +    N    
Sbjct  539   ILQSKAESFNNNNNNQTTSPTEISNNSHNSLQSAG-----------FHLADMQSPNKPIR  587

Query  937   RNDNIQSSPSSILSVDMDMK-SAAGEANKGY--------NHHKF--TADRTPAAAAENFP  791
                 +Q+SP SILSVDM+MK    GE N           N  KF   +          FP
Sbjct  588   STSEMQNSPGSILSVDMEMKPRHHGETNNNTIITREGNNNTTKFGIESHGGGGGGFGAFP  647

Query  790   DLMAAANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSE----NLAVSGS--  629
             ++    + G F           + ++L   F HGNGVSLTLGLP S     NL++SG+  
Sbjct  648   NM---EDIGRFHHHHHHHHHVTDQQSLAPRF-HGNGVSLTLGLPHSTENNNNLSLSGTTH  703

Query  628   QQNYLSTHQDMELGRRLEMGRM------GIDNNPQPSSHSNINGGYETID-FQNGKRFAA  470
             Q  +LS  Q+M LG R             I+  P  +SHS  +  YE+ID  QN KRFAA
Sbjct  704   QHGFLS--QNMHLGMRSTTNNANNEFCGAINTTPPSNSHSGTS--YESIDIIQNRKRFAA  759

Query  469   QLLPDFVA  446
             QLL DFVA
Sbjct  760   QLLRDFVA  767



>gb|AAN03626.1|AF406702_1 BEL1-related homeotic protein 29, partial [Solanum tuberosum]
Length=567

 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 98/291 (34%), Positives = 152/291 (52%), Gaps = 31/291 (11%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNE---ANKEIGSNNS---TEKQEKTSN  1115
             LWKPMVEEMY EE+K  EQ G   E  +  G++NE    ++ I + +    ++ Q K+  
Sbjct  294   LWKPMVEEMYLEEIKEHEQNGLGQEKTSKLGEQNEDSTTSRSIATQDKSPGSDSQNKSFV  353

Query  1114  IQDnnnnnNASPTEISTSIMT--ASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNG--  947
              + +N+    +P      +     +P G+ +++ Q  G   F+ I +  +E+     G  
Sbjct  354   SKQDNHLPQHNPASPMPDVQRHFHTPIGM-TIRNQSAG---FNLIGSPEIESINITQGSP  409

Query  946   KKPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANT  767
             KKPRN+ +  SP+SI S++MD+K      N+     KF  DR      + F  +    N 
Sbjct  410   KKPRNNEMLHSPNSIPSINMDVK-----PNEEQMSMKFGDDR---QDRDGFSLMGGPMNF  461

Query  766   g-gfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLST-HQDME  593
               GFG + IG+  RF+ E  +A +     VSLTLGLP +ENL++S +  ++L    Q+++
Sbjct  462   MGGFGAYPIGEIARFSTEQFSAPYSTSGTVSLTLGLPHNENLSMSATHHSFLPIPTQNIQ  521

Query  592   LGRR--LEMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             +G     E G +       P+S  + +  YET + QN KRFAA LLPDFVA
Sbjct  522   IGSEPNHEFGSLNT-----PTSAHSTSSVYETFNIQNRKRFAAPLLPDFVA  567



>ref|XP_003539151.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006591059.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006591060.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
Length=764

 Score = 94.0 bits (232),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 109/308 (35%), Positives = 140/308 (45%), Gaps = 56/308 (18%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDn--  1103
             LWKPMVEEMY EE+K QE    S +N     K  E++KE+ S  +   QE  +   D+  
Sbjct  482   LWKPMVEEMYLEEVK-QEPNNSSQDNTTKRSK--ESSKELWSEANATAQESGAMRLDHIN  538

Query  1102  nnnnNASPTEISTSIMTASPTGVS-----SLQPQGGGGGAFSFINTLNMENAGERNGKKP  938
                + A     + +  T SPT +S     SLQ  G            ++ +    N    
Sbjct  539   ILQSKAESFNNNNNNQTTSPTEISNNSHNSLQSAG-----------FHLADMQSPNKPIR  587

Query  937   RNDNIQSSPSSILSVDMDMK-SAAGEANKGY--------NHHKF--TADRTPAAAAENFP  791
                 +Q+SP SILSVDM+MK    GE N           N  KF   +          FP
Sbjct  588   STSEMQNSPGSILSVDMEMKPRHHGETNNNTIITREGNNNTTKFGIESHGGGGGGFGAFP  647

Query  790   DLMAAANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSE----NLAVSGS--  629
                   N    G F        + ++L   F HGNGVSLTLGLP S     NL++SG+  
Sbjct  648   ------NMEDIGRFHHHHHHVTDQQSLAPRF-HGNGVSLTLGLPHSTENNNNLSLSGTTH  700

Query  628   QQNYLSTHQDMELGRRLEMGRM------GIDNNPQPSSHSNINGGYETID-FQNGKRFAA  470
             Q  +LS  Q+M LG R             I+  P  +SHS  +  YE+ID  QN KRFAA
Sbjct  701   QHGFLS--QNMHLGMRSTTNNANNEFCGAINTTPPSNSHSGTS--YESIDIIQNRKRFAA  756

Query  469   QLLPDFVA  446
             QLL DFVA
Sbjct  757   QLLRDFVA  764



>dbj|BAE71188.1| BEL1-like homeodomain transcription factor [Trifolium pratense]
Length=651

 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 91/287 (32%), Positives = 144/287 (50%), Gaps = 50/287 (17%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMYTEEMK QE   GS +N ++       +++    ++T +Q  TS  +  + 
Sbjct  405   LWKPMVEEMYTEEMKEQE-MNGSEDNKSS----KHIDEDTSMKSTTPQQVPTSETESKSF  459

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQS  917
             N+      +S S  + SP GV+      G    FSF     ++   + + K+ RN  I  
Sbjct  460   NSKQDIPIVSVSTQSTSPIGVNVRNNNSG----FSFT---ELDGITQASPKRTRNHEILQ  512

Query  916   SPSSILS--------VDMDMKSAAGEANKGYNHHKFTADRTPAAAAE-NFPDLMAAANTg  764
             SP+ + S          + MK   G+  +  + + F  ++T   A    +P         
Sbjct  513   SPNHVKSNETNNNNNEQISMK--FGDDRQSRDGYCFMGNQTNFIAGFGQYP---------  561

Query  763   gfggftigdfgrFNPENLTAGFH-HGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELG  587
                   + + GRF+ E  T  F  + NGVSLTLGLP  + L  SG+ Q+++  +Q+++LG
Sbjct  562   ------MEEIGRFDAEQFTPRFSGNNNGVSLTLGLPHCDTL--SGTHQSFMP-NQNIQLG  612

Query  586   RRLEMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             RRL++         + +   + +  +E+++ QN KRFAAQLLPDFVA
Sbjct  613   RRLDIS--------EQNEFGDSSAAFESMNMQNPKRFAAQLLPDFVA  651



>ref|XP_004303380.1| PREDICTED: BEL1-like homeodomain protein 1-like [Fragaria vesca 
subsp. vesca]
Length=704

 Score = 93.6 bits (231),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 101/294 (34%), Positives = 154/294 (52%), Gaps = 39/294 (13%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K  E   GS E      K +++N++  S ++  ++   +  Q+  N
Sbjct  433   LWKPMVEEMYLEEIKENE-LNGSSE------KISKSNEDSASKSTPPQERSPATDQNQTN  485

Query  1096  nnNASPTEISTSIMTASPTGVSS-----------LQPQGGGGGAFSFINTLNMENAGERN  950
             +   S  E ST+ + A P+   S           ++ Q G    FS I +  ++   + +
Sbjct  486   STFNSKQETSTNHIAAPPSMSMSMSSASTSPTNMVRNQSG----FSLIGSSELDGITQGS  541

Query  949   GKKPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN  770
              KKPR+  I  SP+S+++  MD+K    E +      KF  +R    + + +  +    N
Sbjct  542   PKKPRSTEIMHSPNSMMN-HMDVKPQ--EVSNEQVSMKFGDER---QSRDGYSFMGGQTN  595

Query  769   -TggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDME  593
               G FG + IG+ GRF+ +  T  F  GN VSL+LGLP  ENL++SG+       +Q+++
Sbjct  596   FIGNFGQYPIGEIGRFDTDQFTPRFS-GNSVSLSLGLPHCENLSLSGAHHQTFLPNQNIQ  654

Query  592   LGRRLEM-----GRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             LGRR++       + G  N   P S    + G+E+ID QN KRF AQLLPDFVA
Sbjct  655   LGRRVDHIGEPNDQFGTMNTSAPHS----SAGFESIDIQNRKRFVAQLLPDFVA  704



>ref|XP_010093716.1| BEL1-like homeodomain protein 1 [Morus notabilis]
 gb|EXC39356.1| BEL1-like homeodomain protein 1 [Morus notabilis]
Length=422

 Score = 92.0 bits (227),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 99/286 (35%), Positives = 123/286 (43%), Gaps = 59/286 (21%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE K QE+  GS   +    K+ E N+E  S N T     TS + D  N
Sbjct  187   LWKPMVEEMYMEETKEQERNNGSTSQSGQT-KKTEPNEEPSSANITS----TSQVHDMMN  241

Query  1096  nnNASP------TEISTSIMTASPTGVSSLQPQGGGGGAFSFINT--LNMENAGERNGKK  941
                +S       TE   S ++ SP             G+F F  T    +    +R+   
Sbjct  242   AFQSSKPDQNFATEFPNSPLSTSPM-----------PGSFHFGTTEIQAISPKKQRSTTT  290

Query  940   PRNDNIQSSPSSILSVD-MDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTg  764
             P    + +SPSSILS+D MDM           NH +     T    A    DL       
Sbjct  291   PTTSEVLNSPSSILSMDNMDM------CRDQMNHQRQRKYNTVGFGAYPVGDL-------  337

Query  763   gfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGR  584
                          +   L   F HGNGVSLTLGLP  EN ++S   QN +        G 
Sbjct  338   ----GRFHLSADHHHHQLAPRF-HGNGVSLTLGLPHCENHSLSN--QNIIDPS-----GT  385

Query  583   RLEMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             RL       DN+    S S   G Y+ +D Q+ KRF AQLLPDFVA
Sbjct  386   RL-------DNSIGTGSES--TGNYDNMDMQSRKRFVAQLLPDFVA  422



>ref|XP_010089795.1| BEL1-like homeodomain protein 1 [Morus notabilis]
 gb|EXB38411.1| BEL1-like homeodomain protein 1 [Morus notabilis]
Length=687

 Score = 92.4 bits (228),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 99/286 (35%), Positives = 123/286 (43%), Gaps = 59/286 (21%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE K QE+  GS   +    K+ E N+E  S N T     TS + D  N
Sbjct  452   LWKPMVEEMYMEETKEQERNNGSTSQSGQT-KKTEPNEEPSSANIT----STSQVHDMMN  506

Query  1096  nnNAS------PTEISTSIMTASPTGVSSLQPQGGGGGAFSFINT--LNMENAGERNGKK  941
                +S       TE   S ++ SP             G+F F  T    +    +R+   
Sbjct  507   AFQSSKPDQNFATEFPNSPLSTSPM-----------PGSFHFGTTEIQAISPKKQRSTTT  555

Query  940   PRNDNIQSSPSSILSVD-MDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTg  764
             P    + +SPSSILS+D MDM           NH +     T    A    DL       
Sbjct  556   PTTSEVLNSPSSILSMDNMDM------CRDQMNHQRQRKYNTVGFGAYPVGDL-------  602

Query  763   gfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGR  584
                          +   L   F HGNGVSLTLGLP  EN ++S   QN +        G 
Sbjct  603   ----GRFHLSADHHHHQLAPRF-HGNGVSLTLGLPHCENHSLSN--QNIIDPS-----GT  650

Query  583   RLEMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             RL       DN+    S S   G Y+ +D Q+ KRF AQLLPDFVA
Sbjct  651   RL-------DNSIGTGSES--TGNYDNMDMQSRKRFVAQLLPDFVA  687



>gb|KEH29763.1| BEL1-related homeotic protein [Medicago truncatula]
Length=711

 Score = 90.9 bits (224),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 104/289 (36%), Positives = 144/289 (50%), Gaps = 49/289 (17%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQ---D  1106
             LWKPMVEEMY EE K QE+   S +N   +       KE+G      K ++ +N+    +
Sbjct  460   LWKPMVEEMYLEETKEQEENNDSKDNTNKS-------KELG----VTKLDQINNLHSKAE  508

Query  1105  nnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDN  926
             N NN N SPT IS+S  + S +        GG GG+F   +  ++  + +   + P+N  
Sbjct  509   NFNNQNPSPTVISSSNNSMSTST------MGGEGGSFQSNSGFHLAGSSDVQ-RSPKN--  559

Query  925   IQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRT--PAAAA-ENFPDLMAAANTggfg  755
               S   S LS+DM+MKS   E+N      +   D+   P  +  EN  D    + +    
Sbjct  560   --SHQGSFLSMDMEMKSNR-ESNIEVEVERHNQDKNGYPLMSGNENHHDGGYGSFSMEDI  616

Query  754   gftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRL-  578
                         E L   FH GNGVSLTLGLP +EN+ +S +Q  +LS  Q++ LG  + 
Sbjct  617   RRFNVS------EQLAPRFH-GNGVSLTLGLPHNENIPLSSTQHGFLS--QNLHLGGTID  667

Query  577   EMGR-----MGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             EMG        I+  P   SHS  N  YE+ID +N KRFAAQLL +FV 
Sbjct  668   EMGSNENEFCTINTTP---SHSETN--YESIDIENRKRFAAQLLRNFVT  711



>gb|ACD39469.1| BEL29 protein [Solanum etuberosum]
Length=516

 Score = 89.4 bits (220),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 102/298 (34%), Positives = 157/298 (53%), Gaps = 39/298 (13%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNE---ANKEIGSNNS---TEKQEKT-S  1118
             LWKPMVEEMY EE+K  EQ G   E  +  G++NE    ++ I + +    ++ Q K+  
Sbjct  237   LWKPMVEEMYLEEIKEHEQNGLGQEKTSKLGEQNEDSTTSRSIATQDKSPGSDSQNKSFV  296

Query  1117  NIQDnnnnnN--ASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNG-  947
             + QDN+   +  ASP  +S + M+  P G+ +++ Q  G   F+ I +  +E+     G 
Sbjct  297   SKQDNHLRQHNPASPMPMSNA-MSIPPIGM-NIRNQSAG---FNLIGSPEIESINITQGS  351

Query  946   -KKPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN  770
              KKPR++ +  SP+SI S++MD+K      N+     KF  DR      + F  +    N
Sbjct  352   PKKPRSNEMLHSPNSIPSINMDVK-----PNEEQMSMKFGDDR---QDRDGFSLMGGPMN  403

Query  769   Tg-gfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLST-HQDM  596
                GFG + IG+  RF+ E  +A +     VSLTLGLP +ENL++S +  ++L    Q++
Sbjct  404   FMGGFGAYPIGEIARFSTEQFSAPYSTSGTVSLTLGLPHNENLSMSATHHSFLPIPTQNI  463

Query  595   ELGRRL--------EMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             ++G           E G +       P+S  + +  YE  + QN KRFAA LLPDFVA
Sbjct  464   QIGGGGVEIGEPNHEFGSLNT-----PTSAHSTSSVYENFNIQNRKRFAAPLLPDFVA  516



>ref|XP_006348466.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006348467.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Solanum 
tuberosum]
Length=704

 Score = 89.4 bits (220),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 98/292 (34%), Positives = 152/292 (52%), Gaps = 35/292 (12%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNE---ANKEIGSNNST---EKQEKT-S  1118
             LWKPMVEEMY EE+K  EQ G   E  +  G++NE    ++ I + + +   + Q K+  
Sbjct  433   LWKPMVEEMYLEEIK--EQNGLGQEKTSKLGEQNEDSTTSRSIATQDKSPGSDSQNKSFV  490

Query  1117  NIQDnnnnnN--ASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNG-  947
             + QDN+   +  ASP  +S +  +  P G++ ++ Q  G   F+ I +  +E+     G 
Sbjct  491   SKQDNHLPQHNPASPMPMSNTT-SIPPIGMN-IRNQSAG---FNLIGSPEIESINITQGS  545

Query  946   -KKPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN  770
              KKPRN+ +  SP+SI S+++D+K      N+     KF  DR      + F  +    N
Sbjct  546   PKKPRNNEMLHSPNSIPSINIDVK-----PNEQQMSMKFGDDR---QDRDGFSLMGGPMN  597

Query  769   Tggfggftig-dfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLST-HQDM  596
               G  G     +  RF+ E  +A +     VSLTLGLP +ENL++S +  ++L    Q++
Sbjct  598   FMGGFGAYPIGEIARFSTEQFSAPYSTSGTVSLTLGLPHNENLSMSATHHSFLPIPTQNI  657

Query  595   ELGRR--LEMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             ++G     E G +       P+S  + +  YE  + QN KRFAA LLPDFVA
Sbjct  658   QIGSEPNHEFGSLNT-----PTSAHSTSSVYENFNIQNRKRFAAPLLPDFVA  704



>ref|XP_011094236.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
Length=710

 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 85/238 (36%), Positives = 117/238 (49%), Gaps = 60/238 (25%)
 Frame = -3

Query  1087  ASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQSSPS  908
             A+P  IS S  + SPTG +     G     F+ I +  +E+  + + KK RN +I  SPS
Sbjct  509   AAPV-ISMSTNSTSPTGTTLRNIAG-----FNLIGSTEIESITQGSPKKLRNADILHSPS  562

Query  907   SILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfggftigdfgr  728
             SI S  M+M+S   + +      KF  +R      + F  LM A                
Sbjct  563   SIPS--MNMESKPTDPHNENMSMKFGNER---QGRDGF-TLMGA----------------  600

Query  727   FNPENLTAGF-------------------HHGNGVSLTLGLPPSENLAVSGSQQNYLSTH  605
               P N   GF                   + GNGVSLTLGLP  ENL++SG+ Q +L + 
Sbjct  601   --PTNFIGGFGSYPIGELGRFGTEQFQAPYSGNGVSLTLGLPHCENLSMSGAHQTFLPS-  657

Query  604   QDMELGRRLEMGRM----GIDNNPQPSSHS-NINGGYETIDFQNGKRFAAQLLPDFVA  446
             Q ++LGR +E+G      G+  N Q ++HS N+   Y+ I+ QN KRFAAQLLPDFVA
Sbjct  658   QSIQLGRGVEIGETNDFGGM--NTQTNTHSTNV---YDNINIQNRKRFAAQLLPDFVA  710



>ref|XP_004494251.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=686

 Score = 87.8 bits (216),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 106/288 (37%), Positives = 144/288 (50%), Gaps = 36/288 (13%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNE-ANKEIGSNNSTEKQEKTSNIQDnn  1100
             LWKPMVEEMY EEMK  E  G   +++    K NE ++ +I S      Q+K     + +
Sbjct  424   LWKPMVEEMYLEEMKENELNGSEDKSS----KSNEDSSMKIAS-----PQDKVLT-SETD  473

Query  1099  nnnNASPTEISTSIMTASPTGVSSLQ---PQGGG---GGAFSFINTLNMENAGERNGKKP  938
                  S  E+S S  T+    VS  Q   P GG       FSFI +  +E   + + KK 
Sbjct  474   VKGYNSTQEVSISQDTSPIISVSKRQQTSPLGGNVRNQSGFSFIGSSELEGIAQGSPKKS  533

Query  937   RNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-Tgg  761
             RN  +  S +S   V+MD+K    E N      KF  +R    + + +  +    N  GG
Sbjct  534   RNHELMHSSNSFPLVNMDVKH--NEGNNEEISMKFGDER---HSRDGYSFMGNQTNFIGG  588

Query  760   fggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRR  581
             FG + IGD GRF+ E  T      NGVSLTLGL      ++ G+ Q +L  +Q+++LGR 
Sbjct  589   FGQYPIGDIGRFDSEQFTTPRFSSNGVSLTLGLD-----SIQGTHQTFLP-NQNIQLGRS  642

Query  580   L---EMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             L   E    G  N   P S     G +E+I+ QN KRFAAQLLPDFV+
Sbjct  643   LDISEQNEFGSINTSSPHS----TGPFESINMQNPKRFAAQLLPDFVS  686



>ref|XP_008784116.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008784117.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008784118.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
Length=660

 Score = 85.9 bits (211),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 95/291 (33%), Positives = 133/291 (46%), Gaps = 61/291 (21%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKT---SNIQD  1106
             LWKPMVEEMY+EEMK  EQ     + + +    N  +K      S+ KQE +   +   D
Sbjct  417   LWKPMVEEMYSEEMKDPEQNSADEKASKSDANENSVSK------SSAKQESSPTRTGQAD  470

Query  1105  nnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDN  926
             +       P +  TS + A+P       P G      S+ +  N      R  K  R ++
Sbjct  471   SLKTTQNHPNDPRTSSVAAAPPS-----PLGNDRSHASYYD--NEAAMQPRLKKARRGES  523

Query  925   IQ-----------SSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMA  779
             +Q           +S   +L   MD +  AG+  +G++    T +   +  A    DL  
Sbjct  524   LQHLISFDMKSEETSNRELLMKFMDGQQRAGD--QGFSLIGGTTNHGGSFGAYPIADL--  579

Query  778   AANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQD  599
                            GRF+ E  T  F  GNGVSLTLGLP  ENL++SG+Q ++LS ++ 
Sbjct  580   ---------------GRFDSEQFTPRFS-GNGVSLTLGLPHCENLSLSGAQPSFLS-NES  622

Query  598   MELGRRLEMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             M             +NNP  +  SN    YE+ID  N KR+AAQLLPDFVA
Sbjct  623   MP----------SFNNNPSVAHPSN---AYESIDIPNRKRYAAQLLPDFVA  660



>ref|XP_010543869.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X2 [Tarenaya 
hassleriana]
Length=573

 Score = 85.1 bits (209),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 129/280 (46%), Gaps = 25/280 (9%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE K Q++   S +   +     + +    S     KQEK   + +   
Sbjct  314   LWKPMVEEMYVEETKDQDKNNDSTKEKISPNVNQDEDSMPKSVGYIAKQEKIP-VSEVPQ  372

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQS  917
             N+  +    S+SI  + P   S  +        FS +     E   + N KK R D +  
Sbjct  373   NSFMNNNGHSSSISISVPLSASVSE------TGFSILGVSEFEGNMQGNPKKLRTDELLH  426

Query  916   SPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggf---ggft  746
             SP  + S++MD     GE        +F  ++        FP    A NT      G + 
Sbjct  427   SPELVPSMEMD-ADKVGEVRNDNISPRFRDEK-------EFP--FFANNTNFIGGFGPYP  476

Query  745   igdfgrFNPENLTAGFH-HGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMG  569
             I + GRF  E  T  +  + NGVSLTLGLP  E+ +VS + QN+   +Q++++GR +EM 
Sbjct  477   ICETGRFEAEEFTPSYSGNINGVSLTLGLPHCESFSVSATHQNFFP-NQNIQIGRNVEMS  535

Query  568   RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFV  449
                     +P +       Y  I+ QN +RF +QLLPDFV
Sbjct  536   EPNEFGASEPRTSP---AAYNPINLQNQRRFLSQLLPDFV  572



>ref|XP_010543867.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010543868.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X1 [Tarenaya 
hassleriana]
Length=594

 Score = 84.7 bits (208),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 88/280 (31%), Positives = 129/280 (46%), Gaps = 25/280 (9%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE K Q++   S +   +     + +    S     KQEK   + +   
Sbjct  335   LWKPMVEEMYVEETKDQDKNNDSTKEKISPNVNQDEDSMPKSVGYIAKQEKIP-VSEVPQ  393

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQS  917
             N+  +    S+SI  + P   S  +        FS +     E   + N KK R D +  
Sbjct  394   NSFMNNNGHSSSISISVPLSASVSE------TGFSILGVSEFEGNMQGNPKKLRTDELLH  447

Query  916   SPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggf---ggft  746
             SP  + S++MD     GE        +F  ++        FP    A NT      G + 
Sbjct  448   SPELVPSMEMD-ADKVGEVRNDNISPRFRDEK-------EFP--FFANNTNFIGGFGPYP  497

Query  745   igdfgrFNPENLTAGFH-HGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMG  569
             I + GRF  E  T  +  + NGVSLTLGLP  E+ +VS + QN+   +Q++++GR +EM 
Sbjct  498   ICETGRFEAEEFTPSYSGNINGVSLTLGLPHCESFSVSATHQNFFP-NQNIQIGRNVEMS  556

Query  568   RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFV  449
                     +P +       Y  I+ QN +RF +QLLPDFV
Sbjct  557   EPNEFGASEPRTSP---AAYNPINLQNQRRFLSQLLPDFV  593



>gb|KEH24245.1| BEL1-related homeotic protein [Medicago truncatula]
Length=660

 Score = 82.4 bits (202),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 101/293 (34%), Positives = 140/293 (48%), Gaps = 64/293 (22%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EEMK  EQ            K NE +    S   T  QEK     +   
Sbjct  416   LWKPMVEEMYVEEMKENEQ-----------SKSNEDS----SMKITSSQEKALT-SETEP  459

Query  1096  nnNASPTEISTS----IMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRND  929
                 S  +ISTS    +++ S    S L         FSFI +  +E   + + KKPRN 
Sbjct  460   KGYNSTQDISTSQDTPLISVSRPQTSPLVGNVRNNSGFSFIGSSELEGIPQGSPKKPRNH  519

Query  928   NIQSSPSSILSV--------DMDMKSAAGEANK-GYNHHKFTADRTPAAAAENFPDLMAA  776
              +  +P+S + V        ++ MK      N+ GY+   F  ++T      NF      
Sbjct  520   ELMHNPNSFIDVKHNEANNEELSMKFGDDRQNRDGYS---FMGNQT------NF------  564

Query  775   ANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDM  596
                GGFG + IGD GRF+ E     F   N VSLTLGL      ++ G+ Q +L  +Q++
Sbjct  565   --IGGFGQYPIGDIGRFDSEQFAPRF-SSNNVSLTLGLD-----SIQGNHQTFL-PNQNI  615

Query  595   ELGRRLEMGRMGIDNNPQPSSHSNINGG---YETIDFQNGKRFAAQLLPDFVA  446
             +LGR +++         +P+   +IN     YE+I+ QN KRFAAQLLPDFV+
Sbjct  616   QLGRSIDIS--------EPNEFGSINTSSPQYESINMQNPKRFAAQLLPDFVS  660



>ref|XP_010557975.1| PREDICTED: BEL1-like homeodomain protein 1 [Tarenaya hassleriana]
Length=675

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 88/297 (30%), Positives = 124/297 (42%), Gaps = 56/297 (19%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAA----AAGKRNEANKEIGSNNSTEKQEKTSNIQ  1109
             LWKPMVEEMY EEMK  E+  GS +          K +   K +G ++  EK   +   Q
Sbjct  413   LWKPMVEEMYLEEMKEHEKNNGSSKKKVNPNEHQDKEDSMPKSVGYSDKKEKSHVSEAPQ  472

Query  1108  DnnnnnNASPTEISTS--IMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPR  935
             ++      S    +    I  A P   S+          FS      +E   + + K+ R
Sbjct  473   NSLMLRQDSFMNNNGHGGITMAVPVTASA------SATGFSISGASELEGITQGSPKRVR  526

Query  934   NDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRT----------PAAAAENFPDL  785
              + I  SP+S+ S  MD      E  +      F A  T          P   A  F   
Sbjct  527   INEILHSPASVPSAKMDFN--IPERFRDEKEFSFLASNTNFMGGNFGAYPIEEAGRF---  581

Query  784   MAAANTggfggftigdfgrFNPENLTAGFH-HGNGVSLTLGLPPSENLAVSG-SQQNYLS  611
                                   E  T  +  + NGVSLTLGLP  E+ +VS  + QN+  
Sbjct  582   --------------------EAEEFTPSYSGNNNGVSLTLGLPHCESFSVSAPTHQNFFP  621

Query  610   THQDMELGRRLEMG---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFV  449
              +Q++++GR +EM      G  +  +  SHS+    Y TI  QN +RF+AQLLPDFV
Sbjct  622   -NQNIQIGRDVEMSEPNEFGAISTSE--SHSSA-AAYNTISLQNQRRFSAQLLPDFV  674



>emb|CDP10596.1| unnamed protein product [Coffea canephora]
Length=680

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 61/89 (69%), Gaps = 7/89 (8%)
 Frame = -3

Query  703  GFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGR---MGIDNNPQPSS  533
            G + GNGVSLTLGLP  ENL++SG  QN+L  +Q+++LGR +E+G     G    P  SS
Sbjct  596  GPYSGNGVSLTLGLPHCENLSISGPHQNFLP-NQNIQLGRGVEIGEANDYGGLGTPT-SS  653

Query  532  HSNINGGYETIDFQNGKRFAAQLLPDFVA  446
            HS     YE I+ QN KRFAAQLLPDFVA
Sbjct  654  HST--SVYENINIQNRKRFAAQLLPDFVA  680



>ref|XP_011090301.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
 ref|XP_011090302.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
Length=629

 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 94/293 (32%), Positives = 118/293 (40%), Gaps = 92/293 (31%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTE-------------  1136
             LWKPMVEEMY EE K QEQ   S +N           KE+GS ++T              
Sbjct  413   LWKPMVEEMYLEETKNQEQISASQDNTP---------KELGSKSNTRPEHNSTRTARIDH  463

Query  1135  KQEKTSNIQDn--nnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENA  962
              Q++ +++Q     N    SPTEIS S +    TG +         G    I+ LN ++ 
Sbjct  464   HQQQLNDLQSRPILNLQVPSPTEISASTVITPATGPTR-------PGFAQLISPLNTQSP  516

Query  961   GERNGKKPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLM  782
              E   KK RN+   +SPSSILSV+M+MK   G   K                 + FP   
Sbjct  517   PE---KKRRNEAQDNSPSSILSVEMEMK---GRETK----------------EDCFPGPY  554

Query  781   AAANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQ  602
                  G F                      GN  SLTL LPPSE     G++  Y  +  
Sbjct  555   GIGEVGRFNN------------------FQGNNFSLTLALPPSE--TSQGAEGQYFLS--  592

Query  601   DMELGRRLEMGRMGIDNNPQPSSHSNINGGYETI-DFQNGKRFAAQLLPDFVA  446
                   R+        +NP          GYE I DFQ  K F  QLLPDFVA
Sbjct  593   ------RVNGMNQAAGSNP----------GYENILDFQGRKPFRVQLLPDFVA  629



>ref|XP_003554466.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006604654.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=680

 Score = 80.5 bits (197),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 107/292 (37%), Positives = 153/292 (52%), Gaps = 49/292 (17%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRN---EANKEIGSNNSTEKQEKTSNIQD  1106
             LWKPMVEEMY EEMK  EQ G   +++ +    +    A ++ G +N TE +   S  + 
Sbjct  421   LWKPMVEEMYMEEMKDHEQNGSEDKSSKSNEDSSSKMSAPQDKGPSNETEAKSFNSKQEV  480

Query  1105  nnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDN  926
             + + N A    +S S  + SP GV +++ Q G    FSF+ +  ++   + + KKPRN  
Sbjct  481   SKSQNTAM---VSVSRPSTSPLGV-NVRNQSG----FSFMGSSELDGITQGSPKKPRNHE  532

Query  925   IQSSPSSILSVDMDMKS----------AAGEANKGYNHHKFTADRTPAAAAENFPDLMAA  776
             +  SP+S+ S++MD+K             G   +G N   F  ++T      NF      
Sbjct  533   MMHSPNSVPSLNMDVKPNDENSEQLSMRFGVERQGRNESSFMGNQT------NF------  580

Query  775   ANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDM  596
                GGFG + IGD GRF+ E  T  F  GNGVSLTLGL      ++ G+ Q +L  +Q++
Sbjct  581   --IGGFGQYPIGDIGRFDAEQFTPRF-SGNGVSLTLGLD-----SLPGTHQTFL-PNQNI  631

Query  595   ELGRRLEMG---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFV  449
             +LGR L++G     G  +   P S       YE+I  QN KRFAAQLLPDFV
Sbjct  632   QLGRSLDIGEPNEFGAISTSSPHS----TAAYESISMQNPKRFAAQLLPDFV  679



>gb|KHN08605.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=679

 Score = 80.1 bits (196),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 107/292 (37%), Positives = 153/292 (52%), Gaps = 49/292 (17%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRN---EANKEIGSNNSTEKQEKTSNIQD  1106
             LWKPMVEEMY EEMK  EQ G   +++ +    +    A ++ G +N TE +   S  + 
Sbjct  420   LWKPMVEEMYMEEMKDHEQNGSEDKSSKSNEDSSSKMSAPQDKGPSNETEAKSFNSKQEV  479

Query  1105  nnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDN  926
             + + N A    +S S  + SP GV +++ Q G    FSF+ +  ++   + + KKPRN  
Sbjct  480   SKSQNTAM---VSVSRPSTSPLGV-NVRNQSG----FSFMGSSELDGITQGSPKKPRNHE  531

Query  925   IQSSPSSILSVDMDMKS----------AAGEANKGYNHHKFTADRTPAAAAENFPDLMAA  776
             +  SP+S+ S++MD+K             G   +G N   F  ++T      NF      
Sbjct  532   MMHSPNSVPSLNMDVKPNDENSEQLSMRFGVERQGRNESSFMGNQT------NF------  579

Query  775   ANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDM  596
                GGFG + IGD GRF+ E  T  F  GNGVSLTLGL      ++ G+ Q +L  +Q++
Sbjct  580   --IGGFGQYPIGDIGRFDAEQFTPRF-SGNGVSLTLGLD-----SLPGTHQTFL-PNQNI  630

Query  595   ELGRRLEMG---RMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFV  449
             +LGR L++G     G  +   P S       YE+I  QN KRFAAQLLPDFV
Sbjct  631   QLGRSLDIGEPNEFGAISTSSPHS----TAAYESISMQNPKRFAAQLLPDFV  678



>ref|XP_009133059.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
1 [Brassica rapa]
Length=658

 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 85/294 (29%), Positives = 124/294 (42%), Gaps = 69/294 (23%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EEMK                   E  K +GS       EKT N+ +N +
Sbjct  417   LWKPMVEEMYAEEMK-------------------EQGKNMGS------MEKTPNLDENID  451

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQS  917
             ++ +  T     I            P GGGG     ++  ++ N G  NG+      +Q 
Sbjct  452   DSASKSTSNQEKI------------PMGGGG-----LDNYHL-NPGH-NGELEGVTGMQE  492

Query  916   SPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfggftigd  737
             SP  + + D  M     E        K   +R    +   +P  M +         +  +
Sbjct  493   SPKRLRTSDGTMMQPINEGFSSNEKMKILEERQGIRSDGGYP-FMGSFGQYQMDEMSRFN  551

Query  736   fgrFNPENLTAGFH-HGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMG  560
                 + E LT  F  + NGVSLTLGLP  ++L+ S   Q ++ TH  +++GR +++G   
Sbjct  552   VAVSDQELLTQRFSGNNNGVSLTLGLPHCDSLS-STHHQGFMQTHHGIQIGRSVKIGET-  609

Query  559   IDNNPQPSSHSNINGG----------------YETIDFQNGKRFAAQLLPDFVA  446
                  +   +S INGG                Y  ++ QN KR+ AQLLPDFVA
Sbjct  610   -----EEYGNSAINGGSGSAATAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  658



>ref|XP_002313498.2| hypothetical protein POPTR_0009s02250g [Populus trichocarpa]
 gb|EEE87453.2| hypothetical protein POPTR_0009s02250g [Populus trichocarpa]
Length=662

 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 84/225 (37%), Positives = 110/225 (49%), Gaps = 49/225 (22%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQ----  1109
             LWKPMVEEMY EE+K QE+  GS ENA     +NE NKE  S++S   +  T  +     
Sbjct  467   LWKPMVEEMYAEEIKEQEK-TGSEENA----NKNE-NKESRSHSSAPGESSTLQMDQRKG  520

Query  1108  -------DnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERN  950
                    +   N NASP   S   ++ SP G + LQ Q G    F+ I    ME    R+
Sbjct  521   VLHSKQPEKPRNQNASPPRFSYPAISMSPMG-APLQQQAG----FTLIGPAEMEGISLRS  575

Query  949   GKKPRNDNIQSSPSSILSVDMDMKS--AAGEANKGYNHHKFTADRTPAAAAEN----FP-  791
              KKP +D +Q+SPSSILS+DMD+K    + E +  +   +   D  P   +      +P 
Sbjct  576   SKKPSSD-MQNSPSSILSMDMDVKQGETSREISANFGGERLIKDGYPLITSSGGFGAYPM  634

Query  790   -DLMAAANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLP  659
              DL                 GRFN E +T  F  GN VSL+LGLP
Sbjct  635   GDL-----------------GRFNLEQMTPRF-SGNSVSLSLGLP  661



>ref|XP_004171976.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 gb|KGN59214.1| hypothetical protein Csa_3G782620 [Cucumis sativus]
Length=716

 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 57/98 (58%), Gaps = 15/98 (15%)
 Frame = -3

Query  718  ENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQP  539
            +  T  F   NGVSLTLGLP  ENL+++ +       +Q + LGRR E+G+        P
Sbjct  627  DQFTPRFSGNNGVSLTLGLPHCENLSLNPATHQSFLPNQSIHLGRRTEIGK--------P  678

Query  538  SSHSNING-------GYETIDFQNGKRFAAQLLPDFVA  446
            +  S IN         +ETI+ QNGKRFAAQLLPDFVA
Sbjct  679  TDFSAINASTAHSSTAFETINIQNGKRFAAQLLPDFVA  716



>ref|XP_004136516.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
Length=716

 Score = 79.3 bits (194),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 57/98 (58%), Gaps = 15/98 (15%)
 Frame = -3

Query  718  ENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQP  539
            +  T  F   NGVSLTLGLP  ENL+++ +       +Q + LGRR E+G+        P
Sbjct  627  DQFTPRFSGNNGVSLTLGLPHCENLSLNPATHQSFLPNQSIHLGRRTEIGK--------P  678

Query  538  SSHSNING-------GYETIDFQNGKRFAAQLLPDFVA  446
            +  S IN         +ETI+ QNGKRFAAQLLPDFVA
Sbjct  679  TDFSAINASTAHSSTAFETINIQNGKRFAAQLLPDFVA  716



>ref|XP_008367359.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=349

 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 59/88 (67%), Gaps = 10/88 (11%)
 Frame = -3

Query  691  GNGVSLTLGLPPSENLAVSGSQ--QNYLSTHQDMELGRRLEMG----RMGIDNNPQPSSH  530
            GNGVSLTLGLP  ENL++SG+   Q +L  +Q+++LGRR+++G    + G  N   P S 
Sbjct  266  GNGVSLTLGLPHCENLSLSGAHHHQTFL-PNQNIQLGRRVDIGETNDQFGAINTSAPHSS  324

Query  529  SNINGGYETIDFQNGKRFAAQLLPDFVA  446
            +     +E ID QN KRF AQLLPDFVA
Sbjct  325  A---AAFENIDIQNRKRFVAQLLPDFVA  349



>emb|CDX84585.1| BnaA03g16450D [Brassica napus]
Length=671

 Score = 78.6 bits (192),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 84/294 (29%), Positives = 119/294 (40%), Gaps = 69/294 (23%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EEMK                   E  K +GS       EKT N+ +N +
Sbjct  430   LWKPMVEEMYAEEMK-------------------EQGKNMGS------MEKTPNLDENID  464

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQS  917
             ++ +  T     I            P GGGG     +N          NG       +Q 
Sbjct  465   DSASKSTSNQEKI------------PMGGGGLDNYHLNP-------SHNGDVEGVTGMQE  505

Query  916   SPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfggftigd  737
             SP  + + D  M     E        K   +R    +   +P  M +         +  +
Sbjct  506   SPKRLRTSDGTMMQPINEGFSLNEKMKILEERQGIRSDGGYP-FMVSFGQYQMDEMSRFN  564

Query  736   fgrFNPENLTAGFH-HGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMG  560
                 + E LT  F  + NGVSLTLGLP  ++L+ S   Q ++ TH  +++GR +++G   
Sbjct  565   VAVSDQELLTQRFSGNNNGVSLTLGLPHCDSLS-STHHQGFMQTHHGIQIGRSVKIGET-  622

Query  559   IDNNPQPSSHSNINGG----------------YETIDFQNGKRFAAQLLPDFVA  446
                  +   +S INGG                Y  ++ QN KR+ AQLLPDFVA
Sbjct  623   -----EEYGNSAINGGSGSTATAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  671



>ref|XP_008442920.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
Length=713

 Score = 78.2 bits (191),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 57/98 (58%), Gaps = 15/98 (15%)
 Frame = -3

Query  718  ENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQP  539
            +  T  F   NGVSLTLGLP  ENL+++ +       +Q + LGRR E+G+        P
Sbjct  624  DQFTPRFSGNNGVSLTLGLPHCENLSLNPATHQSFLPNQSIHLGRRTEIGK--------P  675

Query  538  SSHSNING-------GYETIDFQNGKRFAAQLLPDFVA  446
            +  S IN         ++TI+ QNGKRFAAQLLPDFVA
Sbjct  676  TDFSAINASTAHSSTAFDTINIQNGKRFAAQLLPDFVA  713



>ref|XP_004140170.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 ref|XP_004156066.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 gb|KGN48050.1| hypothetical protein Csa_6G426360 [Cucumis sativus]
Length=698

 Score = 76.6 bits (187),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 89/304 (29%), Positives = 131/304 (43%), Gaps = 82/304 (27%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QEQ G S +     G +++ N      ++  +  KT N+ +N  
Sbjct  450   LWKPMVEEMYLEEIKEQEQNGDSQDMIRGGGSQHQNNNNNNRTHNDPQYSKTENLMNN--  507

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDN---  926
                 +P+  S S  +    G +++      GG FS +   +  N      KKPR      
Sbjct  508   ----NPSHSSISSSSILGIGSTTV------GGGFSLVPPSSDNNILLSTPKKPRTTTTTA  557

Query  925   -----------IQSSPS--SILSVDMDMKSA----AGEANKGYNHHKFTADRTPAAAAEN  797
                        +  +PS  S+L  D+D+ ++     GE    +N    T           
Sbjct  558   AITTTNNNNNVVSENPSSESMLLRDIDIVNSNSFPVGEIGSTFNSELLT-----------  606

Query  796   FPDLMAAANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNY  617
              P   A                  N  +LT    H N          S++L++S +Q NY
Sbjct  607   -PRFHA------------------NGVSLTLALPHNN----------SDHLSLSPNQTNY  637

Query  616   --LSTHQDMELGRRLEMGRMGIDN-NPQPSSHSNIN----GGYETIDFQNGKRFAAQLLP  458
               LS++Q++ LGR     R+ I N +P P   S++N      Y+ +D Q  KRFAAQLLP
Sbjct  638   HHLSSNQNLHLGRS---SRLDITNHHPGPPDFSDVNPTAPPSYDHVDMQTTKRFAAQLLP  694

Query  457   DFVA  446
             DFVA
Sbjct  695   DFVA  698



>ref|XP_008449596.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
 ref|XP_008449597.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
Length=693

 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 65/102 (64%), Gaps = 13/102 (13%)
 Frame = -3

Query  724  NPENLTAGFHHGNGVSLTLGLPP--SENLAVSGSQQNY--LSTHQDMELGRRLEMGRMGI  557
            N E LT  FH  NGVSLTL LP   S++L++S +Q NY  LS++Q++ LGR     R+ I
Sbjct  596  NSELLTPRFH-ANGVSLTLALPHNNSDHLSLSPNQTNYHHLSSNQNLHLGRS---SRLDI  651

Query  556  DNN-PQPSSHSNINGG----YETIDFQNGKRFAAQLLPDFVA  446
             N+ P P   S++N      Y+ +D Q  KRFAAQLLPDFVA
Sbjct  652  TNHHPGPPDFSDVNPAAPPAYDHVDMQTTKRFAAQLLPDFVA  693



>ref|XP_006854627.1| hypothetical protein AMTR_s00030p00173920 [Amborella trichopoda]
 gb|ERN16094.1| hypothetical protein AMTR_s00030p00173920 [Amborella trichopoda]
Length=709

 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 59/86 (69%), Gaps = 7/86 (8%)
 Frame = -3

Query  691  GNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGID----NNPQPSSHSN  524
            GNGVSLTLGLP  ++L+++G+QQ YLS + ++++GRR E+G    D    N    ++HS 
Sbjct  627  GNGVSLTLGLPHCDSLSLAGTQQAYLS-NPNLQMGRRHELGGEPNDFCSMNTASATAHS-  684

Query  523  INGGYETIDFQNGKRFAAQLLPDFVA  446
                YE +  QN KRFAAQLLPDFVA
Sbjct  685  -ANPYENLSIQNRKRFAAQLLPDFVA  709



>gb|EPS58511.1| hypothetical protein M569_16303, partial [Genlisea aurea]
Length=298

 Score = 72.8 bits (177),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 75/217 (35%), Positives = 106/217 (49%), Gaps = 30/217 (14%)
 Frame = -3

Query  1057  MTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRN--DNIQSSPSSILSVDMD  884
             M+ SPTG+++++        F+ I    +++  + + KK RN   ++  SP+SI ++ M+
Sbjct  99    MSNSPTGMANMR-------NFNLIRPSEIDHIAQVSPKKMRNVARDVLHSPASITAMSME  151

Query  883   MKSAAGEANKGYNHHKFTADR-TPAAAAENFPDLMAAANTggfggftigdfgrFNPENLT  707
              K    E        KF ADR    A    F  L A  N     G               
Sbjct  152   SKPGDEET------LKFHADRQNREAGGGGFTLLGAPTNFISGFGSYPMAELGRYTAEQF  205

Query  706   AGFHHGNGVSLTLGLPPS--ENLAVSGSQ-----QNYLSTHQDMELGRRLEM---GRMGI  557
                + GNGVSLTLGLP S  ENL + GS      QN+L  +Q ++LGR +E+   G    
Sbjct  206   PAAYSGNGVSLTLGLPHSHCENLQIQGSHRHHHHQNFLP-NQSIQLGRGVEISDPGDYAG  264

Query  556   DNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
              N P  ++  NI   YE I+ Q+ KRFA+QLLPDFVA
Sbjct  265   LNPPAGAAPGNI---YENINIQSRKRFASQLLPDFVA  298



>ref|XP_010031566.1| PREDICTED: BEL1-like homeodomain protein 1 [Eucalyptus grandis]
 gb|KCW50924.1| hypothetical protein EUGRSUZ_J00574 [Eucalyptus grandis]
Length=693

 Score = 74.7 bits (182),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 100/309 (32%), Positives = 136/309 (44%), Gaps = 77/309 (25%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYG---GSGENAA------AAGKRNEANKE--IGSNNSTEKQ  1130
             LWKPMVEEMY EE K +EQ G   G+   AA      AAG ++ + ++   G N+S +  
Sbjct  430   LWKPMVEEMYLEETKSREQAGSENGTTRRAATKSNKDAAGLKSASQEDNAFGMNSSIKSF  489

Query  1129  EKTSNIQDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFI-NTLNMENAGER  953
             + + N   N    + S    STS  +  P  +    P  G    F+    + N+E     
Sbjct  490   QSSPNKALNQAAISPSENSNSTSSTSPMPCAIP---PHHG----FTLTGRSSNVEVGITS  542

Query  952   NGKKPR-NDNIQSSPSSILSVDMDMKSA------AGEANKGYNHHKFTADRTPAAAAENF  794
             + KKPR + ++ +    ILS  MDMK +       G  +  Y H  F+A           
Sbjct  543   SPKKPRMSPDLMNPHGIILSRAMDMKGSEPSRELGGGGSDEYIHGGFSA-----------  591

Query  793   PDLMAAANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLP---PSENLAVSGSQQ  623
                 +  N  G                      +GN V+LTLGLP    S +L+VS + Q
Sbjct  592   ---FSMGNIDG---------------------RYGNCVALTLGLPHRDQSPSLSVSAAPQ  627

Query  622   NYLSTHQDM---ELGR-RLEMGR------MGIDNNPQPSSHSNINGGYETIDFQNGKRFA  473
             NY    Q M   +LGR +L +G        GI   PQ S   +IN  YE ID  N KRFA
Sbjct  628   NYFPN-QSMNHHQLGRTKLVVGNGGEADFFGIAGAPQQSQSGSIN--YEAIDINNRKRFA  684

Query  472   AQLLPDFVA  446
               LLPD+VA
Sbjct  685   DHLLPDYVA  693



>gb|ACC77468.1| BEL1 [Kalanchoe x houghtonii]
Length=641

 Score = 74.3 bits (181),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 83/282 (29%), Positives = 127/282 (45%), Gaps = 45/282 (16%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K Q+ +  + +              I  NN+ +         DN +
Sbjct  400   LWKPMVEEMYNEEVKEQDNHESTDKTG------------ISGNNNAKAYASKVPTHDNIS  447

Query  1096  nnNASPTEI-STSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQ  920
               N SP +  +T+   +       L+ Q  G   FS + +  +E   E + K+ R +++ 
Sbjct  448   FKNVSPEDTGATAAAKSDSVSPGRLRNQNTG---FSLVGSSELEGISEMSPKRQRTNHLM  504

Query  919   SSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfggftig  740
              +P+     +M+MKS    A+  +   +F  +R      +++  LMAA   G      I 
Sbjct  505   INPTDSFQSNMEMKSI--HASNEHVLMQFGIERQ---TRDDY-SLMAAGPFGSCPLEEIN  558

Query  739   dfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMG  560
              F   +       F    GVSLTLGL             + L  +Q+M   RR++ G   
Sbjct  559   QFDSSH--QYQPRFSGKGGVSLTLGL------------TDTLFPNQNM---RRMDTGEAS  601

Query  559   ----IDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
                 I+NNP P+  ++    YE+I+ QN KRF  QLLPDFVA
Sbjct  602   EFGTINNNPNPARTTST--AYESINIQNPKRFPVQLLPDFVA  641



>emb|CDX79646.1| BnaC03g19820D [Brassica napus]
Length=691

 Score = 74.3 bits (181),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 84/299 (28%), Positives = 121/299 (40%), Gaps = 77/299 (26%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EEMK Q +  GS E         + N +  ++ ST  QEK         
Sbjct  448   LWKPMVEEMYAEEMKEQGKNMGSMEKTPNL----DENIDDSASKSTSNQEKI--------  495

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQS  917
                                      P GGGG     +N          NG       +Q 
Sbjct  496   -------------------------PMGGGGLDDYHLNP-------SHNGDLEGVTGMQG  523

Query  916   SPSSILSVDMDMKSAAGEANKGYNHH-----KFTADRTPAAAAENFPDLMAAANTggfgg  752
             SP  + + D  M       N+G++ +     K   +R    +   +P  M +        
Sbjct  524   SPKRLRTSDDTMMQPI---NEGFSSNEKITMKILEERQGIRSDGGYP-FMGSFVQYQMDE  579

Query  751   ftigdfgrFNPENLTAGFH-HGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLE  575
              +  +    + E LT  F  + NGVSLTLGLP  ++L+ S   Q ++ TH  +++GR ++
Sbjct  580   MSRFNVAVSDQELLTQRFSGNINGVSLTLGLPHCDSLS-STHHQGFMQTHHGIQIGRSVK  638

Query  574   MGRMGIDNNPQPSSHSNINGG----------------YETIDFQNGKRFAAQLLPDFVA  446
             +G        +   +S INGG                Y  ++ QN KR+ AQLLPDFVA
Sbjct  639   IG------ETEEYGNSAINGGSGSAATAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  691



>gb|EYU18114.1| hypothetical protein MIMGU_mgv1a010011mg [Erythranthe guttata]
Length=324

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 47/104 (45%), Positives = 64/104 (62%), Gaps = 16/104 (15%)
 Frame = -3

Query  721  PENLTAGFHHGNGVSLTLGLPPSENLAVSGS-------QQNYLSTHQDMELGRRLEMGR-  566
            P++     + GNGVSLTLGLP  +N     S        Q ++ T+Q M+LGR +E+G  
Sbjct  225  PDHFQQHPYLGNGVSLTLGLPHCDNQLTMSSVPHHHHHHQAFMPTNQGMQLGRGVEIGET  284

Query  565  ---MGIDNNPQPSSH-SNINGGYETIDFQNGKRFAAQLLPDFVA  446
               +G+ N  QP++H +N+   YE I+ QN KRFAAQLLPDFVA
Sbjct  285  NDYVGM-NAQQPNTHPTNV---YENINIQNRKRFAAQLLPDFVA  324



>emb|CDY32069.1| BnaC04g44970D [Brassica napus]
Length=636

 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 83/291 (29%), Positives = 123/291 (42%), Gaps = 60/291 (21%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMYTEEMK Q +  GS E      + NE +    ++ ST  QEK+        
Sbjct  392   LWKPMVEEMYTEEMKEQGKNMGSMEKTLNMDQNNEDS----ASKSTSNQEKS--------  439

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRNDNIQS  917
                                      P GGGGGA ++   +N  + G+  G       +Q 
Sbjct  440   -------------------------PMGGGGGADNY--HMNPNHNGDLEGVT----GMQG  468

Query  916   SPSSILSVDMDMKS---AAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANTggfggft  746
             SP  + + +  M     A   +N+     K   +R    +   +P  M           +
Sbjct  469   SPKRLRTSEETMMQPINADFSSNEKLTM-KILEERQGLRSDGGYP-FMGNFGQYQMDEMS  526

Query  745   igdfgrFNPENLTAGFH-HGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMG  569
               +    + E L   +  + NGVSLTLGLP  ++L+ S   Q ++ TH  + +GRR+++G
Sbjct  527   RFEVAVSDQELLAQRYSGNNNGVSLTLGLPHCDSLS-STHHQGFMQTHHGIPIGRRVKIG  585

Query  568   R----------MGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
                         G  +     S +     Y  ++ QN KR+ AQLLPDFVA
Sbjct  586   EADDYGAAALNGGGGSAATVHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  636



>ref|XP_010521016.1| PREDICTED: BEL1-like homeodomain protein 1 [Tarenaya hassleriana]
Length=662

 Score = 72.0 bits (175),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 81/291 (28%), Positives = 117/291 (40%), Gaps = 73/291 (25%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNST----EKQEKTSN--  1115
             LWKPMVEEMY EEMK QE+  G  +        + A+K + +++ +    E  +  SN  
Sbjct  431   LWKPMVEEMYLEEMKEQEKNNGPMDKTVDENNEDSASKSMSNHDKSSVGAEDYQLNSNLP  490

Query  1114  ----IQDnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNG  947
                 + +       SP  + TS           +QP   G   F+    L M+   ER G
Sbjct  491   NRNVVLEGVIGAQGSPKRLRTSDEML-------MQPMNTG---FNPNEKLTMKILEERQG  540

Query  946   KKPRNDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAANT  767
              +                  D  S  G      N  ++  D  P     +   L+    T
Sbjct  541   LR------------------DGYSFVG------NFGQYQMDEMPRFDVSDHQHLIVPPRT  576

Query  766   ggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELG  587
                                   F   NGVSLTLGLP  E+L+ +   QN++  H +++LG
Sbjct  577   ----------------------FSGNNGVSLTLGLPHCESLSAT-HHQNFMPNH-NIQLG  612

Query  586   RRL----EMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
             RR+    E    G  N    + HS+ +  Y  I+ +N KRF AQLLPD V+
Sbjct  613   RRVKINGETDDFGAMNASASTPHSS-SVAYNGINMENQKRFVAQLLPDLVS  662



>ref|XP_010912386.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
Length=663

 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 102/295 (35%), Positives = 138/295 (47%), Gaps = 65/295 (22%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNI--QDn  1103
             LWKPMVEEMY EEMK QEQ      N      +++AN+   S +S  ++   +     D+
Sbjct  416   LWKPMVEEMYMEEMKDQEQ-----NNTDEKASKSDANENSVSKSSANQENSPTRTGQADS  470

Query  1102  nnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAGERNGKKPRN-DN  926
                    PTE   S +  SP+ +         G   S  +  + E A +   KK R  ++
Sbjct  471   LKTTQDHPTETKVSSVAISPSSL---------GNDKSHASYYDNEAAMQPRLKKARRVES  521

Query  925   IQ--SSPSSILSVDMD----------MKSAAGE---ANKGYNHHKFTADRTPAAAAENFP  791
             +Q  + P SI S DM           MK   G+    ++G++    TA    +  A   P
Sbjct  522   LQPNAMPHSI-SFDMKSDETSNRELLMKFMDGQQRAGDQGFSLIAGTASNGGSFGAYPIP  580

Query  790   DLMAAANTggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLS  611
             DL                 GRF+ E  T  F  GNGVSLTLGLP  ENL++SG+Q ++LS
Sbjct  581   DL-----------------GRFDSEQFTPRF-SGNGVSLTLGLPYCENLSLSGAQPSFLS  622

Query  610   THQDMELGRRLEMGRMGIDNNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
              ++ M             +NNP  +  SN    YE+ID QN KRFAAQ LPDFVA
Sbjct  623   -NESMP----------SFNNNPSVAHPSN---AYESIDIQNRKRFAAQPLPDFVA  663



>ref|XP_004506223.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=636

 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 10/84 (12%)
 Frame = -3

Query  694  HGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRL-EMGRMGIDNNPQPSSHSNIN  518
            HGNGVSLTLGLP +EN+++S +Q  +LS  Q++ LG R+ EMG  G +N         IN
Sbjct  562  HGNGVSLTLGLPHNENVSLSSTQHGFLS--QNIHLGGRINEMG--GNEN-----EFCAIN  612

Query  517  GGYETIDFQNGKRFAAQLLPDFVA  446
               E++D QN KRFAAQLL +FV 
Sbjct  613  NNNESVDIQNRKRFAAQLLRNFVV  636



>gb|AFK35661.1| unknown [Medicago truncatula]
Length=242

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 11/81 (14%)
 Frame = -3

Query  688  NGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQPSSHSNINGGY  509
            NGVSLTLGLP  + L  SG+ Q+++  +Q+++LGRRL++         + +   + +  +
Sbjct  173  NGVSLTLGLPHCDTL--SGTHQSFMP-NQNIQLGRRLDIS--------ETNEFGDSSAAF  221

Query  508  ETIDFQNGKRFAAQLLPDFVA  446
            E+I+ QN KRFAAQLLPDFVA
Sbjct  222  ESINMQNPKRFAAQLLPDFVA  242



>emb|CDX84171.1| BnaC04g09330D [Brassica napus]
Length=588

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 5/84 (6%)
 Frame = -3

Query  688  NGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGR---MGIDNNPQPSSHSNIN  518
            NGVSLTLGLP  ++L+ S   Q ++ TH  + +GRR+++G     G  N    + HS+  
Sbjct  507  NGVSLTLGLPHCDSLS-STRHQGFMQTHHGIPIGRRVKIGETEEYGAANISAATVHSSA-  564

Query  517  GGYETIDFQNGKRFAAQLLPDFVA  446
              Y  ++ QN KR+ AQLLPDFVA
Sbjct  565  AAYSAMNIQNQKRYVAQLLPDFVA  588



>emb|CDX75085.1| BnaA05g08310D [Brassica napus]
Length=628

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 5/84 (6%)
 Frame = -3

Query  688  NGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMG---RMGIDNNPQPSSHSNIN  518
            NGVSLTLGLP  ++L+ S   Q ++ TH  + +GRR+++G     G  N    + HS+  
Sbjct  547  NGVSLTLGLPHCDSLS-STRHQGFMQTHHGIPIGRRVKIGDTEEYGSANISAATVHSSA-  604

Query  517  GGYETIDFQNGKRFAAQLLPDFVA  446
              Y  ++ QN KR+ AQLLPDFVA
Sbjct  605  AAYSAMNIQNQKRYVAQLLPDFVA  628



>gb|KEH41936.1| BEL1-related homeotic protein [Medicago truncatula]
Length=649

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 11/81 (14%)
 Frame = -3

Query  688  NGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQPSSHSNINGGY  509
            NGVSLTLGLP  + L  SG+ Q+++  +Q+++LGRRL++         + +   + +  +
Sbjct  580  NGVSLTLGLPHCDTL--SGTHQSFMP-NQNIQLGRRLDIS--------ETNEFGDSSAAF  628

Query  508  ETIDFQNGKRFAAQLLPDFVA  446
            E+I+ QN KRFAAQLLPDFVA
Sbjct  629  ESINMQNPKRFAAQLLPDFVA  649



>ref|XP_008799712.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008799713.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
Length=673

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 52/91 (57%), Gaps = 12/91 (13%)
 Frame = -3

Query  718  ENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQP  539
            E     F    GVSLTLGLP  EN ++SG+Q  +LS             G    ++NP  
Sbjct  595  EQFAPRFPGNGGVSLTLGLPQCENFSLSGAQPPFLSNE-----------GMASFNSNPS-  642

Query  538  SSHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
            ++ ++ +  YE+ID Q+ KRFAA+LLPDFVA
Sbjct  643  AAPAHPSSAYESIDIQSRKRFAARLLPDFVA  673



>ref|XP_010507571.1| PREDICTED: BEL1-like homeodomain protein 1 [Camelina sativa]
Length=233

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 22/96 (23%)
 Frame = -3

Query  688  NGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQPSSHSNINGG-  512
            NGVSLTLGLP  ++L+ S   Q ++ TH  + +GRR+++G        +    ++INGG 
Sbjct  145  NGVSLTLGLPHCDSLS-STHHQGFMQTHHGIPIGRRVKIGE------TEEYGTASINGGG  197

Query  511  --------------YETIDFQNGKRFAAQLLPDFVA  446
                          Y  ++ QN KR+ AQLLPDFVA
Sbjct  198  SATTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  233



>ref|XP_006293790.1| hypothetical protein CARUB_v10022772mg [Capsella rubella]
 gb|EOA26688.1| hypothetical protein CARUB_v10022772mg [Capsella rubella]
Length=679

 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 52/96 (54%), Gaps = 22/96 (23%)
 Frame = -3

Query  688  NGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQPSSHSNINGG-  512
            NGVSLTLGLP  +NL+ S   Q ++ TH  + +GRR+++G        +    + INGG 
Sbjct  591  NGVSLTLGLPHCDNLS-STHHQGFMQTHHGIPIGRRVKIGET------EEYGAAAINGGG  643

Query  511  --------------YETIDFQNGKRFAAQLLPDFVA  446
                          Y  ++ QN KR+ AQLLPDFVA
Sbjct  644  SAATAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  679



>ref|XP_010676226.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=669

 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 103/224 (46%), Gaps = 36/224 (16%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANK-EIGSNNSTEKQEKTSNI---Q  1109
             LWKPM+EEMYTEE+K QE+   S E    + K N  N+ + G+ N    QEKT+ I    
Sbjct  435   LWKPMIEEMYTEELKEQERL--SEEKLGNSSKENSNNENDSGALNYINNQEKTNIIAGNH  492

Query  1108  DnnnnnNASPTEISTSIMTASPTGVSSLQPQGGGGGAFSFINTLNMENAG--ERNGKKPR  935
               NN    +    STS   + P+G ++        G F+  ++L+ME+AG   R  K+ R
Sbjct  493   QVNNCKEQNNATASTSSFISIPSGNNTTMANQNQHG-FTLSSSLDMEDAGISPRGPKRQR  551

Query  934   NDNIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAENFPDLMAAAN-----  770
             ND+       +L  D        E+N G    KF  ++        +P +    N     
Sbjct  552   NDD------QVLRYD--------ESNNGEIMIKFGNEKQGRENENGYPIISGGMNFIGMG  597

Query  769   -----TggfggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPS  653
                  T   G     +   F+P+     F HGNG+SL+LGLPPS
Sbjct  598   GGDLGTYPIGEIGRFETEDFSPQ---PRFLHGNGISLSLGLPPS  638



>ref|XP_010505121.1| PREDICTED: BEL1-like homeodomain protein 1 [Camelina sativa]
Length=675

 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 22/96 (23%)
 Frame = -3

Query  688  NGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQPSSHSNINGG-  512
            NGVSLTLGLP  ++L+ S   Q ++ TH  + +GRR+++G        +    ++INGG 
Sbjct  587  NGVSLTLGLPHCDSLS-STHHQGFMQTHHGIPIGRRVKIGET------EEYGTASINGGG  639

Query  511  --------------YETIDFQNGKRFAAQLLPDFVA  446
                          Y  ++ QN KR+ AQLLPDFVA
Sbjct  640  SATTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  675



>ref|XP_002881420.1| hypothetical protein ARALYDRAFT_482564 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57679.1| hypothetical protein ARALYDRAFT_482564 [Arabidopsis lyrata subsp. 
lyrata]
Length=671

 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 52/96 (54%), Gaps = 22/96 (23%)
 Frame = -3

Query  688  NGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQPSSHSNINGG-  512
            NGVSLTLGLP  ++L+ S   Q ++ TH  + +GRR+++G        +    + INGG 
Sbjct  583  NGVSLTLGLPHCDSLS-STHHQGFMQTHHGIPIGRRVKIGET------EEYGAATINGGS  635

Query  511  --------------YETIDFQNGKRFAAQLLPDFVA  446
                          Y  ++ QN KR+ AQLLPDFVA
Sbjct  636  SATTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  671



>gb|AAK43836.1|AF353094_1 BEL1-like homeodomain 1 [Arabidopsis thaliana]
Length=680

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 52/96 (54%), Gaps = 22/96 (23%)
 Frame = -3

Query  688  NGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQPSSHSNINGG-  512
            NGVSLTLGLP  ++L+ S   Q ++ TH  + +GRR+++G        +    + INGG 
Sbjct  592  NGVSLTLGLPHCDSLS-STDHQGFMQTHHGIPIGRRVKIGET------EEYGPATINGGS  644

Query  511  --------------YETIDFQNGKRFAAQLLPDFVA  446
                          Y  ++ QN KR+ AQLLPDFVA
Sbjct  645  STTTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  680



>ref|NP_181138.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 ref|NP_850256.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 ref|NP_001031490.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 sp|Q9SJ56.1|BLH1_ARATH RecName: Full=BEL1-like homeodomain protein 1; Short=BEL1-like 
protein 1; AltName: Full=Protein EMBRYO SAC DEVELOPMENT ARREST 
29 [Arabidopsis thaliana]
 gb|AAD21463.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAL59997.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAM20198.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAM20705.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAP37781.1| At2g35940 [Arabidopsis thaliana]
 dbj|BAE99297.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AEC09179.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 gb|AEC09180.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 gb|AEC09181.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
Length=680

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 52/96 (54%), Gaps = 22/96 (23%)
 Frame = -3

Query  688  NGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQPSSHSNINGG-  512
            NGVSLTLGLP  ++L+ S   Q ++ TH  + +GRR+++G        +    + INGG 
Sbjct  592  NGVSLTLGLPHCDSLS-STHHQGFMQTHHGIPIGRRVKIGET------EEYGPATINGGS  644

Query  511  --------------YETIDFQNGKRFAAQLLPDFVA  446
                          Y  ++ QN KR+ AQLLPDFVA
Sbjct  645  STTTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  680



>ref|XP_010509532.1| PREDICTED: BEL1-like homeodomain protein 1 [Camelina sativa]
Length=678

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 52/96 (54%), Gaps = 22/96 (23%)
 Frame = -3

Query  688  NGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQPSSHSNINGG-  512
            NGVSLTLGLP  ++L+ S   Q ++ TH  + +GRR+++G        +    + INGG 
Sbjct  590  NGVSLTLGLPHCDSLS-STHHQGFMQTHHGIPIGRRVKIGET------EEYGAAAINGGG  642

Query  511  --------------YETIDFQNGKRFAAQLLPDFVA  446
                          Y  ++ QN KR+ AQLLPDFVA
Sbjct  643  SATTAHSSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  678



>emb|CDY40420.1| BnaA04g20970D [Brassica napus]
Length=632

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 51/91 (56%), Gaps = 11/91 (12%)
 Frame = -3

Query  688  NGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGR--------MGIDNNPQPSS  533
            NGVSLTLGLP  ++L+ S   Q ++ TH  + +GRR+++G         +        + 
Sbjct  543  NGVSLTLGLPHCDSLS-STHHQGFMQTHHGIPIGRRVKIGEADDYGAAALNGGGGSAATV  601

Query  532  HSNINGG--YETIDFQNGKRFAAQLLPDFVA  446
            HS+      Y  ++ QN KR+ AQLLPDFVA
Sbjct  602  HSSATAAAAYNGMNIQNQKRYVAQLLPDFVA  632



>ref|XP_009141535.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
 ref|XP_009141536.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
 ref|XP_009141537.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
Length=675

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 51/91 (56%), Gaps = 11/91 (12%)
 Frame = -3

Query  688  NGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGR--------MGIDNNPQPSS  533
            NGVSLTLGLP  ++L+ S   Q ++ TH  + +GRR+++G         +        + 
Sbjct  586  NGVSLTLGLPHCDSLS-STHHQGFMQTHHGIPIGRRVKIGEADDYGAAALNGGGGSAATV  644

Query  532  HSNINGG--YETIDFQNGKRFAAQLLPDFVA  446
            HS+      Y  ++ QN KR+ AQLLPDFVA
Sbjct  645  HSSATAAAAYNGMNIQNQKRYVAQLLPDFVA  675



>gb|AEW08020.1| hypothetical protein 0_17161_01, partial [Pinus lambertiana]
Length=129

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 53/92 (58%), Gaps = 13/92 (14%)
 Frame = -3

Query  718  ENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGID-----  554
            E+ T  F    GVSLTLGL  ++ L++ G+QQNY+ST Q + LGRR ++G    D     
Sbjct  44   ESFTPRFSGSGGVSLTLGLQRTDGLSLQGAQQNYMST-QSLALGRRHDLGGNSSDYCNIE  102

Query  553  -NNPQPSSHSNINGGYETIDFQNGKRFAAQLL  461
             + P P   +NI   YE I+ Q  K FA QL+
Sbjct  103  TSAPHP---ANI---YENINIQPRKCFATQLM  128



>ref|XP_004497655.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=667

 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 52/82 (63%), Gaps = 18/82 (22%)
 Frame = -3

Query  682  VSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGR---MGIDNNPQPSSHSNINGG  512
            VSLTLGLP           Q+++  +++++LGRRLE+      G  NN    S+S+ +  
Sbjct  601  VSLTLGLP----------HQSFMP-NENIQLGRRLEISENNEFGALNN----SNSHSSAA  645

Query  511  YETIDFQNGKRFAAQLLPDFVA  446
            +E+I+ QN KRFAAQLLPDFVA
Sbjct  646  FESINMQNPKRFAAQLLPDFVA  667



>gb|AEW08021.1| hypothetical protein 0_17161_01, partial [Pinus radiata]
 gb|AFG47671.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47672.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47673.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47674.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47675.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47676.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47677.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47678.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47679.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47680.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47681.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47682.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47683.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
 gb|AFG47684.1| hypothetical protein 0_17161_01, partial [Pinus taeda]
Length=129

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 50/86 (58%), Gaps = 1/86 (1%)
 Frame = -3

Query  718  ENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQP  539
            E+ T  F    GVSLTLGL  ++ L++ G+QQNY+ST Q + LGRR ++G    D     
Sbjct  44   ESFTPRFSGSGGVSLTLGLQRTDGLSLQGAQQNYMST-QSLALGRRHDLGGNSSDYCNIE  102

Query  538  SSHSNINGGYETIDFQNGKRFAAQLL  461
            +S  +    YE I+ Q  K FA QL+
Sbjct  103  TSAPHPANLYENINIQPRKCFATQLM  128



>gb|AFB32720.1| hypothetical protein 0_17161_01, partial [Larix decidua]
Length=129

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 1/86 (1%)
 Frame = -3

Query  718  ENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQP  539
            E+ T  F    GVSLTLGL  ++ L++ G+QQNY+ST Q + LGRR ++G    D     
Sbjct  44   ESFTPRFSGSGGVSLTLGLQRTDGLSLQGTQQNYMST-QSLALGRRHDLGGNSSDYCNIE  102

Query  538  SSHSNINGGYETIDFQNGKRFAAQLL  461
            +S ++    YE ++ Q  K FA QL+
Sbjct  103  TSTAHPANIYENLNIQPRKCFATQLM  128



>gb|AFB32721.1| hypothetical protein 0_17161_01, partial [Pinus mugo]
 gb|AFB32722.1| hypothetical protein 0_17161_01, partial [Pinus mugo]
 gb|AFB32723.1| hypothetical protein 0_17161_01, partial [Pinus mugo]
Length=129

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 13/92 (14%)
 Frame = -3

Query  718  ENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGID-----  554
            E+ T  F    GVSLTLGL  ++ L++ G+QQNY+ST Q + LGRR ++G    D     
Sbjct  44   ESFTPRFSGSGGVSLTLGLQRTDGLSLQGAQQNYMST-QSLALGRRHDLGGNSSDYCNIE  102

Query  553  -NNPQPSSHSNINGGYETIDFQNGKRFAAQLL  461
             + P P   +N+   YE I+ Q  K FA QL+
Sbjct  103  ISAPHP---ANL---YENINIQPRKCFATQLM  128



>gb|AEW09251.1| hypothetical protein UMN_1142_01, partial [Pinus radiata]
 gb|AFG58515.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58516.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58517.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58518.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58519.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58520.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58521.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58522.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58523.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58524.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58525.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58526.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
 gb|AFG58527.1| hypothetical protein UMN_1142_01, partial [Pinus taeda]
Length=100

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 4/93 (4%)
 Frame = -3

Query  718  ENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQP  539
            E  T  +    GVSLTLGL   ++L++SG+QQ+Y ST Q +  GRR ++     D+    
Sbjct  10   ETFTPKYSGIGGVSLTLGLQHCDDLSLSGTQQSYNST-QGLGSGRRHDLAS-DTDDYCHI  67

Query  538  SSHSNINGG--YETIDFQNGKRFAAQLLPDFVA  446
               S + G   Y+ +  QNGKRFA  +L DFVA
Sbjct  68   HDASAVRGASNYDNMSMQNGKRFATHMLHDFVA  100



>ref|XP_006410764.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 ref|XP_006410765.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 ref|XP_006410766.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52217.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52218.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52219.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
Length=677

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 49/88 (56%), Gaps = 8/88 (9%)
 Frame = -3

Query  688  NGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRM-------GIDNNPQPSSH  530
            NGVSLTLGLP  ++L+ S   Q ++ TH  + +GRR+++G                 ++ 
Sbjct  591  NGVSLTLGLPHCDSLS-STHHQGFMQTHHGIPIGRRVKIGETEEYGAAALNGGGGSAATA  649

Query  529  SNINGGYETIDFQNGKRFAAQLLPDFVA  446
             +    Y  ++ QN KR+ AQLLPDFVA
Sbjct  650  HSSAAVYNGMNIQNQKRYVAQLLPDFVA  677



>gb|AEW09250.1| hypothetical protein UMN_1142_01, partial [Pinus lambertiana]
 gb|AFB34663.1| hypothetical protein UMN_1142_01, partial [Pinus cembra]
 gb|AFB34664.1| hypothetical protein UMN_1142_01, partial [Pinus cembra]
Length=100

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 4/93 (4%)
 Frame = -3

Query  718  ENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQP  539
            E  T  +    GVSLTLGL   ++L++SG+QQ+Y ST Q +  GRR ++     D+    
Sbjct  10   ETFTPKYSGIGGVSLTLGLQHCDDLSLSGTQQSYNST-QGLGSGRRHDLASDS-DDYCHI  67

Query  538  SSHSNINGG--YETIDFQNGKRFAAQLLPDFVA  446
               S + G   Y+ +  QNGKRFA  +L DFVA
Sbjct  68   HDTSAVRGASNYDNMSMQNGKRFATHMLHDFVA  100



>ref|XP_010516801.1| PREDICTED: BEL1-like homeodomain protein 1 [Camelina sativa]
Length=260

 Score = 54.3 bits (129),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 49/90 (54%), Gaps = 10/90 (11%)
 Frame = -3

Query  688  NGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGR---------MGIDNNPQPS  536
            NGVSLTLGLP  ++L+ S   Q ++ TH    +GRR+++G           G  +     
Sbjct  172  NGVSLTLGLPHCDSLS-STHHQGFMQTHHGNPIGRRVKIGETEEYGAAAXNGGGSATTAH  230

Query  535  SHSNINGGYETIDFQNGKRFAAQLLPDFVA  446
            S +     Y  ++ QN KR+ AQLLPDFVA
Sbjct  231  SSAAAAAAYNGMNIQNQKRYVAQLLPDFVA  260



>ref|XP_009420594.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
1 [Musa acuminata subsp. malaccensis]
Length=669

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 81/287 (28%), Positives = 122/287 (43%), Gaps = 49/287 (17%)
 Frame = -3

Query  1276  LWKPMVEEMYTEEMKGQEQYGGSGENAAAAGKRNEANKEIGSNNSTEKQEKTSNIQDnnn  1097
             LWKPMVEEMY EE+K QEQ   S ENA+      +AN   GS+ S       SN Q   +
Sbjct  420   LWKPMVEEMYLEELKDQEQ-NNSEENAS----NGDAN---GSSTS------KSNAQQEGS  465

Query  1096  nnNASPTEISTSIMTASPTGVSSLQPQG-GGGGAFSFINTLNMENAGERNGKKPRND---  929
                 +P+E   S+       ++++QP     G + +F +   +E    +  K+  N    
Sbjct  466   PTGTAPSE---SLKIDPNQTLAAVQPSSFAHGQSPAFHDKDAIEQPSFKKAKRHVNSVAH  522

Query  928   --NIQSSPSSILSVDMDMKSAAGEANKGYNHHKFTADRTPAAAAEN-FPDLMAAANTggf  758
                I+  P    + D+ MK   G    G   +      T    +   +P        G F
Sbjct  523   SIGIEVKPDETNNQDILMKLIDGRHRGGEQGYPLIPGNTSHGGSYGAYP---IGGELGRF  579

Query  757   ggftigdfgrFNPENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRL  578
                        N  +LT G  H            SE+L +SG+Q ++LS+ + M++GRR+
Sbjct  580   DAEQFAPRFSGNGVSLTLGLQH------------SESLPLSGAQPSFLSS-ESMQMGRRV  626

Query  577   EMGRMGID----NNPQPSSHSNINGGYETIDFQNGKRFAAQLLPDFV  449
             EM     D    NN    +HS+          Q  +RF+AQLLP+ +
Sbjct  627   EMNTEAGDYCSLNNNAAVAHSS-----NAXSVQGRERFSAQLLPELI  668



>gb|AFB32724.1| hypothetical protein 0_17161_01, partial [Pinus mugo]
Length=129

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = -3

Query  718  ENLTAGFHHGNGVSLTLGLPPSENLAVSGSQQNYLSTHQDMELGRRLEMGRMGIDNNPQP  539
            E+ T  F    GVSLTLGL   + L++ G+QQNY+ T Q + LGRR ++G    D     
Sbjct  44   ESFTPRFSGSGGVSLTLGLQRIDGLSLQGAQQNYMLT-QSLALGRRHDLGGNSSDYCNIE  102

Query  538  SSHSNINGGYETIDFQNGKRFAAQLL  461
            +S  +    YE I+ Q  K FA QL+
Sbjct  103  TSAPHPANLYENINIQPRKCFATQLM  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3273381520216