BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16491_g1_i1 len=1322 path=[1328:0-1230 2559:1231-1321]

Length=1322
                                                                      Score     E

ref|XP_009629592.1|  PREDICTED: BEL1-like homeodomain protein 1         468   7e-155   
ref|XP_009778869.1|  PREDICTED: BEL1-like homeodomain protein 1         468   1e-154   
ref|XP_006362847.1|  PREDICTED: BEL1-like homeodomain protein 1-like    452   9e-149   
ref|XP_010313381.1|  PREDICTED: BEL1-like homeodomain protein 1         445   3e-146   
ref|XP_009613053.1|  PREDICTED: BEL1-like homeodomain protein 1         433   4e-142   
emb|CDP15553.1|  unnamed protein product                                430   6e-140   
ref|XP_009773899.1|  PREDICTED: BEL1-like homeodomain protein 1         426   1e-139   
ref|XP_002275098.1|  PREDICTED: BEL1-like homeodomain protein 1         416   1e-134   Vitis vinifera
emb|CAN69527.1|  hypothetical protein VITISV_027380                     414   6e-134   Vitis vinifera
gb|ACD39468.1|  BEL5 protein                                            413   9e-134   Solanum etuberosum
gb|ACD39464.1|  BEL5 protein                                            410   8e-133   Solanum palustre
ref|NP_001234599.1|  bell-like homeodomain protein 2                    409   5e-132   
ref|NP_001274921.1|  BEL1-related homeotic protein 5                    406   4e-131   
ref|XP_009404911.1|  PREDICTED: BEL1-like homeodomain protein 1         402   1e-129   
ref|XP_006361091.1|  PREDICTED: BEL1-related homeotic protein 5         402   2e-129   
ref|XP_008799712.1|  PREDICTED: BEL1-like homeodomain protein 1         396   2e-127   
ref|XP_010931060.1|  PREDICTED: BEL1-like homeodomain protein 1         387   9e-125   
ref|XP_007027982.1|  BEL1-like homeodomain protein 1 isoform 1          388   2e-124   
ref|XP_009420594.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...    386   9e-124   
ref|XP_008784116.1|  PREDICTED: BEL1-like homeodomain protein 1         385   2e-123   
ref|XP_010912386.1|  PREDICTED: BEL1-like homeodomain protein 1         384   5e-123   
ref|XP_010247184.1|  PREDICTED: BEL1-like homeodomain protein 1         381   4e-121   
ref|XP_003543416.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    377   6e-120   
ref|XP_010263012.1|  PREDICTED: BEL1-like homeodomain protein 1         378   1e-119   
ref|XP_008230296.1|  PREDICTED: BEL1-like homeodomain protein 1         374   3e-119   
ref|XP_007015671.1|  BEL1 homeodomain 1, putative                       375   2e-118   
ref|XP_007208166.1|  hypothetical protein PRUPE_ppa002583mg             370   1e-117   
ref|XP_002313498.2|  hypothetical protein POPTR_0009s02250g             367   3e-116   Populus trichocarpa [western balsam poplar]
ref|XP_007150021.1|  hypothetical protein PHAVU_005G119300g             367   7e-116   
ref|XP_007150022.1|  hypothetical protein PHAVU_005G119300g             367   9e-116   
ref|XP_008449596.1|  PREDICTED: BEL1-like homeodomain protein 1         366   1e-115   
ref|XP_011094236.1|  PREDICTED: BEL1-like homeodomain protein 1         363   2e-114   
ref|XP_011003835.1|  PREDICTED: BEL1-like homeodomain protein 1         363   6e-114   
gb|KHF99976.1|  BEL1-like homeodomain protein 1                         361   7e-114   
ref|XP_011021429.1|  PREDICTED: BEL1-like homeodomain protein 1         362   1e-113   
ref|XP_004140170.1|  PREDICTED: BEL1-like homeodomain protein 1-like    360   2e-113   
ref|XP_011090301.1|  PREDICTED: BEL1-like homeodomain protein 1         356   1e-112   
gb|KHG11906.1|  BEL1-like homeodomain protein 1                         358   1e-112   
gb|AAN03622.1|AF406698_1  BEL1-related homeotic protein 11              353   2e-112   Solanum tuberosum [potatoes]
gb|KHG11905.1|  BEL1-like homeodomain protein 1                         355   5e-112   
ref|XP_002299773.2|  hypothetical protein POPTR_0001s22430g             356   2e-111   Populus trichocarpa [western balsam poplar]
ref|XP_002266838.1|  PREDICTED: BEL1-like homeodomain protein 1         353   1e-110   Vitis vinifera
ref|XP_003540818.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    353   3e-110   
ref|XP_010031566.1|  PREDICTED: BEL1-like homeodomain protein 1         351   8e-110   
ref|XP_010089795.1|  BEL1-like homeodomain protein 1                    350   9e-110   
ref|XP_009787672.1|  PREDICTED: BEL1-like homeodomain protein 1         347   5e-108   
ref|XP_004506223.1|  PREDICTED: BEL1-like homeodomain protein 1-like    343   1e-107   
emb|CAN63083.1|  hypothetical protein VITISV_015358                     344   5e-107   Vitis vinifera
ref|XP_009628712.1|  PREDICTED: BEL1-like homeodomain protein 1         343   6e-107   
ref|XP_006424091.1|  hypothetical protein CICLE_v10027955mg             343   7e-107   
gb|KDO46590.1|  hypothetical protein CISIN_1g005901mg                   342   7e-107   
ref|XP_006494895.1|  PREDICTED: BEL1-like homeodomain protein 1-like    342   8e-107   
ref|XP_007132496.1|  hypothetical protein PHAVU_011G099100g             343   1e-106   
ref|XP_003539486.1|  PREDICTED: BEL1-like homeodomain protein 1-like    337   3e-106   
ref|XP_003539151.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    343   6e-106   
gb|KHN19925.1|  BEL1-like homeodomain protein 1                         343   6e-106   
gb|KEH29763.1|  BEL1-related homeotic protein                           340   1e-105   
gb|KDO70617.1|  hypothetical protein CISIN_1g005514mg                   340   2e-105   
emb|CDP10596.1|  unnamed protein product                                338   3e-105   
ref|XP_006481599.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    338   6e-105   
ref|XP_006430060.1|  hypothetical protein CICLE_v10011201mg             338   7e-105   
gb|KEH24245.1|  BEL1-related homeotic protein                           337   8e-105   
ref|XP_004303380.1|  PREDICTED: BEL1-like homeodomain protein 1-like    337   1e-104   
ref|XP_009403681.1|  PREDICTED: BEL1-like homeodomain protein 1         332   3e-104   
gb|KHG12855.1|  BEL1-like homeodomain protein 1                         334   9e-104   
gb|KHN17979.1|  BEL1-like homeodomain protein 1                         328   4e-103   
ref|XP_004136516.1|  PREDICTED: BEL1-like homeodomain protein 1-like    332   2e-102   
gb|KHG12856.1|  BEL1-like homeodomain protein 1                         333   2e-102   
ref|XP_004171976.1|  PREDICTED: BEL1-like homeodomain protein 1-like    332   2e-102   
gb|KDP36113.1|  hypothetical protein JCGZ_08757                         331   3e-102   
ref|XP_007204250.1|  hypothetical protein PRUPE_ppa002158mg             332   3e-102   
ref|XP_008241058.1|  PREDICTED: BEL1-like homeodomain protein 1         330   8e-102   
ref|XP_006348466.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    330   1e-101   
ref|XP_008442920.1|  PREDICTED: BEL1-like homeodomain protein 1         330   1e-101   
ref|XP_010059079.1|  PREDICTED: BEL1-like homeodomain protein 1         328   3e-101   
ref|XP_006854627.1|  hypothetical protein AMTR_s00030p00173920          328   9e-101   
emb|CDX84585.1|  BnaA03g16450D                                          325   3e-100   
gb|KHG01894.1|  BEL1-like homeodomain protein 1                         324   4e-100   
ref|XP_011046419.1|  PREDICTED: BEL1-like homeodomain protein 1         324   8e-100   
ref|XP_004497655.1|  PREDICTED: BEL1-like homeodomain protein 1-like    323   2e-99    
ref|XP_006373820.1|  hypothetical protein POPTR_0016s07040g             323   3e-99    
emb|CDY40420.1|  BnaA04g20970D                                          321   4e-99    
ref|XP_006381943.1|  hypothetical protein POPTR_0006s21950g             322   4e-99    
ref|XP_011042587.1|  PREDICTED: BEL1-like homeodomain protein 1         322   8e-99    
emb|CDX79646.1|  BnaC03g19820D                                          322   1e-98    
ref|XP_003519115.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    320   2e-98    
ref|XP_002881420.1|  hypothetical protein ARALYDRAFT_482564             320   2e-98    
ref|XP_010521016.1|  PREDICTED: BEL1-like homeodomain protein 1         320   4e-98    
ref|XP_008391977.1|  PREDICTED: BEL1-like homeodomain protein 1         321   4e-98    
ref|XP_009348973.1|  PREDICTED: BEL1-like homeodomain protein 1         321   4e-98    
ref|XP_010553582.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...    317   4e-98    
ref|XP_009141535.1|  PREDICTED: BEL1-like homeodomain protein 1         320   4e-98    
ref|XP_006410764.1|  hypothetical protein EUTSA_v10016349mg             320   5e-98    
ref|XP_007145789.1|  hypothetical protein PHAVU_007G267900g             318   6e-98    
ref|XP_008360598.1|  PREDICTED: BEL1-like homeodomain protein 1         320   6e-98    
dbj|BAE71188.1|  BEL1-like homeodomain transcription factor             318   7e-98    Trifolium pratense [peavine clover]
emb|CBI24428.3|  unnamed protein product                                316   8e-98    
gb|EPS74374.1|  hypothetical protein M569_00381                         310   1e-97    
ref|XP_007162972.1|  hypothetical protein PHAVU_001G195800g             318   1e-97    
ref|XP_006293790.1|  hypothetical protein CARUB_v10022772mg             318   3e-97    
ref|XP_010505121.1|  PREDICTED: BEL1-like homeodomain protein 1         318   3e-97    
ref|XP_003535815.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    317   3e-97    
ref|XP_010509532.1|  PREDICTED: BEL1-like homeodomain protein 1         317   4e-97    
gb|AAK43836.1|AF353094_1  BEL1-like homeodomain 1                       317   6e-97    Arabidopsis thaliana [mouse-ear cress]
ref|NP_181138.1|  BEL1-like homeodomain 1                               317   6e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004978737.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    316   7e-97    
ref|XP_004228612.1|  PREDICTED: BEL1-like homeodomain protein 1         317   1e-96    
emb|CDY32069.1|  BnaC04g44970D                                          315   2e-96    
emb|CBI22785.3|  unnamed protein product                                310   2e-96    
gb|KHN21192.1|  BEL1-like homeodomain protein 1                         312   4e-96    
gb|KEH41936.1|  BEL1-related homeotic protein                           313   5e-96    
ref|XP_003521496.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    313   2e-95    
ref|XP_002450321.1|  hypothetical protein SORBIDRAFT_05g003750          309   6e-94    Sorghum bicolor [broomcorn]
ref|XP_006663234.1|  PREDICTED: BEL1-like homeodomain protein 1-like    305   2e-93    
gb|KHN48417.1|  BEL1-like homeodomain protein 1                         297   9e-92    
ref|XP_008387112.1|  PREDICTED: BEL1-like homeodomain protein 1         302   4e-91    
ref|XP_004494251.1|  PREDICTED: BEL1-like homeodomain protein 1-like    300   2e-90    
ref|XP_009133059.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...    298   6e-90    
ref|XP_010107001.1|  BEL1-like homeodomain protein 1                    291   9e-90    
gb|ACD39469.1|  BEL29 protein                                           288   9e-88    Solanum etuberosum
gb|ACC77468.1|  BEL1                                                    291   2e-87    Kalanchoe x houghtonii
gb|AAN03626.1|AF406702_1  BEL1-related homeotic protein 29              289   2e-87    Solanum tuberosum [potatoes]
ref|XP_002306123.2|  hypothetical protein POPTR_0004s16660g             290   2e-87    Populus trichocarpa [western balsam poplar]
gb|KHN10043.1|  BEL1-like homeodomain protein 1                         285   2e-87    
dbj|BAK05542.1|  predicted protein                                      291   2e-87    
ref|XP_006362026.1|  PREDICTED: BEL1-related homeotic protein 30        291   3e-87    
ref|XP_008382306.1|  PREDICTED: BEL1-like homeodomain protein 6         291   3e-87    
ref|NP_001275368.1|  BEL1-related homeotic protein 30                   290   3e-87    
ref|XP_011037163.1|  PREDICTED: BEL1-like homeodomain protein 6         291   3e-87    
ref|XP_009372989.1|  PREDICTED: BEL1-like homeodomain protein 6         291   4e-87    
gb|ACD39466.1|  BEL29 protein                                           286   6e-87    Solanum palustre
ref|XP_010557975.1|  PREDICTED: BEL1-like homeodomain protein 1         290   8e-87    
gb|EYU37829.1|  hypothetical protein MIMGU_mgv1a003764mg                287   1e-86    
ref|XP_003554466.1|  PREDICTED: BEL1-like homeodomain protein 1-l...    290   1e-86    
ref|XP_008812787.1|  PREDICTED: BEL1-like homeodomain protein 7         290   1e-86    
gb|KHN08605.1|  BEL1-like homeodomain protein 1                         290   1e-86    
gb|KHN33154.1|  BEL1-like homeodomain protein 1                         282   3e-86    
ref|XP_010254698.1|  PREDICTED: BEL1-like homeodomain protein 6         290   3e-86    
ref|XP_010932911.1|  PREDICTED: BEL1-like homeodomain protein 7         288   5e-86    
ref|XP_008377277.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    288   9e-86    
ref|XP_009619241.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    284   1e-85    
ref|XP_010676226.1|  PREDICTED: BEL1-like homeodomain protein 1 i...    286   2e-85    
ref|XP_010676227.1|  PREDICTED: BEL1-like homeodomain protein 1 i...    285   3e-85    
ref|XP_002313027.2|  hypothetical protein POPTR_0009s12360g             284   3e-85    Populus trichocarpa [western balsam poplar]
ref|XP_010932672.1|  PREDICTED: BEL1-like homeodomain protein 7         286   3e-85    
ref|XP_008679683.1|  PREDICTED: BEL1-like homeodomain protein 1         285   4e-85    
ref|XP_004230877.1|  PREDICTED: BEL1-like homeodomain protein 7         284   1e-84    
ref|XP_010066189.1|  PREDICTED: BEL1-like homeodomain protein 6         284   1e-84    
ref|XP_009619240.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    283   2e-84    
ref|XP_008794017.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    284   2e-84    
ref|XP_008794014.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    283   4e-84    
ref|XP_009757871.1|  PREDICTED: BEL1-like homeodomain protein 7         282   4e-84    
ref|NP_001065808.2|  Os11g0158600                                       283   5e-84    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009347845.1|  PREDICTED: BEL1-like homeodomain protein 7         283   5e-84    
ref|XP_007160715.1|  hypothetical protein PHAVU_001G011000g             281   1e-83    
ref|XP_008812200.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    280   4e-83    
ref|XP_010685441.1|  PREDICTED: BEL1-like homeodomain protein 1         282   4e-83    
gb|KHG12221.1|  BEL1-like homeodomain protein 6                         280   4e-83    
ref|XP_006595918.1|  PREDICTED: BEL1-like homeodomain protein 3-l...    279   4e-83    
ref|XP_008812195.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    280   7e-83    
ref|NP_179233.1|  BEL1-like homeodomain 7                               274   9e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008812196.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    279   1e-82    
ref|XP_010917677.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    278   1e-82    
gb|AAL10487.1|  At2g16400/F16F14.10                                     274   1e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007160717.1|  hypothetical protein PHAVU_001G011100g             278   2e-82    
ref|XP_010917673.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    278   2e-82    
gb|KHN22224.1|  BEL1-like homeodomain protein 3                         275   2e-82    
ref|XP_006650407.1|  PREDICTED: BEL1-like homeodomain protein 6-l...    278   2e-82    
ref|XP_010917672.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    278   4e-82    
ref|XP_003523566.1|  PREDICTED: BEL1-like homeodomain protein 10-...    277   4e-82    
ref|XP_009418396.1|  PREDICTED: BEL1-like homeodomain protein 7         278   4e-82    
ref|XP_010516766.1|  PREDICTED: BEL1-like homeodomain protein 7         272   5e-82    
ref|XP_004500978.1|  PREDICTED: BEL1-like homeodomain protein 10-...    275   5e-82    
ref|XP_006297524.1|  hypothetical protein CARUB_v10013548mg             272   5e-82    
ref|XP_003527678.1|  PREDICTED: BEL1-like homeodomain protein 3-l...    276   5e-82    
ref|XP_010917671.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    278   8e-82    
emb|CAD89693.1|  BEL1-like homeodomain protein HB2                      274   1e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010093716.1|  BEL1-like homeodomain protein 1                    270   1e-81    
gb|AAS18416.1|  benzothiadiazole-induced homeodomain protein 1          275   2e-81    Oryza sativa Indica Group [Indian rice]
ref|XP_002886224.1|  hypothetical protein ARALYDRAFT_480804             271   2e-81    
gb|AAK00972.1|AC079736_12  putative homeodomain protein                 275   2e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007136630.1|  hypothetical protein PHAVU_009G060400g             271   3e-81    
ref|XP_006409439.1|  hypothetical protein EUTSA_v10022660mg             271   3e-81    
emb|CDX89711.1|  BnaC03g46250D                                          270   3e-81    
ref|XP_010467364.1|  PREDICTED: BEL1-like homeodomain protein 7         270   4e-81    
dbj|BAJ96483.1|  predicted protein                                      274   4e-81    
ref|XP_006664239.1|  PREDICTED: BEL1-like homeodomain protein 6-l...    275   4e-81    
ref|XP_010489213.1|  PREDICTED: BEL1-like homeodomain protein 7         270   4e-81    
gb|EAY84030.1|  hypothetical protein OsI_39262                          274   4e-81    Oryza sativa Indica Group [Indian rice]
ref|NP_001067363.1|  Os12g0636200                                       274   5e-81    Oryza sativa Japonica Group [Japonica rice]
gb|EEC75936.1|  hypothetical protein OsI_13031                          275   5e-81    Oryza sativa Indica Group [Indian rice]
ref|NP_001050904.1|  Os03g0680800                                       275   6e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009137061.1|  PREDICTED: BEL1-like homeodomain protein 7         268   6e-81    
dbj|BAK01775.1|  predicted protein                                      274   8e-81    
ref|XP_002464081.1|  hypothetical protein SORBIDRAFT_01g011960          273   9e-81    Sorghum bicolor [broomcorn]
gb|EMS47188.1|  BEL1-like homeodomain protein 6                         273   1e-80    
ref|XP_002443654.1|  hypothetical protein SORBIDRAFT_08g022960          273   1e-80    Sorghum bicolor [broomcorn]
ref|XP_009136305.1|  PREDICTED: BEL1-like homeodomain protein 7         268   1e-80    
ref|XP_006487350.1|  PREDICTED: BEL1-like homeodomain protein 6-l...    273   2e-80    
ref|XP_004982177.1|  PREDICTED: BEL1-like homeodomain protein 6-l...    273   2e-80    
ref|XP_003575568.1|  PREDICTED: BEL1-like homeodomain protein 7         272   3e-80    
gb|KDO49465.1|  hypothetical protein CISIN_1g038021mg                   273   3e-80    
ref|XP_006423388.1|  hypothetical protein CICLE_v10027952mg             273   3e-80    
gb|KDP41749.1|  hypothetical protein JCGZ_26767                         273   3e-80    
ref|XP_006487349.1|  PREDICTED: BEL1-like homeodomain protein 6-l...    273   3e-80    
ref|XP_008796600.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    269   4e-80    
ref|XP_010907730.1|  PREDICTED: BEL1-like homeodomain protein 7         272   4e-80    
ref|XP_004963319.1|  PREDICTED: BEL1-like homeodomain protein 6-l...    271   4e-80    
gb|EMS62949.1|  BEL1-like homeodomain protein 6                         271   5e-80    
gb|EMT29295.1|  BEL1-like homeodomain protein 6                         271   5e-80    
ref|XP_003589334.1|  BEL1-like homeodomain protein                      271   7e-80    
ref|XP_002963328.1|  hypothetical protein SELMODRAFT_80869              260   8e-80    
ref|XP_008675002.1|  PREDICTED: BEL1-related homeotic protein 30 ...    271   9e-80    
ref|XP_006838675.1|  hypothetical protein AMTR_s00002p00243900          272   1e-79    
ref|NP_001147963.1|  BEL1-related homeotic protein 30                   271   1e-79    Zea mays [maize]
ref|XP_007199727.1|  hypothetical protein PRUPE_ppa002499mg             271   1e-79    
ref|XP_010107836.1|  BEL1-like homeodomain protein 6                    271   2e-79    
gb|ACD39467.1|  BEL30 protein                                           270   2e-79    Solanum palustre
emb|CBI38029.3|  unnamed protein product                                268   2e-79    
ref|NP_001131173.1|  uncharacterized protein LOC100192481               270   3e-79    Zea mays [maize]
ref|XP_003549446.2|  PREDICTED: BEL1-like homeodomain protein 3-like    268   3e-79    
gb|ACD39463.1|  BEL30 protein                                           269   3e-79    Solanum etuberosum
gb|EMT16587.1|  BEL1-like homeodomain protein 6                         271   3e-79    
ref|XP_008796599.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    270   3e-79    
emb|CDY02261.1|  BnaA03g39060D                                          264   4e-79    
ref|XP_004289652.1|  PREDICTED: BEL1-like homeodomain protein 6-like    269   6e-79    
gb|KEH36201.1|  BEL1-related homeotic protein                           265   7e-79    
gb|EEE51686.1|  hypothetical protein OsJ_33045                          268   1e-78    Oryza sativa Japonica Group [Japonica rice]
gb|KHN12676.1|  BEL1-like homeodomain protein 7                         267   1e-78    
ref|XP_008236952.1|  PREDICTED: BEL1-like homeodomain protein 7         268   1e-78    
emb|CAN62866.1|  hypothetical protein VITISV_015924                     269   1e-78    Vitis vinifera
emb|CDO97015.1|  unnamed protein product                                268   1e-78    
gb|KEH36200.1|  BEL1-related homeotic protein                           266   2e-78    
ref|XP_003576293.1|  PREDICTED: BEL1-like homeodomain protein 1         268   2e-78    
ref|XP_003631586.1|  PREDICTED: BEL1-like homeodomain protein 3         268   4e-78    
ref|XP_007135942.1|  hypothetical protein PHAVU_009G004800g             266   4e-78    
ref|XP_009396357.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    266   5e-78    
ref|XP_008644604.1|  PREDICTED: BEL1-like homeodomain protein 7         266   5e-78    
ref|XP_002465808.1|  hypothetical protein SORBIDRAFT_01g046170          265   5e-78    Sorghum bicolor [broomcorn]
ref|XP_010028619.1|  PREDICTED: BEL1-like homeodomain protein 7         266   5e-78    
ref|XP_007042091.1|  BEL1-like homeodomain protein 6 isoform 1          267   6e-78    
ref|XP_009396355.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    266   9e-78    
ref|XP_004173415.1|  PREDICTED: BEL1-like homeodomain protein 6-like    266   1e-77    
ref|XP_006581113.1|  PREDICTED: BEL1-like homeodomain protein 6-like    263   1e-77    
ref|XP_008460982.1|  PREDICTED: BEL1-like homeodomain protein 7         266   1e-77    
ref|XP_010275538.1|  PREDICTED: BEL1-like homeodomain protein 6         267   1e-77    
ref|XP_004150064.1|  PREDICTED: BEL1-like homeodomain protein 6-like    266   1e-77    
ref|XP_002512955.1|  bel1 homeotic protein, putative                    266   1e-77    Ricinus communis
ref|XP_009138307.1|  PREDICTED: BEL1-like homeodomain protein 6         261   2e-77    
gb|KHG17019.1|  BEL1-like homeodomain protein 6                         263   3e-77    
ref|XP_004985591.1|  PREDICTED: BEL1-like homeodomain protein 7-l...    262   4e-77    
ref|XP_009407152.1|  PREDICTED: BEL1-like homeodomain protein 7         263   4e-77    
ref|XP_011047809.1|  PREDICTED: BEL1-like homeodomain protein 7         264   5e-77    
dbj|BAE98691.1|  putative homeodomain protein BELL1                     258   5e-77    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006390306.1|  hypothetical protein EUTSA_v10018381mg             260   7e-77    
gb|KHG08101.1|  BEL1-like homeodomain protein 7                         260   7e-77    
ref|XP_002889024.1|  hypothetical protein ARALYDRAFT_476691             259   1e-76    
ref|XP_010471651.1|  PREDICTED: BEL1-like homeodomain protein 3         260   1e-76    
ref|XP_009121216.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...    259   1e-76    
ref|XP_006302135.1|  hypothetical protein CARUB_v10020140mg             259   1e-76    
ref|XP_006649449.1|  PREDICTED: BEL1-like homeodomain protein 7-like    261   2e-76    
ref|XP_010416424.1|  PREDICTED: BEL1-like homeodomain protein 3         259   2e-76    
ref|XP_011088451.1|  PREDICTED: BEL1-like homeodomain protein 7         262   2e-76    
dbj|BAJ34230.1|  unnamed protein product                                256   4e-76    
ref|XP_003561342.1|  PREDICTED: BEL1-like homeodomain protein 7         261   4e-76    
ref|XP_002302014.2|  hypothetical protein POPTR_0002s03240g             261   5e-76    Populus trichocarpa [western balsam poplar]
ref|XP_010428562.1|  PREDICTED: BEL1-like homeodomain protein 3         258   6e-76    
gb|AAL32623.1|  Similar to homeodomain proteins                         258   7e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010543867.1|  PREDICTED: BEL1-like homeodomain protein 1 i...    259   7e-76    
ref|NP_177674.1|  BEL1-like homeodomain 3                               257   7e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011028920.1|  PREDICTED: BEL1-like homeodomain protein 7         262   7e-76    
ref|XP_010533491.1|  PREDICTED: BEL1-like homeodomain protein 3         258   8e-76    
ref|XP_006473564.1|  PREDICTED: BEL1-like homeodomain protein 3-l...    261   8e-76    
ref|XP_010548069.1|  PREDICTED: BEL1-like homeodomain protein 6         258   1e-75    
gb|KHG00573.1|  BEL1-like homeodomain protein 6                         261   1e-75    
ref|XP_006412205.1|  hypothetical protein EUTSA_v10024906mg             256   1e-75    
ref|XP_004499204.1|  PREDICTED: BEL1-like homeodomain protein 10-...    259   2e-75    
emb|CDY45321.1|  BnaA03g52940D                                          260   2e-75    
ref|XP_009394462.1|  PREDICTED: BEL1-like homeodomain protein 7         255   3e-75    
tpg|DAA43547.1|  TPA: putative POX domain/homeobox DNA-binding do...    257   4e-75    
emb|CDX85896.1|  BnaC06g22380D                                          254   4e-75    
dbj|BAJ98782.1|  predicted protein                                      257   5e-75    
ref|XP_004238265.1|  PREDICTED: BEL1-like homeodomain protein 3         258   6e-75    
gb|KDO84667.1|  hypothetical protein CISIN_1g005863mg                   258   1e-74    
gb|EMS60062.1|  BEL1-like homeodomain protein 6                         254   1e-74    
ref|XP_006435065.1|  hypothetical protein CICLE_v10000508mg             258   1e-74    
ref|XP_007017638.1|  BEL1-like homeodomain protein 3, putative          258   1e-74    
gb|EEE52807.1|  hypothetical protein OsJ_35304                          256   2e-74    
ref|XP_010432392.1|  PREDICTED: BEL1-like homeodomain protein 6         254   2e-74    
ref|XP_008377193.1|  PREDICTED: BEL1-like homeodomain protein 3         254   4e-74    
ref|XP_009335797.1|  PREDICTED: BEL1-like homeodomain protein 3         254   5e-74    
ref|XP_010557446.1|  PREDICTED: BEL1-like homeodomain protein 5 i...    254   5e-74    
ref|NP_001049067.1|  Os03g0165300                                       254   5e-74    
ref|XP_002969077.1|  hypothetical protein SELMODRAFT_68227              241   5e-74    
ref|XP_007226414.1|  hypothetical protein PRUPE_ppa023311mg             252   6e-74    
ref|XP_006341979.1|  PREDICTED: BEL1-like homeodomain protein 3-l...    256   6e-74    
ref|XP_006283499.1|  hypothetical protein CARUB_v10004551mg             253   6e-74    
gb|EAY82346.1|  hypothetical protein OsI_37556                          255   8e-74    
ref|XP_002992851.1|  hypothetical protein SELMODRAFT_48157              240   1e-73    
ref|XP_009761063.1|  PREDICTED: BEL1-like homeodomain protein 7         254   2e-73    
ref|NP_195187.1|  BEL1-like homeodomain 6                               251   2e-73    
ref|XP_011083613.1|  PREDICTED: BEL1-like homeodomain protein 7         254   2e-73    
ref|XP_009592948.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    251   2e-73    
ref|XP_010447052.1|  PREDICTED: BEL1-like homeodomain protein 6         251   2e-73    
gb|AAZ73643.1|  At1g19700                                               241   3e-73    
gb|KEH36202.1|  BEL1-related homeotic protein                           246   4e-73    
ref|XP_002867111.1|  hypothetical protein ARALYDRAFT_912924             250   4e-73    
gb|EEE58381.1|  hypothetical protein OsJ_09538                          254   5e-73    
emb|CDX73170.1|  BnaC06g36180D                                          249   5e-73    
gb|KDP38560.1|  hypothetical protein JCGZ_04485                         254   5e-73    
ref|XP_008388024.1|  PREDICTED: BEL1-like homeodomain protein 3         251   5e-73    
gb|AAZ73649.1|  At1g19700                                               241   6e-73    
ref|XP_006577910.1|  PREDICTED: BEL1-like homeodomain protein 6-l...    253   7e-73    
gb|KHN33725.1|  BEL1-like homeodomain protein 6                         253   7e-73    
ref|XP_002974618.1|  hypothetical protein SELMODRAFT_414952             258   7e-73    
ref|XP_009592946.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    252   8e-73    
ref|XP_002510446.1|  bel1 homeotic protein, putative                    254   1e-72    
ref|XP_010672761.1|  PREDICTED: BEL1-like homeodomain protein 7 i...    251   2e-72    
ref|XP_010672737.1|  PREDICTED: BEL1-like homeodomain protein 3 i...    252   2e-72    
ref|XP_004291834.1|  PREDICTED: BEL1-like homeodomain protein 3-like    251   2e-72    
emb|CDY47524.1|  BnaAnng09220D                                          248   2e-72    
ref|XP_009106194.1|  PREDICTED: BEL1-like homeodomain protein 3         248   2e-72    
ref|XP_010437584.1|  PREDICTED: BEL1-like homeodomain protein 6         248   2e-72    
ref|XP_006307208.1|  hypothetical protein CARUB_v10008805mg             248   2e-72    
ref|XP_010536333.1|  PREDICTED: BEL1-like homeodomain protein 3         248   3e-72    
ref|NP_173400.1|  BEL1-like homeodomain 10                              248   3e-72    
ref|XP_010557445.1|  PREDICTED: BEL1-like homeodomain protein 5 i...    249   3e-72    
gb|AAZ73651.1|  At1g19700-like protein                                  239   3e-72    
ref|XP_008221346.1|  PREDICTED: BEL1-like homeodomain protein 3         249   6e-72    
emb|CDX75085.1|  BnaA05g08310D                                          249   8e-72    
ref|XP_010498393.1|  PREDICTED: BEL1-like homeodomain protein 10        247   1e-71    
gb|AAM15780.1|AC104428_1  Putative homeodomain protein                  253   1e-71    
ref|XP_010544329.1|  PREDICTED: BEL1-like homeodomain protein 5         248   2e-71    
ref|XP_010477192.1|  PREDICTED: BEL1-like homeodomain protein 10        246   2e-71    
ref|XP_009104706.1|  PREDICTED: BEL1-like homeodomain protein 3 i...    244   2e-71    
ref|XP_010459643.1|  PREDICTED: BEL1-like homeodomain protein 10        246   2e-71    
ref|XP_010459644.1|  PREDICTED: BEL1-like homeodomain protein 10        246   3e-71    
emb|CDY52073.1|  BnaCnng21740D                                          244   3e-71    
ref|XP_002893062.1|  hypothetical protein ARALYDRAFT_472196             245   3e-71    
ref|XP_009395555.1|  PREDICTED: BEL1-like homeodomain protein 6         246   4e-71    
gb|AAZ73632.1|  At1g19700                                               235   9e-71    
gb|AAZ73635.1|  At1g19700                                               234   2e-70    
ref|XP_009128099.1|  PREDICTED: BEL1-like homeodomain protein 3         241   4e-70    
emb|CDY39031.1|  BnaA02g17200D                                          241   5e-70    
gb|AAZ73636.1|  At1g19700                                               233   6e-70    
gb|AAZ73638.1|  At1g19700                                               233   7e-70    
gb|ACR35422.1|  unknown                                                 237   1e-69    
emb|CDP07470.1|  unnamed protein product                                244   2e-69    
ref|XP_003562035.1|  PREDICTED: BEL1-like homeodomain protein 7         242   2e-69    
ref|XP_006416473.1|  hypothetical protein EUTSA_v10007267mg             239   1e-68    
ref|XP_010110017.1|  BEL1-like homeodomain protein 6                    239   1e-68    
gb|KDO84668.1|  hypothetical protein CISIN_1g005863mg                   237   1e-68    
gb|AFW65587.1|  putative POX domain/homeobox DNA-binding domain f...    241   2e-68    
ref|XP_008377278.1|  PREDICTED: BEL1-like homeodomain protein 6 i...    241   2e-68    
emb|CDY29411.1|  BnaA06g13850D                                          232   9e-68    
emb|CDY39359.1|  BnaC05g15280D                                          235   2e-67    
ref|XP_009149453.1|  PREDICTED: BEL1-like homeodomain protein 10        234   4e-67    
gb|EMS58079.1|  BEL1-like homeodomain protein 1                         231   4e-67    
emb|CBI19760.3|  unnamed protein product                                231   1e-65    
emb|CDX96653.1|  BnaA08g21960D                                          230   1e-65    
emb|CDX84171.1|  BnaC04g09330D                                          232   1e-65    
dbj|BAJ04686.1|  BEL1-type homeodomain protein                          235   1e-65    
dbj|BAJ04685.1|  BEL1-type homeodomain protein                          235   1e-65    
emb|CAC82981.1|  putative BEL1-like protein                             236   2e-65    
ref|XP_010230386.1|  PREDICTED: BEL1-like homeodomain protein 4         235   2e-65    
ref|XP_009110262.1|  PREDICTED: BEL1-like homeodomain protein 10        229   2e-65    
dbj|BAJ88032.1|  predicted protein                                      234   3e-65    
gb|AAK38645.1|AF334758_1  homeodomain protein JUBEL1                    234   4e-65    
dbj|BAJ04684.1|  BEL1-type homeodomain protein                          234   4e-65    
ref|NP_180290.2|  BEL1-like homeodomain 5                               226   6e-65    
ref|XP_008461100.1|  PREDICTED: BEL1-like homeodomain protein 7         228   1e-64    
gb|AAN03625.1|AF406701_1  BEL1-related homeotic protein 22              230   1e-64    
ref|XP_010473114.1|  PREDICTED: BEL1-like homeodomain protein 5         224   1e-64    
ref|XP_002281021.3|  PREDICTED: BEL1-like homeodomain protein 7         230   2e-64    
ref|XP_009400050.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    231   2e-64    
ref|XP_001779432.1|  predicted protein                                  234   2e-64    
gb|AAM15481.1|  putative homeodomain transcription factor               224   3e-64    
emb|CAN65696.1|  hypothetical protein VITISV_001987                     230   3e-64    
ref|XP_006344823.1|  PREDICTED: BEL1-related homeotic protein 22        230   3e-64    
dbj|BAJ95083.1|  predicted protein                                      231   4e-64    
ref|XP_010510798.1|  PREDICTED: BEL1-like homeodomain protein 5 i...    224   5e-64    
ref|XP_010510795.1|  PREDICTED: BEL1-like homeodomain protein 5 i...    224   5e-64    
gb|KHN42028.1|  BEL1-like homeodomain protein 2                         229   1e-63    
ref|XP_010417873.1|  PREDICTED: BEL1-like homeodomain protein 5         223   1e-63    
ref|XP_003538830.1|  PREDICTED: BEL1-like homeodomain protein 2-like    229   1e-63    
ref|XP_007156875.1|  hypothetical protein PHAVU_002G024800g             229   2e-63    
ref|XP_004136085.1|  PREDICTED: BEL1-like homeodomain protein 3-like    224   3e-63    
ref|XP_002466514.1|  hypothetical protein SORBIDRAFT_01g009130          228   4e-63    
ref|XP_006294234.1|  hypothetical protein CARUB_v10023231mg             221   6e-63    
ref|XP_010255251.1|  PREDICTED: homeobox protein BEL1 homolog           226   8e-63    
ref|XP_004981881.1|  PREDICTED: BEL1-like homeodomain protein 2-l...    227   1e-62    
ref|NP_001148063.1|  homeodomain protein JUBEL1                         227   1e-62    
ref|XP_003611874.1|  BEL1-like homeodomain protein                      226   2e-62    
ref|XP_006408680.1|  hypothetical protein EUTSA_v10002247mg             220   2e-62    
tpg|DAA51178.1|  TPA: putative POX domain/homeobox DNA-binding do...    226   2e-62    
ref|XP_001777380.1|  predicted protein                                  229   2e-62    
gb|KHN35035.1|  Homeobox protein BEL1 like                              224   3e-62    
ref|XP_003538310.1|  PREDICTED: homeobox protein BEL1 homolog iso...    224   3e-62    
ref|XP_006651784.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...    224   6e-62    
ref|XP_009411323.1|  PREDICTED: BEL1-like homeodomain protein 4         224   7e-62    
gb|AAN03623.1|AF406699_1  BEL1-related homeotic protein 13              221   7e-62    
ref|XP_003517476.1|  PREDICTED: homeobox protein BEL1 homolog iso...    223   8e-62    
ref|XP_008813264.1|  PREDICTED: BEL1-like homeodomain protein 4         224   1e-61    
gb|KDO76309.1|  hypothetical protein CISIN_1g005058mg                   222   1e-61    
ref|XP_009419344.1|  PREDICTED: BEL1-like homeodomain protein 4         223   1e-61    
ref|XP_002281889.1|  PREDICTED: BEL1-like homeodomain protein 4         223   1e-61    
ref|XP_010275694.1|  PREDICTED: homeobox protein BEL1 homolog           223   1e-61    
gb|KEH21114.1|  BEL1-related homeotic protein                           221   2e-61    
gb|KDO76305.1|  hypothetical protein CISIN_1g005058mg                   222   2e-61    
ref|XP_006439494.1|  hypothetical protein CICLE_v10019130mg             222   2e-61    
gb|ABF98709.1|  homeodomain protein JUBEL1, putative, expressed         223   2e-61    
gb|EYU23458.1|  hypothetical protein MIMGU_mgv1a002357mg                222   3e-61    
ref|XP_002880897.1|  predicted protein                                  216   3e-61    
ref|XP_010254984.1|  PREDICTED: BEL1-like homeodomain protein 4         223   3e-61    
emb|CBI34373.3|  unnamed protein product                                216   4e-61    
ref|XP_004300584.1|  PREDICTED: BEL1-like homeodomain protein 4-like    223   4e-61    
ref|XP_006476516.1|  PREDICTED: homeobox protein BEL1 homolog           222   4e-61    
gb|KDO76303.1|  hypothetical protein CISIN_1g005058mg                   222   4e-61    
emb|CDY46209.1|  BnaA07g03610D                                          214   5e-61    
ref|XP_009140780.1|  PREDICTED: BEL1-like homeodomain protein 5         216   5e-61    
ref|XP_006574714.1|  PREDICTED: BEL1-like homeodomain protein 2-like    222   5e-61    
ref|NP_001189615.1|  BEL1-like homeodomain 5                            216   5e-61    
ref|XP_008778978.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    222   6e-61    
gb|EPS58139.1|  hypothetical protein M569_16677                         216   6e-61    
ref|XP_006425771.1|  hypothetical protein CICLE_v10024897mg             223   6e-61    
ref|XP_004503684.1|  PREDICTED: homeobox protein BEL1 homolog           219   7e-61    
emb|CDY30566.1|  BnaA04g15670D                                          216   7e-61    
ref|XP_008344278.1|  PREDICTED: BEL1-like homeodomain protein 2         222   7e-61    
gb|AAF43095.1|AF053769_1  homeodomain protein                           222   7e-61    
ref|XP_002310774.2|  hypothetical protein POPTR_0007s12170g             222   9e-61    
ref|XP_010029855.1|  PREDICTED: BEL1-like homeodomain protein 4         222   1e-60    
ref|XP_009396457.1|  PREDICTED: BEL1-like homeodomain protein 4         221   1e-60    
emb|CDX77099.1|  BnaC04g38940D                                          215   1e-60    
gb|EPS62339.1|  hypothetical protein M569_12452                         214   1e-60    
gb|ACA61780.1|  BIPINNATA                                               220   2e-60    
ref|XP_007158519.1|  hypothetical protein PHAVU_002G159000g             219   2e-60    
ref|XP_011025689.1|  PREDICTED: BEL1-like homeodomain protein 4         221   2e-60    
ref|XP_007160096.1|  hypothetical protein PHAVU_002G292000g             219   2e-60    
gb|AET04003.2|  BEL1-related homeotic protein                           221   2e-60    
ref|XP_006338267.1|  PREDICTED: BEL1-related homeotic protein 13 ...    220   2e-60    
ref|XP_004232087.1|  PREDICTED: BEL1-like homeodomain protein 2         220   3e-60    
ref|XP_011074481.1|  PREDICTED: BEL1-like homeodomain protein 4         218   3e-60    
ref|XP_006599397.1|  PREDICTED: BEL1-like homeodomain protein 2-like    220   3e-60    
gb|ACN33324.1|  unknown                                                 213   3e-60    
ref|XP_010938938.1|  PREDICTED: LOW QUALITY PROTEIN: BEL1-like ho...    219   4e-60    
ref|XP_009389789.1|  PREDICTED: homeobox protein BEL1 homolog           217   5e-60    
ref|XP_008241607.1|  PREDICTED: BEL1-like homeodomain protein 4         220   6e-60    
ref|XP_007204284.1|  hypothetical protein PRUPE_ppa001286mg             220   6e-60    
ref|XP_002279230.2|  PREDICTED: homeobox protein BEL1 homolog           218   7e-60    
gb|KDP31824.1|  hypothetical protein JCGZ_12285                         219   7e-60    
ref|XP_009379163.1|  PREDICTED: BEL1-like homeodomain protein 2         219   7e-60    
ref|XP_011029331.1|  PREDICTED: homeobox protein BEL1 homolog           218   7e-60    
ref|XP_007156003.1|  hypothetical protein PHAVU_003G250500g             219   8e-60    
ref|XP_006366455.1|  PREDICTED: BEL1-like homeodomain protein 4-like    217   8e-60    
ref|XP_010053224.1|  PREDICTED: homeobox protein BEL1 homolog           218   9e-60    
ref|XP_009614985.1|  PREDICTED: BEL1-like homeodomain protein 4         217   1e-59    
ref|XP_008787379.1|  PREDICTED: BEL1-like homeodomain protein 9         218   1e-59    
ref|XP_007047070.1|  BEL1-like homeodomain protein 2 isoform 1          219   1e-59    
ref|XP_009395654.1|  PREDICTED: BEL1-like homeodomain protein 4         218   1e-59    
ref|XP_004148064.1|  PREDICTED: uncharacterized protein LOC101212977    217   1e-59    
ref|XP_009376500.1|  PREDICTED: BEL1-like homeodomain protein 2         218   1e-59    
ref|XP_010243287.1|  PREDICTED: BEL1-like homeodomain protein 2         219   1e-59    
ref|XP_010543869.1|  PREDICTED: BEL1-like homeodomain protein 1 i...    215   1e-59    
ref|XP_007040322.1|  POX family protein isoform 1                       217   2e-59    
ref|XP_009773433.1|  PREDICTED: BEL1-like homeodomain protein 4         217   2e-59    
gb|KGN62029.1|  hypothetical protein Csa_2G287110                       216   2e-59    
ref|XP_009376501.1|  PREDICTED: BEL1-like homeodomain protein 4         218   2e-59    
gb|EPS62050.1|  hypothetical protein M569_12744                         204   2e-59    
gb|AIB05777.1|  HB transcription factor                                 213   3e-59    
ref|XP_011085539.1|  PREDICTED: BEL1-like homeodomain protein 4         217   3e-59    
ref|XP_009800804.1|  PREDICTED: homeobox protein BEL1 homolog           216   4e-59    
ref|XP_006385769.1|  hypothetical protein POPTR_0003s13120g             216   4e-59    
ref|XP_010262659.1|  PREDICTED: BEL1-like homeodomain protein 9         215   5e-59    
ref|XP_008457795.1|  PREDICTED: BEL1-like homeodomain protein 4         216   5e-59    
ref|XP_009604673.1|  PREDICTED: homeobox protein BEL1 homolog           215   5e-59    
ref|XP_006293804.1|  hypothetical protein CARUB_v10022787mg             215   6e-59    
ref|XP_011022632.1|  PREDICTED: homeobox protein BEL1 homolog           215   8e-59    
ref|XP_004238216.1|  PREDICTED: BEL1-like homeodomain protein 4         215   9e-59    
ref|XP_004233410.1|  PREDICTED: BEL1-like homeodomain protein 2         214   9e-59    
ref|XP_010941166.1|  PREDICTED: homeobox protein BEL1 homolog           213   9e-59    
ref|XP_004509227.1|  PREDICTED: BEL1-like homeodomain protein 2-like    216   1e-58    
ref|NP_001140899.1|  putative POX domain/homeobox DNA-binding dom...    211   1e-58    
ref|XP_003532909.1|  PREDICTED: homeobox protein BEL1 homolog iso...    214   1e-58    
ref|XP_004964302.1|  PREDICTED: homeobox protein BEL1 homolog iso...    211   1e-58    
gb|KEH36203.1|  BEL1-related homeotic protein                           207   1e-58    
ref|XP_009629330.1|  PREDICTED: BEL1-like homeodomain protein 4         216   2e-58    
ref|XP_002306443.2|  hypothetical protein POPTR_0005s13780g             216   2e-58    
ref|XP_010429329.1|  PREDICTED: BEL1-like homeodomain protein 4 i...    214   2e-58    
ref|XP_008440170.1|  PREDICTED: BEL1-like homeodomain protein 4         214   2e-58    
ref|XP_008238940.1|  PREDICTED: homeobox protein BEL1 homolog           215   2e-58    
ref|XP_002436343.1|  hypothetical protein SORBIDRAFT_10g000800          210   2e-58    
ref|XP_010417119.1|  PREDICTED: BEL1-like homeodomain protein 4         214   2e-58    
ref|XP_010472371.1|  PREDICTED: BEL1-like homeodomain protein 4         213   2e-58    
ref|XP_011009913.1|  PREDICTED: BEL1-like homeodomain protein 4         216   2e-58    
ref|XP_004143976.1|  PREDICTED: homeobox protein BEL1 homolog           212   2e-58    
ref|XP_006404859.1|  hypothetical protein EUTSA_v10000076mg             213   2e-58    
ref|XP_008783445.1|  PREDICTED: homeobox protein BEL1 homolog           213   2e-58    
ref|XP_011080922.1|  PREDICTED: homeobox protein BEL1 homolog           213   2e-58    
ref|XP_010919091.1|  PREDICTED: homeobox protein BEL1 homolog           213   2e-58    
ref|XP_009776283.1|  PREDICTED: BEL1-like homeodomain protein 2         215   2e-58    



>ref|XP_009629592.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009629593.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=730

 Score =   468 bits (1205),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 291/490 (59%), Positives = 330/490 (67%), Gaps = 75/490 (15%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQ-----QAMFLNSGNALHAGGMP  200
             MAMYYQGSSE+Q DGLQTLYLMNPNYIG++DT   Q Q        FLNS  A   G + 
Sbjct  1     MAMYYQGSSEIQADGLQTLYLMNPNYIGYTDTQQQQQQHLQQANMFFLNSATA---GNLA  57

Query  201   HARLP---QSQHFVGVPLPASALGSAQLHDPAR---------------SLWAGLEQAGS-  323
             H  LP    +QHFVGVPLP S       HDP+R                LW+   Q    
Sbjct  58    HGPLPSQAHTQHFVGVPLPTS------FHDPSRPSVHDVSASHHGLLQRLWSSDVQNSGG  111

Query  324   -------GSGGQQIPSAVVS---GGGGTTDFASQLGFHRSVVVSPTAQ-QGlslslsPQQ  470
                          IP+AVVS   GGG TTDFASQLGF R  +VSPT Q QGLSLSLSPQQ
Sbjct  112   GGGGGGRNESQSHIPTAVVSPNSGGGTTTDFASQLGFQRPGLVSPTQQHQGLSLSLSPQQ  171

Query  471   HP-----FRSLPME----SP-----VGLLSA---RPGAAHDNSGASSSSITHGISGFITG  599
                    FRS P++    SP     VG+LS+   R    +++   S +S +   +G I G
Sbjct  172   QQQQQMNFRSFPLDHHEISPHTNHQVGILSSSSPRTNTNNNHIRGSGASSSSFSNGMIVG  231

Query  600   SKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp--ptsggE  773
             SKYLKAAQELLDEVVNV K++K     E   KEK K+    + P           +  GE
Sbjct  232   SKYLKAAQELLDEVVNVGKNIK-----EVGAKEKDKLLDNELMPLSSDVAAAAPTSGSGE  286

Query  774   SSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSA  953
             +S+QK + AELTT QRQ+LQMKKAKL+SM+DEVEQRYRQYHHQMQ+IVASFE+AAG+GSA
Sbjct  287   TSSQKNSVAELTTVQRQELQMKKAKLISMLDEVEQRYRQYHHQMQIIVASFEEAAGIGSA  346

Query  954   RSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-------SRLKFIDHHLPQ  1112
             +SYT LAL+TISKQFRCLK AI  QIKATSKSLGEE+   G       SRL+++DHHL Q
Sbjct  347   KSYTQLALHTISKQFRCLKDAITGQIKATSKSLGEEDISLGGKIEGSSSRLRYVDHHLRQ  406

Query  1113  QRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQ  1292
             QRALQ LGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQ
Sbjct  407   QRALQQLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQ  466

Query  1293  VSNWFINARV  1322
             VSNWFINARV
Sbjct  467   VSNWFINARV  476



>ref|XP_009778869.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009778870.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009778871.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
Length=732

 Score =   468 bits (1203),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 298/491 (61%), Positives = 335/491 (68%), Gaps = 76/491 (15%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQ--------QAMFLNSGNALHAG  191
             MAMYYQGSSE+Q DGLQTLYLMNPNYIG++DT   + Q           FLNSG A   G
Sbjct  1     MAMYYQGSSEIQADGLQTLYLMNPNYIGYTDTQQQEQQQQQHLQQANMFFLNSGTA---G  57

Query  192   GMPHARLP---QSQHFVGVPLPASALGSAQLHDPAR-------------SLWAGLEQAGS  323
              +P  +LP    +QHFVGVPL  S        DP+R              LW+   Q   
Sbjct  58    NLPLGQLPSQAHTQHFVGVPLQTS------FQDPSRPSVHEVSHHGLLQRLWSSNGQNSG  111

Query  324   GSGGQQ----IPSAVVS---GGGGTTDFASQLGFHRSVVVSPTAQ-QGlslslsPQQHP-  476
             GSGG +    IPSAVVS   GGG TTDFASQLGF R  +VSPT Q QGLSLSLSPQQ   
Sbjct  112   GSGGNESQSHIPSAVVSPNSGGGTTTDFASQLGFQRPGLVSPTQQHQGLSLSLSPQQQQQ  171

Query  477   --------FRSLPME----SP-----VGLLSA---RPGAAHDNSGASSSSITHGISGFIT  596
                     FRS P++    SP     VG+LS+   R    +D+   S +S +   +G I 
Sbjct  172   QQQQQMINFRSFPLDHHEISPHNNHQVGILSSSSPRTNTNNDHIRGSGASSSSFSNGMIV  231

Query  597   GSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp--ptsgg  770
             GSKYLKAAQELLDEVVNV K++K     E   KEK K+    + P           +  G
Sbjct  232   GSKYLKAAQELLDEVVNVGKNIK-----EVGAKEKDKLLDNELMPLSSDVAAAAPTSGSG  286

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ESS+QK + AELTT QRQ+LQMKKAKL+SM+DEVEQRYRQYHHQMQ+IVASFE+AAG+GS
Sbjct  287   ESSSQKNSVAELTTVQRQELQMKKAKLISMLDEVEQRYRQYHHQMQIIVASFEEAAGIGS  346

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-------SRLKFIDHHLP  1109
             A+SYT LAL+TISKQFRCLK AI  QIKATSKSLGEEE   G       SRL+F+DHHL 
Sbjct  347   AKSYTQLALHTISKQFRCLKDAITGQIKATSKSLGEEEINLGGKIEGSSSRLRFVDHHLR  406

Query  1110  QQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRS  1289
             QQRALQ LGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRS
Sbjct  407   QQRALQQLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRS  466

Query  1290  QVSNWFINARV  1322
             QVSNWFINARV
Sbjct  467   QVSNWFINARV  477



>ref|XP_006362847.1| PREDICTED: BEL1-like homeodomain protein 1-like [Solanum tuberosum]
Length=706

 Score =   452 bits (1162),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 277/493 (56%), Positives = 312/493 (63%), Gaps = 87/493 (18%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQ------SQQAMFLNSGNALHAGGM  197
             MAMYYQG SE+Q DGLQTLYLMNPNYIG++DT          S    FLNS   + AG  
Sbjct  1     MAMYYQGGSEIQADGLQTLYLMNPNYIGYTDTHHHHQQHQQQSANMFFLNS---VAAGNF  57

Query  198   PHARLPQSQH----FVGVPLPASALGSAQLHDPAR---------------SLWAGLEQ--  314
             PH  LP   H     VGVPLPA         DP R                LW   +Q  
Sbjct  58    PHVSLPLQAHAQGHLVGVPLPAG------FQDPNRPSIPEIPTSHHGLLSRLWTSGDQNT  111

Query  315   -------AGSGSGGQQIPSAVV------SGGGGTTDFASQLGFHRSVVVSPTA--QQGls  449
                             IPS+ V      SGGG TTDFASQLGF R  +VSPT    QGLS
Sbjct  112   PRGGGGGGEGNGSQSHIPSSTVVSPNSGSGGGTTTDFASQLGFQRPGLVSPTQAHHQGLS  171

Query  450   lslsPQQH-PFRS-LPMES--------PVGLLSARP----GAAHDNS---GASSS-SITH  575
             LSLSPQQ   FRS LP++          VG+LS  P    G   +++   GASSS SI++
Sbjct  172   LSLSPQQQMNFRSSLPLDHRDISTTNHQVGILSPSPLPSPGTNTNHTRGLGASSSFSISN  231

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             G+   I GSKYLK AQ+LLDEVVNV K++KL         +                   
Sbjct  232   GM---IMGSKYLKVAQDLLDEVVNVGKNIKLSEGGAKEKHK-----------LDNELISL  277

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
              +   ESS+QK    ELTTAQRQ+LQMKKAKL+SM+DEV+QRYRQYHHQMQ+I  SFEQ 
Sbjct  278   ASDDVESSSQKNIVVELTTAQRQELQMKKAKLVSMLDEVDQRYRQYHHQMQMIATSFEQT  337

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGV----RGSRLKFIDHH  1103
              G+GS++SYT LAL+TISKQFRCLK AI  QIK TSK+LGEEE +     GS+LKF+DHH
Sbjct  338   TGIGSSKSYTQLALHTISKQFRCLKDAIFGQIKDTSKTLGEEENIGGKIEGSKLKFVDHH  397

Query  1104  LPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLT  1283
             L QQRALQ LGMMQ NAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLT
Sbjct  398   LRQQRALQQLGMMQTNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLT  457

Query  1284  RSQVSNWFINARV  1322
             RSQVSNWFINARV
Sbjct  458   RSQVSNWFINARV  470



>ref|XP_010313381.1| PREDICTED: BEL1-like homeodomain protein 1 [Solanum lycopersicum]
Length=703

 Score =   445 bits (1145),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 271/482 (56%), Positives = 314/482 (65%), Gaps = 70/482 (15%)
 Frame = +3

Query  42    MYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQA----MFLNSGNALHAGGMPHAR  209
             MYYQG SE+Q DGLQTLYLMNPN+IG++DT      Q     MFL   N++ +G  PH  
Sbjct  1     MYYQGGSEIQADGLQTLYLMNPNFIGYNDTHHHHHHQQQSTNMFL--LNSVASGNFPHVS  58

Query  210   LPQSQH----FVGVPLPASALGS---------AQLHDPARSLWAGLEQA---------GS  323
             LP   H     VGVPLP     S         A  H     LW   +Q+           
Sbjct  59    LPLQAHAQGHLVGVPLPGDFQDSNRPSIQEISASHHGLLSRLWTSGDQSTPRGGGGGGEG  118

Query  324   GSGGQQIPSAVV------SGGGGTTDFASQLGFHRSVVVSPTA--QQGlslslsPQQHPF  479
                   IPS+ V      S GG TTDFASQLGF R  +VSPT    QGLSLSLSPQQ   
Sbjct  119   NGSKSHIPSSTVVSPNSGSVGGTTTDFASQLGFQRPGLVSPTQAHHQGLSLSLSPQQQMN  178

Query  480   --RSLPMES--------PVGLLSARPGAAHDN------SGA-SSSSITHGISGFITGSKY  608
                SLP++          VG+LS+ PG    N      SGA SS SI++G+   I GSKY
Sbjct  179   FGSSLPLDHREISTTNHQVGILSSSPGVNTSNIDHTRGSGALSSFSISNGM---ILGSKY  235

Query  609   LKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQK  788
             LK AQ+LLDEVV+V K++KL     A  K K + +  S+           +   ES+ QK
Sbjct  236   LKVAQDLLDEVVSVGKNIKLSEVGGAKEKHKLENELISL----------ASDDIESNTQK  285

Query  789   TAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTH  968
              +  ELTTAQRQ+LQMKKAKL+SM+DEV+QRYRQYHHQMQ+I  SFEQ  G+GS++SYT 
Sbjct  286   NSGVELTTAQRQELQMKKAKLVSMLDEVDQRYRQYHHQMQMIATSFEQTTGIGSSKSYTQ  345

Query  969   LALNTISKQFRCLKVAIASQIKATSKSLGEEEGV----RGSRLKFIDHHLPQQRALQHLG  1136
             LAL+TISKQFRCLK AI+ QIK T+K+LGEEE +     GS+LKF+DHHL QQRALQ LG
Sbjct  346   LALHTISKQFRCLKDAISGQIKDTNKTLGEEENIGGKIEGSKLKFVDHHLRQQRALQQLG  405

Query  1137  MMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINA  1316
             MMQ NAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINA
Sbjct  406   MMQTNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINA  465

Query  1317  RV  1322
             RV
Sbjct  466   RV  467



>ref|XP_009613053.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=643

 Score =   433 bits (1113),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 262/456 (57%), Positives = 300/456 (66%), Gaps = 57/456 (13%)
 Frame = +3

Query  42    MYYQGSSEV---QGDG-LQTLYLMNPNYI--GFSDTALPQSQQAMFLNSGNALHAGGMPH  203
             MYYQG+S+      DG +QTLYLMNPNYI  G++DT      Q              M H
Sbjct  1     MYYQGTSDNIHQAADGNIQTLYLMNPNYIHQGYTDTQQQHQHQQQI-----------MSH  49

Query  204   ARLPQSQ-HFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSG-----GQQIPSAVV--  359
             A L Q+Q HFVGVPLPA +L           LW      G          Q IPS+ V  
Sbjct  50    APLQQAQQHFVGVPLPAVSLHDQNHAQLIHRLWNQSGGGGGSGNGSHHQSQIIPSSTVVS  109

Query  360   --SGGGGTTDFASQLGFHRSVVVSPTAQQ--------GlslslsPQQHPFRSLPMESPVG  509
               S GG TTD ASQLGF RS+ +SPT QQ        GLSLSLSPQQ   R   +     
Sbjct  110   ATSCGGTTTDLASQLGFQRSITMSPTQQQQQQQQQRGGLSLSLSPQQQQIRFNNI-----  164

Query  510   LLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaa  689
                    +A +  G++ +    GIS  + GSKYLKAAQELLDEVVNV K +K      + 
Sbjct  165   -------SAQNQVGSNINRGLDGISSMVLGSKYLKAAQELLDEVVNVGKCIK-----GSE  212

Query  690   nkekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDE  869
              +++  + KES+ P         + G  SS QK   AELTTAQRQ+ QMKKAKL++M++E
Sbjct  213   LEKEEFINKESILPLASDVNTTNSGGESSSKQKNGVAELTTAQRQEFQMKKAKLVTMLEE  272

Query  870   VEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKS  1049
             VEQRYRQYHHQMQ+IV+SFEQ AG+GSA+SYT LAL+ ISKQFRCLK AI  QIKATSKS
Sbjct  273   VEQRYRQYHHQMQIIVSSFEQVAGIGSAKSYTQLALHAISKQFRCLKDAIVGQIKATSKS  332

Query  1050  LGEEE-----GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLF  1214
             LGEE+      + GSRLKF+DHHL QQRALQ LGMMQPNAWRPQRGLPERAVSVLRAWLF
Sbjct  333   LGEEDQSLGGKIEGSRLKFVDHHLRQQRALQQLGMMQPNAWRPQRGLPERAVSVLRAWLF  392

Query  1215  EHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             EHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV
Sbjct  393   EHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  428



>emb|CDP15553.1| unnamed protein product [Coffea canephora]
Length=725

 Score =   430 bits (1105),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 271/471 (58%), Positives = 308/471 (65%), Gaps = 54/471 (11%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLN--SGNALHAGGMPHAR  209
             MAMYYQG SE+Q DGLQTLYLMNPNY G    A  Q    + LN  +GN ++   +   +
Sbjct  1     MAMYYQGGSEIQADGLQTLYLMNPNYAGGYSDAQQQPANMVILNYATGNTVNLASLASNQ  60

Query  210   LPQSQHFVGVPLPASALGSAQLHD-------PAR--------SLWAGLEQAGSGSGGQQ-  341
              PQ+QH VGVPL  S   +A  H+       P R        SLW  L+  G      Q 
Sbjct  61    QPQTQHLVGVPLQGSLGSAANSHELKHEVSAPGRGGIPHFHPSLWGSLDHTGGAGAASQP  120

Query  342   -IPSAVV---SGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPME----  497
              IPS VV     GGG  D   QLGFHR VV SP  QQGLSLSLS QQ  FRSL  E    
Sbjct  121   NIPSGVVVSNPSGGGAADVTRQLGFHRPVV-SPR-QQGLSLSLSSQQPGFRSLSTEQNIS  178

Query  498   --SPVGLLSARPGAAHDNS----------GASSSSITHGISGFITGSKYLKAAQELLDEV  641
               +PVG+LS R G   DN+           ++ S+  HG+   + GSKYLKAAQ+LLDE+
Sbjct  179   VQTPVGILSPRSG---DNNLRGSGGSSSSVSAVSNGIHGLQSAVFGSKYLKAAQQLLDEL  235

Query  642   VNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQR  821
             VNV K +K D  E+A +K K       M            S    S  K+   ELT AQR
Sbjct  236   VNVGKEIKSDTREKAKDKGK-------MNRESTVHSTGEASHIGQSDTKSGVTELTAAQR  288

Query  822   QDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFR  1001
             Q++QMKKAKL+SM+DEVEQRYRQYHHQMQ++VASFEQAAG+GSA+SYT LAL TISKQFR
Sbjct  289   QEIQMKKAKLVSMLDEVEQRYRQYHHQMQIVVASFEQAAGIGSAKSYTQLALQTISKQFR  348

Query  1002  CLKVAIASQIKATSKSLGEEEGV----RGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQR  1169
             CLK AI+ QIK+ SKSLGEEE +     GSRLKF+D  L QQRALQ LGMMQ N WRPQR
Sbjct  349   CLKDAISGQIKSASKSLGEEESLGGKLEGSRLKFVDQQLRQQRALQQLGMMQNNTWRPQR  408

Query  1170  GLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             GLPERAVSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  409   GLPERAVSVLRAWLFEHFLHPYPKDSDKQMLAKQTGLTRSQVSNWFINARV  459



>ref|XP_009773899.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009773900.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
Length=645

 Score =   426 bits (1096),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 259/452 (57%), Positives = 296/452 (65%), Gaps = 50/452 (11%)
 Frame = +3

Query  42    MYYQGSSEV---QGDG-LQTLYLMNPNYI--GFSDTALPQSQQAMFLNSGNALHAGGMPH  203
             MYYQG+S+      DG +QTLYLMNPNYI  G+S+    Q  Q              + H
Sbjct  1     MYYQGTSDNIHQAADGNIQTLYLMNPNYIHQGYSNDTQQQQHQHQ------HHQQQIIRH  54

Query  204   ARLPQSQ-HFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSG---GQQIPSAVV----  359
             A L Q+Q HFVGVPLPA +L           LW      G        Q IPS+ V    
Sbjct  55    APLQQAQQHFVGVPLPAVSLHDQNHAQLIHRLWNQSGGGGGNGSHHQSQIIPSSTVVSAT  114

Query  360   SGGGGTTDFASQLGFHRSVVVSPTAQQGlslsls----PQQH--PFRSLPMESPVGLLSA  521
             S GG TTD ASQLGF R +++SPT QQ     LS    PQQ    F ++  ++ VG    
Sbjct  115   SCGGSTTDLASQLGFQRPIIMSPTQQQQQQGGLSLSLSPQQQQISFNNISAQNQVG----  170

Query  522   RPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankek  701
                 ++ N G        GIS  + GSKYLKAAQELLDEVVNV K +K      +  ++ 
Sbjct  171   ----SNINRGLD------GISSMVLGSKYLKAAQELLDEVVNVGKCIK-----GSELEKG  215

Query  702   akmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQR  881
               M KES+ P         + G  SS QK   AELTTAQRQ+ QMKKAKL++M++EVEQR
Sbjct  216   ELMNKESILPLASDVNTSNSGGESSSKQKNGVAELTTAQRQEFQMKKAKLVTMLEEVEQR  275

Query  882   YRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEE  1061
             YRQYHHQMQ+IV+SFEQ AG+GSA+SYT LAL+ ISKQFRCLK AI  QIKATSKSLGEE
Sbjct  276   YRQYHHQMQIIVSSFEQVAGIGSAKSYTQLALHAISKQFRCLKDAIVGQIKATSKSLGEE  335

Query  1062  -----EGVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFL  1226
                  E + GSRLKF+DHHL QQRALQ LGMMQPNAWRPQRGLPERAVSVLRAWLFEHFL
Sbjct  336   DQSLGEKIEGSRLKFVDHHLRQQRALQQLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFL  395

Query  1227  HPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             HPYPKDSDKIMLAKQTGLTRSQVSNWFINARV
Sbjct  396   HPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  427



>ref|XP_002275098.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
Length=728

 Score =   416 bits (1070),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 267/469 (57%), Positives = 321/469 (68%), Gaps = 53/469 (11%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSG-NALHAGGMPHARL  212
             MA Y+ GSSE+Q DGLQTLYLMNPNYIG+SDT  P +   +FLN+  N+L+   +P+  L
Sbjct  1     MATYFHGSSEIQADGLQTLYLMNPNYIGYSDTQQPSAANMLFLNATPNSLNPTNLPNMSL  60

Query  213   PQSQHFVGVPLPASALGSAQLHDPARS---------------------LWAGLEQAGSGS  329
              Q+QHFVG+PLP   +GSA   D  RS                     LW   +Q  +G+
Sbjct  61    -QNQHFVGIPLPN--MGSANSDDQNRSSLHAQPEMSSLQGIVPRFHYNLWGSTDQNPTGN  117

Query  330   GGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVG  509
               Q   +   +  GG  D  SQLG  R VV SPT QQGLSLSLSP Q  +RS+P E  + 
Sbjct  118   QPQIPTAVAAASSGGAADVTSQLGLRRQVV-SPT-QQGLSLSLSPHQPTYRSVPGEHDIQ  175

Query  510   LL------SARPGAAHD-----NSGASSSSITHGISGF---ITGSKYLKAAQELLDEVVN  647
             +       +  P +  D      S +++S++++GISG    + GSKYLKAAQ+LLDEV N
Sbjct  176   VQQQPPVQAISPTSGDDMRVSGGSSSTASAVSNGISGMQSVLLGSKYLKAAQQLLDEVAN  235

Query  648   VEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQD  827
             V K +K D+ EE   +EK      +             SGGESSA++   AEL+TAQRQ+
Sbjct  236   VGKGIKTDSGEETKEREKVNTISVA------ASTGEALSGGESSAKR--GAELSTAQRQE  287

Query  828   LQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCL  1007
             LQMKKAKL++M+DEVEQRYRQYH QMQ++V+SFEQAAG GSA+SYT LAL TISKQFRCL
Sbjct  288   LQMKKAKLVNMLDEVEQRYRQYHQQMQIVVSSFEQAAGQGSAKSYTALALQTISKQFRCL  347

Query  1008  KVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGL  1175
             K AI++QIKATS SLGEE+     V GSRL+F+DH L QQRALQ LGM+Q NAWRPQRGL
Sbjct  348   KDAISAQIKATSSSLGEEDCSGGKVEGSRLRFVDHQLRQQRALQQLGMIQHNAWRPQRGL  407

Query  1176  PERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PERAVSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  408   PERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  456



>emb|CAN69527.1| hypothetical protein VITISV_027380 [Vitis vinifera]
Length=728

 Score =   414 bits (1065),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 267/469 (57%), Positives = 320/469 (68%), Gaps = 53/469 (11%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSG-NALHAGGMPHARL  212
             MA Y+ GSSE+Q DGLQTLYLMNPNYIG+SDT  P +   +FLN+  N+L+   +P+  L
Sbjct  1     MATYFHGSSEIQADGLQTLYLMNPNYIGYSDTQQPSAANMLFLNATPNSLNPTNLPNMXL  60

Query  213   PQSQHFVGVPLPASALGSAQLHDPARS---------------------LWAGLEQAGSGS  329
              Q+QHFVG+PLP   +GSA   D  RS                     LW   +Q  +G+
Sbjct  61    -QNQHFVGIPLPN--MGSANSDDQNRSXLHAQPEMSSLQGIVPRFHYNLWGSTDQNPTGN  117

Query  330   GGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVG  509
               Q   +   +  GG  D  SQLG  R VV SPT QQGLSLSLSP Q  +RS+P E  + 
Sbjct  118   QPQIPTAVAAASSGGAADVTSQLGLRRQVV-SPT-QQGLSLSLSPHQPTYRSVPGEHDIQ  175

Query  510   LL------SARPGAAHD-----NSGASSSSITHGISGF---ITGSKYLKAAQELLDEVVN  647
             +       +  P +  D      S +++S++++GISG    + GSKYLKAAQ LLDEV N
Sbjct  176   VQQQPPVQAISPTSGDDMRVSGGSSSTASAVSNGISGMQSVLLGSKYLKAAQLLLDEVAN  235

Query  648   VEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQD  827
             V K +K D+ EE   +EK      +             SGGESSA++   AEL+TAQRQ+
Sbjct  236   VGKGIKTDSGEETKEREKVNTISVA------ASTGEALSGGESSAKR--GAELSTAQRQE  287

Query  828   LQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCL  1007
             LQMKKAKL++M+DEVEQRYRQYH QMQ++V+SFEQAAG GSA+SYT LAL TISKQFRCL
Sbjct  288   LQMKKAKLVNMLDEVEQRYRQYHQQMQIVVSSFEQAAGQGSAKSYTALALQTISKQFRCL  347

Query  1008  KVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGL  1175
             K AI++QIKATS SLGEE+     V GSRL+F+DH L QQRALQ LGM+Q NAWRPQRGL
Sbjct  348   KDAISAQIKATSSSLGEEDCSGGKVEGSRLRFVDHQLRQQRALQQLGMIQHNAWRPQRGL  407

Query  1176  PERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PERAVSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  408   PERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  456



>gb|ACD39468.1| BEL5 protein [Solanum etuberosum]
Length=698

 Score =   413 bits (1061),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 258/469 (55%), Positives = 304/469 (65%), Gaps = 54/469 (12%)
 Frame = +3

Query  42    MYYQGSSE--VQGD------------GLQTLYLMNPN-YI-GFSDTALPQSQQA------  155
             MYYQG+S+  +Q D             +QTLYLMNPN Y+ G++ T   Q Q        
Sbjct  1     MYYQGTSDNNIQADHQQHHNHGNSNNNIQTLYLMNPNSYMQGYTTTDTQQHQNQNQHQQQ  60

Query  156   -MFLNSG----NALHAGGMPHARLPQSQHFVGVPLPASAL-GSAQLHDPARSLWAGLEQA  317
              +FLNS     NAL    +PHA L Q QHFVGVPLPA +L      H   + +W   +Q+
Sbjct  61    LLFLNSSPAGSNALGHANIPHAPL-QQQHFVGVPLPAVSLHDQINHHGLLQRMWNNQDQS  119

Query  318   GSGSGGQQI--PSAVV----SGGGGTTDFASQLGFHRSVVVSPTAQ-QGlslslsPQQHP  476
                   QQ+  PS+ V    S GG TTD ASQL F R +VVSPT Q +            
Sbjct  120   ------QQVIVPSSTVVSATSCGGTTTDLASQLAFQRPIVVSPTPQHRQQQQQQGGLSLS  173

Query  477   FRSLPMESPVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVN-VE  653
                   +      +    +   N+     ++    S  + GSKYLKAAQELLDEVVN V 
Sbjct  174   LSPQQQQQISFNNNISSSSPRTNNVTIRGTLDGSSSNMVLGSKYLKAAQELLDEVVNIVG  233

Query  654   KSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKT--AAAELTTAQRQD  827
             KS+K D  ++  +  K      SMP       +    GGESS+++    A ELTTAQRQ+
Sbjct  234   KSIKGDDQKKENSMNKE-----SMPLASDVNTNSSGGGGESSSRQKNEVAVELTTAQRQE  288

Query  828   LQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCL  1007
             LQMKKAKLL+M++EVEQRYRQYHHQMQ+IV+SFEQ AG+GSA+SYT LAL+ ISKQFRCL
Sbjct  289   LQMKKAKLLAMLEEVEQRYRQYHHQMQIIVSSFEQVAGIGSAKSYTQLALHAISKQFRCL  348

Query  1008  KVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGL  1175
             K AIA Q+KATSKSLGEEEG    + GSRLKF+D+HL QQRALQ LGMMQPNAWRPQRGL
Sbjct  349   KDAIAEQVKATSKSLGEEEGLGGKIEGSRLKFVDNHLRQQRALQQLGMMQPNAWRPQRGL  408

Query  1176  PERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV
Sbjct  409   PERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  457



>gb|ACD39464.1| BEL5 protein [Solanum palustre]
Length=698

 Score =   410 bits (1055),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 257/469 (55%), Positives = 303/469 (65%), Gaps = 54/469 (12%)
 Frame = +3

Query  42    MYYQGSSE--VQGD------------GLQTLYLMNPN-YI-GFSDTALPQSQQA------  155
             MYYQG+S+  +Q D             +QTLYLMNPN Y+ G++ T   Q Q        
Sbjct  1     MYYQGTSDNNIQADHQRHHNHGNSNNNIQTLYLMNPNSYMQGYTTTDTQQHQNQNQHQQQ  60

Query  156   -MFLNSG----NALHAGGMPHARLPQSQHFVGVPLPASAL-GSAQLHDPARSLWAGLEQA  317
              +FLNS     NAL    +PHA L Q QHFVGVPLPA +L      H   + +W   +Q+
Sbjct  61    LLFLNSSPAGSNALGHANIPHAPL-QQQHFVGVPLPAVSLHDQINHHGLLQRMWNNQDQS  119

Query  318   GSGSGGQQI--PSAVV----SGGGGTTDFASQLGFHRSVVVSPTAQ-QGlslslsPQQHP  476
                   QQ+  PS+ V    S GG TTD ASQL F R +VVSPT Q +            
Sbjct  120   ------QQVIVPSSTVVSATSCGGTTTDLASQLAFQRPIVVSPTPQHRQQQQQQGGLSLS  173

Query  477   FRSLPMESPVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVN-VE  653
                   +      +    +   N+     ++    S  + GSKYLKAAQELLDEVVN V 
Sbjct  174   LSPQQQQQISFNNNISSSSPRTNNVTIRGTLDGSSSNMVLGSKYLKAAQELLDEVVNIVG  233

Query  654   KSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKT--AAAELTTAQRQD  827
             KS+K D  ++  +  K      SMP       +    GGESS+++    A ELTTAQRQ+
Sbjct  234   KSIKGDDQKKENSMNKE-----SMPLASDVNTNSSGGGGESSSRQKNEVAVELTTAQRQE  288

Query  828   LQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCL  1007
             LQMKKAKLL+M++EVEQRYRQYHHQMQ+IV+SFEQ AG+GSA+SY  LAL+ ISKQFRCL
Sbjct  289   LQMKKAKLLAMLEEVEQRYRQYHHQMQIIVSSFEQVAGIGSAKSYAQLALHAISKQFRCL  348

Query  1008  KVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGL  1175
             K AIA Q+KATSKSLGEEEG    + GSRLKF+D+HL QQRALQ LGMMQPNAWRPQRGL
Sbjct  349   KDAIAEQVKATSKSLGEEEGLGGKIEGSRLKFVDNHLRQQRALQQLGMMQPNAWRPQRGL  408

Query  1176  PERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV
Sbjct  409   PERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  457



>ref|NP_001234599.1| bell-like homeodomain protein 2 [Solanum lycopersicum]
 ref|XP_010322314.1| PREDICTED: bell-like homeodomain protein 2 isoform X1 [Solanum 
lycopersicum]
 gb|AAP47025.1|AF375966_1 bell-like homeodomain protein 2 [Solanum lycopersicum]
Length=699

 Score =   409 bits (1050),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 253/469 (54%), Positives = 295/469 (63%), Gaps = 51/469 (11%)
 Frame = +3

Query  42    MYYQGSSE--VQGD--------------GLQTLYLMNPN-YI-GFSDT-------ALPQS  146
             MYYQG+S+  +Q D               +QTLYLMNPN Y+ G++ T            
Sbjct  1     MYYQGTSDNNIQADHHQQQHNNLGNSNNNIQTLYLMNPNSYMQGYTTTDTQQHLQQQQNQ  60

Query  147   QQAMFLNS----GNALHAGGMPHARLPQSQHFVGVPLPASAL-GSAQLHDPARSLWAGLE  311
              Q +FLNS    GNAL    + HA L Q QHFVGVPLPA +L      H   + +W   +
Sbjct  61    HQLLFLNSAPAGGNALSHANIQHAPL-QQQHFVGVPLPAVSLHDQINHHGLLQRMWNNQD  119

Query  312   QAGSGSGGQQI--PSAVV----SGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQH  473
             Q+      QQ+  PS+ V    S GG TTD ASQL F R +VVSPT Q            
Sbjct  120   QS------QQVIVPSSTVVSATSCGGTTTDLASQLAFQRPIVVSPTPQHRQQQQQQGGLS  173

Query  474   PFRSLPMESPVGLLSARPGAAHDNSGASSSSITHGIS-GFITGSKYLKAAQELLDEVVN-  647
                S   +  +   +    ++   +  +      G S   I GSKYLKAAQELLDEVVN 
Sbjct  174   LSLSPQQQQQISFNNNISSSSPRTNNVTIRGTMDGCSSNMILGSKYLKAAQELLDEVVNI  233

Query  648   VEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQD  827
             V KS K D  ++  +  K  +   S                 S  +   A ELTTAQRQ+
Sbjct  234   VGKSNKGDDQKKDNSMNKELIPLVS--DVNTNSSGGGGGESSSRQKNEVAIELTTAQRQE  291

Query  828   LQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCL  1007
             LQMKKAKLL+M++EVEQRYRQYHHQMQ+IV+SFEQ AGVGSA+SYT LAL+ ISKQFRCL
Sbjct  292   LQMKKAKLLAMLEEVEQRYRQYHHQMQIIVSSFEQVAGVGSAKSYTQLALHAISKQFRCL  351

Query  1008  KVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGL  1175
             K AI+ Q+KATSKSLGE+EG    + GSRLKF+DHHL QQRALQ LGMMQPNAWRPQRGL
Sbjct  352   KDAISEQVKATSKSLGEDEGLGGKIEGSRLKFVDHHLRQQRALQQLGMMQPNAWRPQRGL  411

Query  1176  PERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV
Sbjct  412   PERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  460



>ref|NP_001274921.1| BEL1-related homeotic protein 5 [Solanum tuberosum]
 gb|AAN03621.1|AF406697_1 BEL1-related homeotic protein 5 [Solanum tuberosum]
Length=688

 Score =   406 bits (1043),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 254/463 (55%), Positives = 299/463 (65%), Gaps = 51/463 (11%)
 Frame = +3

Query  42    MYYQGSSE---VQGD-------------GLQTLYLMNPN-YI-GFSDTALPQSQQAMFLN  167
             MYYQG+S+   +Q D              +QTLYLMNPN Y+ G++ +   Q QQ +FLN
Sbjct  1     MYYQGTSDNTNIQADHQQRHNHGNSNNNNIQTLYLMNPNNYMQGYTTSDTQQQQQLLFLN  60

Query  168   SG----NALHAGGMPHARLPQSQHFVGVPLPASAL-GSAQLHDPARSLWAGLEQAGSGSG  332
             S     NAL    + HA L Q QHFVGVPLPA +L      H   + +W   +Q+     
Sbjct  61    SSPAASNALCHANIQHAPL-QQQHFVGVPLPAVSLHDQINHHGLLQRMWNNQDQS-----  114

Query  333   GQQI--PSAV----VSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPM  494
              QQ+  PS+      S GG TTD ASQL F R +   PT Q               S  +
Sbjct  115   -QQVIVPSSTGVSATSCGGITTDLASQLAFQRPI---PTPQHRQQQQQQGGLSLSLSPQL  170

Query  495   ESPVGLLSARPGAA-HDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVN-VEKSLKL  668
             +  +   +    ++   N+     ++    S  + GSKYLKAAQELLDEVVN V KS+K 
Sbjct  171   QQQISFNNNISSSSPRTNNVTIRGTLDGSSSNMVLGSKYLKAAQELLDEVVNIVGKSIKG  230

Query  669   DaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKT-AAAELTTAQRQDLQMKKA  845
             D  ++  +  K      SMP       +    G  SS QK   A ELTTAQRQ+LQMKKA
Sbjct  231   DDQKKDNSMNKE-----SMPLASDVNTNSSGGGESSSRQKNEVAVELTTAQRQELQMKKA  285

Query  846   KLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIAS  1025
             KLL+M++EVEQRYRQYHHQMQ+IV SFEQ AG+GSA+SYT LAL+ ISKQFRCLK AIA 
Sbjct  286   KLLAMLEEVEQRYRQYHHQMQIIVLSFEQVAGIGSAKSYTQLALHAISKQFRCLKDAIAE  345

Query  1026  QIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVS  1193
             Q+KATSKSLGEEEG    + GSRLKF+DHHL QQRALQ +GMMQPNAWRPQRGLPERAVS
Sbjct  346   QVKATSKSLGEEEGLGGKIEGSRLKFVDHHLRQQRALQQIGMMQPNAWRPQRGLPERAVS  405

Query  1194  VLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             VLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV
Sbjct  406   VLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  448



>ref|XP_009404911.1| PREDICTED: BEL1-like homeodomain protein 1 [Musa acuminata subsp. 
malaccensis]
Length=674

 Score =   402 bits (1032),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 243/447 (54%), Positives = 292/447 (65%), Gaps = 42/447 (9%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSG-NALHAGGMPHARL  212
             MA Y+ G+ E+Q DGLQTLYLMNP+Y+G+SD A P +   + LNS  N+++   +  A  
Sbjct  1     MATYFHGAPEIQPDGLQTLYLMNPSYVGYSDAAAPANM--VLLNSTLNSMNPINLAQASQ  58

Query  213   P---QSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSA-----VVSGG  368
             P   Q Q FVG+PL  +A        P       L  A  G     IP         +  
Sbjct  59    PNHHQQQQFVGIPLQTAAQPHESYRPPPIHAPHDLSAAVQG----LIPRLHYNLWTPATS  114

Query  369   GGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESP--------VGLLSAR  524
                 D ASQ G  R   V P+AQQGLSLSLSP        P  +P        V   S  
Sbjct  115   SNPVDMASQFGPRRPSAV-PSAQQGLSLSLSPHDM-VAPAPEITPASANGATTVASASMM  172

Query  525   PGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankeka  704
             PGAA+  SG+ S         F+ GSKYLKAAQ+LLDEVVNVEK +K + A+ A +K+ A
Sbjct  173   PGAANGASGSQS---------FLMGSKYLKAAQQLLDEVVNVEKGIKSEPAKGATSKDPA  223

Query  705   kmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRY  884
                   +               + ++++   A+LTTA+RQ+LQMKKAKL++M+DEVEQRY
Sbjct  224   DSSNAEL-------KCLGAGATDDNSKEKQVADLTTAERQELQMKKAKLINMLDEVEQRY  276

Query  885   RQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE  1064
             RQYHHQMQ++++SFE  AG GSAR+YT LAL TISKQFRCL+ AI  QI+ATSKSLGEEE
Sbjct  277   RQYHHQMQIVISSFEAVAGYGSARTYTALALRTISKQFRCLRDAITGQIQATSKSLGEEE  336

Query  1065  GVR-GSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPK  1241
                 GSRL+FIDHHL QQRALQ LGM+QPNAWRPQRGLPER+VSVLRAWLFEHFLHPYPK
Sbjct  337   SKSGGSRLRFIDHHLRQQRALQQLGMIQPNAWRPQRGLPERSVSVLRAWLFEHFLHPYPK  396

Query  1242  DSDKIMLAKQTGLTRSQVSNWFINARV  1322
             DSDK+MLAKQTGLTRSQVSNWFINARV
Sbjct  397   DSDKMMLAKQTGLTRSQVSNWFINARV  423



>ref|XP_006361091.1| PREDICTED: BEL1-related homeotic protein 5 [Solanum tuberosum]
Length=684

 Score =   402 bits (1032),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 253/465 (54%), Positives = 294/465 (63%), Gaps = 56/465 (12%)
 Frame = +3

Query  42    MYYQGSSE--VQGD--------------GLQTLYLMNPN-YI-GFSDTALPQSQQAMFLN  167
             MYYQG+S+  +Q D               +QTLYLMNPN Y+ G++ +   Q QQ +FLN
Sbjct  1     MYYQGTSDNNIQADHQQHHNHGNSSNNNNIQTLYLMNPNNYMQGYTTSDTQQQQQLLFLN  60

Query  168   SG----NALHAGGMPHARLPQSQHFVGVPLPASAL-GSAQLHDPARSLWAGLEQAGSGSG  332
             S     NAL    + HA L Q QHFVGVPLPA +L      H   + +W   +Q+     
Sbjct  61    SSPAGSNALCHANIQHAPL-QQQHFVGVPLPAVSLHDQINHHGLLQRMWNNQDQS-----  114

Query  333   GQQI--PSAV----VSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPM  494
              QQ+  PS+      S GG TTD ASQL F R +  +P  +Q                  
Sbjct  115   -QQVIVPSSTGVSATSCGGITTDLASQLAFQRPIP-TPQHRQQQQQQQGGLSLSLSPQQQ  172

Query  495   ESPVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVN-VEKSLKLD  671
             +      +    +   N+     ++    S  + GSKYLKAAQELLDEVVN V KS+K D
Sbjct  173   QQISFNNNISSSSPRTNNVTIRGTLDGSSSNMVLGSKYLKAAQELLDEVVNIVGKSIKGD  232

Query  672   aaeeaankekakmkkeSMP---PFggcggdpptsggESSAQKTAAA-ELTTAQRQDLQMK  839
                        + K  SMP               G  SS QK   A ELTTAQRQ+LQMK
Sbjct  233   ----------DQKKDNSMPLASDVNTNSSGGGGGGESSSRQKNEVAIELTTAQRQELQMK  282

Query  840   KAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAI  1019
             KAKLL+M++EVEQRYRQYHHQMQ+IV+SFEQ AG+GSA+SYT LAL+ ISKQFRCLK AI
Sbjct  283   KAKLLAMLEEVEQRYRQYHHQMQIIVSSFEQVAGIGSAKSYTQLALHAISKQFRCLKDAI  342

Query  1020  ASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERA  1187
             A Q+KATSKSLGEEEG    + GSRLKF+DHHL QQRALQ LGMMQPNAWRPQRGLPERA
Sbjct  343   AEQVKATSKSLGEEEGLVGKIEGSRLKFVDHHLRQQRALQQLGMMQPNAWRPQRGLPERA  402

Query  1188  VSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             VSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV
Sbjct  403   VSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  447



>ref|XP_008799712.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008799713.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
Length=673

 Score =   396 bits (1017),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 233/436 (53%), Positives = 294/436 (67%), Gaps = 23/436 (5%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSG-NALHAGGMPH---  203
             MA Y+ G+ E Q DGLQTLYLMNPNY+G+SDTA P +   + LNS  N+L+   + H   
Sbjct  1     MATYFHGAPEFQADGLQTLYLMNPNYVGYSDTAAPANM--ILLNSAMNSLNPVNLGHCAA  58

Query  204   -ARLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSAVVSGGGGTT  380
              A+  Q QH  G+P P   + S   H+  R  +      GS                 +T
Sbjct  59    MAQPNQQQHLAGIP-PQPTVAS---HESNRLSFIQASHDGSAIPLLHYDLWTPMAPNNST  114

Query  381   DFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARP-GAAHDNSGAS  557
             D ASQLG  R+  V P  QQGLSLSLS Q+     +P  +  G   A+  G++    G +
Sbjct  115   DMASQLGPRRTSAVPPQPQQGLSLSLSSQEM-VAPVPEITLAGTEEAKILGSSSSAPGVA  173

Query  558   SSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFg  737
             +++++ G+  F+ GSKYLKAAQ+LLDEVVNV + ++ D+ +   +K   K  +ES     
Sbjct  174   NAAVS-GLQSFLMGSKYLKAAQQLLDEVVNVGQGIRGDSTKGTNSKSPTKSNRES-----  227

Query  738   gcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIV  917
                    T  GE        A+LTTA+RQ+ QMKKAKL++M++EVEQRYRQYHHQMQ++V
Sbjct  228   ---EATGTGTGEEDKNTKRGADLTTAERQEFQMKKAKLVNMLEEVEQRYRQYHHQMQIVV  284

Query  918   ASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-SRLKFI  1094
             +SFEQ AG+GSAR+YT LAL TISKQFRCL+ AI  QI+A S+SLGEE+   G SRL+F+
Sbjct  285   SSFEQVAGIGSARTYTALALQTISKQFRCLRDAITGQIQAASRSLGEEDSKSGGSRLRFV  344

Query  1095  DHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQT  1274
             DHHL QQRALQ LGM+Q NAWRPQRGLPER+VS+LRAWLFEHFLHPYPKDSDK++LAKQT
Sbjct  345   DHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSILRAWLFEHFLHPYPKDSDKLVLAKQT  404

Query  1275  GLTRSQVSNWFINARV  1322
             GLTRSQVSNWFINARV
Sbjct  405   GLTRSQVSNWFINARV  420



>ref|XP_010931060.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
 ref|XP_010931061.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
Length=621

 Score =   387 bits (995),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 235/449 (52%), Positives = 292/449 (65%), Gaps = 56/449 (12%)
 Frame = +3

Query  36    MAMYYQGS-SEVQGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGNALHAGGMPH---  203
             MA Y+ G+ +E Q DGLQTLYLMNPNY  +SDTA+P +   + LNS N+L+   + H   
Sbjct  1     MATYFHGAPAEFQADGLQTLYLMNPNYAAYSDTAVPANM--ILLNSVNSLNPTNLGHCAA  58

Query  204   -ARLPQSQHFVGVPL--PASALGSAQL------HDPA------RSLWAGLEQAGSGSGGQ  338
              A+  Q QHF G+PL  P +A  S +L      HD +       +LW             
Sbjct  59    TAQPNQHQHFAGIPLQPPVAAHESNRLPSIQPSHDVSADPRLHYNLWT------------  106

Query  339   QIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLS  518
               P+A       + D ASQLG  R+    P  QQGLSLSLSPQ+            G   
Sbjct  107   --PTAP----NNSIDMASQLGPRRTSTAPPQPQQGLSLSLSPQEITL--------AGTEE  152

Query  519   ARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaanke  698
             A+   +  ++ +  S+    +  F+ GSKYLKAAQ+LLDE V+V + +K D+ +   +K 
Sbjct  153   AKILGSSSSAPSGVSNAVSVLQSFLIGSKYLKAAQQLLDEAVHVGQGIKGDSMKGTNSKS  212

Query  699   kakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQ  878
               K  +ES            T   E        A+LTTA+RQ+LQMKKAKL++M++EVEQ
Sbjct  213   PTKSNRES--------EGTGTGTAEEDKSTKREADLTTAERQELQMKKAKLVNMLEEVEQ  264

Query  879   RYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGE  1058
             RYRQYHHQMQ++V+SFEQ AG+GSAR+YT LAL TISKQFRCL+ AI  QI+ATS+SLGE
Sbjct  265   RYRQYHHQMQIVVSSFEQVAGIGSARTYTALALQTISKQFRCLRDAITGQIQATSRSLGE  324

Query  1059  EEGVR-GSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPY  1235
             E+    GSRL+ +DHHL QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPY
Sbjct  325   EDTKSGGSRLRLVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPY  384

Query  1236  PKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PKDSDK+MLAKQTGLTRSQVSNWFINARV
Sbjct  385   PKDSDKLMLAKQTGLTRSQVSNWFINARV  413



>ref|XP_007027982.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007027983.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 ref|XP_007027984.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08484.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08485.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
 gb|EOY08486.1| BEL1-like homeodomain protein 1 isoform 1 [Theobroma cacao]
Length=668

 Score =   388 bits (997),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 242/441 (55%), Positives = 286/441 (65%), Gaps = 46/441 (10%)
 Frame = +3

Query  36    MAMYYQGSSEVQG-DGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGNALHAGGMPHARL  212
             MA Y+ G+ E+Q  DGLQTL LMNP Y+ +SDTA P +   +FLNS N+L     PHA  
Sbjct  1     MATYFHGNPEIQAPDGLQTLVLMNPAYVQYSDTAPPPANNLVFLNS-NSLS----PHAPS  55

Query  213   PQSQHFVGVPLPASALGSAQLHDPAR---SLWAGLEQAGSGSGGQQI-PSAVVSGGGGTT  380
             P +Q FVG+PLPA+   S+   DP+    S   GL Q    +    I PS      GG  
Sbjct  56    PHTQQFVGIPLPAT---SSANQDPSSHDISPLHGLVQRVHYNLYNSIDPS------GGAR  106

Query  381   DFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAHDNSGASS  560
             D             +P AQQGLSLSLS QQHP       S    +S         S +S 
Sbjct  107   D-------------TPRAQQGLSLSLSSQQHPGYG----SQAQAVSGEDMRVSGGSASSG  149

Query  561   SSITHGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPP  731
             S +T+G+SG    +  SKYLKAAQELLDEVVNV  +      +    K+ +     S   
Sbjct  150   SGVTNGVSGMQSVLLSSKYLKAAQELLDEVVNVNNT---GITKSELAKKGSGNNNNSSKA  206

Query  732   FggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQV  911
              G          G   A     AELTTA+RQ++QMKKAKL+SM+DEV+ RYRQYHHQMQ+
Sbjct  207   VGESLAVAGDGSGGGEAGGKRGAELTTAERQEIQMKKAKLISMLDEVDHRYRQYHHQMQI  266

Query  912   IVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGS  1079
             I++SFEQAAG+GSA++YT LAL TISKQFRCLK AI  QI+A +KSLGEE+     + GS
Sbjct  267   IISSFEQAAGIGSAKTYTALALKTISKQFRCLKDAITGQIRAANKSLGEEDCLGGKIEGS  326

Query  1080  RLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIM  1259
             RLKF+DHHL QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK M
Sbjct  327   RLKFVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHM  386

Query  1260  LAKQTGLTRSQVSNWFINARV  1322
             LAKQTGLTRSQVSNWFINARV
Sbjct  387   LAKQTGLTRSQVSNWFINARV  407



>ref|XP_009420594.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
1 [Musa acuminata subsp. malaccensis]
Length=669

 Score =   386 bits (992),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 236/438 (54%), Positives = 296/438 (68%), Gaps = 29/438 (7%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSG-NALHAGGMPHARL  212
             MA Y+ G+ E+Q DGLQTLYLMNP+Y+G++D A P +   +FLNS  N++++  +  A+ 
Sbjct  1     MATYFHGAPEIQPDGLQTLYLMNPSYVGYTDAAAPANM--VFLNSTMNSVNSINL--AQT  56

Query  213   PQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSA-----VVSGGGGT  377
              Q QHFVG+PL ++A    Q HD  RS             G  +P +       +     
Sbjct  57    GQQQHFVGIPLQSAA----QPHDSHRSQPIHASHDVPAVQGL-LPRSHYNLWTTATSSNP  111

Query  378   TDFASQLGFHRSVVVSPTAQQGlslslsPQQH--PFRSLPMESPVGLLSARPGAAHDNSG  551
              D ASQ G  R+   +P+AQQGLSLSLSP +   P + +   S    +     A+  +  
Sbjct  112   VDMASQFGPWRTST-APSAQQGLSLSLSPHEMVAPAQEITPASAANEVKIAASASMASGA  170

Query  552   ASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPP  731
             A+  S   G+  F+ G+KYLKAAQ+LLDEVVNV K +K +AA+ A  K  A      +  
Sbjct  171   ANGGS---GLQSFLMGTKYLKAAQQLLDEVVNVGKGVKDEAAKGAPLKNPADSSNVEL--  225

Query  732   FggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQV  911
                   DP     E +      A+LTTA+RQ+LQMKKAKL++M++EVEQRYRQYHHQMQ+
Sbjct  226   -----KDPGAGTSEGNTSAKRGADLTTAERQELQMKKAKLINMLEEVEQRYRQYHHQMQI  280

Query  912   IVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-SRLK  1088
             +V+SFE  AG GSAR+YT LAL TISKQFRCL+ AI +QI+ TSKSLGEE+   G SRL+
Sbjct  281   VVSSFEAVAGYGSARTYTALALRTISKQFRCLRDAITAQIRETSKSLGEEDSKSGGSRLR  340

Query  1089  FIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAK  1268
             FIDHHL QQRALQ LGM+Q NAWRPQRGLPER+VS+LRAWLFEHFLHPYPKDSDK+MLAK
Sbjct  341   FIDHHLRQQRALQQLGMIQQNAWRPQRGLPERSVSILRAWLFEHFLHPYPKDSDKLMLAK  400

Query  1269  QTGLTRSQVSNWFINARV  1322
             QTGLTRSQVSNWFINARV
Sbjct  401   QTGLTRSQVSNWFINARV  418



>ref|XP_008784116.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008784117.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
 ref|XP_008784118.1| PREDICTED: BEL1-like homeodomain protein 1 [Phoenix dactylifera]
Length=660

 Score =   385 bits (988),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 244/443 (55%), Positives = 297/443 (67%), Gaps = 42/443 (9%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGNALHAGGMPHARLP  215
             MA Y+ G+ E+Q DGLQTLYLMNPNY+G+SDTA  Q    + LNS N+L+    P     
Sbjct  1     MATYFHGAPEIQPDGLQTLYLMNPNYVGYSDTAAAQGNMVL-LNSMNSLN----PMNHHQ  55

Query  216   QSQHFVGVPL-PASALGSAQ----LHDPARSLWA--GLEQAGSGSGGQQIPSAVVSGGGG  374
             Q QHFVG+PL P  A   +     +  PA  + A  GL      +     P +       
Sbjct  56    QQQHFVGIPLQPTVASHESNRPQPIQAPAHDVSAIHGLVPRLHCNLWSPTPPS------N  109

Query  375   TTDFASQLGFHR-SVVVSPTAQQGlslslsPQQHPFRSLPMESPV-GLLSARPGAAH---  539
             + D ASQLG  R S +  P  QQGLSLSLSP++       M +PV  +  AR   A    
Sbjct  110   SIDMASQLGPRRPSTMRQP--QQGLSLSLSPRE-------MVAPVPNMTPARTEEAKILG  160

Query  540   -DNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkk  716
               +S +  SS   G+  F+ GSKYLKAAQ+LLDEVVNV + +K ++A+  ++K   K  +
Sbjct  161   SSSSASGISSGVSGLQSFLMGSKYLKAAQQLLDEVVNVGQGIKGESAKGTSSKSPMKGNR  220

Query  717   eSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYH  896
             +S               GE        A+LTTA+RQ+LQMKKAKL++M+DEVEQRYRQYH
Sbjct  221   DS--------EGTAAGTGEEDTSTKRGADLTTAERQELQMKKAKLVNMLDEVEQRYRQYH  272

Query  897   HQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG  1076
             +QMQV+V+SFE  AG GSAR+YT LAL TISKQFRCL+ AIA QI+ATS+SLGEEE   G
Sbjct  273   NQMQVVVSSFEAVAGTGSARTYTALALQTISKQFRCLRDAIAGQIRATSRSLGEEETKSG  332

Query  1077  -SRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK  1253
              SRL+F+DHHL QQRALQ LGM+Q NAWRPQRGLPER+VS+LRAWLFEHFLHPYPKDSDK
Sbjct  333   GSRLRFVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSILRAWLFEHFLHPYPKDSDK  392

Query  1254  IMLAKQTGLTRSQVSNWFINARV  1322
             IMLAKQTGL+RSQVSNWFINARV
Sbjct  393   IMLAKQTGLSRSQVSNWFINARV  415



>ref|XP_010912386.1| PREDICTED: BEL1-like homeodomain protein 1 [Elaeis guineensis]
Length=663

 Score =   384 bits (987),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 240/443 (54%), Positives = 291/443 (66%), Gaps = 43/443 (10%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGNALHAGGMPHARLP  215
             MA Y+ G+ E+Q DGLQTLYLMNPNY+G+SDTA       + LNS N+L+   + H    
Sbjct  1     MATYFHGTPEIQTDGLQTLYLMNPNYVGYSDTAAAAPANMVLLNSMNSLNP--INHQ---  55

Query  216   QSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSA-----VVSGGGGTT  380
             Q QHFVG+PL  +       H+ +R     +    S   G  +P         +    + 
Sbjct  56    QQQHFVGIPLQPTVAS----HESSRPQPIEVPHDVSTVHGL-VPRLHCNLWTPTPASNSI  110

Query  381   DFASQLGFHR-SVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAHDNS---  548
             D ASQLG  R S +  P  QQ LSLSLSP++       M +PV  ++  P +  D     
Sbjct  111   DMASQLGPQRPSTMRQP--QQVLSLSLSPRE-------MVAPVPEIA--PASTEDKKILG  159

Query  549   ----GASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkk  716
                  +  SS   G+  F+ GSKYLKAAQ LLDEVVNV    K D A+   +K   K  +
Sbjct  160   SLSSASGVSSGVSGLQSFLMGSKYLKAAQRLLDEVVNVGLGFKGDPAKGTNSKSPMKSNR  219

Query  717   eSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYH  896
             ES       G        E+S ++   A+LTTA+RQ+LQMKKAKL++M+DEVEQRYRQYH
Sbjct  220   ES------EGTGAGMGEEETSTKR--GADLTTAERQELQMKKAKLVNMLDEVEQRYRQYH  271

Query  897   HQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG  1076
             HQMQ++V SFE  AG+GSAR+YT LAL TISKQFRCL+ AIA QI+ATS+SLGEEE   G
Sbjct  272   HQMQIVVTSFEAVAGIGSARTYTALALQTISKQFRCLRDAIAGQIRATSRSLGEEETKSG  331

Query  1077  S-RLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK  1253
             S RL+ +DHHL QQRALQ LGM+Q NAWRPQRGLPER+VS+LRAWLFEHFLHPYPKDSDK
Sbjct  332   SSRLRLVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSILRAWLFEHFLHPYPKDSDK  391

Query  1254  IMLAKQTGLTRSQVSNWFINARV  1322
             IMLAKQTGLTRSQVSNWFINARV
Sbjct  392   IMLAKQTGLTRSQVSNWFINARV  414



>ref|XP_010247184.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247191.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247201.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247208.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247219.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247226.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010247233.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
Length=729

 Score =   381 bits (979),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 251/476 (53%), Positives = 310/476 (65%), Gaps = 64/476 (13%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNS-GNALHAGGMPHARL  212
             MA Y+ G+SE+Q DGLQTLYLMNP Y+G++DT  P +   +FLNS GN L+   + +A  
Sbjct  1     MATYFHGTSEIQADGLQTLYLMNPGYVGYTDTQPPSNM--VFLNSTGNTLNPASLVNAPQ  58

Query  213   PQSQHFVGVPLPASAL----GSAQLHDPAR---------------------SLWAGLEQA  317
              Q+QH VG+PL A+A+     +A   DP R                     +LW   +  
Sbjct  59    -QNQHLVGIPLQAAAVPPGSAAAAAQDPNRPSVHNQQEMSAVHGFVPRVHYNLWTSTQ--  115

Query  318   GSGSGGQQIPSAV-----VSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFR  482
                    QI ++      V+   G  D +S LG  RSVV  P AQQGLSLSLS QQ  + 
Sbjct  116   AHHHHHHQISTSAAAAAAVNNSIGV-DVSSPLGLRRSVV--PLAQQGLSLSLSSQQPTYG  172

Query  483   S------LPMESPVGLLSA------RPGAAHDNSGASSSSITHGISGFITGSKYLKAAQE  626
             S      LP  +P  ++S       R      +S ++ SS   G+   I GSKYLKAAQ+
Sbjct  173   SYRQESDLPASAPAPVISPTSNNEMRISGGSSSSASAVSSGISGMQSVILGSKYLKAAQQ  232

Query  627   LLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAEL  806
             LLDEVVNV K +K ++A+      K      +            ++GGE+S ++  AAEL
Sbjct  233   LLDEVVNVGKGIKAESAKGVKGSSKISRDPNA-------STGEASTGGENSTKQ--AAEL  283

Query  807   TTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTI  986
             TTA+RQ+LQMKKAKL++M+DEVEQRYRQYHHQMQ++V++FEQAAG GSA++YT LAL TI
Sbjct  284   TTAERQELQMKKAKLINMLDEVEQRYRQYHHQMQIVVSAFEQAAGFGSAKTYTALALQTI  343

Query  987   SKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNA  1154
             SKQFRCLK AI+ QI+ATSKSLGEE+       GSRL+F+D  L QQRALQ LGM+Q NA
Sbjct  344   SKQFRCLKDAISGQIRATSKSLGEEDCFGGKTEGSRLRFVDQQLRQQRALQQLGMIQHNA  403

Query  1155  WRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             WRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  404   WRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  459



>ref|XP_003543416.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006594920.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006594921.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
 ref|XP_006594922.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Glycine 
max]
Length=702

 Score =   377 bits (969),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 245/454 (54%), Positives = 291/454 (64%), Gaps = 44/454 (10%)
 Frame = +3

Query  36    MAMYYQGS-SEVQ---GDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGNALHAGGMPH  203
             MA Y+ GS SE+Q     GLQTLYLMNP Y+ ++D   P     + +N  NA +   +PH
Sbjct  1     MATYFNGSTSEIQPSADGGLQTLYLMNPTYVPYADA--PHHPTTLLVNP-NAPNLANIPH  57

Query  204   A--RLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQA-------GSGSGGQQIP---  347
             A    P  QH   +    S +GS    D +R    G   A       G+G+     P   
Sbjct  58    APPVSPNQQHHHVIHGVTSIIGSGNSDDHSRPSLIGENIAAFHGFSGGAGTASTAAPRLH  117

Query  348   ----SAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLL  515
                   VV   G  +  +   GF R       +QQGLSLSLS QQ  FRS+  E  V   
Sbjct  118   YNLWGPVVDQPGTPSSSSGGGGFRRP------SQQGLSLSLSSQQTNFRSVSGELDVA--  169

Query  516   SARPGAAH-DNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaan  692
                 G  H    G S  S + G+SG I GSKYLKAAQELLDEVVNV K +  +       
Sbjct  170   ----GQGHVAGIGNSPMSASIGVSGVIMGSKYLKAAQELLDEVVNVGKGIYKEEKFSEKV  225

Query  693   kekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEV  872
             K   +          G GGD  + GGE+SA K    EL+TAQRQ+LQMKK+KL++M+DEV
Sbjct  226   KANRESTNSGA---AGDGGDGSSGGGENSAGK-QVVELSTAQRQELQMKKSKLVTMLDEV  281

Query  873   EQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSL  1052
             EQRYRQYHHQMQ++V+SFEQAAG G+A+SYT LAL TISKQFRCLK AI++QIKATSK+L
Sbjct  282   EQRYRQYHHQMQIVVSSFEQAAGYGAAKSYTALALKTISKQFRCLKDAISAQIKATSKTL  341

Query  1053  GEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEH  1220
             GE++     V GSRL+F+DHHL QQRALQ LGM+QPNAWRPQRGLPERAVS+LRAWLFEH
Sbjct  342   GEDDCLGVKVEGSRLRFVDHHLRQQRALQQLGMIQPNAWRPQRGLPERAVSILRAWLFEH  401

Query  1221  FLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             FLHPYPKDSDK+MLAKQTGL RSQVSNWFINARV
Sbjct  402   FLHPYPKDSDKVMLAKQTGLARSQVSNWFINARV  435



>ref|XP_010263012.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
 ref|XP_010263013.1| PREDICTED: BEL1-like homeodomain protein 1 [Nelumbo nucifera]
Length=739

 Score =   378 bits (970),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 248/480 (52%), Positives = 311/480 (65%), Gaps = 64/480 (13%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNS-GNALHAGGMPHARL  212
             MA Y+ G+SE+Q DGLQTLYLMNP Y+G+SDT  P +   +FLNS GN L+   + HA  
Sbjct  1     MATYFHGTSEIQADGLQTLYLMNPGYVGYSDTQPPSNM--VFLNSAGNTLNPASLSHA-A  57

Query  213   PQSQHFVGVPLPASALGSAQL---HDPAR---------------------SLWAGLE-QA  317
               SQH VG+PL A+A+ +       DP R                     +LW  ++  A
Sbjct  58    QTSQHLVGIPLQATAVAAGAAAASQDPNRPSVHSQQDMSTIHGFVPRVHYNLWTPMDPTA  117

Query  318   GSGS----GGQQIPSAV-----VSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQ  470
             G+GS       QI +       VS   G TD +SQLG  RSVV SPT Q       S QQ
Sbjct  118   GAGSPQAHHQHQISTTAAAAAAVSNSVGVTDVSSQLGLRRSVV-SPTQQGLSLSLSSHQQ  176

Query  471   HPFRSLPMESPVGLLSAR----PGAAHD-----NSGASSSSITHGISGF---ITGSKYLK  614
               + S   ES +   +      P + ++      S +S+S++++GISG    + GSKYLK
Sbjct  177   TAYGSYRQESDIPAPAPAPAISPTSGNEMRISGGSSSSASAVSNGISGMQSVLLGSKYLK  236

Query  615   AAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTA  794
             AAQ+LLDEVVNV K +K ++A+ +    K      +       G    ++ GE+S +   
Sbjct  237   AAQQLLDEVVNVGKGIKTESAKGSKGLSKLSRDSNA-------GSGEVSNAGETSTK--P  287

Query  795   AAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLA  974
             A E TTA+RQ+LQM+KAKL+SM+DEVEQRYRQYHHQMQ++V++FEQAAG GSA++YT LA
Sbjct  288   AVEFTTAERQELQMRKAKLVSMLDEVEQRYRQYHHQMQIVVSAFEQAAGFGSAKTYTALA  347

Query  975   LNTISKQFRCLKVAIASQIKATSKSLGEEEGV----RGSRLKFIDHHLPQQRALQHLGMM  1142
             L TISKQFRCLK AI+ QI+ATSKSLGEE+       GSRL+F+D  L QQRALQ +GM+
Sbjct  348   LQTISKQFRCLKDAISGQIRATSKSLGEEDCFGGKSEGSRLRFVDQQLRQQRALQQIGMI  407

Query  1143  QPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             Q NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK MLAKQTGL+R QVSNWFINARV
Sbjct  408   QHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLSRGQVSNWFINARV  467



>ref|XP_008230296.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008230304.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
Length=655

 Score =   374 bits (961),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 236/456 (52%), Positives = 279/456 (61%), Gaps = 79/456 (17%)
 Frame = +3

Query  39    AMYYQGSSEVQG---DGLQTLYLMNPNYI-GFSDTAL--PQSQQAMFLNSGNALHAGGMP  200
               ++ GSSE+Q      LQTLYLMNPNY+  FSD+A   P     +  N           
Sbjct  3     TFFHHGSSEIQAPTDHALQTLYLMNPNYVPSFSDSAQQNPTPPSMLLFN-----------  51

Query  201   HARLPQSQHFVGVPLPASALGSAQ--------LH---DPAR---SLWAGLEQAGSGSGGQ  338
             H   P + H VG+PL ++A+GS          LH   DP+R   +LW  +       GGQ
Sbjct  52    HTPPPTTHHLVGIPLHSAAVGSNNSDDHSPPSLHHQTDPSRLHYNLWGPM-------GGQ  104

Query  339   Q-IPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLL  515
               I ++ VS    TT    Q G   S+ +S   Q G + +  P      S P E  V   
Sbjct  105   TPIGASAVSPTSATT----QQGL--SLSLSTHQQPGYNSNYRPS-----SFPAERDV---  150

Query  516   SARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEK---SLKLDaaeea  686
                P      S +S S+I+HG SG + GSKYLKAAQELLDEVV+V K   + +LD   + 
Sbjct  151   ---PDKG--TSLSSVSAISHGFSGVLLGSKYLKAAQELLDEVVHVGKGSNAAELDGGIKD  205

Query  687   ankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVD  866
                                       G  SS      AEL TAQRQ+LQMKKAKL+SM+D
Sbjct  206   K--------------MKVSRETTAGIGASSSGGAKQGAELNTAQRQELQMKKAKLVSMLD  251

Query  867   EVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSK  1046
             EVEQRYRQYH QMQ ++ SFEQAAG GSA+SYTHLAL TISKQFRCLK AI++QIKA SK
Sbjct  252   EVEQRYRQYHQQMQFVITSFEQAAGFGSAKSYTHLALQTISKQFRCLKDAISAQIKAGSK  311

Query  1047  SLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLF  1214
             +LGEEE     + GSRLK+ID+H+ QQRALQ LGM+Q N WRPQRGLPERAVSVLRAWLF
Sbjct  312   NLGEEECLGAKIEGSRLKYIDNHVRQQRALQQLGMVQHNPWRPQRGLPERAVSVLRAWLF  371

Query  1215  EHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             EHFLHPYPKDSDK+MLAKQTGLTRSQVSNWFINARV
Sbjct  372   EHFLHPYPKDSDKVMLAKQTGLTRSQVSNWFINARV  407



>ref|XP_007015671.1| BEL1 homeodomain 1, putative [Theobroma cacao]
 gb|EOY33290.1| BEL1 homeodomain 1, putative [Theobroma cacao]
Length=732

 Score =   375 bits (962),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 264/472 (56%), Positives = 312/472 (66%), Gaps = 54/472 (11%)
 Frame = +3

Query  36    MAMYYQGSSEVQG------DG-LQTLYLMNPNYIGFSDTALPQSQQAMF-LN-SGNALHA  188
             MA Y+ GSSE Q       DG +QTLYLMNPNY+ +SDT  P +   MF LN +GNAL+ 
Sbjct  1     MATYFHGSSEFQAASAAAPDGTMQTLYLMNPNYVPYSDTHQPAAATNMFFLNPAGNALNP  60

Query  189   GGMPHARLPQSQHFVGVPLP--ASALGSAQLHDPAR------------SLWA-GLEQAGS  323
               + HA  P   H +G+PLP  A+++G     DP R            +LW   ++   S
Sbjct  61    TSLHHAPPPNHHHLLGLPLPTPAASIGPGSSDDPHRPSLHGIVSGVHYNLWGPNIDHQNS  120

Query  324   -GSGGQQIPSAVVS---GGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQH-PFRSL  488
              GS   Q+ SA  +     GG  D ASQLG  R V  SP  +QGLSLSLS QQ   +RS 
Sbjct  121   PGSSHAQVVSAAAAAAANSGGAHDVASQLGLRRPVA-SP--RQGLSLSLSSQQQVTYRSS  177

Query  489   PMESPVGLLSARP--GAAHD--------NSGASSSSITHGISGFITGSKYLKAAQELLDE  638
              +E+ +   S  P    A D        +S +  S+   G+   + GSKYL+AAQELLDE
Sbjct  178   NVETDIQGQSQVPTISLADDMRISGNSPSSVSVVSNGISGVQSVVLGSKYLRAAQELLDE  237

Query  639   VVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQ  818
             VVNV K +K D +E    K K   +  +            +S GE+ A++   AELTTAQ
Sbjct  238   VVNVGKGIKTDVSEGTKEKIKMNKESIA------AVTGEGSSAGENGAKR--GAELTTAQ  289

Query  819   RQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQF  998
             RQ+LQMKKAKL+SM+DEVEQRYRQYHHQMQ++V+SFEQAAG G+ARSYT LAL TISKQF
Sbjct  290   RQELQMKKAKLVSMLDEVEQRYRQYHHQMQIVVSSFEQAAGFGAARSYTALALQTISKQF  349

Query  999   RCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQ  1166
             RCLK AI+ QIKATSKSLGEE+     V GSRL+F+DH L QQRALQ LGMMQ NAWRPQ
Sbjct  350   RCLKDAISGQIKATSKSLGEEDCLGAKVEGSRLRFVDHQLRQQRALQQLGMMQHNAWRPQ  409

Query  1167  RGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             RGLPERAVSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  410   RGLPERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  461



>ref|XP_007208166.1| hypothetical protein PRUPE_ppa002583mg [Prunus persica]
 gb|EMJ09365.1| hypothetical protein PRUPE_ppa002583mg [Prunus persica]
Length=655

 Score =   370 bits (950),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 232/453 (51%), Positives = 280/453 (62%), Gaps = 73/453 (16%)
 Frame = +3

Query  39    AMYYQGSSEVQG---DGLQTLYLMNPNYI-GFSDTAL--PQSQQAMFLNSGNALHAGGMP  200
               ++ GSSE+Q      LQTLYLMNPNY+  FSD+A   P     +  N           
Sbjct  3     TFFHHGSSEIQAPTDHALQTLYLMNPNYVPSFSDSAQQNPTPPSMLLFN-----------  51

Query  201   HARLPQSQHFVGVPLPASALGSAQLHD-----------PAR---SLWAGLEQAGSGSGGQ  338
             H   P + H VG+PL ++A+GS    D           P+R   +LW  L       GGQ
Sbjct  52    HTPPPTTHHLVGIPLHSAAVGSNNSDDHSPPSLQHQTDPSRLHYNLWGPL-------GGQ  104

Query  339   Q-IPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLL  515
               + ++ VS    TT    Q G   S+ +S   Q G + +  P      S P E  V   
Sbjct  105   TPVGASAVSPTSATT----QQGL--SLSLSTHQQPGYNSNYRPS-----SFPAERDV---  150

Query  516   SARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaank  695
                   A  +S +S S+++HG SG + GSKYLKAAQELLDEVV+V K    D  +     
Sbjct  151   -----PAKGSSLSSVSAMSHGFSGVLLGSKYLKAAQELLDEVVHVGKGSNADELDGGIKD  205

Query  696   ekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVE  875
             +    ++ +              G  SS      AEL TAQRQ+LQMKKAKL+SM+DEVE
Sbjct  206   KMKVSRETT-----------AGIGASSSGGVKQGAELNTAQRQELQMKKAKLVSMLDEVE  254

Query  876   QRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLG  1055
             QRYRQYH QMQ ++ SFEQAAG GSA+SYTHLAL TISKQFRCLK AI++QIKA+SK+LG
Sbjct  255   QRYRQYHQQMQFVITSFEQAAGFGSAKSYTHLALQTISKQFRCLKDAISTQIKASSKNLG  314

Query  1056  EEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHF  1223
             EEE     + GSRLK+ID+H+ QQRALQ LGM+Q N WRPQRGLPERAVSVLRAWLFEHF
Sbjct  315   EEECLGAKIEGSRLKYIDNHVRQQRALQQLGMVQHNPWRPQRGLPERAVSVLRAWLFEHF  374

Query  1224  LHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             LHPYPKDSDK+MLAKQTGLTRSQVSNWFINARV
Sbjct  375   LHPYPKDSDKVMLAKQTGLTRSQVSNWFINARV  407



>ref|XP_002313498.2| hypothetical protein POPTR_0009s02250g [Populus trichocarpa]
 gb|EEE87453.2| hypothetical protein POPTR_0009s02250g [Populus trichocarpa]
Length=662

 Score =   367 bits (941),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 252/486 (52%), Positives = 304/486 (63%), Gaps = 78/486 (16%)
 Frame = +3

Query  36    MAMYYQGSSEVQG-----DGLQTLYLMNPNYIG-FSDTALPQSQ----QAMFLN------  167
             MA Y+ GSSE+Q      DG+QTLYLMNPNY+  +SD+   Q Q      +F N      
Sbjct  1     MATYFHGSSEIQAAAAPSDGIQTLYLMNPNYLSSYSDSTQQQHQQQPPNMIFFNPSSSTA  60

Query  168   -SGNALHAGGMPHARLPQSQHFVGVPL--PASALGSAQLHDPAR-------------SLW  299
              S N LH G +PH   PQ+ HFVG+PL  P+S + S      +R             ++W
Sbjct  61    ASNNGLHTGNLPHGP-PQNHHFVGIPLAAPSSNITSLTPDSHSRPSLHGVVPSHVHYNIW  119

Query  300   AGLEQAGSGSGGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPF  479
               ++Q         + +A  S        + Q+GF R V VSP  +QGLSLSLS QQ P 
Sbjct  120   GSIDQ-------NSVATACESSAANDV-VSPQVGFRRPVAVSP-GRQGLSLSLSSQQAPT  170

Query  480   RSLPMESPVGLLSARPGAAH---------------DNSGASSSSITHGISGF---ITGSK  605
                P    +G       A H                NS +S S++++G+SG    + GS+
Sbjct  171   PPTPYNRAIGNKHHEIQALHPHVSVVSSGDEIRVSGNSPSSVSAVSNGVSGLQNMVLGSR  230

Query  606   YLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQ  785
             YL+A QELLDE VNV K L      E ++KEK KM KES+           T  G S  +
Sbjct  231   YLRATQELLDEAVNVGKDLIKSGLIEGSSKEKMKMTKESI-----------TGDGSSGGE  279

Query  786   KTAA---AELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSAR  956
               AA   AELTTA RQ+LQMKK KL++M+DEVEQRYRQYHHQMQV+V+SFEQA+G G+A+
Sbjct  280   AYAANRGAELTTAHRQELQMKKGKLVNMLDEVEQRYRQYHHQMQVVVSSFEQASGFGAAK  339

Query  957   SYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRAL  1124
             SYT LAL TISKQFR LK  I+SQI+A SKSLGEE+     V GSRL+++DH L QQRAL
Sbjct  340   SYTALALQTISKQFRSLKDTISSQIRAASKSLGEEDCIGAKVEGSRLRYVDHQLRQQRAL  399

Query  1125  QHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNW  1304
             Q LGM+Q NAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNW
Sbjct  400   QQLGMVQHNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNW  459

Query  1305  FINARV  1322
             FINARV
Sbjct  460   FINARV  465



>ref|XP_007150021.1| hypothetical protein PHAVU_005G119300g [Phaseolus vulgaris]
 gb|ESW22015.1| hypothetical protein PHAVU_005G119300g [Phaseolus vulgaris]
Length=708

 Score =   367 bits (942),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 234/454 (52%), Positives = 287/454 (63%), Gaps = 45/454 (10%)
 Frame = +3

Query  36    MAMYYQGS-SEVQ--GDGLQTLYLMNPNYIGFSDTALPQSQQAMFL-NSGNALHAGGMPH  203
             MA Y+ GS SE+Q   DGLQTLYLMNP+Y+ ++D   P     +   N+ NAL+   + H
Sbjct  1     MATYFHGSTSEIQSSADGLQTLYLMNPSYVPYADA--PHHPTLLVNPNATNALNLASLTH  58

Query  204   A--RLPQSQHFVGVPLPASAL---GSAQLHDPARSLWAGLEQA-------GSGSGGQQIP  347
             A    P + H   V    S +   G++  H   R    G   A       G+ S   ++P
Sbjct  59    APPVSPAANHHQQVIHGVSNVLGSGNSDEHAHTRQSLFGENIAAFHGFSGGASSTAPRVP  118

Query  348   -----SAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGL  512
                  S V   G  ++      GF R       +QQGLSLSLS QQ  FRS+  E  +  
Sbjct  119   YNLWGSGVDQPGTPSSSSGGGGGFRR------PSQQGLSLSLSSQQTNFRSVSGELEI--  170

Query  513   LSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaan  692
               A  G       + +S+ + G+SG I GSKYLKA QELLDEVVNV K +  D       
Sbjct  171   --AGQGHVAGTGNSPTSAASTGVSGLILGSKYLKATQELLDEVVNVGKGIYKDEKFSEKV  228

Query  693   kekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEV  872
             K   +                 +SGG  ++      EL+TAQRQ+LQMKK+KL++M+DEV
Sbjct  229   KANKESTNSGA--------GAGSSGGGENSAGKQMVELSTAQRQELQMKKSKLVNMLDEV  280

Query  873   EQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSL  1052
             EQRYRQYHHQMQ++V+SFEQAAG G+A+SYT LAL TISKQFRCLK AI++QIKATSK+L
Sbjct  281   EQRYRQYHHQMQIVVSSFEQAAGYGAAKSYTALALKTISKQFRCLKDAISAQIKATSKTL  340

Query  1053  GEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEH  1220
             GE++     V GSRL+++DHHL QQRALQ LGM+QPNAWRPQRGLPERAVS+LRAWLFEH
Sbjct  341   GEDDCLGVKVEGSRLRYVDHHLRQQRALQQLGMIQPNAWRPQRGLPERAVSILRAWLFEH  400

Query  1221  FLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             FLHPYPKDSDK MLAKQTGL RSQVSNWFINARV
Sbjct  401   FLHPYPKDSDKAMLAKQTGLARSQVSNWFINARV  434



>ref|XP_007150022.1| hypothetical protein PHAVU_005G119300g [Phaseolus vulgaris]
 gb|ESW22016.1| hypothetical protein PHAVU_005G119300g [Phaseolus vulgaris]
Length=702

 Score =   367 bits (941),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 234/454 (52%), Positives = 287/454 (63%), Gaps = 45/454 (10%)
 Frame = +3

Query  36    MAMYYQGS-SEVQ--GDGLQTLYLMNPNYIGFSDTALPQSQQAMFL-NSGNALHAGGMPH  203
             MA Y+ GS SE+Q   DGLQTLYLMNP+Y+ ++D   P     +   N+ NAL+   + H
Sbjct  1     MATYFHGSTSEIQSSADGLQTLYLMNPSYVPYADA--PHHPTLLVNPNATNALNLASLTH  58

Query  204   A--RLPQSQHFVGVPLPASAL---GSAQLHDPARSLWAGLEQA-------GSGSGGQQIP  347
             A    P + H   V    S +   G++  H   R    G   A       G+ S   ++P
Sbjct  59    APPVSPAANHHQQVIHGVSNVLGSGNSDEHAHTRQSLFGENIAAFHGFSGGASSTAPRVP  118

Query  348   -----SAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGL  512
                  S V   G  ++      GF R       +QQGLSLSLS QQ  FRS+  E  +  
Sbjct  119   YNLWGSGVDQPGTPSSSSGGGGGFRR------PSQQGLSLSLSSQQTNFRSVSGELEI--  170

Query  513   LSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaan  692
               A  G       + +S+ + G+SG I GSKYLKA QELLDEVVNV K +  D       
Sbjct  171   --AGQGHVAGTGNSPTSAASTGVSGLILGSKYLKATQELLDEVVNVGKGIYKDEKFSEKV  228

Query  693   kekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEV  872
             K   +                 +SGG  ++      EL+TAQRQ+LQMKK+KL++M+DEV
Sbjct  229   KANKESTNSGA--------GAGSSGGGENSAGKQMVELSTAQRQELQMKKSKLVNMLDEV  280

Query  873   EQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSL  1052
             EQRYRQYHHQMQ++V+SFEQAAG G+A+SYT LAL TISKQFRCLK AI++QIKATSK+L
Sbjct  281   EQRYRQYHHQMQIVVSSFEQAAGYGAAKSYTALALKTISKQFRCLKDAISAQIKATSKTL  340

Query  1053  GEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEH  1220
             GE++     V GSRL+++DHHL QQRALQ LGM+QPNAWRPQRGLPERAVS+LRAWLFEH
Sbjct  341   GEDDCLGVKVEGSRLRYVDHHLRQQRALQQLGMIQPNAWRPQRGLPERAVSILRAWLFEH  400

Query  1221  FLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             FLHPYPKDSDK MLAKQTGL RSQVSNWFINARV
Sbjct  401   FLHPYPKDSDKAMLAKQTGLARSQVSNWFINARV  434



>ref|XP_008449596.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
 ref|XP_008449597.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
Length=693

 Score =   366 bits (939),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 245/464 (53%), Positives = 287/464 (62%), Gaps = 57/464 (12%)
 Frame = +3

Query  36    MAMYYQGSSEVQ--GDGLQTLYLMNPNYIGFSDTALPQSQQAMFLN--SGNALHAGGMPH  203
             MA Y+ G SE+Q   DG+ TLYLMNPNY+ +SDT    S   +FLN  S +AL+   +PH
Sbjct  1     MATYFHGGSEIQTNSDGIHTLYLMNPNYVPYSDTHSQSSHNMLFLNPSSTHALNPSTLPH  60

Query  204   ARLPQSQHFVGVPLPASALGSAQLHD-----PAR---SLWAGLEQAGSGSGGQQIPSAVV  359
             A  P + HFVG+PLP +       H+     P R   +LWA ++Q           SA  
Sbjct  61    AP-PSNNHFVGIPLPTTDSSRPSFHEISTLHPHRLHYNLWAPVDQQQQQQQSLHADSA--  117

Query  360   SGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAH  539
                         L F R     PTAQQGLSLSLS QQ  +R+L  E  +         + 
Sbjct  118   -----------DLTFRR-----PTAQQGLSLSLSSQQSLYRTLSAEQEIQGGGGGGAPSG  161

Query  540   DNSGASSSSITHGIS---------GFITGSKYLKAAQELLDEVVNVEK-SLKLDaaeeaa  689
             +    S +S T               I GSKYLKAAQELLDEVV+V K + K D   +  
Sbjct  162   EEIRVSGNSGTSVSVVSSSITGVQSVILGSKYLKAAQELLDEVVHVGKANYKTDKFGDGT  221

Query  690   nkekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDE  869
                K KMKKES    GG        G  +S    + AEL+TAQRQDLQMKKAKL+ M+DE
Sbjct  222   KDNKMKMKKESTATIGGGSSAATGGGETTSK---SVAELSTAQRQDLQMKKAKLIGMLDE  278

Query  870   VEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKS  1049
             VEQ+YRQYH QM+ +V+ FEQAAG+GSA+SY  LAL TISKQFRCLK AI  QIKAT KS
Sbjct  279   VEQKYRQYHQQMRGVVSCFEQAAGLGSAKSYASLALETISKQFRCLKDAICGQIKATGKS  338

Query  1050  LGEE-EGVRGS------------RLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAV  1190
             LGE+ E   GS            RL+++DHHL QQRALQ LGM+Q N WRPQRGLPERAV
Sbjct  339   LGEDQENWLGSSKMEGSSTTSSSRLRYVDHHLRQQRALQQLGMIQHNTWRPQRGLPERAV  398

Query  1191  SVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             SVLRAWLFEHFLHPYPKDSDKI+LAKQTGLTRSQVSNWFINARV
Sbjct  399   SVLRAWLFEHFLHPYPKDSDKIILAKQTGLTRSQVSNWFINARV  442



>ref|XP_011094236.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
Length=710

 Score =   363 bits (932),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 232/456 (51%), Positives = 285/456 (63%), Gaps = 43/456 (9%)
 Frame = +3

Query  36    MAMYYQGSSEVQG---DGLQTLYLMNPNYIGFSDTAL---PQSQQAMFLNSGNALHAG-G  194
             MA Y+ G+SE+QG   DGLQTL LMNP Y+G+SDT     P S   +FLNS ++ + G  
Sbjct  1     MATYFHGNSEIQGGGGDGLQTLILMNPAYVGYSDTQQQQPPPSSNFVFLNSNSSGNNGHN  60

Query  195   MPHARLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSAVVSGGGG  374
             +PHA   Q+QHFVG PL  +    A    PA       +Q  S   G  +P    +    
Sbjct  61    IPHAPPTQTQHFVGFPLQGTTSAPAPPPAPAAPPQDPQQQDVSALHGF-LPRVQYN----  115

Query  375   TTDFASQLGFHRSVVVSPTAQQGlslslsPQQ-------HPFRSLP-------MESPVGL  512
               +    LG  R V     AQQGLSLSLS QQ        P R +P       +  P G 
Sbjct  116   LYNLPIDLGAARDVT---RAQQGLSLSLSSQQPPGYGSFRPEREVPSQPLVTAVSPPRGG  172

Query  513   LSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaan  692
                R      +S +  S+  +G+   +  SKYLKAAQELLDEVVNV K  K        +
Sbjct  173   EDVRVSGGSPSSASGVSNGVNGVQSVLLSSKYLKAAQELLDEVVNVGKGAK--------S  224

Query  693   kekakmkkeSMPPFggcggdpptsggESSAQKTA--AAELTTAQRQDLQMKKAKLLSMVD  866
               ++       P   G         G+S  + +    AELTTA+RQ++QMKKAKL++M+D
Sbjct  225   ATESSKGANGQPKNTGDSSLAAAGDGQSGGEGSGKRGAELTTAERQEIQMKKAKLVNMLD  284

Query  867   EVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSK  1046
             EVEQRYRQYHHQMQ++++    AAG+GSA++YT LAL TISKQFRCLK AI  QI+A SK
Sbjct  285   EVEQRYRQYHHQMQIVISWTSSAAGIGSAKTYTALALQTISKQFRCLKDAILGQIRAASK  344

Query  1047  SLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLF  1214
             SLGEE+     + GSRLK++D+ + QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLF
Sbjct  345   SLGEEDSLEGKIEGSRLKYVDNQIRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLF  404

Query  1215  EHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             EHFLHPYPKDSDK+MLAKQTGLTRSQVSNWFINARV
Sbjct  405   EHFLHPYPKDSDKLMLAKQTGLTRSQVSNWFINARV  440



>ref|XP_011003835.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003836.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003838.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003839.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003840.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011003841.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=734

 Score =   363 bits (931),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 246/475 (52%), Positives = 292/475 (61%), Gaps = 57/475 (12%)
 Frame = +3

Query  36    MAMYYQGSSEVQG-----DGLQTLYLMNPNYIG-FSDTALPQSQ----QAMFLN------  167
             MA Y+  SSE+Q      DG+QTLYLMNPNY+  +SD+   Q Q      +F N      
Sbjct  1     MATYFHESSEIQAAAAPSDGIQTLYLMNPNYLSSYSDSTQQQHQQQHPNMIFFNPSSSTA  60

Query  168   -SGNALHAGGMPHARLPQSQHFVGVPL--PASALGSAQLHDPARSLWAGLEQAGS-----  323
              S N LH G +PH   PQ+ HFVG+PL  P+S + S      +R    G+  +       
Sbjct  61    ASNNGLHTGNLPHGP-PQNHHFVGIPLAAPSSNITSLTPDSHSRPSPHGIVPSHVHYNIW  119

Query  324   GSGGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESP  503
             GS  Q   S            ++Q+GF R V VSP  +QGLSLSLS QQ P    P    
Sbjct  120   GSMDQNSVSTACESSAANDVVSAQVGFRRPVAVSP-GRQGLSLSLSSQQAPTPPTPYNRA  178

Query  504   VGLLSARPGAAH---------------DNSGASSSSITHGISGF---ITGSKYLKAAQEL  629
             +        A H                NS +S S++++G+SG    + GSKYL+A QEL
Sbjct  179   ISNKHHEIQALHPYVSVVSSGDEIRVSGNSPSSVSAVSNGVSGLQNMVLGSKYLRATQEL  238

Query  630   LDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELT  809
             LDE VNV K L                 KE M           +SGGE+ A     AELT
Sbjct  239   LDEAVNVGKDL--------IKSGLEGSSKEKMKMTKQSITGDGSSGGEAYA-ANRGAELT  289

Query  810   TAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTIS  989
             TA RQ+LQMKK KL++M+DEVEQRYRQYHHQMQV+V+SFEQA+G G+A+SYT LAL TIS
Sbjct  290   TAHRQELQMKKGKLVNMLDEVEQRYRQYHHQMQVVVSSFEQASGFGAAKSYTALALQTIS  349

Query  990   KQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAW  1157
             KQFR LK  I+SQI+A SKSLGEE+     V GSRL+++DH L QQRALQ LGM+Q NAW
Sbjct  350   KQFRSLKDTISSQIRAASKSLGEEDCIGAKVEGSRLRYVDHQLRQQRALQQLGMVQHNAW  409

Query  1158  RPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             RPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  410   RPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  464



>gb|KHF99976.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=693

 Score =   361 bits (927),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 247/476 (52%), Positives = 303/476 (64%), Gaps = 68/476 (14%)
 Frame = +3

Query  36    MAMYYQGSSEVQG------DGLQTLYLMNPNYIGFSDTALP-QSQQAMFLN-SGNALHAG  191
             MA Y  GSSE Q       DG+QTLYLMNPNYI +SDT  P  +   +FLN +GNAL+  
Sbjct  1     MATYSHGSSEFQAASVAAPDGMQTLYLMNPNYIPYSDTNQPVAATNLLFLNPAGNALNPS  60

Query  192   GMPHARLPQSQHFVGVPLPASAL-----GSAQLHDPA--RSLWAGLEQAGSGSGG-----  335
               PH   P   H +G+PLP          S + H P+    + +G+     GS       
Sbjct  61    SFPHTPPPNYHHLLGLPLPTPTASIVPANSNETHRPSSLHGIVSGVHYNSWGSSSTIDHQ  120

Query  336   --------QQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLP  491
                     Q + +AV +      D ASQL   R VVVSP  +QGLSLSLS QQ P+ S  
Sbjct  121   TSSASTYPQIVSTAVDNSAARPHDVASQL---RPVVVSP--RQGLSLSLSSQQVPYSSSN  175

Query  492   MESP-----VGLLSARPGAAHD-----NSGASSSSITHGISGF---ITGSKYLKAAQELL  632
             +E+      V  +S  P AA +     NS +S+S +++GI G    + GSKYL+AAQELL
Sbjct  176   VEADHIQGQVPTMS--PAAADEMRISGNSPSSASVVSNGILGVQSVVLGSKYLRAAQELL  233

Query  633   DEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTT  812
             DEVVNV K +K + +E    K                     +S GE  AQ+    ELTT
Sbjct  234   DEVVNVGKVIKPEVSEGTKEK------------IKADKEPVGSSAGEDGAQR--GPELTT  279

Query  813   AQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISK  992
             AQRQ+LQMKKAKL+SM+DEVE+RYRQY  QMQ++V+S E+AAG G+A+SYT +A  TISK
Sbjct  280   AQRQELQMKKAKLVSMLDEVERRYRQYRQQMQIVVSSLEKAAGFGAAKSYTGIASRTISK  339

Query  993   QFRCLKVAIASQIKATSKSLGEEE--GVR--GSRLKFIDHHLPQQRALQHLGMMQ--PNA  1154
             QFRCLK +I+ QIKATSK LGE++  GV+  GSRL+++D+ L QQRALQ LGM+Q   N 
Sbjct  340   QFRCLKDSISEQIKATSKILGEDDCLGVKLEGSRLRYVDYQLRQQRALQQLGMIQHNNNV  399

Query  1155  WRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             WRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTR+QVSNWFINARV
Sbjct  400   WRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRNQVSNWFINARV  455



>ref|XP_011021429.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011021430.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011021431.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=732

 Score =   362 bits (929),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 252/475 (53%), Positives = 311/475 (65%), Gaps = 59/475 (12%)
 Frame = +3

Query  36    MAMYYQGSSEVQG-----DGLQTLYLMNPNYIG-FSDTALPQ----SQQAMFLNSGNALH  185
             MA Y+ GSSE+Q      DG+QTLYLMNPNY+  +SD    Q    S   +F N  N ++
Sbjct  1     MATYFHGSSEIQAAAAPSDGIQTLYLMNPNYLSSYSDATQQQHQQQSPNMIFFNHSNTVN  60

Query  186   AGGMPHARLPQSQHFVGVPLP--ASALGSAQLHDPAR-------------SLWAGLEQAG  320
                + H   PQ+ HFVG+PLP  +S + S+   + +R             ++W  ++Q  
Sbjct  61    -NSLSHGP-PQNHHFVGIPLPVPSSNITSSAPENHSRPSSLHGVVPSVHYNIWGSIDQNS  118

Query  321   SGSGGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPF------R  482
               S      S+           +SQ+GF R VVVSP  +QGLSLSLS QQ P       R
Sbjct  119   VASAATASESSGAH-----DVMSSQVGFRRPVVVSP-GRQGLSLSLSSQQAPAPPTPYSR  172

Query  483   SLPMESPVGLL--------SARPGAAHDNSGASSSSITHGISGF---ITGSKYLKAAQEL  629
             ++  E  +  L        S        NS +S S++++G+SG    + GSKYL+AAQEL
Sbjct  173   AISNEHEIQALHPHVSVVSSGDEIRVSGNSPSSVSAVSNGVSGMQNMVLGSKYLRAAQEL  232

Query  630   LDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELT  809
             LDEV NV K L + +   A  KEK KM KESM   G        + GE+SA++   A+LT
Sbjct  233   LDEVANVGKDL-IKSGIIARTKEKMKMTKESMT--GDGSDGSGEAVGETSAKR--GADLT  287

Query  810   TAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTIS  989
             TA RQ+LQMKKAKL++M+DEV+QRYRQYHHQMQV+V+SFEQAAG G+A+SYT LAL TIS
Sbjct  288   TAHRQELQMKKAKLVTMLDEVDQRYRQYHHQMQVVVSSFEQAAGYGAAKSYTALALQTIS  347

Query  990   KQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAW  1157
             +QFR LK  IASQI+ATSKSLGEE+     V GSRL+++DH L QQRALQ LG++Q NAW
Sbjct  348   RQFRSLKDTIASQIRATSKSLGEEDCIGAKVEGSRLRYVDHQLRQQRALQQLGIVQHNAW  407

Query  1158  RPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             RPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  408   RPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  462



>ref|XP_004140170.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 ref|XP_004156066.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 gb|KGN48050.1| hypothetical protein Csa_6G426360 [Cucumis sativus]
Length=698

 Score =   360 bits (925),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 240/470 (51%), Positives = 289/470 (61%), Gaps = 63/470 (13%)
 Frame = +3

Query  36    MAMYYQGSSEVQG--DGLQTLYLMNPNYIGFSDTALPQSQQAMFLN--SGNALHAGGMPH  203
             MA Y+ G SE+Q   DG+ TLYLMNPNY+ +SDT    S   +FLN  S +AL+   +PH
Sbjct  1     MATYFHGGSEIQNNSDGIHTLYLMNPNYVPYSDTHSQSSHNMLFLNPSSTHALNPSTLPH  60

Query  204   ARLPQSQHFVGVPLPASALGSAQLHD------PAR---SLWAGLEQAGSGSGGQQIPSAV  356
                P + HFVG+PLP +       H+      P R   +LWA ++Q        Q P   
Sbjct  61    PP-PSNNHFVGIPLPTTDPLRPSYHEISTTLHPHRLHYNLWAPVDQQHQHH---QQPLHA  116

Query  357   VSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLL-------  515
              S         + L F R     PTAQQ LSLSLS QQ  +R+L  E  +          
Sbjct  117   DS---------ADLTFRR-----PTAQQSLSLSLSSQQSLYRTLSAEQEIQGGGGGGGGG  162

Query  516   ----SARPGAAHDNSGASSSSITHGISGF---ITGSKYLKAAQELLDEVVNVEK-SLKLD  671
                 S        NSG S S ++ GI+G    I GSKYLKAAQELLDEVV+V K + K D
Sbjct  163   GGAPSGEEIRVSGNSGTSVSVVSSGITGVQSVILGSKYLKAAQELLDEVVHVGKANFKTD  222

Query  672   aaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKL  851
                +    +    ++ +       GG    + G       + AEL+TAQRQDLQMKKAKL
Sbjct  223   KFGDGTKDKMKMKREST----TTIGGGSSATTGGGETTSKSVAELSTAQRQDLQMKKAKL  278

Query  852   LSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQI  1031
             + M+DEVEQ+Y+QYH Q++ +V+ FEQAAG+GSA+SY  LAL TISKQFRCLK AI  QI
Sbjct  279   IGMLDEVEQKYKQYHQQIRGVVSCFEQAAGLGSAKSYASLALETISKQFRCLKDAICGQI  338

Query  1032  KATSKSLGEE-EGVRGS------------RLKFIDHHLPQQRALQHLGMMQPNAWRPQRG  1172
             KAT KSLGE+ E   GS            RL+++DHHL QQRALQ LGM+Q N WRPQRG
Sbjct  339   KATGKSLGEDQENWLGSSKMEGSSTTSSSRLRYVDHHLRQQRALQQLGMIQHNTWRPQRG  398

Query  1173  LPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             LPERAVSVLRAWLFEHFLHPYPKDSDKI+LAKQTGLTRSQVSNWFINARV
Sbjct  399   LPERAVSVLRAWLFEHFLHPYPKDSDKIILAKQTGLTRSQVSNWFINARV  448



>ref|XP_011090301.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
 ref|XP_011090302.1| PREDICTED: BEL1-like homeodomain protein 1 [Sesamum indicum]
Length=629

 Score =   356 bits (914),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 223/436 (51%), Positives = 272/436 (62%), Gaps = 34/436 (8%)
 Frame = +3

Query  42    MYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGNA-----LHAGGMPHA  206
             MY+QGSSE+Q D LQTLYLMNPNY+G+SD         +F NS  A     L+   M HA
Sbjct  1     MYFQGSSEIQADALQTLYLMNPNYVGYSDNHHQPQPNILFSNSATAATVQALNPALMHHA  60

Query  207   RLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSAVVSGGGGTTDF  386
                Q+QHFVG+PL          HDP+R      +Q    +    IP    +  G     
Sbjct  61    PPAQAQHFVGIPLS---------HDPSRPSSVLGQQEDIQATHSTIPRFQYNIRG----L  107

Query  387   ASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAHDNSGASSSS  566
               Q        V     QGLSLSLSP Q  F     +S + ++S +  ++   +    ++
Sbjct  108   FDQAATGNQTNVCQQTHQGLSLSLSPHQTGFDH--GQSSIRMVSPKNCSSPSLTTTDQTN  165

Query  567   ITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcg  746
               + +   I GSKYLKAAQELLDE+ NV+K   +   E     +     K +        
Sbjct  166   EVNTMQSVIIGSKYLKAAQELLDELANVQKETPIGRPEAGRMDKAKAKAKIT--------  217

Query  747   gdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASF  926
                 ++ G+    K   A+LTTAQRQ++QMKKAKL S++DEVE R RQYHHQMQ++VASF
Sbjct  218   --KESTVGDEDGNKGGGADLTTAQRQEIQMKKAKLSSLLDEVEHRCRQYHHQMQIVVASF  275

Query  927   EQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGV----RGSRLKFI  1094
             EQ AG+GSA+SYT LAL TI KQFRCLK  I++QIKA +KSLGEEE       GSRLK++
Sbjct  276   EQVAGIGSAKSYTQLALKTILKQFRCLKAKISAQIKALNKSLGEEESFGDKFEGSRLKYV  335

Query  1095  DHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQT  1274
             DH L QQRALQ LGM+Q +AWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK MLA+QT
Sbjct  336   DHQLRQQRALQQLGMVQNSAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKQMLARQT  395

Query  1275  GLTRSQVSNWFINARV  1322
             GLTRSQ SNWFINARV
Sbjct  396   GLTRSQDSNWFINARV  411



>gb|KHG11906.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=680

 Score =   358 bits (918),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 217/455 (48%), Positives = 270/455 (59%), Gaps = 60/455 (13%)
 Frame = +3

Query  12    FKEKRRKFMAMYYQGSSEVQG--DGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGNALH  185
              K++++  M+ Y+ G+ E+Q   DGLQTL LMNP Y+ +SDT  P     +   + N+L 
Sbjct  20    IKQRKQHPMSTYFHGNPEIQASTDGLQTLVLMNPAYVQYSDTPPPPPANNLLFFNPNSLS  79

Query  186   AGGMPHARLPQSQHFVGVPLPASALGS--------AQLHDPARSLWAGLEQAGSGSGGQQ  341
                      PQ+Q  VG+PLPA++  +        + LH   + +   L      SG   
Sbjct  80    P--------PQTQQLVGIPLPATSAANQGPTSHDISPLHGLVQRVHYNLYNPIDPSG---  128

Query  342   IPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSA  521
                                    S   +P +QQGLSL+LS QQ P      ++  G  ++
Sbjct  129   -----------------------SARETPRSQQGLSLTLSSQQQPGYGSQAQAVSGGSAS  165

Query  522   RPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKS-LKLDaaeeaanke  698
                  H+           G+      SKYLKAAQELLDEVVNV  + +            
Sbjct  166   SGSGVHNR--------VSGVQSVFLSSKYLKAAQELLDEVVNVNTTGITKSELLAKKGGG  217

Query  699   kakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQ  878
                    S    G          G   A +   AELTTA++Q++QMKKAKL++M+DEVEQ
Sbjct  218   GNNHSNSSSKAVGESSVVAGDGSGGGEAGEKHPAELTTAEKQEIQMKKAKLINMLDEVEQ  277

Query  879   RYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGE  1058
             RYRQYHHQMQ++ +SFEQAAG+GSA++YT LAL TISKQFRCLK AI+ QI+A +KSLGE
Sbjct  278   RYRQYHHQMQIVTSSFEQAAGIGSAKTYTALALKTISKQFRCLKDAISDQIRAANKSLGE  337

Query  1059  EEG-------VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFE  1217
             EE        + GSRLKF+DHHL QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFE
Sbjct  338   EEDGVGGAAKIEGSRLKFVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFE  397

Query  1218  HFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             HFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  398   HFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  432



>gb|AAN03622.1|AF406698_1 BEL1-related homeotic protein 11, partial [Solanum tuberosum]
Length=535

 Score =   353 bits (906),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 190/288 (66%), Positives = 219/288 (76%), Gaps = 26/288 (9%)
 Frame = +3

Query  504   VGLLSARP----GAAHDNS------GASSS-SITHGISGFITGSKYLKAAQELLDEVVNV  650
             VG+LS+ P    G   +N       GASSS SI++G+   I GSKYLK AQ+LLDEVVNV
Sbjct  21    VGILSSSPLPSPGTNTNNINHTRGLGASSSFSISNGM---ILGSKYLKVAQDLLDEVVNV  77

Query  651   EKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDL  830
              K++KL    E+  KEK K                 +   ESS+QK +  ELTTAQRQ+L
Sbjct  78    GKNIKLSDGLESGAKEKHK--------LDNELISLASDDVESSSQKNSGVELTTAQRQEL  129

Query  831   QMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLK  1010
             QMKKAKL+SM+DEV+QRYRQYHHQMQ+I  SFEQ  G+GS++SYT LAL+TISKQFRCLK
Sbjct  130   QMKKAKLVSMLDEVDQRYRQYHHQMQMIATSFEQTTGIGSSKSYTQLALHTISKQFRCLK  189

Query  1011  VAIASQIKATSKSLGEEEGV----RGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLP  1178
              AI+ QIK TSK+LGEEE +     GS+LKF+DHHL QQRALQ LGMMQ NAW+PQRGLP
Sbjct  190   DAISGQIKDTSKTLGEEENIGGKIEGSKLKFVDHHLRQQRALQQLGMMQTNAWKPQRGLP  249

Query  1179  ERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             ERAVSVLRAWLFEHFLHPYPKDSDKI+LAKQTGLTRSQVSNWFINARV
Sbjct  250   ERAVSVLRAWLFEHFLHPYPKDSDKIILAKQTGLTRSQVSNWFINARV  297



>gb|KHG11905.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=653

 Score =   355 bits (912),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 216/447 (48%), Positives = 265/447 (59%), Gaps = 60/447 (13%)
 Frame = +3

Query  36    MAMYYQGSSEVQG--DGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGNALHAGGMPHAR  209
             M+ Y+ G+ E+Q   DGLQTL LMNP Y+ +SDT  P     +   + N+L         
Sbjct  1     MSTYFHGNPEIQASTDGLQTLVLMNPAYVQYSDTPPPPPANNLLFFNPNSLSP-------  53

Query  210   LPQSQHFVGVPLPASALGS--------AQLHDPARSLWAGLEQAGSGSGGQQIPSAVVSG  365
              PQ+Q  VG+PLPA++  +        + LH   + +   L      SG           
Sbjct  54    -PQTQQLVGIPLPATSAANQGPTSHDISPLHGLVQRVHYNLYNPIDPSG-----------  101

Query  366   GGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAHDN  545
                            S   +P +QQGLSL+LS QQ P      ++  G  ++     H+ 
Sbjct  102   ---------------SARETPRSQQGLSLTLSSQQQPGYGSQAQAVSGGSASSGSGVHNR  146

Query  546   SGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKS-LKLDaaeeaankekakmkkeS  722
                       G+      SKYLKAAQELLDEVVNV  + +                   S
Sbjct  147   --------VSGVQSVFLSSKYLKAAQELLDEVVNVNTTGITKSELLAKKGGGGNNHSNSS  198

Query  723   MPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQ  902
                 G          G   A +   AELTTA++Q++QMKKAKL++M+DEVEQRYRQYHHQ
Sbjct  199   SKAVGESSVVAGDGSGGGEAGEKHPAELTTAEKQEIQMKKAKLINMLDEVEQRYRQYHHQ  258

Query  903   MQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG-----  1067
             MQ++ +SFEQAAG+GSA++YT LAL TISKQFRCLK AI+ QI+A +KSLGEEE      
Sbjct  259   MQIVTSSFEQAAGIGSAKTYTALALKTISKQFRCLKDAISDQIRAANKSLGEEEDGVGGA  318

Query  1068  --VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPK  1241
               + GSRLKF+DHHL QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPYPK
Sbjct  319   AKIEGSRLKFVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPK  378

Query  1242  DSDKIMLAKQTGLTRSQVSNWFINARV  1322
             DSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  379   DSDKHMLAKQTGLTRSQVSNWFINARV  405



>ref|XP_002299773.2| hypothetical protein POPTR_0001s22430g [Populus trichocarpa]
 gb|EEE84578.2| hypothetical protein POPTR_0001s22430g [Populus trichocarpa]
Length=732

 Score =   356 bits (914),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 249/475 (52%), Positives = 307/475 (65%), Gaps = 59/475 (12%)
 Frame = +3

Query  36    MAMYYQGSSEVQG-----DGLQTLYLMNPNYIG-FSDTALPQ----SQQAMFLNSGNALH  185
             MA Y+ GSSE+Q      DG+QTLYLMNPNY+  +SD    Q    S   +F N  N ++
Sbjct  1     MATYFHGSSEIQAAAAPSDGIQTLYLMNPNYLSSYSDATQQQHQQQSPNMIFFNHSNTVN  60

Query  186   AGGMPHARLPQSQHFVGVPLP--ASALGSAQLHDPAR-------------SLWAGLEQAG  320
                + H   PQ+ HFVG+PLP  +S + S+   + +R             ++W  ++Q  
Sbjct  61    -NSLSHGP-PQNHHFVGIPLPVPSSNITSSVPDNHSRPSSLHGVVPSVHYNIWGSIDQNS  118

Query  321   SGSGGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPF------R  482
               S      S+           +SQ+GF R VVVSP  +QGLSLSLS QQ P       R
Sbjct  119   VASAATASESSGAH-----DVMSSQVGFRRPVVVSP-GRQGLSLSLSSQQAPAPPTPYSR  172

Query  483   SLPMESPVGLLSARPGAAHD--------NSGASSSSITHGIS---GFITGSKYLKAAQEL  629
             ++  E  +  L                 NS  S S++++G+S     + GSKYL+A QEL
Sbjct  173   AISNEHEIQALHPHVSVVSSGDEIRLSGNSPPSVSAVSNGVSCMQNMVLGSKYLRATQEL  232

Query  630   LDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELT  809
             LDEV NV K L + +   A  KEK KM KES+   G        + GE+SA++   A+LT
Sbjct  233   LDEVANVGKDL-IKSGIIARTKEKMKMTKESI--TGDGSDGSGEAVGETSAKR--GADLT  287

Query  810   TAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTIS  989
             TA RQ+LQMKKAKL++M+DEV+QRYRQYHHQMQV+V+SFEQAAG G+A+SYT LAL TIS
Sbjct  288   TAHRQELQMKKAKLVTMLDEVDQRYRQYHHQMQVVVSSFEQAAGYGAAKSYTALALQTIS  347

Query  990   KQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAW  1157
             +QFR LK  IASQI+ATSKSLGEE+     V GSRL+++DH L QQRALQ LGM+Q NAW
Sbjct  348   RQFRSLKDTIASQIRATSKSLGEEDCIGAKVEGSRLRYVDHQLRQQRALQQLGMVQHNAW  407

Query  1158  RPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             RPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  408   RPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  462



>ref|XP_002266838.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653287.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653288.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653289.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653290.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
 ref|XP_010653292.1| PREDICTED: BEL1-like homeodomain protein 1 [Vitis vinifera]
Length=696

 Score =   353 bits (906),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 239/448 (53%), Positives = 294/448 (66%), Gaps = 45/448 (10%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQA--MFLNSGNA-LHAGGMPHA  206
             MA Y+ G+SE+Q DGLQTL LMNP Y+G+SD   P       +FLNS  A L    + HA
Sbjct  1     MATYFHGNSEIQADGLQTLILMNPAYVGYSDAPPPPPLHPNFVFLNSAAASLAPSNLSHA  60

Query  207   RLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSAVVSGGGGTTDF  386
               PQ+Q FV +PL A+A  ++       S+ A  E  G   G  Q P   +     TT  
Sbjct  61    PPPQTQQFVSIPLSATAPSASSDPS-PPSVHAHHEIPGL-PGFIQRPHYNLWSSIDTTAA  118

Query  387   ASQLGFHRSVVVSPTAQQGlslslsPQQHPF-------RSLPME-----SPVGLLSARPG  530
             A           +P +QQGLSLSLS QQ P        R +P +     SPV     R  
Sbjct  119   ARD---------TPRSQQGLSLSLSSQQPPAYGSYGNEREVPPQHATAISPVSD-DMRIS  168

Query  531   AAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakm  710
              A  +S +  S+   G+ G I  SKYLKAAQ+LLDEVVNV   +K +   + ++ E  K 
Sbjct  169   GASSSSASGISNGVSGMHGVILSSKYLKAAQQLLDEVVNVGNGIKTETPSKKSSSEATKT  228

Query  711   kkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQ  890
               E +             GGE+S +++A  +L+TA+RQ++QMKKAKLL+M+DEVEQRYRQ
Sbjct  229   LGEGL------------IGGETSTKRSA--DLSTAERQEIQMKKAKLLNMLDEVEQRYRQ  274

Query  891   YHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG-  1067
             YHHQMQ++++SFEQAAG+GSA++YT LAL TISKQFRCLK AI+ QI+A +KSLGEE+G 
Sbjct  275   YHHQMQIVISSFEQAAGIGSAKTYTALALQTISKQFRCLKDAISGQIRAANKSLGEEDGT  334

Query  1068  ---VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYP  1238
                + GSRLKF+DH L QQRALQ LGM+Q N WRPQRGLPER+VSVLRAWLFEHFLHPYP
Sbjct  335   GGKIEGSRLKFVDHQLRQQRALQQLGMIQQNVWRPQRGLPERSVSVLRAWLFEHFLHPYP  394

Query  1239  KDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             KDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  395   KDSDKHMLAKQTGLTRSQVSNWFINARV  422



>ref|XP_003540818.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006592357.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=741

 Score =   353 bits (906),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 242/497 (49%), Positives = 298/497 (60%), Gaps = 86/497 (17%)
 Frame = +3

Query  36    MAMYYQGS-SEV--QGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGN----------  176
             MA Y+ GS SE+    +GLQTLYLMNPNY+ +SD A   +Q  + +N  N          
Sbjct  1     MATYFHGSTSEIPSSAEGLQTLYLMNPNYVPYSDAAQHPTQNMLLVNPNNNNTSNTSPTS  60

Query  177   --ALHAGGMPHA------------RLPQSQHFVGVPLPAS-ALGS-AQLHDPARSLWAGL  308
               AL+ G   HA            R  Q  H +GV +P+S  LGS A   DPARS + G 
Sbjct  61    TNALNLGNFSHAPPPPSPNNNNNHREQQQHHLIGVTIPSSNILGSNAAATDPARSSFLGQ  120

Query  309   EQAGSGSGGQQIPSAVVSGGGG-------------------------------TTDFASQ  395
              +  S  GG    S V +  G                                ++  ++Q
Sbjct  121   HEFSSFHGGAAATSTVTASRGNYNLWGSIIDQSALNIMAATTHTPSSNMGCVASSVMSTQ  180

Query  396   LGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAHDNSGASSSSITH  575
             +GFHR   +S +        LS QQ P+RSL      G + A   A+    G     + +
Sbjct  181   IGFHRPNHLSLS--------LSSQQTPYRSLS-----GEIHAISPASRGGGGDDMRGLHN  227

Query  576   GISGFIT---GSKYLKAAQELLDEVVNVEKSL-KLDaaeeaankekakmkkeSMPPFggc  743
             G+S   +   GSKYLKA QELLDEVVNV K + K + + E A KEK K   ES       
Sbjct  228   GVSSMHSVALGSKYLKATQELLDEVVNVGKGISKGEESMEGAKKEKMKGNIES----TSG  283

Query  744   ggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVAS  923
              GD  + G E++ +     EL+TAQRQ+LQMKK+KL++M+DEVEQRYRQYHHQMQV++ S
Sbjct  284   VGDGSSCGRENNDRAKQGVELSTAQRQELQMKKSKLVTMLDEVEQRYRQYHHQMQVVLTS  343

Query  924   FEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKF  1091
             FEQAAGVG+A+SYT LAL TISKQFRCLK AI+SQIK TSK+LGE+      V GSRL++
Sbjct  344   FEQAAGVGAAKSYTALALKTISKQFRCLKDAISSQIKTTSKTLGEDNCLGVKVEGSRLRY  403

Query  1092  IDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQ  1271
             +D H  +Q+    LGM+Q NAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK+MLAKQ
Sbjct  404   VD-HQQRQQRALQLGMIQHNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKVMLAKQ  462

Query  1272  TGLTRSQVSNWFINARV  1322
             TGLTRSQVSNWFINARV
Sbjct  463   TGLTRSQVSNWFINARV  479



>ref|XP_010031566.1| PREDICTED: BEL1-like homeodomain protein 1 [Eucalyptus grandis]
 gb|KCW50924.1| hypothetical protein EUGRSUZ_J00574 [Eucalyptus grandis]
Length=693

 Score =   351 bits (900),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 228/456 (50%), Positives = 286/456 (63%), Gaps = 55/456 (12%)
 Frame = +3

Query  36    MAMYYQGSSEVQG-DGLQTLYLMNPNYIGFSDTALPQSQ-QAMFLNS-GNALHAGGMPHA  206
             MA Y+ GSSE++  DGLQTLY++NPN+I +S+ A   +    +FLN  G+A      P  
Sbjct  1     MATYFHGSSEIEATDGLQTLYILNPNFIPYSNAAHDATAPNTLFLNPMGSATQPAPSPQL  60

Query  207   RLPQSQHFVGVPL--PASALGSA------------QLHDPARSL-----WAGLEQAGSGS  329
                   HFVG+PL  PA+  G A             LH  A        W   + + + +
Sbjct  61    ---NHNHFVGIPLSGPAAPFGPAASDVHPNRHEIPSLHSVAPRFRLNHPWGQPDTSAAST  117

Query  330   GGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVG  509
                QI SA  S G       SQ G   S+    T Q  LS     + H  R  P     G
Sbjct  118   DQLQICSATNSAGVS----PSQRGLSLSLS---TEQSPLSRESDIRGHSHRQFP-----G  165

Query  510   LLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaa  689
             +  AR  A   NS ++ S++  G+ G + GSKYLKAAQELLDEVVNV K +K  ++ E A
Sbjct  166   INEARVLAR--NSSSTVSNVVLGLHGVLLGSKYLKAAQELLDEVVNVGKEIKNHSSAEGA  223

Query  690   nkekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDE  869
             NKEK+K+  +             +   +     ++ +EL  A RQ+LQMKKAKL+ M+DE
Sbjct  224   NKEKSKLGNKD-----------SSKEEKKVESSSSGSELGMAHRQELQMKKAKLVDMLDE  272

Query  870   VEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKS  1049
             VEQRY+QYH QMQ++V+SFEQAAG+G A+SYT LAL TIS+QF+CLK AI+SQIKAT +S
Sbjct  273   VEQRYKQYHSQMQLVVSSFEQAAGIGVAKSYTALALQTISRQFKCLKDAISSQIKATGRS  332

Query  1050  LGEEE--GVR--GSRLKFIDHHLPQQRALQHLGMM-QPNAWRPQRGLPERAVSVLRAWLF  1214
             LGE++  GV+  GSRL+++DHH  QQRAL  LG++ Q N WRPQRGLPERAVSVLRAWLF
Sbjct  333   LGEDDCMGVKMEGSRLRYVDHHFQQQRALHQLGIIHQNNTWRPQRGLPERAVSVLRAWLF  392

Query  1215  EHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             EHFLHPYPKDSDK MLAKQ GLTRSQVSNWFINARV
Sbjct  393   EHFLHPYPKDSDKHMLAKQAGLTRSQVSNWFINARV  428



>ref|XP_010089795.1| BEL1-like homeodomain protein 1 [Morus notabilis]
 gb|EXB38411.1| BEL1-like homeodomain protein 1 [Morus notabilis]
Length=687

 Score =   350 bits (899),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 237/477 (50%), Positives = 280/477 (59%), Gaps = 75/477 (16%)
 Frame = +3

Query  36    MAMYYQ-GSSEVQG-DGL-QTLYLMNPN-YI-GFSDT-----ALPQSQQAMFL-NSGNAL  182
             MA Y+  GSSE+Q  DGL  TLYLMNPN Y+  +SDT     + P +  +MFL N   A+
Sbjct  1     MATYFHHGSSEIQTPDGLTHTLYLMNPNNYVPTYSDTQQEQQSPPAAVASMFLLNPAAAV  60

Query  183   HAGGMPHARLPQSQHFVGVPLPASALGSAQLHD------------------PAR---SLW  299
              A   P       +H  G+P+ +S  GS  L D                  P R   +LW
Sbjct  61    SAPTHP------GRHLAGIPVLSSGPGSNNLPDHHGEIPPFHGISGVAAAPPPRLHYNLW  114

Query  300   AGLEQAGSGSGGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPF  479
             A  +Q                      D  S +GF R  V SPT Q       S QQ   
Sbjct  115   APTDQVA-------------------VDVVSPMGFRRQAV-SPTQQALSLSLSSSQQTST  154

Query  480   ----------RSLPMESPVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQEL  629
                         +P  SP      R    +  S A S+ I +     + GSKYLKAA EL
Sbjct  155   AYATSLSGENEVVPGISPTSCDDIRAFPGNSMSSAVSNGIGNSAQSVLLGSKYLKAAHEL  214

Query  630   LDEVVNV--EKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAE  803
             LDEVVNV   K +K    + A    +   K +         G    SGGESS  K   AE
Sbjct  215   LDEVVNVGSTKGVKTATTDSADGGREKTAKIDRESTPAAAIGGSYNSGGESSCSK-QGAE  273

Query  804   LTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNT  983
             L+TAQRQ+LQ+KKAKL  M+DEVEQRYRQYHHQMQV++++FE+AAG GSA+SYT L L T
Sbjct  274   LSTAQRQELQVKKAKLARMLDEVEQRYRQYHHQMQVVISTFEEAAGFGSAKSYTALGLKT  333

Query  984   ISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPN  1151
             ISKQFRCLK AI+SQIKA SKSLGEEE     + GSRL+++DHHL QQRALQ LGM+Q N
Sbjct  334   ISKQFRCLKDAISSQIKAASKSLGEEECLGVKIEGSRLRYVDHHLRQQRALQQLGMIQHN  393

Query  1152  AWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             AWRPQRGLPERAVSVLRAWLFEHFLHPYPK +DK++LAKQTGLTRSQVSNWFINARV
Sbjct  394   AWRPQRGLPERAVSVLRAWLFEHFLHPYPKTADKVILAKQTGLTRSQVSNWFINARV  450



>ref|XP_009787672.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009787673.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
 ref|XP_009787674.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana sylvestris]
Length=707

 Score =   347 bits (889),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 226/456 (50%), Positives = 282/456 (62%), Gaps = 52/456 (11%)
 Frame = +3

Query  36    MAMYYQGSSEVQG--DGLQTLYLMNP-NYIGFSDTALPQ----SQQAMFLNS---GNALH  185
             MA Y+ G+SE+QG  DGLQTL LMNP  Y+GFS+T   Q        +F NS   GN+L+
Sbjct  1     MAAYFPGNSEIQGGNDGLQTLILMNPAGYVGFSETQHHQPPAGGSNLVFFNSNPPGNSLN  60

Query  186   AGGMPHARLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSA----  353
                + HA     Q FVG+PL  SA  +    D                 G   P+     
Sbjct  61    ---LSHAPPSSQQQFVGIPLATSAFTAPSSQD-----------------GTTTPTVHSQH  100

Query  354   VVSGGGGTTDFASQLGFH-------RSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGL  512
              +S   G    + + GF+        +  V+   QQGLSLSLS QQ  F +   E    +
Sbjct  101   DISALHGFLARSHEYGFYNPSNNITEAREVTRAQQQGLSLSLSSQQPGFGNFRPEREELM  160

Query  513   LSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaan  692
              +  P A   +S ++S+  +  +S      KYLKAAQELLDEVVNV K++K    +E  N
Sbjct  161   TTVSPTAVGGSSSSASAVQSVPLS-----PKYLKAAQELLDEVVNVGKAVKTSTTDEDVN  215

Query  693   kekakmkkeSMPPFggcggdpptsggE--SSAQKTAAAELTTAQRQDLQMKKAKLLSMVD  866
               +       +           T+G E   S  K   AEL+TA+RQ++QMKKAKL++M+D
Sbjct  216   DGQKSKNNGELSGNMATAAAAATAGQEGGESNSKRDGAELSTAERQEIQMKKAKLVNMLD  275

Query  867   EVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSK  1046
             EVEQRYR YH QMQ +++  EQAAG+GSA++YT LAL TISKQFRCLK AI  QI++ SK
Sbjct  276   EVEQRYRHYHQQMQSVISWLEQAAGIGSAKTYTALALQTISKQFRCLKDAITGQIRSASK  335

Query  1047  SLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLF  1214
             +LGEE+     + GSRLKF+D+ + QQRALQ LGM+Q NAWRPQRGLPERAVSVLRAWLF
Sbjct  336   TLGEEDSFGGKIEGSRLKFVDNQIRQQRALQQLGMIQHNAWRPQRGLPERAVSVLRAWLF  395

Query  1215  EHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             EHFLHPYPKDSDK+MLAKQTGLTRSQVSNWFINARV
Sbjct  396   EHFLHPYPKDSDKMMLAKQTGLTRSQVSNWFINARV  431



>ref|XP_004506223.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=636

 Score =   343 bits (881),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 231/471 (49%), Positives = 277/471 (59%), Gaps = 88/471 (19%)
 Frame = +3

Query  42    MYY---QGSSEVQ--GDGLQTLYLMNPNYIGFSDTALPQSQQAMF---LNSGNALHAGGM  197
             MY+     SSE Q   +GLQTLYLMNPNY+ +S +  P +Q  +F    N+ ++ HA  +
Sbjct  1     MYFHCNNNSSEFQPSAEGLQTLYLMNPNYVPYSHS--PHTQNMLFNATTNNSSSHHALDL  58

Query  198   ---PHA---RLPQSQHFVGVPLPAS-----------ALGSAQLHDPARS---LWAGLEQA  317
                PHA    LP   +F G     +           AL SA  +  +RS   LW      
Sbjct  59    VKSPHAPSFTLPSISNFHGSNTADTPTQHYELSGFHALASAA-NATSRSHYNLWGS----  113

Query  318   GSGSGGQQIPSAVVSGGGGTT-----------DFASQLGFHRSVVVSPTAQQGlslslsP  464
                  G  IP   V+     +           +F  Q+ FH      P  Q+ LSLSLS 
Sbjct  114   -----GNLIPDQSVTATTTNSVVVAVTTTAAAEFPPQIDFHM-----PIYQRSLSLSLSS  163

Query  465   QQHPFRSLPMESPVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVV  644
              Q P+RS+  E  V   S+R G      G SS      + G   GSKYLKAAQELLDE V
Sbjct  164   NQTPYRSVSGEVEV-CPSSRGG------GISS------MHGVFLGSKYLKAAQELLDEFV  210

Query  645   NVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQ  824
             NV+K +                 + S                     K    EL+TAQRQ
Sbjct  211   NVDKGI--------------YKGENSNNNNKEKKKTNVEWSSSGDGGKLQVGELSTAQRQ  256

Query  825   DLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRC  1004
             +LQMKK+KL+SM+DEVE RYRQYHH+MQV+ +SFEQAAG G+++SYT LAL TISKQFR 
Sbjct  257   ELQMKKSKLVSMLDEVELRYRQYHHEMQVVTSSFEQAAGYGASKSYTSLALKTISKQFRS  316

Query  1005  LKVAIASQIKATSKSLGEEE--GVR---GSRLKFIDHHLPQQRALQHLGMMQPNAWRPQR  1169
             LK AI SQIK TSKSLGE++  GV+    SRL+F+DHHL QQRALQ LGM+Q NAWRPQR
Sbjct  317   LKDAICSQIKRTSKSLGEDDCLGVKVEGSSRLRFVDHHLRQQRALQQLGMIQNNAWRPQR  376

Query  1170  GLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             GLPERAVSVLRAWLFEHFLHPYPKDSDK+MLA+QTGLTRSQVSNWFINARV
Sbjct  377   GLPERAVSVLRAWLFEHFLHPYPKDSDKVMLARQTGLTRSQVSNWFINARV  427



>emb|CAN63083.1| hypothetical protein VITISV_015358 [Vitis vinifera]
Length=709

 Score =   344 bits (882),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 239/461 (52%), Positives = 294/461 (64%), Gaps = 58/461 (13%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQA--MFLNSGNA-LHAGGMPHA  206
             MA Y+ G+SE+Q DGLQTL LMNP Y+G+SD   P       +FLNS  A L    + HA
Sbjct  1     MATYFHGNSEIQADGLQTLILMNPAYVGYSDAPPPPPLHPNFVFLNSAAASLAPSNLSHA  60

Query  207   RLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSAVVSGGGGTTDF  386
               PQ+Q FV +PL A+A  ++       S+ A  E  G   G  Q P   +     TT  
Sbjct  61    PPPQTQQFVSIPLSATAPSASSDPS-PPSVHAHHEIPGL-PGFIQRPHYNLWSSIDTTAA  118

Query  387   ASQLGFHRSVVVSPTAQQGlslslsPQQHPF-------RSLPME-----SPVGLLSARPG  530
             A           +P +QQGLSLSLS QQ P        R +P +     SPV     R  
Sbjct  119   ARD---------TPRSQQGLSLSLSSQQPPAYGSYGNEREVPPQHATAISPVSD-DMRIS  168

Query  531   AAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakm  710
              A  +S +  S+   G+ G I  SKYLKAAQ+LLDEVVNV   +K +   + ++ E  K 
Sbjct  169   GASSSSASGISNGVSGMHGVILSSKYLKAAQQLLDEVVNVGNGIKTETPSKKSSSEATKT  228

Query  711   kkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQ  890
               E +             GGE+S +++A  +L+TA+RQ++QMKKAKLL+M+DEVEQRYRQ
Sbjct  229   LGEGL------------IGGETSTKRSA--DLSTAERQEIQMKKAKLLNMLDEVEQRYRQ  274

Query  891   YHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG-  1067
             YHHQMQ++++SFEQAAG+GSA++YT LAL TISKQFRCLK AI+ QI+A +KSLGEE+G 
Sbjct  275   YHHQMQIVISSFEQAAGIGSAKTYTALALQTISKQFRCLKDAISGQIRAANKSLGEEDGT  334

Query  1068  ---VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYP  1238
                + GSRLKF+DH L QQRALQ LGM+Q N WRPQRGLPER+VSVLRAWLFEHFLHPYP
Sbjct  335   GGKIEGSRLKFVDHQLRQQRALQQLGMIQQNVWRPQRGLPERSVSVLRAWLFEHFLHPYP  394

Query  1239  KDSDKIMLAKQTGLTRS-------------QVSNWFINARV  1322
             KDSDK MLAKQTGLTRS             QVSNWFINARV
Sbjct  395   KDSDKHMLAKQTGLTRSQIMGTLNQSFVIMQVSNWFINARV  435



>ref|XP_009628712.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628714.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
 ref|XP_009628715.1| PREDICTED: BEL1-like homeodomain protein 1 [Nicotiana tomentosiformis]
Length=700

 Score =   343 bits (881),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 218/453 (48%), Positives = 270/453 (60%), Gaps = 54/453 (12%)
 Frame = +3

Query  36    MAMYYQGSSEVQG--DGLQTLYLMNP-NYIGFSDTALPQS--QQAMFLNS---GNALHAG  191
             MA Y+ G+SE+QG  DGLQTL LMNP  Y+GFS+T  P +     +F NS   GN+L+  
Sbjct  1     MAAYFDGNSEIQGGNDGLQTLILMNPAGYVGFSETQQPPAGGSNLVFFNSNPLGNSLN--  58

Query  192   GMPHAR-LPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSA----V  356
              +PHAR   Q Q FVG+PL  S   +                  S   G   P+      
Sbjct  59    -LPHARPSSQQQQFVGIPLATSVFTAP----------------SSFPDGTTTPTVHSQHD  101

Query  357   VSGGGGTTDFASQLGFH-------RSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLL  515
             +S   G    + + GF+        +  V+   QQGLSLSLS QQ  F +   E    + 
Sbjct  102   ISALHGFLARSHEYGFYNPSNDIMEAREVTRAQQQGLSLSLSSQQPGFGNFRPEREELVT  161

Query  516   SARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaank  695
             +  P A            +  +       KYLKAAQELLDEVVNV K++K     E  N 
Sbjct  162   TVSPTAG--------GGSSSSVQSVPLSPKYLKAAQELLDEVVNVGKAVKTSTTTEDVNY  213

Query  696   ekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVE  875
              +                        S   K    EL+ A+RQ++QMKKAKL++M+DEVE
Sbjct  214   SQKSKNNGESSGNMATAAGQEGGETNS---KRDGPELSAAERQEIQMKKAKLVNMLDEVE  270

Query  876   QRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLG  1055
             QRYR YH QMQ +++  EQAAG+GSA++YT LAL TISKQFRCLK AI  QI++ SK+LG
Sbjct  271   QRYRHYHQQMQSVISWLEQAAGIGSAKTYTALALKTISKQFRCLKDAITGQIRSASKTLG  330

Query  1056  EEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHF  1223
             E++     + GSRLKF+D+ + QQRALQ LGM+Q NAWRPQRGLPERAVSVLRAWLFEHF
Sbjct  331   EDDSFGGKIEGSRLKFVDNQIRQQRALQQLGMIQHNAWRPQRGLPERAVSVLRAWLFEHF  390

Query  1224  LHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             LHPYP+DSDK+MLAKQTGLTRSQVSNWFINARV
Sbjct  391   LHPYPRDSDKMMLAKQTGLTRSQVSNWFINARV  423



>ref|XP_006424091.1| hypothetical protein CICLE_v10027955mg [Citrus clementina]
 gb|ESR37331.1| hypothetical protein CICLE_v10027955mg [Citrus clementina]
Length=671

 Score =   343 bits (879),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 231/460 (50%), Positives = 281/460 (61%), Gaps = 45/460 (10%)
 Frame = +3

Query  36    MAMYYQ-GSSEVQ---GDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGNALHAGGMPH  203
             MA Y+    SE+Q   G G+QTLYLMNP+Y     T+LP +   + LN  N  HA   P 
Sbjct  1     MATYFHLNPSEIQAGDGGGMQTLYLMNPSYD--YTTSLPNN--TLLLNPVNLSHAP--PS  54

Query  204   ARLPQSQH-FVGVPLPASALGSAQLHDPA------RSLWAGLEQAGSGSGGQQIPSAVVS  362
                 Q QH  VG+PLP +A  S    D          LW+ ++Q  + S   Q   A ++
Sbjct  55    NDHQQQQHPLVGIPLPHAASSSHDHQDNIPGGGVHYDLWSSIDQ--NSSQNNQTHMASLA  112

Query  363   GGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAHD  542
                  ++  + LG  R V   P  QQGLSLSLS QQ    + P+ +     S      H 
Sbjct  113   AAAAASNSTAPLGLLRPVASVPNRQQGLSLSLSSQQVAAYNRPINN--NNNSIEVDDLHK  170

Query  543   NSG----------------ASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDa  674
               G                 +SS I       I GSKYLKAAQELLDEVV VE  +   +
Sbjct  171   GRGLQQGQVTESSPSSVSVVTSSGINSSTQSAILGSKYLKAAQELLDEVVKVESMIIKGS  230

Query  675   aeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLL  854
                 + K     +   M      G       G+S+    ++ ELTTAQRQ+LQ+KKAKL+
Sbjct  231   DHHHSAKAAQIKETMKMNRESIDGDQELNGTGDSTK---SSFELTTAQRQELQIKKAKLV  287

Query  855   SMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIK  1034
             +M+DEVEQRY+QYHHQMQV+V++FEQAAG GSA+SYT LAL TISKQFRCLK AI++QIK
Sbjct  288   NMLDEVEQRYKQYHHQMQVVVSAFEQAAGFGSAKSYTALALRTISKQFRCLKDAISAQIK  347

Query  1035  ATSKSLGEEEGV----RGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLR  1202
             ATSK LGE++ +     GSRL+FIDH + QQRALQHLG MQ +AWRPQRGLPERAV++LR
Sbjct  348   ATSKKLGEDDCLGAKAEGSRLRFIDHQIRQQRALQHLG-MQHHAWRPQRGLPERAVTILR  406

Query  1203  AWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             AWLFEHFLHPYPKDSDK  LAKQTGLTRSQVSNWFINARV
Sbjct  407   AWLFEHFLHPYPKDSDKQQLAKQTGLTRSQVSNWFINARV  446



>gb|KDO46590.1| hypothetical protein CISIN_1g005901mg [Citrus sinensis]
 gb|KDO46591.1| hypothetical protein CISIN_1g005901mg [Citrus sinensis]
 gb|KDO46592.1| hypothetical protein CISIN_1g005901mg [Citrus sinensis]
Length=671

 Score =   342 bits (878),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 231/460 (50%), Positives = 281/460 (61%), Gaps = 45/460 (10%)
 Frame = +3

Query  36    MAMYYQ-GSSEVQ---GDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGNALHAGGMPH  203
             MA Y+    SE+Q   G G+QTLYLMNP+Y     T+LP +   + LN  N  HA   P 
Sbjct  1     MATYFHLNPSEIQAGDGGGMQTLYLMNPSYD--YTTSLPNN--TLLLNPVNLSHAP--PS  54

Query  204   ARLPQSQH-FVGVPLPASALGSAQLHDPA------RSLWAGLEQAGSGSGGQQIPSAVVS  362
                 Q QH  VG+PLP +A  S    D          LW+ ++Q  + S   Q   A ++
Sbjct  55    NDHQQQQHPLVGIPLPHAASSSHDHQDNIPGGGVHYDLWSSIDQ--NSSQNNQTHMASLA  112

Query  363   GGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAHD  542
                  ++  + LG  R V   P  QQGLSLSLS QQ    + P+ +     S      H 
Sbjct  113   AAAAASNSTAPLGLLRPVASVPNRQQGLSLSLSSQQVAAYNRPINN--NNNSIEVDDLHK  170

Query  543   NSG----------------ASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDa  674
               G                 +SS I       I GSKYLKAAQELLDEVV VE  +   +
Sbjct  171   GRGLQQGQVTESSPSSVSVVTSSGINSSTQSAILGSKYLKAAQELLDEVVKVESMIIKGS  230

Query  675   aeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLL  854
                 + K     +   M      G       G+S+    ++ ELTTAQRQ+LQ+KKAKL+
Sbjct  231   DHHHSAKAAQIKETMKMNRESIDGDQELNGTGDSTK---SSFELTTAQRQELQIKKAKLV  287

Query  855   SMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIK  1034
             +M+DEVEQRY+QYHHQMQV+V++FEQAAG GSA+SYT LAL TISKQFRCLK AI++QIK
Sbjct  288   NMLDEVEQRYKQYHHQMQVVVSAFEQAAGFGSAKSYTALALRTISKQFRCLKDAISAQIK  347

Query  1035  ATSKSLGEEEGV----RGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLR  1202
             ATSK LGE++ +     GSRL+FIDH + QQRALQHLG MQ +AWRPQRGLPERAV++LR
Sbjct  348   ATSKKLGEDDCLGAKAEGSRLRFIDHQIRQQRALQHLG-MQHHAWRPQRGLPERAVTILR  406

Query  1203  AWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             AWLFEHFLHPYPKDSDK  LAKQTGLTRSQVSNWFINARV
Sbjct  407   AWLFEHFLHPYPKDSDKQQLAKQTGLTRSQVSNWFINARV  446



>ref|XP_006494895.1| PREDICTED: BEL1-like homeodomain protein 1-like [Citrus sinensis]
Length=672

 Score =   342 bits (878),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 234/460 (51%), Positives = 286/460 (62%), Gaps = 44/460 (10%)
 Frame = +3

Query  36    MAMYYQ-GSSEVQ---GDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGNALHAGGMPH  203
             MA Y+    SE+Q   G G+QTLYLMNP+Y     T+LP +   + LN  N  HA   P 
Sbjct  1     MATYFHLNPSEIQAGDGGGMQTLYLMNPSYD--YTTSLPNN--TLLLNPVNLSHAP--PS  54

Query  204   ARLPQSQH-FVGVPLPASALGSAQLHDPA------RSLWAGLEQAGSGSGGQQIPSAVVS  362
                 Q QH  VG+PLP +A  S    D          LW+ ++Q  + S   Q   A ++
Sbjct  55    NDHQQQQHPLVGIPLPHAASSSHDHQDNIPGGGVHYDLWSSIDQ--NSSQNNQTHMASLA  112

Query  363   GGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAHD  542
                  ++ ++ LG  R V   P  QQGLSLSLS QQ    + P+ +     S      H 
Sbjct  113   AAAAASNSSAPLGLLRPVASVPNRQQGLSLSLSSQQVAAYNRPINN--NNNSIEVDDLHK  170

Query  543   NSG----------------ASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDa  674
               G                 +SS I       I GSKYLKAAQELLDEVV VE S+ +  
Sbjct  171   GRGLQQGQVTESSPSSVSVVTSSGINSSTQSAILGSKYLKAAQELLDEVVKVE-SMIIKG  229

Query  675   aeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLL  854
             ++   +  KA   KE+M              G   + K++  ELTTAQRQ+LQ+KKAKL+
Sbjct  230   SDHHHHSAKAAQIKETMKMNRESIDGDQELNGTGDSTKSSF-ELTTAQRQELQIKKAKLV  288

Query  855   SMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIK  1034
             +M+DEVEQRY+QYHHQMQV+V++FEQAAG GSA+SYT LAL TISKQFRCLK AI++QIK
Sbjct  289   NMLDEVEQRYKQYHHQMQVVVSAFEQAAGFGSAKSYTALALRTISKQFRCLKDAISAQIK  348

Query  1035  ATSKSLGEEEGV----RGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLR  1202
             ATSK LGE++ +     GSRL+FIDH + QQRALQHLG MQ +AWRPQRGLPERAV++LR
Sbjct  349   ATSKKLGEDDCLGAKAEGSRLRFIDHQIRQQRALQHLG-MQHHAWRPQRGLPERAVTILR  407

Query  1203  AWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             AWLFEHFLHPYPKDSDK  LAKQTGLTRSQVSNWFINARV
Sbjct  408   AWLFEHFLHPYPKDSDKQQLAKQTGLTRSQVSNWFINARV  447



>ref|XP_007132496.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
 ref|XP_007132497.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
 gb|ESW04490.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
 gb|ESW04491.1| hypothetical protein PHAVU_011G099100g [Phaseolus vulgaris]
Length=733

 Score =   343 bits (881),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 231/496 (47%), Positives = 283/496 (57%), Gaps = 89/496 (18%)
 Frame = +3

Query  36    MAMYYQGS-SEV--QGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGNA---------  179
             MA Y+ GS SE+    +GLQTLYLMNPNY+ +SD A   +Q  + +NS NA         
Sbjct  1     MATYFHGSTSEIPSSAEGLQTLYLMNPNYVPYSDAAQHPAQNMLLVNSNNASNTSPTSAN  60

Query  180   -LHAGGMPHARLPQS----------QHFVGVPLPASAL--GSAQLHDPAR----------  290
              L+ G   HA  P S           H +G+ +P+S +   +    D AR          
Sbjct  61    ALNLGNFTHAPPPPSPNNHRDQQHHHHLIGLTIPSSNIIGSNTATGDHARPSFLGHHEFS  120

Query  291   -------------------SLWAGL--EQAGSGSGGQQIPSAVVSGGGGTTDFASQLGFH  407
                                +LW  +  + A +       PS  +         ++Q+GFH
Sbjct  121   GFHGGATAATTASTSRSNYNLWGSIFDQSASNMVATTNTPSENMGCVASAVTASTQIGFH  180

Query  408   RSVVVSPTAQQGlslslsPQQHPFRSLPME----SPVGLLSARPGAAHDNSGASSSSITH  575
             R   +S        LSLS QQ P+RSL  +    SP  L            G     + +
Sbjct  181   RPNHLS--------LSLSSQQTPYRSLSGDVHAISPASL-----------GGDDMRGLQN  221

Query  576   GISGFIT---GSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcg  746
             G+S   +   GSKYLK+ QELLDEVVNV K +          K++            G G
Sbjct  222   GVSSMHSVALGSKYLKSTQELLDEVVNVGKGISKGRESMEGAKKEKMKGNIESTSGVGDG  281

Query  747   gdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASF  926
                     +   Q     EL TAQRQ+LQMKK+KL+SM+DEVEQRYRQYHHQMQ++V SF
Sbjct  282   SSCGGENNDGGKQ---GGELGTAQRQELQMKKSKLVSMLDEVEQRYRQYHHQMQIVVTSF  338

Query  927   EQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFI  1094
             EQAAGVG+A+SYT LAL TISKQFRCLK AI+SQIK  SK+LGE++     V  SRL+++
Sbjct  339   EQAAGVGAAKSYTALALRTISKQFRCLKDAISSQIKTASKTLGEDDCLGVKVESSRLRYV  398

Query  1095  DHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQT  1274
             DH L QQRALQ LGM+Q NAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK+MLAKQT
Sbjct  399   DHQLRQQRALQQLGMIQHNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKVMLAKQT  458

Query  1275  GLTRSQVSNWFINARV  1322
             GLTRSQVSNWFINARV
Sbjct  459   GLTRSQVSNWFINARV  474



>ref|XP_003539486.1| PREDICTED: BEL1-like homeodomain protein 1-like, partial [Glycine 
max]
Length=526

 Score =   337 bits (863),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 171/253 (68%), Positives = 200/253 (79%), Gaps = 9/253 (4%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             G+SG I GS YLKAAQELLDE VNV K +  +       K   +            GG  
Sbjct  4     GVSGVIMGSNYLKAAQELLDEAVNVGKGIYKEEKFAEKVKANRESTNSGA-----AGGGD  58

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
              +SGG  ++      EL+TAQRQ+LQMKK+KL+SM+DEVEQRYRQYHHQMQ++V+SFEQA
Sbjct  59    GSSGGGENSAGKQVVELSTAQRQELQMKKSKLVSMLDEVEQRYRQYHHQMQIVVSSFEQA  118

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHH  1103
             AG G+A+SYT LAL TISKQFRCLK AI++QIKATSK+LGE++     V GSRL+++DHH
Sbjct  119   AGYGAAKSYTALALKTISKQFRCLKDAISAQIKATSKTLGEDDCLGVKVEGSRLRYVDHH  178

Query  1104  LPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLT  1283
             L QQRALQ LGM+QPNAWRPQRGLPERAVS+LRAWLFEHFLHPYPKDSDK+MLAKQTGL+
Sbjct  179   LRQQRALQQLGMIQPNAWRPQRGLPERAVSILRAWLFEHFLHPYPKDSDKVMLAKQTGLS  238

Query  1284  RSQVSNWFINARV  1322
             RSQVSNWFINARV
Sbjct  239   RSQVSNWFINARV  251



>ref|XP_003539151.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006591059.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006591060.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
Length=764

 Score =   343 bits (879),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 242/494 (49%), Positives = 291/494 (59%), Gaps = 79/494 (16%)
 Frame = +3

Query  36    MAMYYQGSSE---VQGDGLQTLYLMNPNYI-GFSDTALPQSQQAMFLN-----------S  170
             MA Y+ GS+       +GLQTLYLMNPNY+  +SD A   +Q  + +N           S
Sbjct  1     MATYFHGSTSETPSSAEGLQTLYLMNPNYVVPYSDAAQHPTQNMLLVNPNNNTSNTSSTS  60

Query  171   GNALHAGGMPHA---------RLPQSQHFVGVPLPASA-LGSAQLHDPARS---------  293
              NAL+ G   HA         R     H  GV +P+S  L S    DPARS         
Sbjct  61    TNALNLGNFSHAPPPPSPNNNREHHHHHLTGVTIPSSNFLLSNAAADPARSSFLGQHEFS  120

Query  294   ----------------------LWAGL-EQAGSG--SGGQQIPSAVVSGGGGTTDFASQL  398
                                   LW  + +Q+ S   +     PS   S  G     ++Q+
Sbjct  121   GFHSSAAATTSTAAASRGNNYNLWGSIFDQSASNIMTSTTHTPS---SNMGCVIGHSTQI  177

Query  399   GFHRSVVVSPTAQQGlslslsPQQHPFRSLPMES-PVGLLSARPGAAHDNSGASSSSITH  575
             GFHR   +S        LSLS QQ P+ SL  E+  + L +   G        +  S  H
Sbjct  178   GFHRPNHLS--------LSLSSQQTPYSSLSGETHAISLANRGGGGDDMRGMHNGVSSMH  229

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSL-KLDaaeeaankekakmkkeSMPPFggcggd  752
              +S    GSKYLKA QELLDEVVNV K + K + + E   KEK K   ES    G     
Sbjct  230   SVS---LGSKYLKATQELLDEVVNVGKGIFKGEESMEGDKKEKMKGNIESSSWVGDGSSC  286

Query  753   pptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQ  932
                    ++       EL+TAQRQ+LQMKK+KL++M+DEVEQRYRQYHHQMQV++ SFEQ
Sbjct  287   GGGENNNNNDGGKQGVELSTAQRQELQMKKSKLVTMLDEVEQRYRQYHHQMQVVITSFEQ  346

Query  933   AAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDH  1100
             AAGVG+A+SYT LAL TISKQFRCLK AI+SQIK TSK+LGE++     V GSRL+++DH
Sbjct  347   AAGVGAAKSYTALALKTISKQFRCLKDAISSQIKTTSKTLGEDDCLGVKVEGSRLRYVDH  406

Query  1101  HLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGL  1280
              L QQRALQ LGM+Q NAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK+MLAKQTGL
Sbjct  407   QLRQQRALQQLGMIQHNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKVMLAKQTGL  466

Query  1281  TRSQVSNWFINARV  1322
             TRSQVSNWFINARV
Sbjct  467   TRSQVSNWFINARV  480



>gb|KHN19925.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=767

 Score =   343 bits (879),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 241/494 (49%), Positives = 291/494 (59%), Gaps = 79/494 (16%)
 Frame = +3

Query  36    MAMYYQGSSE---VQGDGLQTLYLMNPNYI-GFSDTALPQSQQAMFLN-----------S  170
             MA Y+ GS+       +GLQTLYLMNPNY+  +SD A   +Q  + +N           S
Sbjct  1     MATYFHGSTSETPSSAEGLQTLYLMNPNYVVPYSDAAQHPTQNMLLVNPNNNTSNTSSTS  60

Query  171   GNALHAGGMPHA---------RLPQSQHFVGVPLPASA-LGSAQLHDPARS---------  293
              NAL+ G   HA         R     H  GV +P+S  L S    DPARS         
Sbjct  61    TNALNLGNFSHAPPPPSPNNNREHHHHHLTGVTIPSSNFLLSNAAADPARSSFLGQHEFS  120

Query  294   ----------------------LWAGL-EQAGSG--SGGQQIPSAVVSGGGGTTDFASQL  398
                                   LW  + +Q+ S   +     PS   S  G     ++Q+
Sbjct  121   GFHSSAAATTSTAAASRGNNYNLWGSIFDQSASNIMTSTTHTPS---SNMGCVIGHSTQI  177

Query  399   GFHRSVVVSPTAQQGlslslsPQQHPFRSLPMES-PVGLLSARPGAAHDNSGASSSSITH  575
             GFHR   +S        LSLS QQ P+ SL  E+  + L +   G        +  S  H
Sbjct  178   GFHRPNHLS--------LSLSSQQTPYSSLSGETHAISLANRGGGGDDMRGMHNGVSSMH  229

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSL-KLDaaeeaankekakmkkeSMPPFggcggd  752
              +S    GSKYLKA QELLDEVVNV K + K + + E   KEK K   ES    G     
Sbjct  230   SVS---LGSKYLKATQELLDEVVNVGKGIFKGEESMEGDKKEKMKGNIESTSWVGDGSSC  286

Query  753   pptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQ  932
                    ++       EL+TAQRQ+LQMKK+KL++M+DEVEQRYRQYHHQMQ+++ SFEQ
Sbjct  287   GGGENNNNNDGGKQGVELSTAQRQELQMKKSKLVTMLDEVEQRYRQYHHQMQIVITSFEQ  346

Query  933   AAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDH  1100
             AAGVG+A+SYT LAL TISKQFRCLK AI+SQIK TSK+LGE++     V GSRL+++DH
Sbjct  347   AAGVGAAKSYTALALKTISKQFRCLKDAISSQIKTTSKTLGEDDCLGVKVEGSRLRYVDH  406

Query  1101  HLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGL  1280
              L QQRALQ LGM+Q NAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK+MLAKQTGL
Sbjct  407   QLRQQRALQQLGMIQHNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKVMLAKQTGL  466

Query  1281  TRSQVSNWFINARV  1322
             TRSQVSNWFINARV
Sbjct  467   TRSQVSNWFINARV  480



>gb|KEH29763.1| BEL1-related homeotic protein [Medicago truncatula]
Length=711

 Score =   340 bits (873),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 235/489 (48%), Positives = 294/489 (60%), Gaps = 91/489 (19%)
 Frame = +3

Query  36    MAMYYQG-----SSEVQG--DGLQTLYLMNPNYIGFSDTALPQSQQAMFLN---------  167
             MA Y+ G     SSE+Q   +GLQTLYLMNPNY+ +S+       Q M            
Sbjct  1     MATYFHGNSNSNSSEIQPSVEGLQTLYLMNPNYVPYSEEEPQNPTQNMLFANPNATTNNN  60

Query  168   -SGNALHAGGMPHARLPQSQH-FVGVPLPASALGSAQLHD--------------------  281
              S +ALH    PHA    +QH  +GV +P S    +   D                    
Sbjct  61    TSPHALHGFKFPHAPSSLNQHHLLGVTIPPSNFHGSNTTDTPTQPYEVSTFHPFASSATV  120

Query  282   ---PARSLWAGLEQAGSGSGGQQIPSAVVSGGG-------------GTTDFASQ-LGFHR  410
                P  ++W      GSGS    IP   V+                 +T+F SQ +GFHR
Sbjct  121   TPRPHYNMW------GSGSF---IPDHTVTATTTDRSECSDVVAVTSSTEFRSQQIGFHR  171

Query  411   SVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAHDNSGASSSSITHGISGF  590
                  P  Q+GLSLSLS QQ P+RS       G +   PG+     G   S++    +G 
Sbjct  172   -----PIYQRGLSLSLSSQQTPYRSAS-----GEIEVSPGSRGGEEGGGVSTM----NGV  217

Query  591   ITGSKYLKAAQELLDEVVNVEKSL-KLDaaeeaankekakmkkeSMPPFggcggdpptsg  767
             + GSKYLK AQELLDEVVNV+K + K ++ E   +    + +K ++           + G
Sbjct  218   VFGSKYLKVAQELLDEVVNVDKGIIKGESVEGGNSNNNKEKRKVNI-------ESSSSGG  270

Query  768   gESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVG  947
              E+   K   AEL+TAQRQ+LQMKK+KL+SM+DEVE RYRQYHHQMQ +++SFEQA G G
Sbjct  271   RENDGGK-QVAELSTAQRQELQMKKSKLVSMLDEVELRYRQYHHQMQSVISSFEQATGYG  329

Query  948   SARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE--GVR--GSRLKFIDHHLPQQ  1115
             +++SYT LAL TISKQFR LK +I+SQIK  SK+LGE++  GV+  GSRL+++DH L QQ
Sbjct  330   ASKSYTSLALKTISKQFRSLKDSISSQIKTASKTLGEDDCLGVKLEGSRLRYVDHQLRQQ  389

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RALQ LGM+  NAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK+MLA+QTGLTRSQV
Sbjct  390   RALQQLGMIHSNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKVMLARQTGLTRSQV  449

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  450   SNWFINARV  458



>gb|KDO70617.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70618.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70619.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
 gb|KDO70620.1| hypothetical protein CISIN_1g005514mg [Citrus sinensis]
Length=693

 Score =   340 bits (871),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 226/453 (50%), Positives = 269/453 (59%), Gaps = 60/453 (13%)
 Frame = +3

Query  36    MAMYYQGS-SEVQG-DGLQTLYLMNPN-YIG--------FSDTALPQS-----QQAMFLN  167
             MA Y+ G+ +E Q  DGLQTL LMNP  Y+         FSDT  P +        +FLN
Sbjct  1     MATYFHGNPAEFQAPDGLQTLVLMNPTTYVQQQQQQHQQFSDTNHPPAPAPAHNSLIFLN  60

Query  168   SGNALHAGGMPHARLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIP  347
             S                +QHFVG+P       +A   D    L   L +          P
Sbjct  61    SSAISPHA---PPPPSHTQHFVGIPT------TAHQDDSISPLHGLLPRVHYNLYNPNYP  111

Query  348   SAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHP-FRSLPMESPVGLLSAR  524
             S                        +P A+QGLSLSLS  QHP F S   ++    +S  
Sbjct  112   SPPARD-------------------TPRAKQGLSLSLSSHQHPAFGSQGGQT----VSGE  148

Query  525   PGAAHDNSGASSSSITHGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaank  695
                    S +S S +T+G+SG    +  SKYLKAAQELLDEVVNV  S         +  
Sbjct  149   DIRVSGGSASSGSGVTNGVSGMQSVLLSSKYLKAAQELLDEVVNVNNS----GISNKSEF  204

Query  696   ekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVE  875
              K      +       G     +G +  +    AAELTTA+RQ++QMKKAKL++M+DEVE
Sbjct  205   SKKGSGNNNSNINKVIGESSAAAGDDGQSAGKRAAELTTAERQEIQMKKAKLINMLDEVE  264

Query  876   QRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLG  1055
             QRYRQYHHQMQ++++SFEQAAG+ SA++YT LAL TISKQFRCLK AI  QIKA +K LG
Sbjct  265   QRYRQYHHQMQIVISSFEQAAGIESAKTYTALALKTISKQFRCLKDAITGQIKAANKMLG  324

Query  1056  EEEGV----RGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHF  1223
             EE+ V     GSRLKF+DHHL QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHF
Sbjct  325   EEDCVGSKIEGSRLKFVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHF  384

Query  1224  LHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             LHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  385   LHPYPKDSDKQMLAKQTGLTRSQVSNWFINARV  417



>emb|CDP10596.1| unnamed protein product [Coffea canephora]
Length=680

 Score =   338 bits (868),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 243/470 (52%), Positives = 292/470 (62%), Gaps = 57/470 (12%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDG----LQTLYLMN-PNYIG-FSDTALP------QSQ---QAMFLNS  170
             MA Y+ G+SE+QG G    LQTL LMN   Y+G +SDT  P      Q Q     +FLNS
Sbjct  1     MATYFHGNSEIQGGGGDHGLQTLILMNHAGYVGGYSDTHQPPPHVQVQVQPPSNFVFLNS  60

Query  171   GNALHAGGMP--------HARLPQS--QHFVGVPLPASALGSAQLHDPARSLWAGLEQAG  320
              N       P        HA  P S  Q FVG+PL A+A  S+Q H P          A 
Sbjct  61    SNTPGPSAAPGANSLNVHHAPPPPSPTQQFVGIPLTATAATSSQDHQP---------HAA  111

Query  321   SGSGGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQ------HPFR  482
             S      + + +          A  LG  R V     AQQGLSLSLS QQ       P R
Sbjct  112   SVQDISALHAFLPRLQYNLYSPAMDLGAAREVS---RAQQGLSLSLSSQQPAYGSFRPER  168

Query  483   SLPME------SPVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVV  644
              +P +      SP G    R      +S +  S+  +G+   +  SKYLKAAQELLDEVV
Sbjct  169   EIPSQPLVTAISPTGGDDLRVSGGSSSSASGISNGVNGMQSVLLSSKYLKAAQELLDEVV  228

Query  645   NVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQ  824
             NV K +K   A       +AK   ES             +G E+SA+++A  ELTTA+RQ
Sbjct  229   NVGKGVKSGVATAKGANGQAKEIGESSE--MTATAGEGQNGRENSAKRSA--ELTTAERQ  284

Query  825   DLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRC  1004
             ++QMKKAKL++M+DEVEQRYRQYH+QMQ++++ FEQAAG+GSA++YT LAL TISKQFRC
Sbjct  285   EIQMKKAKLVNMLDEVEQRYRQYHNQMQIVISWFEQAAGIGSAKTYTALALQTISKQFRC  344

Query  1005  LKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRG  1172
             LK AI  QI+A SKSLGEE+     + GSRLKF+D+ L QQRALQ LGM+Q NAWRPQRG
Sbjct  345   LKDAILGQIRAASKSLGEEDSFGGKIEGSRLKFVDNQLRQQRALQQLGMIQHNAWRPQRG  404

Query  1173  LPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             LPER+VSVLRAWLFEHFLHPYPKDSDK+MLAKQTGLTRSQVSNWFINARV
Sbjct  405   LPERSVSVLRAWLFEHFLHPYPKDSDKLMLAKQTGLTRSQVSNWFINARV  454



>ref|XP_006481599.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006481600.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Citrus 
sinensis]
Length=693

 Score =   338 bits (867),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 225/453 (50%), Positives = 269/453 (59%), Gaps = 60/453 (13%)
 Frame = +3

Query  36    MAMYYQGS-SEVQG-DGLQTLYLMNPN-YIG--------FSDTALPQS-----QQAMFLN  167
             MA Y+ G+ +E Q  DGLQTL LMNP  Y+         FSDT  P +        +FLN
Sbjct  1     MATYFHGNPAEFQAPDGLQTLVLMNPTTYVQQQQQQHQQFSDTNHPPAPAPAHNSLIFLN  60

Query  168   SGNALHAGGMPHARLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIP  347
             S                +QHFVG+P       +A   D    L   L +          P
Sbjct  61    SSAISPHA---PPPPSHTQHFVGIPT------TAHQDDSISPLHGLLPRVHYNLYNPNYP  111

Query  348   SAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHP-FRSLPMESPVGLLSAR  524
             S                        +P A+QGLSLSLS  QHP F S   ++    +S  
Sbjct  112   SPPARD-------------------TPRAKQGLSLSLSSHQHPAFGSQGGQT----VSGE  148

Query  525   PGAAHDNSGASSSSITHGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaank  695
                    S +S S +T+G+SG    +  SKYLKAAQELLDEVVNV  S         +  
Sbjct  149   DIRVSGGSASSGSGVTNGVSGMQSVLLSSKYLKAAQELLDEVVNVNNS----GISNKSEF  204

Query  696   ekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVE  875
              K      +       G     +G +  +    AAEL+TA+RQ++QMKKAKL++M+DEVE
Sbjct  205   SKKGSGNNNSNINKVIGESSAAAGDDGQSAGKRAAELSTAERQEIQMKKAKLINMLDEVE  264

Query  876   QRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLG  1055
             QRYRQYHHQMQ++++SFEQAAG+ SA++YT LAL TISKQFRCLK AI  QIKA +K LG
Sbjct  265   QRYRQYHHQMQIVISSFEQAAGIESAKTYTALALKTISKQFRCLKDAITGQIKAANKMLG  324

Query  1056  EEEGV----RGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHF  1223
             EE+ V     GSRLKF+DHHL QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHF
Sbjct  325   EEDCVGSKIEGSRLKFVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHF  384

Query  1224  LHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             LHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  385   LHPYPKDSDKQMLAKQTGLTRSQVSNWFINARV  417



>ref|XP_006430060.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
 ref|XP_006430061.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
 gb|ESR43300.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
 gb|ESR43301.1| hypothetical protein CICLE_v10011201mg [Citrus clementina]
Length=693

 Score =   338 bits (867),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 226/453 (50%), Positives = 269/453 (59%), Gaps = 60/453 (13%)
 Frame = +3

Query  36    MAMYYQGS-SEVQG-DGLQTLYLMNPN-YIG--------FSDTALPQSQQA-----MFLN  167
             MA Y+ G+ +E Q  DGLQTL LMNP  Y+         FSDT  P +        +FLN
Sbjct  1     MATYFHGNPAEFQAPDGLQTLVLMNPTTYVQQQQQQQQQFSDTNPPPAPAPAHNSLIFLN  60

Query  168   SGNALHAGGMPHARLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIP  347
             S                +QHFVG+P       +A   D    L   L +          P
Sbjct  61    SSAISPHA---PPPPSHTQHFVGIPT------TAHQDDSISPLHGLLPRVHYNLYNPNYP  111

Query  348   SAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHP-FRSLPMESPVGLLSAR  524
             S                        +P A+QGLSLSLS  QHP F S   ++    +S  
Sbjct  112   SPPARD-------------------TPRAKQGLSLSLSSHQHPAFGSQGGQT----VSGE  148

Query  525   PGAAHDNSGASSSSITHGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaank  695
                    S +S S +T+G+SG    +  SKYLKAAQELLDEVVNV  S         +  
Sbjct  149   DIRVSGGSASSGSGVTNGVSGMQSVLLSSKYLKAAQELLDEVVNVNNS----GISNKSEF  204

Query  696   ekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVE  875
              K      +       G     +G +  +    AAELTTA+RQ++QMKKAKL++M+DEVE
Sbjct  205   SKKGSGNNNSNINKVIGESSAAAGDDGQSAGKRAAELTTAERQEIQMKKAKLINMLDEVE  264

Query  876   QRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLG  1055
             QRYRQYHHQMQ++++SFEQAAG+ SA++YT LAL TISKQFRCLK AI  QIKA +K LG
Sbjct  265   QRYRQYHHQMQIVISSFEQAAGIESAKTYTALALKTISKQFRCLKDAITGQIKAANKMLG  324

Query  1056  EEEGV----RGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHF  1223
             EE+ V     GSRLKF+DHHL QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHF
Sbjct  325   EEDCVGSKIEGSRLKFVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHF  384

Query  1224  LHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             LHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  385   LHPYPKDSDKQMLAKQTGLTRSQVSNWFINARV  417



>gb|KEH24245.1| BEL1-related homeotic protein [Medicago truncatula]
Length=660

 Score =   337 bits (864),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 224/449 (50%), Positives = 272/449 (61%), Gaps = 55/449 (12%)
 Frame = +3

Query  36    MAMYYQG-SSEVQ------GDGLQTLYLMNPNYIGFSDTAL------PQSQQA---MFLN  167
             MA YY G +SE+Q       DGLQTL LMNP+YI +SD +       P    A   +FLN
Sbjct  1     MATYYHGGNSEIQSSGGGGADGLQTLVLMNPSYIQYSDASQQQQAQQPSHATAGNYVFLN  60

Query  168   SGNALHAGGMPHARLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIP  347
             S  A +    PHA    +Q FVG+PL          HD   SL   L            P
Sbjct  61    STAAENNSFSPHAPPSNTQQFVGIPLNHQQHQIHAHHDVVPSLHGFLPHVQYNQWNTIDP  120

Query  348   SAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARP  527
             +                        +P AQQGLSLSLS Q           P   +S   
Sbjct  121   NTAARD-------------------TPRAQQGLSLSLSSQ-----------PARFVSMSG  150

Query  528   GAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekak  707
             G+    SG ++++        I  SKYL+AA ELL+EVVNV   ++L         +   
Sbjct  151   GSPSPASGVTTNNNNGNPGIQILSSKYLRAAHELLEEVVNVNSGVELGKKSGGGMSKVNI  210

Query  708   mkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYR  887
              +   +   G  G      G E S ++++  EL+TA+RQ++QMKKAKL++M+DEVEQRYR
Sbjct  211   GESSGV---GSGGDGSIIGGAEGSGKRSS--ELSTAERQEIQMKKAKLITMLDEVEQRYR  265

Query  888   QYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG  1067
             QYHHQM+++V+SFEQAAG+GSAR+YT LAL TISKQFRCLK AI  QIKAT+KSLGEE+ 
Sbjct  266   QYHHQMEIVVSSFEQAAGIGSARTYTALALQTISKQFRCLKDAITGQIKATNKSLGEEDC  325

Query  1068  ----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPY  1235
                 + GSRLK++DH L QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPY
Sbjct  326   FGGKIEGSRLKYVDHQLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPY  385

Query  1236  PKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  386   PKDSDKHMLAKQTGLTRSQVSNWFINARV  414



>ref|XP_004303380.1| PREDICTED: BEL1-like homeodomain protein 1-like [Fragaria vesca 
subsp. vesca]
Length=704

 Score =   337 bits (865),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 233/454 (51%), Positives = 288/454 (63%), Gaps = 48/454 (11%)
 Frame = +3

Query  36    MAMYYQGSSEVQG--DGLQTLYLMN-PNYIGFSD--------TALPQSQQAMFLNSGNA-  179
             MA YY G+SE+Q    GLQTL LMN   Y+ +SD        +A   +QQ +FLNS  A 
Sbjct  1     MATYYHGNSEIQSPDGGLQTLVLMNHGGYVPYSDATQQQHSPSAAATNQQLVFLNSAGAN  60

Query  180   ---LHAGGMPHARLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPS  350
                  A  +PHA    +Q FVG+PLP     +    DP+ S   G+      +       
Sbjct  61    NQLAQASTLPHAPPSHTQQFVGIPLP-----TVSTQDPSNS--QGMHPHHDMAALHAFMP  113

Query  351   AVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQ---HPFRSLPMESPVGLLSA  521
              +       T +A       S   +P AQQGLSLSLS QQ     FR    E P G    
Sbjct  114   RI------QTQYALWNSIDPSTRDTPRAQQGLSLSLSSQQPGFGSFRGADREVPTG----  163

Query  522   RPGAAHDNSGASSSSITHGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaan  692
                     S +S+S +T+GISG    +  SKYLKAAQELLDEVVNV   ++ +  ++   
Sbjct  164   EDIRVSSGSTSSASGVTNGISGMQSVLLSSKYLKAAQELLDEVVNVGNGMRTELPKKGNG  223

Query  693   kekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEV  872
              +   M + SM       GD    G + S ++  A EL+TA+RQ++QMKK KL++M+DEV
Sbjct  224   NQSKAMAESSM----AAAGDGSVGGDQDSGKR--AVELSTAERQEIQMKKGKLITMLDEV  277

Query  873   EQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSL  1052
             +QRYRQYH QMQ+++ASFEQAAG+GSAR+YT LAL TISKQFRCLK AI +QI+A +KSL
Sbjct  278   DQRYRQYHRQMQMVIASFEQAAGIGSARTYTALALQTISKQFRCLKDAITNQIRAANKSL  337

Query  1053  GEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEH  1220
             GEE+     + GSRLK++DH L QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEH
Sbjct  338   GEEDCSGGKIEGSRLKYVDHQLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEH  397

Query  1221  FLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             FLHPYPKDSDK +LAKQTGLTRSQVSNWFINARV
Sbjct  398   FLHPYPKDSDKHLLAKQTGLTRSQVSNWFINARV  431



>ref|XP_009403681.1| PREDICTED: BEL1-like homeodomain protein 1 [Musa acuminata subsp. 
malaccensis]
Length=540

 Score =   332 bits (851),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 218/437 (50%), Positives = 269/437 (62%), Gaps = 62/437 (14%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSG-NALH--AGGMPHA  206
             MA +  G+ EVQ DGLQTL+LMNP Y G+ D A P +   + LNS  N+L+         
Sbjct  1     MATFIHGAPEVQPDGLQTLFLMNPGYAGYMDAAAPANM--VLLNSTMNSLNPIILAQAGQ  58

Query  207   RLPQSQHFVGVPL-PASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSAVVSGGGGTTD  383
                Q Q FVG+PL PA     A+L D  R L        S            +    + D
Sbjct  59    PNQQQQDFVGIPLQPA-----ARLRDSDRPLPIHASHDASVLTRLHHNLWTPTPTSNSVD  113

Query  384   FASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAHDNSGASSS  563
              ASQ    R         +GLSLSLSP +              ++  PG+AH+   A+S 
Sbjct  114   VASQFSPRR---------RGLSLSLSPHE--------------MAMTPGSAHEVMFAASV  150

Query  564   SITHGISG---FITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPF  734
                +G+SG   F+ GSKYLKAAQ+LLDEVV+V K +K +AA+   ++       E+    
Sbjct  151   GGANGVSGRRSFLMGSKYLKAAQQLLDEVVDVGKGIKDEAAKGPKSRNTELKGGETT---  207

Query  735   ggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVI  914
                          S+ Q+   A+LTTA+RQ+LQMKKAKL+SM++E EQRYR+Y+HQMQ +
Sbjct  208   -------------STKQR---ADLTTAERQELQMKKAKLISMLEEAEQRYRKYNHQMQTV  251

Query  915   VASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-SRLKF  1091
             +ASFE  AG GSAR+YT LA  TISKQFRCL+ AI  QI+AT K+LGEE+   G SRL+F
Sbjct  252   IASFEAVAGHGSARTYTVLAQRTISKQFRCLRDAIVGQIRATCKTLGEEDTKLGNSRLRF  311

Query  1092  IDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQ  1271
             ID HL QQR      M+QPNAWRPQRGLPER+VSVLRAWLFEHFLHPYP DSDK MLAKQ
Sbjct  312   IDQHLRQQRQ-----MIQPNAWRPQRGLPERSVSVLRAWLFEHFLHPYPTDSDKFMLAKQ  366

Query  1272  TGLTRSQVSNWFINARV  1322
             TGLTRSQV+NWFINARV
Sbjct  367   TGLTRSQVANWFINARV  383



>gb|KHG12855.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=644

 Score =   334 bits (856),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 221/439 (50%), Positives = 272/439 (62%), Gaps = 51/439 (12%)
 Frame = +3

Query  36    MAMYYQGSSEVQG-DGLQTLYLMNPNYIGFSDTALPQ--SQQAMFLNSGNALHAGGMPHA  206
             MA Y+ G+ E+Q  D LQTL LMNP Y+ +S+T  P   S   +FLNS +       P+A
Sbjct  1     MAAYFHGNPEIQAADDLQTLVLMNPAYVHYSNTPPPPPPSNNLVFLNSLS-------PNA  53

Query  207   RLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSAVVSGGGGTTDF  386
                 SQ  VG+PLPA    S Q  D   SL   +++    S     PS      G   D 
Sbjct  54    PSSHSQQLVGIPLPAVTSRSNQ--DAISSLHGLVQRLHYNSYNPIDPS------GAPRD-  104

Query  387   ASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAHDNSGASSSS  566
                         +P AQQGLSL+LS Q  P              ++P A    S +S S+
Sbjct  105   ------------TPRAQQGLSLTLSSQHQPSN----------YGSQPQAVSGGSASSCSA  142

Query  567   ITHGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFg  737
             +T+G+SG    +  SKYL+AAQELLDEVVNV+ +                 + +      
Sbjct  143   VTNGVSGIQSVLLSSKYLRAAQELLDEVVNVDNTGFTKTEMAKKGCGNDSNRSKGTGELS  202

Query  738   gcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIV  917
                GD          ++T   EL+TA+RQ++QMKKAKL+SM+DEV+QRYRQYHHQMQ+++
Sbjct  203   AAAGDGSGGEDAVGKRRT---ELSTAERQEIQMKKAKLISMLDEVDQRYRQYHHQMQIVI  259

Query  918   ASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE----GVRGSRL  1085
             ++FEQ AG+GSA++YT LAL TISKQFRCLK AI  QI+A +KSLGEE+       GS L
Sbjct  260   STFEQTAGIGSAKTYTALALKTISKQFRCLKDAIIGQIRAVNKSLGEEDRLGGKTEGSGL  319

Query  1086  KFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLA  1265
             KF+DH L QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK MLA
Sbjct  320   KFVDHQLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLA  379

Query  1266  KQTGLTRSQVSNWFINARV  1322
             KQTGLTRSQVSNWFINARV
Sbjct  380   KQTGLTRSQVSNWFINARV  398



>gb|KHN17979.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=517

 Score =   328 bits (841),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 167/246 (68%), Positives = 195/246 (79%), Gaps = 9/246 (4%)
 Frame = +3

Query  597   GSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggES  776
             GS YLKAAQELLDE VNV K +  +       K   +            GG   +SGG  
Sbjct  2     GSNYLKAAQELLDEAVNVGKGIYKEEKFAEKVKANRESTNSGA-----AGGGDGSSGGGE  56

Query  777   SAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSAR  956
             ++      EL+TAQRQ+LQMKK+KL+SM+DEVEQRYRQYHHQMQ++V+SFEQAAG G+A+
Sbjct  57    NSAGKQVVELSTAQRQELQMKKSKLVSMLDEVEQRYRQYHHQMQIVVSSFEQAAGYGAAK  116

Query  957   SYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRAL  1124
             SYT LAL TISKQFRCLK AI++QIKATSK+LGE++     V GSRL+++DHHL QQRAL
Sbjct  117   SYTALALKTISKQFRCLKDAISAQIKATSKTLGEDDCLGVKVEGSRLRYVDHHLRQQRAL  176

Query  1125  QHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNW  1304
             Q LGM+QPNAWRPQRGLPERAVS+LRAWLFEHFLHPYPKDSDK+MLAKQTGL+RSQVSNW
Sbjct  177   QQLGMIQPNAWRPQRGLPERAVSILRAWLFEHFLHPYPKDSDKVMLAKQTGLSRSQVSNW  236

Query  1305  FINARV  1322
             FINARV
Sbjct  237   FINARV  242



>ref|XP_004136516.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
Length=716

 Score =   332 bits (852),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 169/253 (67%), Positives = 195/253 (77%), Gaps = 8/253 (3%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             GI G +  SKYLKA QELLDEVVNV +    +  +  ++ +KA   +  M          
Sbjct  189   GIQGVLISSKYLKATQELLDEVVNVTQ----NGIKSESSPKKATGNQSKMIGDAAAATGT  244

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
                  E  A    AAELTT++RQ++QMKKAKL+SM++EVEQRYRQYHHQMQ++++SFEQA
Sbjct  245   ADGSLEGEADGKQAAELTTSERQEIQMKKAKLISMLEEVEQRYRQYHHQMQIVISSFEQA  304

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHH  1103
             AG GSAR+YT LAL TISKQFRCLK AI  QI+A +KSLGEEE     V GSRLKF+DHH
Sbjct  305   AGAGSARTYTALALQTISKQFRCLKDAITGQIRAANKSLGEEECIGRKVEGSRLKFVDHH  364

Query  1104  LPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLT  1283
             L QQRALQ LGM+Q NAWRPQRGLPER+VS+LRAWLFEHFLHPYPKDSDK MLAKQTGLT
Sbjct  365   LRQQRALQQLGMIQHNAWRPQRGLPERSVSILRAWLFEHFLHPYPKDSDKHMLAKQTGLT  424

Query  1284  RSQVSNWFINARV  1322
             RSQVSNWFINARV
Sbjct  425   RSQVSNWFINARV  437



>gb|KHG12856.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=763

 Score =   333 bits (855),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 221/439 (50%), Positives = 272/439 (62%), Gaps = 51/439 (12%)
 Frame = +3

Query  36    MAMYYQGSSEVQG-DGLQTLYLMNPNYIGFSDTALPQ--SQQAMFLNSGNALHAGGMPHA  206
             MA Y+ G+ E+Q  D LQTL LMNP Y+ +S+T  P   S   +FLNS +       P+A
Sbjct  120   MAAYFHGNPEIQAADDLQTLVLMNPAYVHYSNTPPPPPPSNNLVFLNSLS-------PNA  172

Query  207   RLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSAVVSGGGGTTDF  386
                 SQ  VG+PLPA    S Q  D   SL   +++    S     PS      G   D 
Sbjct  173   PSSHSQQLVGIPLPAVTSRSNQ--DAISSLHGLVQRLHYNSYNPIDPS------GAPRD-  223

Query  387   ASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAHDNSGASSSS  566
                         +P AQQGLSL+LS Q  P              ++P A    S +S S+
Sbjct  224   ------------TPRAQQGLSLTLSSQHQPSN----------YGSQPQAVSGGSASSCSA  261

Query  567   ITHGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFg  737
             +T+G+SG    +  SKYL+AAQELLDEVVNV+ +                 + +      
Sbjct  262   VTNGVSGIQSVLLSSKYLRAAQELLDEVVNVDNTGFTKTEMAKKGCGNDSNRSKGTGELS  321

Query  738   gcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIV  917
                GD          ++T   EL+TA+RQ++QMKKAKL+SM+DEV+QRYRQYHHQMQ+++
Sbjct  322   AAAGDGSGGEDAVGKRRT---ELSTAERQEIQMKKAKLISMLDEVDQRYRQYHHQMQIVI  378

Query  918   ASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE----GVRGSRL  1085
             ++FEQ AG+GSA++YT LAL TISKQFRCLK AI  QI+A +KSLGEE+       GS L
Sbjct  379   STFEQTAGIGSAKTYTALALKTISKQFRCLKDAIIGQIRAVNKSLGEEDRLGGKTEGSGL  438

Query  1086  KFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLA  1265
             KF+DH L QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK MLA
Sbjct  439   KFVDHQLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLA  498

Query  1266  KQTGLTRSQVSNWFINARV  1322
             KQTGLTRSQVSNWFINARV
Sbjct  499   KQTGLTRSQVSNWFINARV  517



>ref|XP_004171976.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cucumis sativus]
 gb|KGN59214.1| hypothetical protein Csa_3G782620 [Cucumis sativus]
Length=716

 Score =   332 bits (851),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 169/253 (67%), Positives = 195/253 (77%), Gaps = 8/253 (3%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             GI G +  SKYLKA QELLDEVVNV +    +  +  ++ +KA   +  M          
Sbjct  189   GIQGVLISSKYLKATQELLDEVVNVTQ----NGIKSESSPKKATGNQSKMIGDAAAATGT  244

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
                  E  A    AAELTT++RQ++QMKKAKL+SM++EVEQRYRQYHHQMQ++++SFEQA
Sbjct  245   ADGSLEGEADGKQAAELTTSERQEIQMKKAKLISMLEEVEQRYRQYHHQMQIVISSFEQA  304

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHH  1103
             AG GSAR+YT LAL TISKQFRCLK AI  QI+A +KSLGEEE     V GSRLKF+DHH
Sbjct  305   AGAGSARTYTALALQTISKQFRCLKDAITGQIRAANKSLGEEECIGRKVEGSRLKFVDHH  364

Query  1104  LPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLT  1283
             L QQRALQ LGM+Q NAWRPQRGLPER+VS+LRAWLFEHFLHPYPKDSDK MLAKQTGLT
Sbjct  365   LRQQRALQQLGMIQHNAWRPQRGLPERSVSILRAWLFEHFLHPYPKDSDKHMLAKQTGLT  424

Query  1284  RSQVSNWFINARV  1322
             RSQVSNWFINARV
Sbjct  425   RSQVSNWFINARV  437



>gb|KDP36113.1| hypothetical protein JCGZ_08757 [Jatropha curcas]
Length=676

 Score =   331 bits (848),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 170/253 (67%), Positives = 194/253 (77%), Gaps = 8/253 (3%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             G+ G +  SKYLKAAQELLDEVVNV  S ++           +      M    G     
Sbjct  165   GMQGVLLSSKYLKAAQELLDEVVNV-NSNEIKNELSKKANGISSNNSNKM---IGESSGG  220

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
               S G  +     AAELTTA+RQ++QMKKAKL+SM+DEVEQRYRQYHHQMQ++++SFEQA
Sbjct  221   DGSAGGDAGGGKRAAELTTAERQEIQMKKAKLISMLDEVEQRYRQYHHQMQIVISSFEQA  280

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGV----RGSRLKFIDHH  1103
             AG+GSA++YT LAL TISKQFRCLK AI  QIKA +KSLGEE+ +     GSRLKF+DHH
Sbjct  281   AGIGSAKTYTALALQTISKQFRCLKDAITGQIKAANKSLGEEDCLGGKLEGSRLKFVDHH  340

Query  1104  LPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLT  1283
             L QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK MLAKQTGLT
Sbjct  341   LRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKRMLAKQTGLT  400

Query  1284  RSQVSNWFINARV  1322
             RSQVSNWFINARV
Sbjct  401   RSQVSNWFINARV  413


 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 51/86 (59%), Gaps = 6/86 (7%)
 Frame = +3

Query  36   MAMYYQGSSEVQG--DGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGNALHAGGMPHAR  209
            MA Y+ G+ E+Q   +GLQTL LMNP Y+ +SDT  P S   +FLNSG   H    PH  
Sbjct  1    MATYFHGNPEIQASAEGLQTLVLMNPTYVQYSDTPPPPSNNLVFLNSGTN-HLSPPPHLS  59

Query  210  --LPQSQHFVGVPL-PASALGSAQLH  278
               P +Q FVG+PL P S   ++ LH
Sbjct  60   HAPPNTQQFVGIPLDPTSHHDASALH  85



>ref|XP_007204250.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 ref|XP_007204251.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 gb|EMJ05449.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
 gb|EMJ05450.1| hypothetical protein PRUPE_ppa002158mg [Prunus persica]
Length=707

 Score =   332 bits (850),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 231/462 (50%), Positives = 293/462 (63%), Gaps = 59/462 (13%)
 Frame = +3

Query  36    MAMYYQ--GSSEVQG--DG-LQTLYLMNPNYIGFSDTALPQSQQA----------MFLNS  170
             MA Y+    SSE+Q   DG LQTL LMNP Y+ +SDT  P               +FLNS
Sbjct  1     MATYFHHGNSSEIQASSDGALQTLVLMNPGYVQYSDTPPPPPHPQPHQPPSAGNLVFLNS  60

Query  171   -GNAL--HAGGMPHARLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQ  341
               N+L  H   + HA     Q FVG+PL          HDP  +    + QA        
Sbjct  61    PTNSLPHHPSTLSHAPPSHPQQFVGIPLS---------HDPNNNNSPSMHQAHPDLSSLH  111

Query  342   IPSAVVSGGGGTTDFA--SQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLL  515
                  +      T +A  + +  + +   +P AQQGLSL+LS QQ  F S       G  
Sbjct  112   AFMPRIQ-----TQYALWNSIDPNTAARDTPRAQQGLSLTLSSQQPGFGSF-----RGAT  161

Query  516   SARPGAAHDN------SGASSSSITHGISGF---ITGSKYLKAAQELLDEVVNVEKSLKL  668
             S R   + ++      S +S+S +T+G+SG    +  SKYLKAAQELL+EVVNV   ++ 
Sbjct  162   SDREVPSGEDIRVSSGSNSSASGVTNGVSGMQSVLLSSKYLKAAQELLEEVVNVGNGIRT  221

Query  669   DaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAK  848
             +  ++ + ++   + + SM           + GGE S ++  AAEL+TA+RQ++QMKK K
Sbjct  222   ELPKKGSGQQSKVVAESSM-----AAAGDSSVGGEGSGKR--AAELSTAERQEIQMKKGK  274

Query  849   LLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQ  1028
             L+SM+DEV+QRYRQYH QMQV+++SFEQAAG+GSAR+YT LAL TISKQFRCLK AI +Q
Sbjct  275   LISMLDEVDQRYRQYHRQMQVVISSFEQAAGIGSARTYTALALQTISKQFRCLKDAITNQ  334

Query  1029  IKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSV  1196
             I+A +KSLGEE+     + GSRLK++DH L QQRALQ LGM+Q NAWRPQRGLPER+VSV
Sbjct  335   IRAANKSLGEEDCAAGKIEGSRLKYVDHQLRQQRALQQLGMIQHNAWRPQRGLPERSVSV  394

Query  1197  LRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             LRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  395   LRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  436



>ref|XP_008241058.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241059.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241060.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
 ref|XP_008241062.1| PREDICTED: BEL1-like homeodomain protein 1 [Prunus mume]
Length=710

 Score =   330 bits (847),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 231/465 (50%), Positives = 295/465 (63%), Gaps = 62/465 (13%)
 Frame = +3

Query  36    MAMYYQ--GSSEVQG--DG-LQTLYLMNPNYIGFSDTALPQSQQA-------------MF  161
             MA Y+    SSE+Q   DG LQTL LMNP Y+ +SDT  P   Q              +F
Sbjct  1     MATYFHHGNSSEIQASSDGALQTLVLMNPGYVQYSDTPPPPPHQQQQQPHQPPSAGNLVF  60

Query  162   LNS-GNAL--HAGGMPHARLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSG  332
             LNS  N+L  H   + HA    +Q FVG+PL          HDP  +    + QA     
Sbjct  61    LNSPTNSLPHHPSTLSHAPPSHAQQFVGIPLS---------HDPNNNNSPSMHQAHPDLS  111

Query  333   GQQIPSAVVSGGGGTTDFA--SQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPV  506
                     +      T +A  + +  + +   +P AQQGLSL+LS QQ  F S       
Sbjct  112   SLHAFMPRIQ-----TQYALWNSIDPNTAARDTPRAQQGLSLTLSSQQPGFGSF-----R  161

Query  507   GLLSARPGAAHDN------SGASSSSITHGISGF---ITGSKYLKAAQELLDEVVNVEKS  659
             G  S R   + ++      S +S+S +T+G+SG    +  SKYLKAAQELL+EVVNV   
Sbjct  162   GATSDREVPSGEDIRVSSGSNSSASGVTNGVSGMQSVLLSSKYLKAAQELLEEVVNVGNG  221

Query  660   LKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMK  839
             ++ D  ++ + ++   + + S+           + GGE S ++  AAEL+TA+RQ++QMK
Sbjct  222   IRTDLPKKGSGQQSKVVAESSL-----AAAGDSSVGGEGSGKR--AAELSTAERQEIQMK  274

Query  840   KAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAI  1019
             K KL+SM+DEV+QRYRQYH QMQ++++SFEQAAG+GSAR+YT LAL TISKQFRCLK AI
Sbjct  275   KGKLISMLDEVDQRYRQYHRQMQMVISSFEQAAGIGSARTYTALALQTISKQFRCLKDAI  334

Query  1020  ASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERA  1187
              +QI+A +KSLGEE+     + GSRLK++DH L QQRALQ LGM+Q NAWRPQRGLPER+
Sbjct  335   TNQIRAANKSLGEEDCAAGKIEGSRLKYVDHQLRQQRALQQLGMIQHNAWRPQRGLPERS  394

Query  1188  VSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             VSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  395   VSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  439



>ref|XP_006348466.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006348467.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Solanum 
tuberosum]
Length=704

 Score =   330 bits (846),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 223/457 (49%), Positives = 268/457 (59%), Gaps = 54/457 (12%)
 Frame = +3

Query  36    MAMYYQGSSEVQ--GDGLQTLYLMNPNYIGFSDT----ALP----QSQQAMFLNS---GN  176
             MA Y+ G+SE+Q   DGLQTL LMNP Y+GFS+T    A P     S   +F NS   GN
Sbjct  1     MASYFHGNSEIQEGNDGLQTLILMNPGYVGFSETQHHHAPPPPGGSSNNIVFFNSNPLGN  60

Query  177   ALHAGGMPHARLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSAV  356
             +++    P    P  QHFVG+PL  +A                   A S   G    +  
Sbjct  61    SINLSHAPPPPPPPQQHFVGIPLATAAF-----------------TAPSQDSGNNNNNES  103

Query  357   VSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGL---LSARP  527
             +S   G    +SQ GF+        A++        QQ    SL      G     +AR 
Sbjct  104   ISALHGFLARSSQYGFYNPANDITAAREVTRAHHQQQQGLSLSLSSSQQPGFGNFTAARE  163

Query  528   GAAHDNSGASSSSITH------GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaa  689
               +     AS+S I         IS     SKY+KAAQELLDEVVNV KS++   + E  
Sbjct  164   IVSSPTRSASASGIQQQQQQQQSISSVPLSSKYMKAAQELLDEVVNVGKSMRSTNSTEVV  223

Query  690   nkekakmkkeSMPPFggcggdpptsggESSAQK--TAAAELTTAQRQDLQMKKAKLLSMV  863
                  K  K                  +  A K  T   EL+TA+RQ++QMKKAKL++M+
Sbjct  224   VNNDVKKSKI---------MTDMDGQIDGGADKDGTPTTELSTAERQEIQMKKAKLVNML  274

Query  864   DEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATS  1043
             DEVEQRYR YHHQMQ ++   EQAAG+GSAR+YT LAL TISKQFRCLK AI  QI++  
Sbjct  275   DEVEQRYRHYHHQMQSVIHWLEQAAGIGSARTYTALALQTISKQFRCLKDAIIGQIRSAG  334

Query  1044  KSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWL  1211
             K+LGEE+     + GSRLKF+D+ L QQRALQ LGM+Q NAWRPQRGLPERAVSVLRAWL
Sbjct  335   KTLGEEDSLGGKIEGSRLKFVDNQLRQQRALQQLGMIQHNAWRPQRGLPERAVSVLRAWL  394

Query  1212  FEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             FEHFLHPYPKDSDK+MLAKQTGLTRSQVSNWFINARV
Sbjct  395   FEHFLHPYPKDSDKMMLAKQTGLTRSQVSNWFINARV  431



>ref|XP_008442920.1| PREDICTED: BEL1-like homeodomain protein 1 [Cucumis melo]
Length=713

 Score =   330 bits (846),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 168/254 (66%), Positives = 199/254 (78%), Gaps = 10/254 (4%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKS-LKLDaaeeaankekakmkkeSMPPFggcggd  752
             GI G +  SKYLKAAQELLDEVVNV ++ +K +++ + A   ++K   ++          
Sbjct  189   GIQGVLISSKYLKAAQELLDEVVNVTQNGIKSESSPKKATGNQSKAIGDAA-----AATG  243

Query  753   pptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQ  932
                   E       AAELTT++RQ++QMKKAKL+SM++EVEQRYRQYHHQMQ++++SFEQ
Sbjct  244   TADGSLEGETDGKRAAELTTSERQEIQMKKAKLISMLEEVEQRYRQYHHQMQIVISSFEQ  303

Query  933   AAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGV----RGSRLKFIDH  1100
             AAG GSAR+YT LAL TISKQFRCLK AI  QI+A +KSLGEEE +     GSRLKF+DH
Sbjct  304   AAGAGSARTYTALALQTISKQFRCLKDAITGQIRAANKSLGEEECIGRKMEGSRLKFVDH  363

Query  1101  HLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGL  1280
             HL QQRALQ LGM+Q NAWRPQRGLPER+VS+LRAWLFEHFLHPYPKDSDK MLAKQTGL
Sbjct  364   HLRQQRALQQLGMIQHNAWRPQRGLPERSVSILRAWLFEHFLHPYPKDSDKHMLAKQTGL  423

Query  1281  TRSQVSNWFINARV  1322
             TRSQVSNWFINARV
Sbjct  424   TRSQVSNWFINARV  437



>ref|XP_010059079.1| PREDICTED: BEL1-like homeodomain protein 1 [Eucalyptus grandis]
 gb|KCW90459.1| hypothetical protein EUGRSUZ_A02588 [Eucalyptus grandis]
 gb|KCW90460.1| hypothetical protein EUGRSUZ_A02588 [Eucalyptus grandis]
Length=703

 Score =   328 bits (842),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/259 (63%), Positives = 203/259 (78%), Gaps = 16/259 (6%)
 Frame = +3

Query  561   SSITHGISGFITGSKYLKAAQELLDEVVNVEKS-LKLDaaeeaankekakmkkeSMPPFg  737
             +++  G+ G +  SKYLKAAQELL+EVVNV  + +K +  ++A+ + K   +  ++    
Sbjct  180   AAVGSGMQGVLLSSKYLKAAQELLEEVVNVGNTGIKAEMLKKASGQSKPGGESAAL----  235

Query  738   gcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIV  917
                       G         AEL+ A+RQ++QMKKAKL++M+DEVEQRYRQYH+QMQ+++
Sbjct  236   -------KEEGGGDGSGKRGAELSMAERQEIQMKKAKLINMLDEVEQRYRQYHNQMQIVI  288

Query  918   ASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRL  1085
             +SFEQAAG+GSAR+YT LAL TISKQFRCLK AIA QI+A +KSLGEE+G    + GSRL
Sbjct  289   SSFEQAAGIGSARTYTALALQTISKQFRCLKDAIAGQIRAANKSLGEEDGPGGKIEGSRL  348

Query  1086  KFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLA  1265
             KF+DHHL QQRALQ LGM+Q NAWRPQRGLPER+VS+LRAWLFEHFLHPYPKDSDK+MLA
Sbjct  349   KFVDHHLRQQRALQQLGMIQQNAWRPQRGLPERSVSILRAWLFEHFLHPYPKDSDKVMLA  408

Query  1266  KQTGLTRSQVSNWFINARV  1322
             KQTGLTRSQVSNWFINARV
Sbjct  409   KQTGLTRSQVSNWFINARV  427


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 45/79 (57%), Gaps = 9/79 (11%)
 Frame = +3

Query  36   MAMYYQGSSEVQGDGLQTLYLMNP-NYIGFSDTALPQSQ-QAMFLNSGNALHAGGMPHAR  209
            MA YY  SS      LQTL LMNP +Y+ +SD   P  Q  A+FLNS  A    G P + 
Sbjct  1    MATYYHQSSSDPDGALQTLVLMNPASYVHYSDAPPPHQQPSAIFLNSSTA----GPPAS-  55

Query  210  LPQSQHFVGVPLPASALGS  266
              Q+Q FVG+PLP SA  S
Sbjct  56   --QTQQFVGIPLPGSAADS  72



>ref|XP_006854627.1| hypothetical protein AMTR_s00030p00173920 [Amborella trichopoda]
 gb|ERN16094.1| hypothetical protein AMTR_s00030p00173920 [Amborella trichopoda]
Length=709

 Score =   328 bits (840),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 217/471 (46%), Positives = 281/471 (60%), Gaps = 62/471 (13%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQ--QAMFLN--SGNALHAG-GMP  200
             MA YY G+ E+Q D LQTLYLMNP Y+G+++ A P +     + LN  +GN L  G  + 
Sbjct  1     MATYYPGT-EIQPDNLQTLYLMNPGYVGYAE-ATPSANPGNMVLLNHVNGNPLTIGTNLS  58

Query  201   HARLPQSQHFVGVPL----PASALGSAQLHDPARSLWA---------------GLE----  311
                  Q QHF+G+PL    P   + +    D   +L A               G E    
Sbjct  59    QNPNQQPQHFIGIPLQGPDPQRQVLTVNPTDINPNLLASRISGHHQYNQWRNSGNELTFL  118

Query  312   QAGSGSGGQQIPSAVVSGGGGTT---------DFASQLGFHRSVVVSPTAQQGlslslsP  464
             QA   S     PS + +     +            SQ+G  R  + S   QQG       
Sbjct  119   QAIDQSQASTNPSQIANMNSSVSLSHHQPVQEITNSQMGIRRGPMASDQTQQGALSLSLS  178

Query  465   QQHPFRSLPMESPVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVV  644
              Q P             S+  G +      +  S++  + G + GSKYLKAAQELLDEVV
Sbjct  179   SQQP-----SNGQFSFHSSGHGVSQSMKQGTVDSVSSNLQGVLMGSKYLKAAQELLDEVV  233

Query  645   NVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQ  824
             +V K +K D+ +   ++ K   +                SG ESS +K   +EL+T +RQ
Sbjct  234   SVGKGVKTDSGKREKSQVKIGREMA-----------VEGSGAESSGKK--GSELSTVERQ  280

Query  825   DLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRC  1004
             ++QMKKAKL++M+DEV+QRYRQYHHQM ++V+SFE AAG+G+A++YT LAL TIS+QFRC
Sbjct  281   EVQMKKAKLVAMLDEVDQRYRQYHHQMHLVVSSFEAAAGLGAAKTYTALALQTISRQFRC  340

Query  1005  LKVAIASQIKATSKSLGEEEGV-----RGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQR  1169
             L+ AI+SQIK+ SK+LGEE+ +      GSRL+++DH L QQRALQ LGM+  NAWRPQR
Sbjct  341   LRDAISSQIKSASKALGEEDCLNGGRGEGSRLRYVDHQLRQQRALQQLGMIPHNAWRPQR  400

Query  1170  GLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             GLPER+VSVLRAWLFEHFLHPYPKD+DK MLAKQTGLTRSQVSNWFINARV
Sbjct  401   GLPERSVSVLRAWLFEHFLHPYPKDADKHMLAKQTGLTRSQVSNWFINARV  451



>emb|CDX84585.1| BnaA03g16450D [Brassica napus]
Length=671

 Score =   325 bits (834),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 220/464 (47%), Positives = 272/464 (59%), Gaps = 71/464 (15%)
 Frame = +3

Query  36    MAMYYQGS----SEVQGDGLQTLYLMNPNYIGFSDTALPQSQQA----------------  155
             MA Y+ G+    S     GLQTL LMNP       T +P +QQ                 
Sbjct  1     MAAYFHGNPPEISAGTDGGLQTLILMNPT------TYVPYTQQDDDSNNSNNNNNNTNNN  54

Query  156   --MFLNSGNALHAGGMPHARLP---QSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAG  320
               +FL+S            R P    +Q FVG+PL      S    D    L        
Sbjct  55    NFVFLDS------------RAPPQNANQQFVGIPLSGHEAASITAADNISVLHG------  96

Query  321   SGSGGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMES  500
                     P  V     G+         H++   +P AQ+GLSL+LS QQ   +      
Sbjct  97    -------YPPRVQYSLYGSHHVDPT--HHQAACETPRAQRGLSLTLSSQQQQQQHRQTLH  147

Query  501   PVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVE-KSLKLDaa  677
              VG  S         SG+++S +T+G++  ++ SKYLKAAQELLDEVV  +   +   + 
Sbjct  148   HVGFGSGPGEDIRVGSGSTASGVTNGVANLVS-SKYLKAAQELLDEVVKADSNDINTKSQ  206

Query  678   eeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLS  857
               ++ K  +    +++        +    GGE+S ++T   EL TA+RQ++QMKKAKL S
Sbjct  207   LFSSKKGTSVTDTKAVGESSTGAREGSDGGGEASGKRTV--ELGTAERQEIQMKKAKLSS  264

Query  858   MVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKA  1037
             M+ EVEQRYRQYH QMQ++++SFEQAAG+GSA+SYT LAL TIS+QFRCLK AIA QIKA
Sbjct  265   MLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQIKA  324

Query  1038  TSKSLGEEEGV------RGSRLKFIDHHLPQQRALQHLGMMQ---PNAWRPQRGLPERAV  1190
              +KSLGEE+ V       GSRLKF+DHHL QQRALQ LGM+Q    NAWRPQRGLPERAV
Sbjct  325   ANKSLGEEDSVSGVGRFEGSRLKFVDHHLRQQRALQQLGMIQHPSNNAWRPQRGLPERAV  384

Query  1191  SVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             SVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  385   SVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  428



>gb|KHG01894.1| BEL1-like homeodomain protein 1 [Gossypium arboreum]
Length=634

 Score =   324 bits (830),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 163/260 (63%), Positives = 193/260 (74%), Gaps = 15/260 (6%)
 Frame = +3

Query  567   ITHGISG---FITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFg  737
             +T+G+SG    +  SK+LKAAQELLDEVVNV  +           +        S     
Sbjct  149   VTNGVSGVQSMLLSSKFLKAAQELLDEVVNVNNTGITKNELAKKGRGGGDNSNSS-----  203

Query  738   gcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIV  917
                    ++     A      ELTTA+RQ++QMKKAKL+SM+DEV+QRYRQYHHQMQ+++
Sbjct  204   --KAVGESAAAAGDADGKQGPELTTAERQEIQMKKAKLISMLDEVDQRYRQYHHQMQIVI  261

Query  918   ASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG-----VRGSR  1082
             +SFEQAAG+GSA++YT LAL TISKQFRCLK AI  QI+A +KSLGEE+      + GSR
Sbjct  262   SSFEQAAGIGSAKTYTSLALKTISKQFRCLKDAITGQIRAANKSLGEEDCLGGSKIEGSR  321

Query  1083  LKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIML  1262
             LK +DHHL QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK+ML
Sbjct  322   LKLVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKVML  381

Query  1263  AKQTGLTRSQVSNWFINARV  1322
             AKQTGLTRSQVSNWFINARV
Sbjct  382   AKQTGLTRSQVSNWFINARV  401


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 42/75 (56%), Gaps = 12/75 (16%)
 Frame = +3

Query  36   MAMYYQGSSEVQG-DGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGNALHAGGMPHARL  212
            MA Y+ G+ E+Q  DGLQTL LMNP Y+ +SDT  P     +        HA   PH   
Sbjct  1    MATYFHGNPEIQAPDGLQTLVLMNPAYVQYSDTTPPPQPNNL------VFHAPPPPH---  51

Query  213  PQSQHFVGVPLPASA  257
              +Q FVGVPL A++
Sbjct  52   --TQQFVGVPLTATS  64



>ref|XP_011046419.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046420.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046421.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046422.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011046423.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=679

 Score =   324 bits (831),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 167/265 (63%), Positives = 200/265 (75%), Gaps = 14/265 (5%)
 Frame = +3

Query  552   ASSSSITHGI---SGFITGSKYLKAAQELLDEVVNVEKS-LKLDaaeeaankekakmkke  719
             ++ S +T+G+    G +  SKYLKA +ELLDEVVNV  + +K + ++++         K 
Sbjct  156   SAGSGVTNGVPAMQGVLLSSKYLKATEELLDEVVNVNSNGIKSELSKKSNGISSNNSNKL  215

Query  720   SMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHH  899
                             GE  A      EL+TA+RQ++QMKKAKL+SM+DEVEQRYRQYHH
Sbjct  216   ------IGESSTGEGSGEGEASGKRGPELSTAERQEIQMKKAKLISMLDEVEQRYRQYHH  269

Query  900   QMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----  1067
             QMQ++++SFEQAAG+GSA++YT LAL TISKQFRCLK AI  QIKA +KSLGEE+     
Sbjct  270   QMQIVISSFEQAAGIGSAKTYTALALKTISKQFRCLKDAITGQIKAANKSLGEEDCLGGK  329

Query  1068  VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDS  1247
             + GSRLKF+DHHL QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDS
Sbjct  330   IEGSRLKFVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDS  389

Query  1248  DKIMLAKQTGLTRSQVSNWFINARV  1322
             DK MLAKQTGLTRSQVSNWFINARV
Sbjct  390   DKHMLAKQTGLTRSQVSNWFINARV  414



>ref|XP_004497655.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=667

 Score =   323 bits (827),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 165/266 (62%), Positives = 203/266 (76%), Gaps = 14/266 (5%)
 Frame = +3

Query  546   SGASSSSITHGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkk  716
             +G S SS ++G+SG    +  SKYLKA QELLDEVVNV   +K++ ++++  K K   + 
Sbjct  138   NGGSCSSASNGVSGIQSVLLSSKYLKATQELLDEVVNVNGGIKVEISKKSFEKNKVVGES  197

Query  717   eSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYH  896
              +     G       SG  SS       EL+T +RQ++QMKKAKL++M+DEVEQRYRQYH
Sbjct  198   STGVSGDGGSVGGDGSGKRSS-------ELSTTERQEIQMKKAKLINMLDEVEQRYRQYH  250

Query  897   HQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG---  1067
             +QMQ++++SFEQ AG+GSAR+YT LAL TISKQFRCLK AI  QI+  +KSLGE++    
Sbjct  251   NQMQMVISSFEQVAGIGSARTYTALALQTISKQFRCLKDAITGQIRTANKSLGEDDSFGG  310

Query  1068  -VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKD  1244
              + GSRLK++DHHL QQRA+Q LGM+  NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKD
Sbjct  311   KIEGSRLKYVDHHLRQQRAIQQLGMIHHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKD  370

Query  1245  SDKIMLAKQTGLTRSQVSNWFINARV  1322
             SDK MLAKQTGLTRSQVSNWFINARV
Sbjct  371   SDKQMLAKQTGLTRSQVSNWFINARV  396


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 50/81 (62%), Gaps = 13/81 (16%)
 Frame = +3

Query  36   MAMYYQGSSEVQG---DGLQTLYLMNPN-YIGFSDTALPQSQQA---MFLNS--GNALHA  188
            MA Y+  +SE+QG   DGLQTL  MNP+ YI +SDT   QSQ A   +FLNS    ++H 
Sbjct  1    MATYFHNNSEIQGGSADGLQTLIFMNPSGYINYSDTPPQQSQHAGNLVFLNSAANTSIHQ  60

Query  189  GGMPHARLPQSQHFVGVPLPA  251
              + HA  PQ   FVGVPL A
Sbjct  61   QNLSHAP-PQ---FVGVPLTA  77



>ref|XP_006373820.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 ref|XP_002323384.2| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 ref|XP_006373821.1| BEL1-like homeodomain 1 family protein [Populus trichocarpa]
 ref|XP_006373822.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 gb|ERP51617.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 gb|EEF05145.2| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
 gb|ERP51618.1| BEL1-like homeodomain 1 family protein [Populus trichocarpa]
 gb|ERP51619.1| hypothetical protein POPTR_0016s07040g [Populus trichocarpa]
Length=679

 Score =   323 bits (827),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 168/253 (66%), Positives = 197/253 (78%), Gaps = 9/253 (4%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             G+ G +  SKYLKAAQELLDEVV+V  +   D   E + +        S    G      
Sbjct  167   GMQGVLLSSKYLKAAQELLDEVVSVNNN---DIKSELSKRSNGIGSNTSNKVVGESLAGE  223

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
              + GGE S ++    EL+TA+RQ++QMKKAKL+SM+DEVEQRYRQYHHQMQ++++SFEQA
Sbjct  224   GSGGGEVSGKR--GPELSTAERQEIQMKKAKLISMLDEVEQRYRQYHHQMQIVISSFEQA  281

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHH  1103
             AG+GSA++YT LAL TISKQFRCLK AI  QIKA +KSLGEE+     + GSRLKF+DHH
Sbjct  282   AGIGSAKTYTALALKTISKQFRCLKDAITGQIKAANKSLGEEDCLGGKIEGSRLKFVDHH  341

Query  1104  LPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLT  1283
             L QQRALQ LGM+Q NAWRPQRGLPER+VS+LRAWLFEHFLHPYPKDSDK MLAKQTGLT
Sbjct  342   LRQQRALQQLGMIQHNAWRPQRGLPERSVSLLRAWLFEHFLHPYPKDSDKHMLAKQTGLT  401

Query  1284  RSQVSNWFINARV  1322
             RSQVSNWFINARV
Sbjct  402   RSQVSNWFINARV  414



>emb|CDY40420.1| BnaA04g20970D [Brassica napus]
Length=632

 Score =   321 bits (823),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 172/268 (64%), Positives = 208/268 (78%), Gaps = 13/268 (5%)
 Frame = +3

Query  549   GASSSSITHGISGFITGSKYLKAAQELLDEVVNVE-KSLKLDaaeeaankekakmkkeSM  725
             G++ S +T+GI+  ++ SKYLKAAQELLDEVVN +   + + +   ++ K  +    +++
Sbjct  123   GSTGSGVTNGIANLVS-SKYLKAAQELLDEVVNADSNDINIKSQLFSSKKGTSGTDNKAV  181

Query  726   PPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQM  905
                    G+    GGE+S ++T   EL TA+RQ++QMKKAKL SM+ EVEQRYRQYH QM
Sbjct  182   GESSTGAGEGSGGGGEASGKRTV--ELGTAERQEIQMKKAKLSSMLHEVEQRYRQYHQQM  239

Query  906   QVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGV-----  1070
             Q++++SFEQAAG+GSA+SYT LAL TIS+QFRCLK AIA QIKA +KSLGEE+ V     
Sbjct  240   QMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQIKAANKSLGEEDSVSGVGR  299

Query  1071  -RGSRLKFIDHHLPQQRALQHLGMMQ---PNAWRPQRGLPERAVSVLRAWLFEHFLHPYP  1238
               GSRLKF+DHHL QQRALQ LGM+Q    NAWRPQRGLPERAVSVLRAWLFEHFLHPYP
Sbjct  300   LEGSRLKFVDHHLRQQRALQQLGMIQHPSNNAWRPQRGLPERAVSVLRAWLFEHFLHPYP  359

Query  1239  KDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             KDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  360   KDSDKHMLAKQTGLTRSQVSNWFINARV  387



>ref|XP_006381943.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381944.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381945.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_002308323.2| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381946.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381947.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 ref|XP_006381948.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59740.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59741.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59742.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|EEE91846.2| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59743.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59744.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
 gb|ERP59745.1| hypothetical protein POPTR_0006s21950g [Populus trichocarpa]
Length=678

 Score =   322 bits (826),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 166/262 (63%), Positives = 197/262 (75%), Gaps = 14/262 (5%)
 Frame = +3

Query  561   SSITHGISGF---ITGSKYLKAAQELLDEVVNVEKS-LKLDaaeeaankekakmkkeSMP  728
             S +T+G+ G    +  SKYLKA +ELLDEVVNV  + +K + ++++         K    
Sbjct  158   SGVTNGVPGMQGVLLSSKYLKATEELLDEVVNVNSNGIKSELSKKSNGISSNNSNKV---  214

Query  729   PFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQ  908
                          GE  A      EL+TA+RQ++ MKKAKL+SM+DEVEQRYRQYHHQMQ
Sbjct  215   ---IGESSTGEGSGEGEASGKRGPELSTAERQEIHMKKAKLMSMLDEVEQRYRQYHHQMQ  271

Query  909   VIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRG  1076
             ++++SFEQAAG+GSA++YT LAL TISKQFRCLK AI  QIKA +KSLGEE+     + G
Sbjct  272   IVISSFEQAAGIGSAKTYTALALKTISKQFRCLKDAITGQIKAANKSLGEEDCLGGKIEG  331

Query  1077  SRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKI  1256
             SRLKF+DHHL QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK 
Sbjct  332   SRLKFVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKH  391

Query  1257  MLAKQTGLTRSQVSNWFINARV  1322
             MLAKQTGLTRSQVSNWFINARV
Sbjct  392   MLAKQTGLTRSQVSNWFINARV  413



>ref|XP_011042587.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042589.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042590.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042591.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042592.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
 ref|XP_011042593.1| PREDICTED: BEL1-like homeodomain protein 1 [Populus euphratica]
Length=679

 Score =   322 bits (824),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 166/253 (66%), Positives = 196/253 (77%), Gaps = 9/253 (4%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             G+ G +  SKYLKAAQELLDEVV+V  +   D   E + K        S    G      
Sbjct  167   GMQGVLLSSKYLKAAQELLDEVVSVNNN---DIKSELSKKSNGIGSNTSNKVVGESLAGE  223

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
              + GG+ S ++    EL+TA+RQ++QMKKAK +S++DEV+QRYRQYHHQMQ++++SFEQA
Sbjct  224   GSGGGDVSGKR--GPELSTAERQEIQMKKAKFISLLDEVDQRYRQYHHQMQIVISSFEQA  281

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHH  1103
             AG+GSA++YT LAL TISKQFRCLK AI  QIKA +KSLGEE+     + GSRLKF+DHH
Sbjct  282   AGIGSAKTYTALALKTISKQFRCLKDAITGQIKAANKSLGEEDCMGGKIEGSRLKFVDHH  341

Query  1104  LPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLT  1283
             L QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK MLAKQTGLT
Sbjct  342   LRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLT  401

Query  1284  RSQVSNWFINARV  1322
             RSQVSNWFINARV
Sbjct  402   RSQVSNWFINARV  414



>emb|CDX79646.1| BnaC03g19820D [Brassica napus]
Length=691

 Score =   322 bits (824),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 221/469 (47%), Positives = 275/469 (59%), Gaps = 81/469 (17%)
 Frame = +3

Query  36    MAMYYQGS----SEVQGDGLQTLYLMNPNYIGFSDTALPQSQQA----------------  155
             MA Y+ G+    S     GLQTL LMNP       T +P +QQ                 
Sbjct  19    MAAYFHGNPPEISAGTDGGLQTLILMNPT------TYVPYTQQDDDSNNSSNNNNNTNNN  72

Query  156   --MFLNSGNALHAGGMPHARLPQSQHFVGVPLPASALGSAQLHD--------PARSLWAG  305
               +FL+S    HA          +Q FVG+PL      S    D        P R  +  
Sbjct  73    SFVFLDS----HA-----PPRNANQQFVGIPLSGHEAASITAADNISVLHGYPPRVQY--  121

Query  306   LEQAGSGSGGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRS  485
                  S  G  Q+                    H++   +P AQ+GLSL+LS QQ   + 
Sbjct  122   -----SLYGSHQVDPT----------------HHQAACETPRAQRGLSLTLSSQQQKQQH  160

Query  486   LPMESPVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKS-L  662
                   VG  S         SG+++S +T+GI+  ++ SKYLKAAQELLDEVV  + + +
Sbjct  161   RQTLHHVGFGSGPGEDIRVGSGSTASGVTNGIANLVS-SKYLKAAQELLDEVVKADSNDI  219

Query  663   KLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKK  842
                +   ++ K  +    +++        +    GGE+S ++T   EL TA+RQ++QMKK
Sbjct  220   NTKSQLFSSKKGTSVTDTKAVGESSTGAREGSDGGGEASGKRTV--ELGTAERQEIQMKK  277

Query  843   AKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIA  1022
             AKL SM+ EVEQRYRQYH QMQ++++SFEQAAG+GSA+SYT LAL TIS+QFRCLK AIA
Sbjct  278   AKLSSMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIA  337

Query  1023  SQIKATSKSLGEEEGV------RGSRLKFIDHHLPQQRALQHLGMMQ---PNAWRPQRGL  1175
              QIKA +KSLGEE+ V       GSRLKF+D+HL QQRALQ LGM+Q    NAWRPQRGL
Sbjct  338   GQIKAANKSLGEEDSVSGVGRFEGSRLKFVDNHLRQQRALQQLGMIQHPSNNAWRPQRGL  397

Query  1176  PERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PERAVSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  398   PERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  446



>ref|XP_003519115.1| PREDICTED: BEL1-like homeodomain protein 1-like isoformX1 [Glycine 
max]
 ref|XP_006575286.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006575287.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
Length=664

 Score =   320 bits (821),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 157/253 (62%), Positives = 191/253 (75%), Gaps = 10/253 (4%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             GI   +  SKYLKA QELLDEVVNV   +K++  ++   ++   + + S           
Sbjct  154   GIQSVLLSSKYLKATQELLDEVVNVNSGIKVEQTKKLCFEKTKVVGESS------TAASG  207

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
                          ++EL+T +RQ++QMKKAKL++M+DEVEQRYRQYH QMQ++++SFEQA
Sbjct  208   GDGSVGGEGSGKRSSELSTTERQEIQMKKAKLINMLDEVEQRYRQYHSQMQIVISSFEQA  267

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHH  1103
             AG+GSAR+YT LAL TISKQFRCLK AI  QI+A +KSLGEE+     + GSRLK++DHH
Sbjct  268   AGIGSARTYTALALQTISKQFRCLKDAITGQIRAANKSLGEEDCFGAKIEGSRLKYVDHH  327

Query  1104  LPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLT  1283
             L QQRA+Q LGM+  NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK MLAKQTGLT
Sbjct  328   LRQQRAIQQLGMINHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLT  387

Query  1284  RSQVSNWFINARV  1322
             RSQVSNWFINARV
Sbjct  388   RSQVSNWFINARV  400


 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 46/75 (61%), Gaps = 6/75 (8%)
 Frame = +3

Query  36   MAMYYQGSSEVQG--DGLQTLYLMNPNYIGFSDT-ALPQSQQAMFLNS--GNALHAGGMP  200
            MA Y+  +SE+Q   DGLQTL LMNP Y+ +SDT   P     +FLNS  GNA     + 
Sbjct  1    MATYFHSNSEIQAGADGLQTLVLMNPGYVQYSDTPPPPHGGNLVFLNSAAGNA-SLQNLS  59

Query  201  HARLPQSQHFVGVPL  245
            HA  P +Q FVGVPL
Sbjct  60   HAPPPHTQQFVGVPL  74



>ref|XP_002881420.1| hypothetical protein ARALYDRAFT_482564 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57679.1| hypothetical protein ARALYDRAFT_482564 [Arabidopsis lyrata subsp. 
lyrata]
Length=671

 Score =   320 bits (821),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 221/471 (47%), Positives = 263/471 (56%), Gaps = 81/471 (17%)
 Frame = +3

Query  36    MAMYYQGS----SEVQGDGLQTLYLMNPN-YIGFSDTALPQSQQA------------MFL  164
             MA Y+ G+    S     GLQTL LMNP  Y+ ++      +               +FL
Sbjct  1     MAAYFHGNPPEISAGSDGGLQTLILMNPTTYVQYTQQDNDSNNNNNNNSNTNNNNSFVFL  60

Query  165   NSGNALHAGGMPHARLPQ-SQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQ  341
             +S          HA  P  SQ FVG+PL      S    D    L               
Sbjct  61    DS----------HAPQPNASQQFVGIPLSGHEAASITAADNISVLHG-------------  97

Query  342   IPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESP------  503
              P  V            Q   + S  V PT QQ    +   QQ    SL + S       
Sbjct  98    YPPRV------------QYSLYGSHQVDPTHQQAACETPRAQQG--LSLTLSSQQQQQQQ  143

Query  504   ---------VGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEK  656
                      VG  S         SG++ S +T+GI+  ++ SKYLKAAQELLDEVVN + 
Sbjct  144   HHQQHQPIHVGFGSGPGEDIRVGSGSTGSGVTNGIANLVS-SKYLKAAQELLDEVVNAD-  201

Query  657   SLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQM  836
             S  ++A  +  + +K     +        G     SGG   A      EL TA+RQ++QM
Sbjct  202   SDDMNAKSQLFSSKKGSSGNDKAVGESSAGAGGEGSGGGGEAAGKRTVELGTAERQEIQM  261

Query  837   KKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVA  1016
             KKAKL +M+ EVEQRYRQYH QMQ++++SFEQAAG+GSA+SYT LAL TIS+QFRCLK A
Sbjct  262   KKAKLNNMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEA  321

Query  1017  IASQIKATSKSLGEEEGV------RGSRLKFIDHHLPQQRALQHLGMMQ---PNAWRPQR  1169
             IA QIKA +KSLGEE+ V       GSRLKF+DHHL QQRALQ LGM+Q    NAWRPQR
Sbjct  322   IAGQIKAANKSLGEEDSVSGVGRFEGSRLKFVDHHLRQQRALQQLGMIQHPSNNAWRPQR  381

Query  1170  GLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             GLPERAVSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  382   GLPERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  432



>ref|XP_010521016.1| PREDICTED: BEL1-like homeodomain protein 1 [Tarenaya hassleriana]
Length=662

 Score =   320 bits (819),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 170/268 (63%), Positives = 203/268 (76%), Gaps = 11/268 (4%)
 Frame = +3

Query  546   SGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSM  725
             SG++ S +T+ +   +  SKYL+AAQELLDEVVNV  S +L        K  +     + 
Sbjct  164   SGSTVSGLTNSVVSGLLSSKYLRAAQELLDEVVNVNNSNELLLPSTTPKKASSGGXXPAG  223

Query  726   PPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQM  905
                 G G      GG+ + ++ A  EL+TA+RQ++QMKKAKL+SM+ EV+QRYRQYHHQM
Sbjct  224   ESSAGVGEGSGGGGGDVTGKRVA--ELSTAERQEIQMKKAKLISMLHEVDQRYRQYHHQM  281

Query  906   QVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGV-----  1070
             Q++++SFEQAAG+GSA+SYT LAL TIS+QFRCLK AI+ QI+  +KSLGEEE V     
Sbjct  282   QIVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKDAISGQIETANKSLGEEESVSGGGR  341

Query  1071  -RGSRLKFIDHHLPQQRALQHLGMMQ---PNAWRPQRGLPERAVSVLRAWLFEHFLHPYP  1238
               GSRLKF+DHHL QQRALQ LGM+Q    NAWRPQRGLPERAVSVLRAWLFEHFLHPYP
Sbjct  342   FEGSRLKFVDHHLRQQRALQQLGMIQHPNNNAWRPQRGLPERAVSVLRAWLFEHFLHPYP  401

Query  1239  KDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             KDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  402   KDSDKHMLAKQTGLTRSQVSNWFINARV  429



>ref|XP_008391977.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008391978.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=708

 Score =   321 bits (822),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 230/477 (48%), Positives = 288/477 (60%), Gaps = 85/477 (18%)
 Frame = +3

Query  36    MAMYYQ----GSSEVQG--DG-LQTLYLMNPNYIGFSDTALPQ------------SQQAM  158
             MA Y+      SSE+Q   DG LQTL LMNP Y+ +SDT  P             +   +
Sbjct  1     MAAYFHHHGGNSSEIQASSDGALQTLVLMNPGYVQYSDTPPPPQQQQQQPQPPSAATNLV  60

Query  159   FLNSG-NAL--HAGGMPHARLPQSQHFVGVPLPASALGSAQL--HDPAR-----------  290
             FLNS  N+L  H   + HA     Q F+G+PL     G++ L  H P             
Sbjct  61    FLNSAPNSLTHHPSTLSHAPPSHHQQFLGIPLTQDPNGNSSLSMHHPHHDISALHAFMPR  120

Query  291   -----SLWAGLEQAGSGSGGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlsls  455
                  +LW  ++ A S                 T D             +P +QQGLSLS
Sbjct  121   IQTQYALWNSIDPAAS-----------------TRD-------------TPRSQQGLSLS  150

Query  456   lsPQQHPFRSLPMESPVGLL-SARPGAAHDNSGASSSSITHGISGF---ITGSKYLKAAQ  623
             LS QQ  F S    S    + S         S +S+S +T+G+SG    +  SKYLKAAQ
Sbjct  151   LSSQQPGFGSFQETSAEREVPSGEDIRVSSGSNSSASGVTNGVSGMQSVLLSSKYLKAAQ  210

Query  624   ELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAE  803
             ELLDE VNV   ++ +  ++   ++     + SM           + GGE S ++  AAE
Sbjct  211   ELLDEFVNVGNGMRTELPKKGNGQQSKAAAESSM-----AEARDGSVGGEGSGKR--AAE  263

Query  804   LTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNT  983
             L+TA+RQ++QMKK KL++M+DEV+QRYRQYH QMQ++++SFEQAAG+GSAR+YT LAL T
Sbjct  264   LSTAERQEIQMKKGKLINMLDEVDQRYRQYHRQMQMVISSFEQAAGIGSARTYTALALQT  323

Query  984   ISKQFRCLKVAIASQIKATSKSLGEEEGV----RGSRLKFIDHHLPQQRALQHLGMMQPN  1151
             ISKQFRCLK AI +QI++ +KSLGEE+ V     GSRLK++DH L QQRALQ LGM+Q N
Sbjct  324   ISKQFRCLKDAITNQIRSANKSLGEEDSVGGKIEGSRLKYVDHQLRQQRALQQLGMVQHN  383

Query  1152  AWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             AWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  384   AWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  440



>ref|XP_009348973.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
 ref|XP_009348980.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
 ref|XP_009348985.1| PREDICTED: BEL1-like homeodomain protein 1 [Pyrus x bretschneideri]
Length=710

 Score =   321 bits (822),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 228/466 (49%), Positives = 289/466 (62%), Gaps = 61/466 (13%)
 Frame = +3

Query  36    MAMYYQ----GSSEVQG--DG-LQTLYLMNPNYIGFSDTALPQ--------------SQQ  152
             MA Y+      SSE+Q   DG LQTL LMNP Y+ +SDT  P               +  
Sbjct  1     MAAYFHHHGGNSSEIQASSDGALQTLVLMNPGYVQYSDTPPPPQQQQQQQQPQPPSAATN  60

Query  153   AMFLNSG-NAL--HAGGMPHARLPQSQHFVGVPLPASALGSAQL-----HDPARSLWAGL  308
              +FLNS  N+L  H   + HA     Q F+G+PL     G++ L     H+   +L A +
Sbjct  61    LVFLNSAPNSLTHHPSTLSHAPPSHHQQFLGIPLTQDPNGNSSLSMHHPHNDISALHAFM  120

Query  309   EQAGSGSGGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSL  488
              +  +    Q      +     T D             +P +QQGLSLSLS QQ  F S 
Sbjct  121   PRIQT----QYALWNSIDPAASTRD-------------TPRSQQGLSLSLSSQQPGFGSF  163

Query  489   PMESPVGLL-SARPGAAHDNSGASSSSITHGISGF---ITGSKYLKAAQELLDEVVNVEK  656
                S    + S         S +S+S +T+G+SG    +  SKYLKAAQELLDEVVNV  
Sbjct  164   QETSAEREVPSGEDIRVSSGSNSSASGVTNGVSGMQSVLLSSKYLKAAQELLDEVVNVGN  223

Query  657   SLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQM  836
              ++ +  ++   ++     + SM           + GGE + ++  AAEL+TA+RQ++QM
Sbjct  224   GMRTELPKKGNGQQSKAAAESSM-----AEARDGSVGGEGNGKR--AAELSTAERQEIQM  276

Query  837   KKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVA  1016
             KK KL++M+DEV+QRYRQYH QM V+++SFEQAAG+GSAR+YT LAL TISKQFRCLK A
Sbjct  277   KKGKLINMLDEVDQRYRQYHRQMHVVISSFEQAAGIGSARTYTALALQTISKQFRCLKDA  336

Query  1017  IASQIKATSKSLGEEEGV----RGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPER  1184
             I +QI++ +KSLGEE+ V     GSRLK++DH L QQRALQ LGM+Q NAWRPQRGLPER
Sbjct  337   ITNQIRSANKSLGEEDSVGGKIEGSRLKYVDHQLRQQRALQQLGMVQHNAWRPQRGLPER  396

Query  1185  AVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             +VSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  397   SVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  442



>ref|XP_010553582.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
1 [Tarenaya hassleriana]
Length=563

 Score =   317 bits (811),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 162/258 (63%), Positives = 189/258 (73%), Gaps = 19/258 (7%)
 Frame = +3

Query  561   SSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFgg  740
             S +T+G+   +  SKYLKA QELLDEVVNV   + +       +K        +      
Sbjct  89    SGVTNGVVSDLLSSKYLKAVQELLDEVVNVNNFMNISLFXCGGDKLSGGSSAGT------  142

Query  741   cggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVA  920
                      GE SA + +  E+ T +RQ++QMKKAKL+SM+ EV+QRYRQYHHQMQ++++
Sbjct  143   ---------GEGSAAEKSDVEVGTVERQEIQMKKAKLISMLHEVDQRYRQYHHQMQIVIS  193

Query  921   SFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGV-RGSRLKFID  1097
             SFEQAAG GSA+SYT LAL TIS+QFRCLK AI  QIKA +K LGEEE V  GSRLKF+D
Sbjct  194   SFEQAAGTGSAKSYTSLALKTISRQFRCLKEAITGQIKAANKCLGEEESVFEGSRLKFVD  253

Query  1098  HHLPQQRALQHLGMMQ---PNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAK  1268
             HH  QQR LQ LG++Q    NAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK MLAK
Sbjct  254   HHFRQQRTLQQLGVIQHSNNNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKHMLAK  313

Query  1269  QTGLTRSQVSNWFINARV  1322
             QTGLTRSQVSNWFINARV
Sbjct  314   QTGLTRSQVSNWFINARV  331



>ref|XP_009141535.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
 ref|XP_009141536.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
 ref|XP_009141537.1| PREDICTED: BEL1-like homeodomain protein 1 [Brassica rapa]
Length=675

 Score =   320 bits (819),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 172/268 (64%), Positives = 208/268 (78%), Gaps = 13/268 (5%)
 Frame = +3

Query  549   GASSSSITHGISGFITGSKYLKAAQELLDEVVNVE-KSLKLDaaeeaankekakmkkeSM  725
             G++ S +T+GI+  ++ SKYLKAAQELLDEVVN +   + + +   ++ K  +    +++
Sbjct  166   GSTGSGVTNGIANLVS-SKYLKAAQELLDEVVNADSNDINIKSQLFSSKKGTSGTDNKAV  224

Query  726   PPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQM  905
                    G+    GGE+S ++T   EL TA+RQ++QMKKAKL SM+ EVEQRYRQYH QM
Sbjct  225   GESSTGAGEGSGGGGEASGKRTV--ELGTAERQEIQMKKAKLSSMLHEVEQRYRQYHQQM  282

Query  906   QVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGV-----  1070
             Q++++SFEQAAG+GSA+SYT LAL TIS+QFRCLK AIA QIKA +KSLGEE+ V     
Sbjct  283   QMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQIKAANKSLGEEDSVSGVGT  342

Query  1071  -RGSRLKFIDHHLPQQRALQHLGMMQ---PNAWRPQRGLPERAVSVLRAWLFEHFLHPYP  1238
               GSRLKF+DHHL QQRALQ LGM+Q    NAWRPQRGLPERAVSVLRAWLFEHFLHPYP
Sbjct  343   LEGSRLKFVDHHLRQQRALQQLGMIQHPSNNAWRPQRGLPERAVSVLRAWLFEHFLHPYP  402

Query  1239  KDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             KDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  403   KDSDKHMLAKQTGLTRSQVSNWFINARV  430



>ref|XP_006410764.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 ref|XP_006410765.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 ref|XP_006410766.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52217.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52218.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
 gb|ESQ52219.1| hypothetical protein EUTSA_v10016349mg [Eutrema salsugineum]
Length=677

 Score =   320 bits (819),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 221/476 (46%), Positives = 268/476 (56%), Gaps = 86/476 (18%)
 Frame = +3

Query  36    MAMYYQGS----SEVQGDGLQTLYLMNPN-YIGFSDTALPQSQQA--------------M  158
             MA Y+ G+    S     GLQTL LMNP  Y+ ++      +                 +
Sbjct  1     MAAYFHGNPPEISAGSDGGLQTLILMNPTTYVQYTQQDNDSNNNINNNSNNNTNNNNSFV  60

Query  159   FLNSGNALHAGGMPHARLPQ--SQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSG  332
             FL+S          HA  PQ  SQ FVG+PL      S    D    L            
Sbjct  61    FLDS----------HAP-PQNTSQQFVGIPLSGHEAASITAADNISVLHG----------  99

Query  333   GQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMES----  500
                 P  V            Q   + S  V PT QQ    +   QQ    SL + S    
Sbjct  100   ---YPPRV------------QYSLYNSHQVDPTHQQAACETPRAQQG--LSLTLSSQQQQ  142

Query  501   ---------PVGLLSARPGAAHD---NSGASSSSITHGISGFITGSKYLKAAQELLDEVV  644
                      P+  +    G   D    SG++ S +T+GI+  ++ SKYLKAAQELLDEVV
Sbjct  143   QQQHHNQNRPLHHVGFGSGPGEDIRVGSGSTGSGVTNGIANLVS-SKYLKAAQELLDEVV  201

Query  645   NVE-KSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQR  821
             N +   +    ++  ++K+ +    +++      G     SGG   A      EL TA+R
Sbjct  202   NADSNDINTTKSQLFSSKKGSSGNDKAVGESSAGGATGEGSGGGGEASGKRTVELGTAER  261

Query  822   QDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFR  1001
             Q++QMKKAKL SM+ EVEQRYRQYH QMQ++++SFEQAAG+GSA+SYT LAL TIS+QFR
Sbjct  262   QEIQMKKAKLSSMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFR  321

Query  1002  CLKVAIASQIKATSKSLGEEEGV------RGSRLKFIDHHLPQQRALQHLGMMQ---PNA  1154
             CLK AIA QIKA +KSLGEE+ V       GSRLKF+DHHL QQRALQ LGM+Q    NA
Sbjct  322   CLKEAIAGQIKAANKSLGEEDSVSGVGRFEGSRLKFVDHHLRQQRALQQLGMIQHPSNNA  381

Query  1155  WRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             WRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  382   WRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  437



>ref|XP_007145789.1| hypothetical protein PHAVU_007G267900g [Phaseolus vulgaris]
 gb|ESW17783.1| hypothetical protein PHAVU_007G267900g [Phaseolus vulgaris]
Length=649

 Score =   318 bits (816),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 162/253 (64%), Positives = 197/253 (78%), Gaps = 15/253 (6%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             GI   +  SKYLKA QELLDEVVNV   +K++ A+++  K K   +  +           
Sbjct  153   GIQSVLLSSKYLKATQELLDEVVNVNSGIKIEQAKKSFEKTKVVGESST---------AA  203

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
                GGE S ++++  EL+T +RQ++QMKKAKL++M+DEVEQRYRQYH+QMQ++ +SFEQ 
Sbjct  204   SGDGGEGSGKRSS--ELSTTERQEIQMKKAKLINMLDEVEQRYRQYHNQMQIVTSSFEQV  261

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHH  1103
             AG+GSAR+YT LAL TISKQFRCLK AI  QI+A ++SLGEE+     V GSRLK++DHH
Sbjct  262   AGIGSARTYTALALQTISKQFRCLKDAITGQIRAANRSLGEEDCFGTKVEGSRLKYVDHH  321

Query  1104  LPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLT  1283
             L QQRA+Q LGM+  NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK MLAKQTGLT
Sbjct  322   LRQQRAIQQLGMIHHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLT  381

Query  1284  RSQVSNWFINARV  1322
             RSQVSNWFINARV
Sbjct  382   RSQVSNWFINARV  394


 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 7/81 (9%)
 Frame = +3

Query  36   MAMYYQGSSEVQ--GDGLQTLYLMNPNYIGFSDTALPQ-SQQAMFLNSG----NALHAGG  194
            MA Y+Q + ++Q   DGLQTL LMN +Y+ +SD   P      +FLNS     N      
Sbjct  1    MATYFQSNPKIQSGADGLQTLVLMNSDYVQYSDAPPPHHGGNHLFLNSAATVANNTSLLN  60

Query  195  MPHARLPQSQHFVGVPLPASA  257
            +PHA  P +Q FVGVPL A+A
Sbjct  61   LPHAPSPHTQQFVGVPLSATA  81



>ref|XP_008360598.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008360599.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=710

 Score =   320 bits (820),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 229/479 (48%), Positives = 287/479 (60%), Gaps = 87/479 (18%)
 Frame = +3

Query  36    MAMYYQ----GSSEVQG--DG-LQTLYLMNPNYIGFSDTALPQ--------------SQQ  152
             MA Y+      SSE+Q   DG LQTL LMNP Y+ +SDT  P               +  
Sbjct  1     MAAYFHHHGGNSSEIQASSDGALQTLVLMNPGYVQYSDTPPPPQQQQQQQQPQPPSAATN  60

Query  153   AMFLNSG-NAL--HAGGMPHARLPQSQHFVGVPLPASALGSAQL--HDPAR---------  290
              +FLNS  N+L  H   + HA     Q F+G+PL     G++ L  H P           
Sbjct  61    LVFLNSAPNSLTHHPSTLSHAPPSHHQQFLGIPLTQDPNGNSSLSMHHPHHDISALHAFM  120

Query  291   -------SLWAGLEQAGSGSGGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGls  449
                    +LW  ++ A S                 T D             +P +QQGLS
Sbjct  121   PRIQTQYALWNSIDPAAS-----------------TRD-------------TPRSQQGLS  150

Query  450   lslsPQQHPFRSLPMESPVGLL-SARPGAAHDNSGASSSSITHGISGF---ITGSKYLKA  617
             LSLS QQ  F S    S    + S         S +S+S +T+G+SG    +  SKYLKA
Sbjct  151   LSLSSQQPGFGSFQETSAEREVPSGEDIRVSSGSNSSASGVTNGVSGMQSVLLSSKYLKA  210

Query  618   AQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAA  797
             AQELLDE VNV   ++ +  ++   ++     + SM           + G E S ++  A
Sbjct  211   AQELLDEFVNVGNGMRTELPKKGNGQQSKAAAESSM-----AEARDGSVGXEGSGKR--A  263

Query  798   AELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLAL  977
             AEL+TA+RQ++QMKK KL++M+DEV+QRYRQYH QMQ++++SFEQAAG+GSAR+YT LAL
Sbjct  264   AELSTAERQEIQMKKGKLINMLDEVDQRYRQYHRQMQMVISSFEQAAGIGSARTYTALAL  323

Query  978   NTISKQFRCLKVAIASQIKATSKSLGEEEGV----RGSRLKFIDHHLPQQRALQHLGMMQ  1145
              TISKQFRCLK AI +QI++ +KSLGEE+ V     GSRLK++DH L QQRALQ LGM+Q
Sbjct  324   QTISKQFRCLKDAITNQIRSANKSLGEEDSVGGKIEGSRLKYVDHQLRQQRALQQLGMVQ  383

Query  1146  PNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
              NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  384   HNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  442



>dbj|BAE71188.1| BEL1-like homeodomain transcription factor [Trifolium pratense]
Length=651

 Score =   318 bits (816),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 161/253 (64%), Positives = 195/253 (77%), Gaps = 11/253 (4%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             GI   +  SKYLKA QELLDEVVNV   +K+++ +++  K K   +  +     G     
Sbjct  158   GIQSVLLNSKYLKATQELLDEVVNVNGGIKVESVKKSFEKNKVVGESSTAVSGDGGSVGG  217

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
               SG  S+       EL+T +RQ++QMKKAKL++M+DEVEQRYRQYH+QMQ++++SFEQ 
Sbjct  218   DGSGKRST-------ELSTTERQEVQMKKAKLINMLDEVEQRYRQYHNQMQMVISSFEQV  270

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHH  1103
             AG+GSAR+YT LAL TISKQFRCLK AI  QI+A +KSLGE++     + GSRLK++DHH
Sbjct  271   AGIGSARTYTALALQTISKQFRCLKDAITGQIRAANKSLGEDDSFGGKIEGSRLKYVDHH  330

Query  1104  LPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLT  1283
             L QQRA+Q LGMM  NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK MLAKQTGLT
Sbjct  331   LRQQRAIQQLGMMHHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLT  390

Query  1284  RSQVSNWFINARV  1322
             RSQVSNWFINARV
Sbjct  391   RSQVSNWFINARV  403


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/101 (43%), Positives = 51/101 (50%), Gaps = 19/101 (19%)
 Frame = +3

Query  36   MAMYYQGSSEVQG---DGLQTLYLMNPN-YIGFSDTAL--PQSQQAMFLNSGNALHAGGM  197
            MA Y+  +SE+QG   DGLQTL  MNP+ YI +SDT    P +   +FLNS   L   G 
Sbjct  1    MATYFHNNSEIQGGSADGLQTLIFMNPSGYINYSDTPQPPPHAGNLVFLNSAATLAGNGN  60

Query  198  PHARLPQSQH--------FVGVPLPASALGSAQLHDPARSL  296
                  Q QH        FVGVPL  SA  S Q H    +L
Sbjct  61   TSI---QQQHNLSHAPPQFVGVPL--SAEQSVQAHHDISAL  96



>emb|CBI24428.3| unnamed protein product [Vitis vinifera]
Length=573

 Score =   316 bits (810),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 181/257 (70%), Positives = 205/257 (80%), Gaps = 15/257 (6%)
 Frame = +3

Query  573   HGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggc  743
             +GISG    + GSKYLKAAQ+LLDEV NV K +K D+ EE   +EK      +       
Sbjct  137   NGISGMQSVLLGSKYLKAAQQLLDEVANVGKGIKTDSGEETKEREKVNTISVA------A  190

Query  744   ggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVAS  923
                   SGGESSA++   AEL+TAQRQ+LQMKKAKL++M+DEVEQRYRQYH QMQ++V+S
Sbjct  191   STGEALSGGESSAKR--GAELSTAQRQELQMKKAKLVNMLDEVEQRYRQYHQQMQIVVSS  248

Query  924   FEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKF  1091
             FEQAAG GSA+SYT LAL TISKQFRCLK AI++QIKATS SLGEE+     V GSRL+F
Sbjct  249   FEQAAGQGSAKSYTALALQTISKQFRCLKDAISAQIKATSSSLGEEDCSGGKVEGSRLRF  308

Query  1092  IDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQ  1271
             +DH L QQRALQ LGM+Q NAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK MLAKQ
Sbjct  309   VDHQLRQQRALQQLGMIQHNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQ  368

Query  1272  TGLTRSQVSNWFINARV  1322
             TGLTRSQVSNWFINARV
Sbjct  369   TGLTRSQVSNWFINARV  385


 Score = 96.3 bits (238),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 62/87 (71%), Gaps = 4/87 (5%)
 Frame = +3

Query  36   MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSG-NALHAGGMPHARL  212
            MA Y+ GSSE+Q DGLQTLYLMNPNYIG+SDT  P +   +FLN+  N+L+   +P+  L
Sbjct  1    MATYFHGSSEIQADGLQTLYLMNPNYIGYSDTQQPSAANMLFLNATPNSLNPTNLPNMSL  60

Query  213  PQSQHFVGVPLPASALGSAQLHDPARS  293
             Q+QHFVG+PLP   +GSA   D  RS
Sbjct  61   -QNQHFVGIPLP--NMGSANSDDQNRS  84



>gb|EPS74374.1| hypothetical protein M569_00381 [Genlisea aurea]
Length=404

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 197/421 (47%), Positives = 252/421 (60%), Gaps = 39/421 (9%)
 Frame = +3

Query  36    MAMYYQGSSEVQG--DGLQTLYLMNPNYIGFSDT-------ALPQSQQAMFLNSGNALHA  188
             M  YY G SE+QG  DGLQTL LMNP ++G+ D        A+ Q    +FLNSG+A   
Sbjct  1     MGTYYHGDSEIQGGGDGLQTLILMNPAFVGYGDGQQAPPSGAVAQGNNFVFLNSGSAAAG  60

Query  189   GG--MPHARLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSAVVS  362
              G  + H   PQ+QHFVG+PL      S Q      +L   + Q  +  G   +P  + +
Sbjct  61    VGNNLSHGAPPQTQHFVGIPLHRPPPSSPQQQQDVSALHGFMAQRATTYGLYNLPMDMSA  120

Query  363   GGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLP--MESPVGLLSARPGA-  533
                  T   SQ G   S+              S QQHP +SL      P G  + R  A 
Sbjct  121   AARDVTR--SQGGLSLSL-------------SSHQQHP-QSLGGGYGPPFGSAAERDVAP  164

Query  534   ----AHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankek  701
                 +  ++ A S+ +T G+   +  SKYLKAAQELLDEVVNV K  +  A E ++    
Sbjct  165   ISGGSPSSASAVSNGVTGGVQSVLLSSKYLKAAQELLDEVVNVGKGARTPAGESSSKATT  224

Query  702   akmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQR  881
                  ++       G          S+ K  A +LTTA+RQ++QMKKAKL++M+DEVEQR
Sbjct  225   TNSHNKTAAESSVSGAAANEPDNVGSSSKL-ATDLTTAERQEVQMKKAKLVNMLDEVEQR  283

Query  882   YRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEE  1061
             YRQYHHQMQ++VA FEQAAG+GSA++YT LAL TISKQFRCLK AI  QI++ SK+LGE+
Sbjct  284   YRQYHHQMQIVVAWFEQAAGIGSAKTYTALALQTISKQFRCLKDAILEQIRSVSKTLGED  343

Query  1062  EG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLH  1229
             E     + GSRLK++D+ + QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLH
Sbjct  344   ENLEGKIEGSRLKYVDNQIRQQRALQQLGMIQNNAWRPQRGLPERSVSVLRAWLFEHFLH  403

Query  1230  P  1232
             P
Sbjct  404   P  404



>ref|XP_007162972.1| hypothetical protein PHAVU_001G195800g [Phaseolus vulgaris]
 gb|ESW34966.1| hypothetical protein PHAVU_001G195800g [Phaseolus vulgaris]
Length=679

 Score =   318 bits (816),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 165/264 (63%), Positives = 203/264 (77%), Gaps = 18/264 (7%)
 Frame = +3

Query  543   NSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeS  722
             N+GAS      GI   +  SKYLKAA ELL+EVVNV      +  +++  + K   +  +
Sbjct  169   NNGAS------GIQSVLLSSKYLKAAHELLEEVVNVNNGTGTELGKKSGGQNKVIGESSA  222

Query  723   MPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQ  902
                    G    +  GE + ++++  EL+TA+RQ++QMKKAKL++M+DEVEQRYRQYH Q
Sbjct  223   ------AGSGDGSVVGEGNGKRSS--ELSTAERQEIQMKKAKLIAMLDEVEQRYRQYHQQ  274

Query  903   MQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----V  1070
             M+++V+SFEQAAG+GSAR+YT LAL TISKQFRCLK AIA Q++A +KSLGEE+     +
Sbjct  275   MEIVVSSFEQAAGIGSARTYTALALQTISKQFRCLKDAIAGQVRAANKSLGEEDCFGGKI  334

Query  1071  RGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
              GSRLK++DHHL QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSD
Sbjct  335   EGSRLKYVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSD  394

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             K MLAKQTGLTRSQVSNWFINARV
Sbjct  395   KHMLAKQTGLTRSQVSNWFINARV  418


 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 49/86 (57%), Gaps = 13/86 (15%)
 Frame = +3

Query  36   MAMYYQ-GSSEVQ---GDGLQTLYLMNPNYIGFSD--TALPQSQQA---MFLNS----GN  176
            MA Y+  G+SE+Q    DGLQTL LMNP YI +SD  +  P S  A   +FLNS    G 
Sbjct  1    MATYFHHGNSEIQSGAADGLQTLVLMNPGYIHYSDAPSQPPPSHAAGNLVFLNSAAVAGT  60

Query  177  ALHAGGMPHARLPQSQHFVGVPLPAS  254
              +    PHA    +Q FVG+PL AS
Sbjct  61   NSNNSFNPHAPPSHTQQFVGIPLSAS  86



>ref|XP_006293790.1| hypothetical protein CARUB_v10022772mg [Capsella rubella]
 gb|EOA26688.1| hypothetical protein CARUB_v10022772mg [Capsella rubella]
Length=679

 Score =   318 bits (814),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 173/268 (65%), Positives = 203/268 (76%), Gaps = 11/268 (4%)
 Frame = +3

Query  546   SGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSM  725
             SG++ S +T+GI+  ++ SKYLKAAQELLDEVVN + S  ++A  +  + +K     +  
Sbjct  176   SGSTGSGVTNGIANLVS-SKYLKAAQELLDEVVNAD-SDDINAKSQLFSSKKGSSGNDKA  233

Query  726   PPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQM  905
                   G     SGG   A      EL TA+RQ++QMKKAKL +M+ EVEQRYRQYH QM
Sbjct  234   VGESSAGAGGEGSGGGGEAAGKRTVELGTAERQEIQMKKAKLSNMLHEVEQRYRQYHQQM  293

Query  906   QVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGV-----  1070
             Q++++SFEQAAG+GSA+SYT LAL TIS+QFRCLK AIA QIKA +KSLGEE+ V     
Sbjct  294   QMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQIKAANKSLGEEDSVSGVGR  353

Query  1071  -RGSRLKFIDHHLPQQRALQHLGMMQ---PNAWRPQRGLPERAVSVLRAWLFEHFLHPYP  1238
               GSRLKF+DHHL QQRALQ LGM+Q    NAWRPQRGLPERAVSVLRAWLFEHFLHPYP
Sbjct  354   FEGSRLKFVDHHLRQQRALQQLGMIQHPSNNAWRPQRGLPERAVSVLRAWLFEHFLHPYP  413

Query  1239  KDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             KDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  414   KDSDKHMLAKQTGLTRSQVSNWFINARV  441



>ref|XP_010505121.1| PREDICTED: BEL1-like homeodomain protein 1 [Camelina sativa]
Length=675

 Score =   318 bits (814),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 221/476 (46%), Positives = 263/476 (55%), Gaps = 86/476 (18%)
 Frame = +3

Query  36    MAMYYQGS----SEVQGDGLQTLYLMNPN-YIGFSD-----------------TALPQSQ  149
             MA Y+ G+    S     GLQTL LMNP  Y+ ++                       + 
Sbjct  1     MAAYFHGNPPEISAGSDGGLQTLILMNPTTYVQYTQQDDDSNNNNNNNSNNNNNTNTNNN  60

Query  150   QAMFLNSGNALHAGGMPHARLPQ-SQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSG  326
               +FL+S          HA  P  SQ FVG+PL      S    D    L          
Sbjct  61    SFVFLDS----------HAPQPNASQQFVGIPLSGHEAASITAADNISVLHG--------  102

Query  327   SGGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESP-  503
                   P  V            Q   + S  V PT QQ    +   QQ    SL + S  
Sbjct  103   -----YPPRV------------QYSLYGSHQVDPTHQQAACETPRAQQG--LSLTLSSQQ  143

Query  504   --------------VGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEV  641
                           VG  S         SG++ S +T+GI+  ++ SKYLKAAQELLDEV
Sbjct  144   QQQQQHHQQHQPIHVGFGSGPGEDIRVGSGSAGSGVTNGIANLVS-SKYLKAAQELLDEV  202

Query  642   VNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQR  821
             VN + S  ++A  +  + +K     +        G     SGG   A      EL TA+R
Sbjct  203   VNAD-SDDINAKSQLFSSKKGSSGNDKAVGESSTGAGGEGSGGGGEAAGKRTVELGTAER  261

Query  822   QDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFR  1001
             Q++QMKKAKL +M+ EVEQRYRQYH QMQ++++SFEQAAG+GSA+SYT LAL TIS+QFR
Sbjct  262   QEIQMKKAKLSNMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALKTISRQFR  321

Query  1002  CLKVAIASQIKATSKSLGEEEGV------RGSRLKFIDHHLPQQRALQHLGMMQ---PNA  1154
             CLK AIA QIKA +KSLGEE+ V       GSRLKF+DHHL QQRALQ LGM+Q    NA
Sbjct  322   CLKEAIAGQIKAANKSLGEEDSVSGVGRFEGSRLKFVDHHLRQQRALQQLGMIQHPTNNA  381

Query  1155  WRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             WRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  382   WRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  437



>ref|XP_003535815.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006588872.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=661

 Score =   317 bits (812),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 159/253 (63%), Positives = 200/253 (79%), Gaps = 11/253 (4%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             GI   +  SKYLKA QELLDEVVNV   ++++ A++   ++   + + S           
Sbjct  150   GIQSVLLSSKYLKATQELLDEVVNVNGGIRVEHAKKLNFEKTKVVGESST-----AASGD  204

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
              + GGE S +++  +EL+T +RQ++Q+KKAKL++M+DEVEQRYRQYH+QM+++++SFEQA
Sbjct  205   GSVGGEGSGKRS--SELSTTERQEIQIKKAKLINMLDEVEQRYRQYHNQMKIVISSFEQA  262

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHH  1103
             AG+GSAR+YT LAL TISKQFRCLK AI  QI+A +KSLGEE+     + GSRLK++DHH
Sbjct  263   AGIGSARTYTALALQTISKQFRCLKDAITGQIRAANKSLGEEDCFGAKIEGSRLKYVDHH  322

Query  1104  LPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLT  1283
             L QQRA+Q LGM+  NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK MLAKQTGLT
Sbjct  323   LRQQRAIQQLGMIHHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLT  382

Query  1284  RSQVSNWFINARV  1322
             RSQVSNWFINARV
Sbjct  383   RSQVSNWFINARV  395


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 55/92 (60%), Gaps = 12/92 (13%)
 Frame = +3

Query  36   MAMYYQGSSEVQG--DGLQTLYLMNPNYIGFSDT-ALPQSQQAMFLNS--GNALHAGGMP  200
            MA Y+  +SE+Q   DGLQTL LMNP Y+ +SDT   P     +FLNS  GNA     +P
Sbjct  1    MATYFHSNSEIQAGADGLQTLVLMNPGYVQYSDTPPPPHGGNLVFLNSAAGNA-SLQSLP  59

Query  201  HARLPQSQHFVGVPLPASALGSAQLHDPARSL  296
            HA  P +Q FVGVPL A+A      H+P  S+
Sbjct  60   HAPPPHTQQFVGVPLSAAA------HEPPASM  85



>ref|XP_010509532.1| PREDICTED: BEL1-like homeodomain protein 1 [Camelina sativa]
Length=678

 Score =   317 bits (813),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 173/268 (65%), Positives = 203/268 (76%), Gaps = 11/268 (4%)
 Frame = +3

Query  546   SGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSM  725
             SG++ S +T+GI+  ++ SKYLKAAQELLDEVVN + S  ++A  +  + +K     +  
Sbjct  175   SGSAGSGVTNGIANLVS-SKYLKAAQELLDEVVNAD-SDDINAKSQLFSSKKGSSGNDKA  232

Query  726   PPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQM  905
                   G     SGG   A      EL TA+RQ++QMKKAKL +M+ EVEQRYRQYH QM
Sbjct  233   VGESSTGAGGEGSGGGGEAAGKRTVELGTAERQEIQMKKAKLSNMLHEVEQRYRQYHQQM  292

Query  906   QVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGV-----  1070
             Q++++SFEQAAG+GSA+SYT LAL TIS+QFRCLK AIA QIKA +KSLGEE+ V     
Sbjct  293   QMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQIKAANKSLGEEDSVSGVGR  352

Query  1071  -RGSRLKFIDHHLPQQRALQHLGMMQ---PNAWRPQRGLPERAVSVLRAWLFEHFLHPYP  1238
               GSRLKF+DHHL QQRALQ LGM+Q    NAWRPQRGLPERAVSVLRAWLFEHFLHPYP
Sbjct  353   FEGSRLKFVDHHLRQQRALQQLGMIQHPTNNAWRPQRGLPERAVSVLRAWLFEHFLHPYP  412

Query  1239  KDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             KDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  413   KDSDKHMLAKQTGLTRSQVSNWFINARV  440



>gb|AAK43836.1|AF353094_1 BEL1-like homeodomain 1 [Arabidopsis thaliana]
Length=680

 Score =   317 bits (812),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 171/270 (63%), Positives = 199/270 (74%), Gaps = 15/270 (6%)
 Frame = +3

Query  546   SGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSM  725
             SG++ S +T+GI+  ++ SKYLKAAQELLDEVVN +     D   ++      K    + 
Sbjct  176   SGSTGSGVTNGIANLVS-SKYLKAAQELLDEVVNADSD---DMNAKSQLFSSKKGSCGND  231

Query  726   PPFggcggdpptsggESSAQKTAA--AELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHH  899
              P G         G    A+       EL TA+RQ++QMKKAKL +M+ EVEQRYRQYH 
Sbjct  232   KPVGESSAGAGGEGSGGGAEAAGKRPVELGTAERQEIQMKKAKLSNMLHEVEQRYRQYHQ  291

Query  900   QMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGV---  1070
             QMQ++++SFEQAAG+GSA+SYT LAL TIS+QFRCLK AIA QIKA +KSLGEE+ V   
Sbjct  292   QMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQIKAANKSLGEEDSVSGV  351

Query  1071  ---RGSRLKFIDHHLPQQRALQHLGMMQ---PNAWRPQRGLPERAVSVLRAWLFEHFLHP  1232
                 GSRLKF+DHHL QQRALQ LGM+Q    NAWRPQRGLPERAVSVLRAWLFEHFLHP
Sbjct  352   GRFEGSRLKFVDHHLRQQRALQQLGMIQHPSNNAWRPQRGLPERAVSVLRAWLFEHFLHP  411

Query  1233  YPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             YPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  412   YPKDSDKHMLAKQTGLTRSQVSNWFINARV  441



>ref|NP_181138.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 ref|NP_850256.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 ref|NP_001031490.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 sp|Q9SJ56.1|BLH1_ARATH RecName: Full=BEL1-like homeodomain protein 1; Short=BEL1-like 
protein 1; AltName: Full=Protein EMBRYO SAC DEVELOPMENT ARREST 
29 [Arabidopsis thaliana]
 gb|AAD21463.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAL59997.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAM20198.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAM20705.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AAP37781.1| At2g35940 [Arabidopsis thaliana]
 dbj|BAE99297.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AEC09179.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 gb|AEC09180.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
 gb|AEC09181.1| BEL1-like homeodomain 1 [Arabidopsis thaliana]
Length=680

 Score =   317 bits (812),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 171/270 (63%), Positives = 199/270 (74%), Gaps = 15/270 (6%)
 Frame = +3

Query  546   SGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSM  725
             SG++ S +T+GI+  ++ SKYLKAAQELLDEVVN +     D   ++      K    + 
Sbjct  176   SGSTGSGVTNGIANLVS-SKYLKAAQELLDEVVNADSD---DMNAKSQLFSSKKGSCGND  231

Query  726   PPFggcggdpptsggESSAQKTAA--AELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHH  899
              P G         G    A+       EL TA+RQ++QMKKAKL +M+ EVEQRYRQYH 
Sbjct  232   KPVGESSAGAGGEGSGGGAEAAGKRPVELGTAERQEIQMKKAKLSNMLHEVEQRYRQYHQ  291

Query  900   QMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGV---  1070
             QMQ++++SFEQAAG+GSA+SYT LAL TIS+QFRCLK AIA QIKA +KSLGEE+ V   
Sbjct  292   QMQMVISSFEQAAGIGSAKSYTSLALKTISRQFRCLKEAIAGQIKAANKSLGEEDSVSGV  351

Query  1071  ---RGSRLKFIDHHLPQQRALQHLGMMQ---PNAWRPQRGLPERAVSVLRAWLFEHFLHP  1232
                 GSRLKF+DHHL QQRALQ LGM+Q    NAWRPQRGLPERAVSVLRAWLFEHFLHP
Sbjct  352   GRFEGSRLKFVDHHLRQQRALQQLGMIQHPSNNAWRPQRGLPERAVSVLRAWLFEHFLHP  411

Query  1233  YPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             YPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  412   YPKDSDKHMLAKQTGLTRSQVSNWFINARV  441



>ref|XP_004978737.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Setaria 
italica]
 ref|XP_004978738.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Setaria 
italica]
 ref|XP_004978739.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Setaria 
italica]
 ref|XP_004978740.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Setaria 
italica]
 ref|XP_004978741.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X5 [Setaria 
italica]
 ref|XP_004978742.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X6 [Setaria 
italica]
 ref|XP_004978743.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X7 [Setaria 
italica]
 ref|XP_004978744.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X8 [Setaria 
italica]
Length=662

 Score =   316 bits (810),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 217/448 (48%), Positives = 265/448 (59%), Gaps = 67/448 (15%)
 Frame = +3

Query  36    MAMYYQGS--SEVQG--DGLQTLYLMNPNYI-GFSDTAL--PQSQQAMFLNSGNALH--A  188
             MA YY G   +++Q   DGLQTLYLMNP+Y  G++D     P     M LNS  +    A
Sbjct  1     MAAYYHGGAGTDIQASTDGLQTLYLMNPSYTAGYADAGASPPGPANMMLLNSAVSTMTPA  60

Query  189   GGMPHARLPQS--QHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSAVVS  362
                 H + P +  QHFVG+PL A   G         +LWA    A SG+     P A   
Sbjct  61    SFGHHQQSPSAAQQHFVGIPLQAPPAG--------YNLWA---PATSGAADMSPPQAQTP  109

Query  363   GGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAHD  542
             G  G            S V+S ++               R  P  +   +  A  G  H 
Sbjct  110   GAAGV-----------SAVLSLSS---------------REAPPVTVAAVGGADEGKYH-  142

Query  543   NSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeS  722
               GAS++S        +  SKYLKAAQELLDEVV+V K ++   A   +     K +   
Sbjct  143   LVGASATSQGQ----MVMSSKYLKAAQELLDEVVSVSKGVEEAKAATKSLSAVKKKEDSE  198

Query  723   MPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQ  902
                         T  G  +   +AA EL+TA+RQ+LQMKK+KL++M+DEVEQRYRQYH Q
Sbjct  199   ------GVSGGGTEDGGGAKSGSAAPELSTAERQELQMKKSKLINMLDEVEQRYRQYHGQ  252

Query  903   MQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVR---  1073
             MQ + ASFE AAG GSAR+YT LAL TIS+QFRCL+ AIA+Q++A S++LGE+       
Sbjct  253   MQAVSASFEAAAGAGSARTYTALALRTISRQFRCLRDAIAAQVRAASRALGEDADAAVAA  312

Query  1074  -----GSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYP  1238
                  GSRL++IDH L QQRALQ LGMMQ  AWRPQRGLPER+VS+LRAWLFEHFLHPYP
Sbjct  313   GGRTVGSRLRYIDHQLRQQRALQQLGMMQGGAWRPQRGLPERSVSILRAWLFEHFLHPYP  372

Query  1239  KDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             KDSDKIMLAKQTGLTRSQVSNWFINARV
Sbjct  373   KDSDKIMLAKQTGLTRSQVSNWFINARV  400



>ref|XP_004228612.1| PREDICTED: BEL1-like homeodomain protein 1 [Solanum lycopersicum]
Length=700

 Score =   317 bits (811),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 217/460 (47%), Positives = 264/460 (57%), Gaps = 54/460 (12%)
 Frame = +3

Query  36    MAMYYQGSSEVQ--GDGLQTLYLMNPNYIGFSDTALPQS----------QQAMFLNS---  170
             MA Y+ G+SE+Q   DGLQTL LMNP Y+GFS+     +             +F NS   
Sbjct  1     MASYFHGNSEIQEGNDGLQTLILMNPGYVGFSEAQHHHAPPPPPQGGGGSNIVFFNSNPL  60

Query  171   GNALHAGGMPHARLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPS  350
             GN+++    P     Q Q FVG+PL A+A  +A   D               SG     +
Sbjct  61    GNSINLSHAPPPPPSQQQQFVGIPL-ATAAFTAPSQD---------------SGNNNNNN  104

Query  351   AVVSGGGGTTDFASQLGFHR---SVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSA  521
                SG  G    +S  GF+     +  +    +              S    S     +A
Sbjct  105   ESFSGLHGFLARSSPYGFYNPANDITAAREVTRAHQQQQQGLSLSLSSSQQPSFGSFTAA  164

Query  522   RPGAAHDNSGASSSSITH-------GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaae  680
             R   +      S+S I          I      SKY+KAAQELLDEVVNV KS+K   + 
Sbjct  165   REIVSSPTGSGSASGIQQQQQQQQQSICSVPLSSKYMKAAQELLDEVVNVGKSMKSSNST  224

Query  681   eaankekakmkkeSMPPFggcggdpptsggESSAQKTAAA--ELTTAQRQDLQMKKAKLL  854
             E       K  K  +              G   A+K  A   EL+TA+RQ++QMKKAKL+
Sbjct  225   EVVVYNDVKKSKNMV-------DMDVQLDGVGPAEKDGAPTNELSTAERQEIQMKKAKLV  277

Query  855   SMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIK  1034
             +M+DEVEQRYR YHHQMQ ++   EQAAG+GSA++YT LAL TISKQFRCLK AI  QI+
Sbjct  278   NMLDEVEQRYRHYHHQMQSVINWLEQAAGIGSAKTYTALALQTISKQFRCLKDAIIGQIR  337

Query  1035  ATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLR  1202
             A SK+LGEE+     + GSRLKF+D+ L QQRALQ LGM+Q NAWRPQRGLPERAVSVLR
Sbjct  338   AASKTLGEEDSLGGKIEGSRLKFVDNQLRQQRALQQLGMIQHNAWRPQRGLPERAVSVLR  397

Query  1203  AWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             AWLFEHFLHPYPKDSDK+MLAKQTGLTRSQVSNWFINARV
Sbjct  398   AWLFEHFLHPYPKDSDKMMLAKQTGLTRSQVSNWFINARV  437



>emb|CDY32069.1| BnaC04g44970D [Brassica napus]
Length=636

 Score =   315 bits (806),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 171/267 (64%), Positives = 199/267 (75%), Gaps = 22/267 (8%)
 Frame = +3

Query  549   GASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMP  728
             G++ S +T+GI+  ++ SKYLKAAQELLDEVVN +            +         S  
Sbjct  137   GSTGSGVTNGIANLVS-SKYLKAAQELLDEVVNADSK----------DINTKSQLFSSKK  185

Query  729   PFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQ  908
                   G+    GGE+S ++T   EL TA+RQ++QMKKAKL SM+ EVEQRYRQYH QMQ
Sbjct  186   ESSTGAGEGSGGGGEASGKRTV--ELGTAERQEIQMKKAKLSSMLHEVEQRYRQYHQQMQ  243

Query  909   VIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGV------  1070
             ++++SFEQAAG+GSA+ YT LAL TIS+QFRCLK AIA QIKA +KSLGEE+ V      
Sbjct  244   MVISSFEQAAGIGSAKLYTSLALKTISRQFRCLKEAIAGQIKAANKSLGEEDSVSGVGRL  303

Query  1071  RGSRLKFIDHHLPQQRALQHLGMMQ---PNAWRPQRGLPERAVSVLRAWLFEHFLHPYPK  1241
              GSRLKF+DHHL QQRALQ LGM+Q    NAWRPQRGLPERAVSVLRAWLFEHFLHPYPK
Sbjct  304   EGSRLKFVDHHLRQQRALQQLGMIQHPSNNAWRPQRGLPERAVSVLRAWLFEHFLHPYPK  363

Query  1242  DSDKIMLAKQTGLTRSQVSNWFINARV  1322
             DSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  364   DSDKHMLAKQTGLTRSQVSNWFINARV  390



>emb|CBI22785.3| unnamed protein product [Vitis vinifera]
Length=489

 Score =   310 bits (794),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 168/253 (66%), Positives = 202/253 (80%), Gaps = 18/253 (7%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             G+ G I  SKYLKAAQ+LLDEVVNV   +K +   + ++ E  K   E +          
Sbjct  146   GMHGVILSSKYLKAAQQLLDEVVNVGNGIKTETPSKKSSSEATKTLGEGL----------  195

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
                GGE+S +++A  +L+TA+RQ++QMKKAKLL+M+DEVEQRYRQYHHQMQ++++SFEQA
Sbjct  196   --IGGETSTKRSA--DLSTAERQEIQMKKAKLLNMLDEVEQRYRQYHHQMQIVISSFEQA  251

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHH  1103
             AG+GSA++YT LAL TISKQFRCLK AI+ QI+A +KSLGEE+G    + GSRLKF+DH 
Sbjct  252   AGIGSAKTYTALALQTISKQFRCLKDAISGQIRAANKSLGEEDGTGGKIEGSRLKFVDHQ  311

Query  1104  LPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLT  1283
             L QQRALQ LGM+Q N WRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK MLAKQTGLT
Sbjct  312   LRQQRALQQLGMIQQNVWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLT  371

Query  1284  RSQVSNWFINARV  1322
             RSQVSNWFINARV
Sbjct  372   RSQVSNWFINARV  384



>gb|KHN21192.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=584

 Score =   312 bits (799),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 189/321 (59%), Positives = 228/321 (71%), Gaps = 26/321 (8%)
 Frame = +3

Query  384   FASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAHDNSGASSS  563
              ++Q+GFHR   +S +        LS QQ P+RSL      G + A   A+    G    
Sbjct  20    MSTQIGFHRPNHLSLS--------LSSQQTPYRSLS-----GEIHAISPASRGGGGDDMR  66

Query  564   SITHGISGFIT---GSKYLKAAQELLDEVVNVEKSL-KLDaaeeaankekakmkkeSMPP  731
              + +G+S   +   GSKYLKA QELLDEVVNV K + K + + E A KEK K   ES   
Sbjct  67    GLHNGVSSMHSVALGSKYLKATQELLDEVVNVGKGISKGEESMEGAKKEKMKGNIES---  123

Query  732   FggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQV  911
                  GD  + G E++ +     EL+TAQRQ+LQMKK+KL++M+DEVEQRYRQYHHQMQV
Sbjct  124   -TSGVGDGSSCGRENNDRAKQGVELSTAQRQELQMKKSKLVTMLDEVEQRYRQYHHQMQV  182

Query  912   IVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGS  1079
             ++ SFEQAAGVG+A+SYT LAL TISKQFRCLK AI+SQIK TSK+LGE+      V GS
Sbjct  183   VLTSFEQAAGVGAAKSYTALALKTISKQFRCLKDAISSQIKTTSKTLGEDNCLGVKVEGS  242

Query  1080  RLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIM  1259
             RL+++D H  +Q+    LGM+Q NAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK+M
Sbjct  243   RLRYVD-HQQRQQRALQLGMIQHNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKVM  301

Query  1260  LAKQTGLTRSQVSNWFINARV  1322
             LAKQTGLTRSQVSNWFINARV
Sbjct  302   LAKQTGLTRSQVSNWFINARV  322



>gb|KEH41936.1| BEL1-related homeotic protein [Medicago truncatula]
Length=649

 Score =   313 bits (803),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 155/252 (62%), Positives = 189/252 (75%), Gaps = 11/252 (4%)
 Frame = +3

Query  579   ISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpp  758
             I   +  SKYLKA QELLDEVVNV   +K++  +++  K K   +  +            
Sbjct  158   IQSVLLSSKYLKATQELLDEVVNVNGGIKVENVKKSFEKNKVVGESST-------AVSGE  210

Query  759   tsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAA  938
                         + EL+T +RQ++QMKKAKL++M+DEVEQRYRQYH+QMQ++++SFEQ A
Sbjct  211   GGSVGGDGNGKRSTELSTTERQEIQMKKAKLINMLDEVEQRYRQYHNQMQMVISSFEQVA  270

Query  939   GVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHL  1106
             G+GSAR+YT LAL TISKQFRCLK AI  QI+A +KSLGE++     + GSRLK++DHHL
Sbjct  271   GIGSARTYTALALQTISKQFRCLKDAITGQIRAANKSLGEDDSFGGKIEGSRLKYVDHHL  330

Query  1107  PQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTR  1286
              QQRA+Q LGM+  NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTR
Sbjct  331   RQQRAIQQLGMIHHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTR  390

Query  1287  SQVSNWFINARV  1322
             SQVSNWFINARV
Sbjct  391   SQVSNWFINARV  402



>ref|XP_003521496.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006577097.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
 ref|XP_006577098.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X3 [Glycine 
max]
 ref|XP_006577099.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X4 [Glycine 
max]
Length=679

 Score =   313 bits (801),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 164/264 (62%), Positives = 201/264 (76%), Gaps = 18/264 (7%)
 Frame = +3

Query  543   NSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeS  722
             N+GAS      GI   +  SKYLKAA ELL+EVVNV   +  +  ++   + K   +  +
Sbjct  169   NNGAS------GIQSVLLSSKYLKAAHELLEEVVNVNNGIGTELGKKRGGQNKVVGESSA  222

Query  723   MPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQ  902
                    G    + GGE + ++++  EL+TA+RQ++QMKKAKL+ M+DEVEQRYRQYH Q
Sbjct  223   ------AGSGDGSVGGEGNGKRSS--ELSTAERQEIQMKKAKLIGMLDEVEQRYRQYHQQ  274

Query  903   MQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----V  1070
             M+++ +SFEQAAG+GSAR+YT LAL TISKQFRCLK AIA Q++  +KSLGEE+     +
Sbjct  275   MEIVGSSFEQAAGIGSARTYTALALQTISKQFRCLKDAIAGQVRTANKSLGEEDCFGGKM  334

Query  1071  RGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
              GSRLK++DHHL QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSD
Sbjct  335   EGSRLKYVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSD  394

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             K MLAKQTGLTRSQVSNWFINARV
Sbjct  395   KHMLAKQTGLTRSQVSNWFINARV  418


 Score = 61.6 bits (148),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 50/88 (57%), Gaps = 17/88 (19%)
 Frame = +3

Query  36   MAMYYQ-GSSEVQ---GDGLQTLYLMNPNYIGFSDTALPQSQQA------MFLNSGNALH  185
            MA Y+  G+SE+Q    DGLQTL LMNP YI +SD   PQ Q +      +FLN   A  
Sbjct  1    MATYFHHGNSEIQSGGADGLQTLVLMNPGYIHYSDAPPPQQQTSQTAGNLVFLNP--AAV  58

Query  186  AGG-----MPHARLPQSQHFVGVPLPAS  254
            AGG      PHA    +Q FVG+PLP S
Sbjct  59   AGGNNNSFNPHAPPSHTQQFVGIPLPNS  86



>ref|XP_002450321.1| hypothetical protein SORBIDRAFT_05g003750 [Sorghum bicolor]
 gb|EES09309.1| hypothetical protein SORBIDRAFT_05g003750 [Sorghum bicolor]
Length=690

 Score =   309 bits (792),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 215/463 (46%), Positives = 269/463 (58%), Gaps = 76/463 (16%)
 Frame = +3

Query  36    MAMYYQGS--SEVQG--DGLQTLYLMNPNYIGFSD----TALPQSQQAMFLNSG-NALHA  188
             MA YY G   +++Q   DGLQTLYLMNP+Y G++D    +  P +   M LNS    +  
Sbjct  1     MAAYYHGGAGTDIQASTDGLQTLYLMNPSYAGYADDGGASTAPGATNMMLLNSAVTTMTP  60

Query  189   GGMPH-----------ARLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGG  335
                 H           A   Q QHFVG+PL A   G         +LW            
Sbjct  61    ASFAHHHQQQQSPSSAAHHQQQQHFVGIPLQAPPSG--------YNLW------------  100

Query  336   QQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMES----P  503
                P+ V +      D +         + SPT  Q    + +       SL        P
Sbjct  101   --TPATVAA------DMS---------MSSPTQAQTPGGAAAGGVSAVLSLSSREAAPPP  143

Query  504   VGLLS-ARPGAAHDNSGASSSSITHGISG-FITGSKYLKAAQELLDEVVNVEKSLKLDaa  677
             V + + A PG   D +G     ++    G  +  SKYLKAAQELLDEVV+V K ++    
Sbjct  144   VTVAAVAGPGCT-DEAGKYHLGVSATSQGQMVMSSKYLKAAQELLDEVVSVSKGVEDANK  202

Query  678   eeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLS  857
                 +    K K++S     G  G     G  + +  + AAE++TA+RQ+LQMKK+KL++
Sbjct  203   TTTKSLAAVKKKEDS----EGVSGGGTEDGSGAKSGGSGAAEMSTAERQELQMKKSKLIN  258

Query  858   MVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKA  1037
             M+DEVEQRYRQYH QMQ + +SFE AAG GSAR+YT LAL TIS+QFRCL+ AIASQ++A
Sbjct  259   MLDEVEQRYRQYHGQMQAVSSSFEAAAGAGSARTYTALALRTISRQFRCLRDAIASQVRA  318

Query  1038  TSKSLGEEEGVR--------GSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVS  1193
              S++LGE+            GSRL++IDH L QQRALQ LGMMQ  AWRPQRGLPER+VS
Sbjct  319   ASRALGEDADAAVAAGGRTVGSRLRYIDHQLRQQRALQQLGMMQGGAWRPQRGLPERSVS  378

Query  1194  VLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             +LRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV
Sbjct  379   ILRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  421



>ref|XP_006663234.1| PREDICTED: BEL1-like homeodomain protein 1-like [Oryza brachyantha]
Length=576

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 217/451 (48%), Positives = 263/451 (58%), Gaps = 65/451 (14%)
 Frame = +3

Query  36    MAMYYQGS--SEVQGD--GLQTLYLMNPNYIGFSDTALPQSQQA----MFLNSG-NALHA  188
             MA YY G   +++Q D  GLQTLYLMNP+Y G+SD A   +Q      M LNS   ++  
Sbjct  1     MAAYYHGGAGTDIQSDTDGLQTLYLMNPSYAGYSDAAAAAAQPGAANMMLLNSAVTSMTP  60

Query  189   GGMPHARLPQS--QHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSAVVS  362
                 H   P S  QHFVG+P    A G         +LW     A +G+     PS    
Sbjct  61    VSFGHQPSPSSAAQHFVGIPPQPQASG--------YNLWT---SAATGADDMSPPSQQAP  109

Query  363   GGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAHD  542
             GGG             S V+S                   S P   PV + +   G    
Sbjct  110   GGGAAA---------VSAVLS-----------------LSSRPAAPPVTVAAVVAGDEGK  143

Query  543   NSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeS  722
                   ++ + G    +  SKYLKAAQELLDEVV+V K +    A  AA    +  KKE 
Sbjct  144   YGAPVPTTTSQG--QMVMSSKYLKAAQELLDEVVSVSKGVDDGKAAAAAKSPTSVKKKED  201

Query  723   MPPFggcggdpptsggESSAQKTAAA---ELTTAQRQDLQMKKAKLLSMVDEVEQRYRQY  893
                         T  G   A+++ AA   E++TA+RQ+LQMKK KL++M+DEVEQRYRQY
Sbjct  202   ----SEGVSGGGTEDGGGGAKRSGAAPPPEMSTAERQELQMKKGKLINMLDEVEQRYRQY  257

Query  894   HHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVR  1073
             H QMQV+V SFE  AG GSAR+YT LAL TIS+QFRCL+ AIA+Q++A S++LGE E   
Sbjct  258   HQQMQVVVTSFEAVAGGGSARTYTALALRTISRQFRCLRDAIAAQVRAASRALGEAEADG  317

Query  1074  GSR--------LKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLH  1229
             G          L++IDH L QQRALQ LGMMQ +AWRPQRGLPER+VS+LRAWLFEHFLH
Sbjct  318   GGGGGRSMGSRLRYIDHQLRQQRALQQLGMMQSSAWRPQRGLPERSVSILRAWLFEHFLH  377

Query  1230  PYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PYPKDSDKIMLAKQTGLTRSQVSNWFINARV
Sbjct  378   PYPKDSDKIMLAKQTGLTRSQVSNWFINARV  408



>gb|KHN48417.1| BEL1-like homeodomain protein 1, partial [Glycine soja]
Length=471

 Score =   297 bits (761),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 162/180 (90%), Gaps = 4/180 (2%)
 Frame = +3

Query  795   AAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLA  974
             ++EL+T +RQ++Q+KKAKL++M+DEVEQRYRQYH+QM+++++SFEQAAG+GSAR+YT LA
Sbjct  26    SSELSTTERQEIQIKKAKLINMLDEVEQRYRQYHNQMKIVISSFEQAAGIGSARTYTALA  85

Query  975   LNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMM  1142
             L TISKQFRCLK AI  QI+A +KSLGEE+     + GSRLK++DHHL QQRA+Q LGM+
Sbjct  86    LQTISKQFRCLKDAITGQIRAANKSLGEEDCFGAKIEGSRLKYVDHHLRQQRAIQQLGMI  145

Query  1143  QPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
               NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  146   HHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  205



>ref|XP_008387112.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008387113.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
 ref|XP_008387114.1| PREDICTED: BEL1-like homeodomain protein 1 [Malus domestica]
Length=703

 Score =   302 bits (774),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 163/259 (63%), Positives = 203/259 (78%), Gaps = 17/259 (7%)
 Frame = +3

Query  567   ITHGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFg  737
             +T+G+SG    +  SKYLKAAQELLDEVVNV   ++ +  ++   ++     + +     
Sbjct  187   VTNGVSGMQSVLLSSKYLKAAQELLDEVVNVGNGMRTELPKKGNGQQSKAAAESA-----  241

Query  738   gcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIV  917
                    + GGE S ++  A+EL+TA+RQ++QMKK KL++M+DEV+QRYRQYH QMQ+++
Sbjct  242   ---AGDXSVGGEGSGKR--ASELSTAERQEIQMKKGKLINMLDEVDQRYRQYHRQMQMVI  296

Query  918   ASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGV----RGSRL  1085
             +SFEQAAG+GSAR+YT LAL TISKQFRCLK AI +QI++ +KSLGEE+ V     GSRL
Sbjct  297   SSFEQAAGIGSARTYTALALQTISKQFRCLKDAITNQIRSANKSLGEEDSVGGKIEGSRL  356

Query  1086  KFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLA  1265
             K++DH L QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK MLA
Sbjct  357   KYVDHQLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKHMLA  416

Query  1266  KQTGLTRSQVSNWFINARV  1322
             KQTGLTRSQVSNWFINARV
Sbjct  417   KQTGLTRSQVSNWFINARV  435



>ref|XP_004494251.1| PREDICTED: BEL1-like homeodomain protein 1-like [Cicer arietinum]
Length=686

 Score =   300 bits (768),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 161/252 (64%), Positives = 191/252 (76%), Gaps = 13/252 (5%)
 Frame = +3

Query  579   ISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpp  758
             I   +  SKYL+AA ELL+EVVNV   ++L        K K           G   G   
Sbjct  180   IHSVVVSSKYLRAAHELLEEVVNVNSGIELGKKSVGREKNKV---------IGESSGGDG  230

Query  759   tsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAA  938
             +  G        + EL+T++RQ++QMKKAKL++M+DEVEQRYRQYHHQM+V+V+SFEQ A
Sbjct  231   SIIGGGEGSGKRSIELSTSERQEIQMKKAKLINMLDEVEQRYRQYHHQMEVVVSSFEQVA  290

Query  939   GVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHL  1106
             G+GSAR+YT LAL TISKQFRCLK AIA QI+AT+KSLGE++     + GSRLK++DH L
Sbjct  291   GIGSARTYTALALQTISKQFRCLKDAIAGQIRATNKSLGEDDCFGVKIEGSRLKYVDHQL  350

Query  1107  PQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTR  1286
              QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDK+MLAKQTGLTR
Sbjct  351   RQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKLMLAKQTGLTR  410

Query  1287  SQVSNWFINARV  1322
             SQVSNWFINARV
Sbjct  411   SQVSNWFINARV  422


 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 45/85 (53%), Gaps = 11/85 (13%)
 Frame = +3

Query  36   MAMYYQGSSEVQ----GDGLQTLYLMNPNYIGFSDTAL---PQSQQA----MFLNSGNAL  182
            MA Y+ G++        DGLQTL LMNP YI +SDT     P S  +    +FLNS    
Sbjct  1    MATYFHGNNNSDQSGGADGLQTLVLMNPTYIQYSDTTQQPPPPSHSSTGNLVFLNSTTTN  60

Query  183  HAGGMPHARLPQSQHFVGVPLPASA  257
            +    PHA    +Q FVG+PL  ++
Sbjct  61   NNSYSPHAPPSHTQQFVGIPLTTNS  85



>ref|XP_009133059.1| PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 
1 [Brassica rapa]
Length=658

 Score =   298 bits (763),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 211/469 (45%), Positives = 266/469 (57%), Gaps = 94/469 (20%)
 Frame = +3

Query  36    MAMYYQGS----SEVQGDGLQTLYLMNPNYIGFSDTALPQSQQA---------------M  158
             MA Y+ G+    S     GLQTL LMNP       T +P +QQ                +
Sbjct  1     MAAYFHGNPPEISAGTDGGLQTLILMNPT------TYVPYTQQDDDSNNSNNNTNNNNFV  54

Query  159   FLNSGNALHAGGMPHARLP---QSQHFVGVPLPASALGSAQLHD--------PARSLWAG  305
             FL+S            R P    +Q FVG+PL      S    D        P R  +  
Sbjct  55    FLDS------------RAPPQNANQQFVGIPLSGHEAASITAADNISVLHGYPPRVQY--  100

Query  306   LEQAGSGSGGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRS  485
                  S  G  Q+                    H++   +P AQ+GLSL+LS QQ   + 
Sbjct  101   -----SLYGSHQVDPT----------------HHQAACETPRAQRGLSLTLSSQQQQQQH  139

Query  486   LPMESPVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKS-L  662
                   VG  S         SG+++S +T+G++  ++ SKYL+AAQELLDEVV  + + +
Sbjct  140   RQTLHHVGFGSGPGEDIRVGSGSTASGVTNGVANLVS-SKYLRAAQELLDEVVKADSNDI  198

Query  663   KLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKK  842
              + +   ++ K  +    +++        +    GGE+S ++T   EL TA+RQ++QMKK
Sbjct  199   TIKSQLFSSKKGTSVTDTKAVGESSTGAREGSDGGGEASGKRTV--ELGTAERQEIQMKK  256

Query  843   AKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIA  1022
             AKL SM+ EVEQRYRQYH QMQ++++SFEQAAG+GSA+SYT LAL            AIA
Sbjct  257   AKLSSMLHEVEQRYRQYHQQMQMVISSFEQAAGIGSAKSYTSLALXE----------AIA  306

Query  1023  SQIKATSKSLGEEEGV------RGSRLKFIDHHLPQQRALQHLGMMQ---PNAWRPQRGL  1175
              QIKA +KSLGEE+ V       GSRLKF+DHHL QQRALQ LGM+Q    NAWRPQRGL
Sbjct  307   GQIKAANKSLGEEDSVSGVGRFEGSRLKFVDHHLRQQRALQQLGMIQHPSNNAWRPQRGL  366

Query  1176  PERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PERAVSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  367   PERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  415



>ref|XP_010107001.1| BEL1-like homeodomain protein 1 [Morus notabilis]
 gb|EXC12999.1| BEL1-like homeodomain protein 1 [Morus notabilis]
Length=441

 Score =   291 bits (745),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 135/167 (81%), Positives = 150/167 (90%), Gaps = 4/167 (2%)
 Frame = +3

Query  834   MKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKV  1013
             MKKAKL+SM+DEVEQRYRQYHHQMQ++++SFEQAAGVGSAR+YT LAL TISKQFRCLK 
Sbjct  1     MKKAKLISMLDEVEQRYRQYHHQMQIVISSFEQAAGVGSARTYTALALQTISKQFRCLKD  60

Query  1014  AIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPE  1181
             AI  QI+A +KSLGEE+     + GSRLK++DHHL QQRALQ LGM+Q NAWRPQRGLPE
Sbjct  61    AITGQIRAANKSLGEEDCLGGKIEGSRLKYVDHHLRQQRALQQLGMIQQNAWRPQRGLPE  120

Query  1182  RAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             R+VS LRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  121   RSVSFLRAWLFEHFLHPYPKDSDKQMLAKQTGLTRSQVSNWFINARV  167



>gb|ACD39469.1| BEL29 protein [Solanum etuberosum]
Length=516

 Score =   288 bits (738),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 154/242 (64%), Positives = 181/242 (75%), Gaps = 11/242 (5%)
 Frame = +3

Query  609   LKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQK  788
             +KAAQELLDEVVNV KS+K       +      +    +              G +    
Sbjct  1     MKAAQELLDEVVNVGKSMK-------STNSTDVVVNNDVKKSKNMADMDGQIDGGADKDG  53

Query  789   TAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTH  968
             T   EL+TA+RQ++QMKKAKL++M+DEVEQRYR YHHQMQ ++   EQAAG+GSA++YT 
Sbjct  54    TPTTELSTAERQEIQMKKAKLVNMLDEVEQRYRHYHHQMQSVIHWLEQAAGIGSAKTYTA  113

Query  969   LALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLG  1136
             LAL TISKQFRCLK AI  QI++ SK+LGEE+     + GSRLKF+D+ L QQRALQ LG
Sbjct  114   LALQTISKQFRCLKDAIIGQIRSASKTLGEEDSLGGKIEGSRLKFVDNQLRQQRALQQLG  173

Query  1137  MMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINA  1316
             M+Q NAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK+MLAKQTGLTRSQVSNWFINA
Sbjct  174   MIQNNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKMMLAKQTGLTRSQVSNWFINA  233

Query  1317  RV  1322
             RV
Sbjct  234   RV  235



>gb|ACC77468.1| BEL1 [Kalanchoe x houghtonii]
Length=641

 Score =   291 bits (745),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 202/444 (45%), Positives = 257/444 (58%), Gaps = 61/444 (14%)
 Frame = +3

Query  36    MAMYYQG-SSEVQG-DGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGNALHAGGMPHAR  209
             MA Y+ G +S++Q  DGLQTL  MNP+Y+              F+ +  ++         
Sbjct  1     MAAYFDGGNSQIQAADGLQTLIFMNPSYV----NNHHHQNPNNFVFANPSMSPA------  50

Query  210   LPQSQHFVGVPL-------PASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSAVVSGG  368
               QSQ  VGVPL       P SAL    +  P  +LW  + +          P       
Sbjct  51    TDQSQQLVGVPLQQTQHPEPISAL-HGLVPRPHYNLWTPIVRDN--------PRPQKGLS  101

Query  369   GGTTDFASQLGFHRS--VVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAHD  542
                ++   Q+GF  +    +SP++        +P           SP  ++S  P +   
Sbjct  102   LSLSNSQQQVGFAGTPPSAISPSSGSKDDGIGTP-----------SPASVISNGPAS---  147

Query  543   NSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeS  722
                        G+   +  SKYLKA Q+LL+EVVNV  ++     ++ A    +K   E+
Sbjct  148   -----------GLRSVLLCSKYLKATQQLLEEVVNVGSAMDSAKKKDTATGSSSKAANEA  196

Query  723   MPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQ  902
               P            GE+  +K  AAEL+TA+R ++QMKK KL+ M+D VE RYRQY  Q
Sbjct  197   SSPEAAAAAAVAVGDGENGGKK--AAELSTAERHEIQMKKGKLVCMLDGVELRYRQYQQQ  254

Query  903   MQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE--GVRG  1076
             MQ+++ASFEQAAG GSAR+YT LAL TIS+QFRCLK AI  Q++A SKSLGEEE  G++ 
Sbjct  255   MQIVIASFEQAAGQGSARTYTALALRTISRQFRCLKDAIVVQMRAMSKSLGEEEDMGIKE  314

Query  1077  --SRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
               SRLKF+DHHL QQRALQ LGM+Q NAWRPQRGLPER+V VLRAWLFEHFLHPYPKDSD
Sbjct  315   GVSRLKFVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVLVLRAWLFEHFLHPYPKDSD  374

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             K MLAKQ GLTRSQVSNWFINARV
Sbjct  375   KQMLAKQAGLTRSQVSNWFINARV  398



>gb|AAN03626.1|AF406702_1 BEL1-related homeotic protein 29, partial [Solanum tuberosum]
Length=567

 Score =   289 bits (739),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 161/254 (63%), Positives = 187/254 (74%), Gaps = 14/254 (6%)
 Frame = +3

Query  579   ISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpp  758
             IS     SKY+KAAQELLDEVVNV KS+K               K ++M    G      
Sbjct  47    ISSVPLSSKYMKAAQELLDEVVNVGKSMK-STNSTDVVVNNDVKKSKNMGDMDGQLDGV-  104

Query  759   tsggESSAQKTAA--AELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQ  932
                    A K  A   EL+T +RQ++QMKKAKL++M+DEVEQRYR YHHQMQ ++   EQ
Sbjct  105   ------GADKDGAPTTELSTGERQEIQMKKAKLVNMLDEVEQRYRHYHHQMQSVIHWLEQ  158

Query  933   AAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDH  1100
             AAG+GSA++YT LAL TISKQFRCLK AI  QI++ S++LGEE+     + GSRLKF+D+
Sbjct  159   AAGIGSAKTYTALALQTISKQFRCLKDAIIGQIRSASQTLGEEDSLGGKIEGSRLKFVDN  218

Query  1101  HLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGL  1280
              L QQRALQ LGM+Q NAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK+MLAKQTGL
Sbjct  219   QLRQQRALQQLGMIQHNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKMMLAKQTGL  278

Query  1281  TRSQVSNWFINARV  1322
             TRSQVSNWFINARV
Sbjct  279   TRSQVSNWFINARV  292



>ref|XP_002306123.2| hypothetical protein POPTR_0004s16660g [Populus trichocarpa]
 gb|EEE86634.2| hypothetical protein POPTR_0004s16660g [Populus trichocarpa]
Length=605

 Score =   290 bits (742),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 153/272 (56%), Positives = 189/272 (69%), Gaps = 29/272 (11%)
 Frame = +3

Query  528   GAAHD-NSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankeka  704
             G  HD N G  S    + I+  I  SKYLKAAQ+LLDEVVNV K++K    E+     + 
Sbjct  187   GGNHDMNKGDLSPYGMNSIARTIPNSKYLKAAQQLLDEVVNVRKAIKQPDKEKNQTTSEH  246

Query  705   kmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRY  884
              + K +  P                      +EL+ A+RQ+LQ K  KLLSM+DEV++RY
Sbjct  247   GLNKSTNSP----------------------SELSHAERQELQNKLTKLLSMLDEVDRRY  284

Query  885   RQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE  1064
             +QY+HQMQ++V+SF+  +G G+A+ YT LAL TIS+ FRCL+ AI  QI AT KSLGE+E
Sbjct  285   KQYYHQMQIVVSSFDVISGCGAAKPYTALALQTISRHFRCLRDAITGQIHATRKSLGEQE  344

Query  1065  ------GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFL  1226
                   GV  +RL+++D HL QQRAL  LGMMQ +AWRPQRGLPE +VS+LRAWLFEHFL
Sbjct  345   TSENSKGVGITRLRYVDQHLRQQRALHQLGMMQQHAWRPQRGLPESSVSILRAWLFEHFL  404

Query  1227  HPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             HPYPKDSDKIMLA+QTGLTRSQVSNWFINARV
Sbjct  405   HPYPKDSDKIMLARQTGLTRSQVSNWFINARV  436



>gb|KHN10043.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=431

 Score =   285 bits (728),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 149/167 (89%), Gaps = 4/167 (2%)
 Frame = +3

Query  834   MKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKV  1013
             MKKAKL++M+DEVEQRYRQYH QMQ++++SFEQAAG+GSAR+YT LAL TISKQFRCLK 
Sbjct  1     MKKAKLINMLDEVEQRYRQYHSQMQIVISSFEQAAGIGSARTYTALALQTISKQFRCLKD  60

Query  1014  AIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPE  1181
             AI  QI+A +KSLGEE+     + GSRLK++DHHL QQRA+Q LGM+  NAWRPQRGLPE
Sbjct  61    AITGQIRAANKSLGEEDCFGAKIEGSRLKYVDHHLRQQRAIQQLGMINHNAWRPQRGLPE  120

Query  1182  RAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             R+VSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  121   RSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  167



>dbj|BAK05542.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85858.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97739.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=666

 Score =   291 bits (746),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 215/453 (47%), Positives = 262/453 (58%), Gaps = 75/453 (17%)
 Frame = +3

Query  36    MAMYYQGSS-----EVQGDGLQTLYLMNPNYI--GFSDTALPQSQQAMFLNSG-----NA  179
             MA YY G +     +   DGLQTLYLMNP+Y   G+ D A P     M LNS       A
Sbjct  1     MAAYYHGGTGTDIHQAGSDGLQTLYLMNPSYGTGGYGDAA-PSGANMMLLNSSVSSMTPA  59

Query  180   LHAGGMPHARLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSAVV  359
                G       P  QHFVG+PL A   G         +LW               P+   
Sbjct  60    SFGGHQASPPPPPGQHFVGIPLQAPPSG--------YNLW--------------TPT---  94

Query  360   SGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGLLSARPGAAH  539
                  TT  A         V+SP  QQ   +S        R  P   PV + S       
Sbjct  95    -----TTGIAD--------VMSPPTQQAHGVSAVLSLSS-RETP---PVTVASIAGDEGR  137

Query  540   DNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkke  719
                GA++++    +   +  SKYL+AAQELLDEVV+V K +  D   +A +    K K++
Sbjct  138   YQLGATTAASQGQV---VMNSKYLRAAQELLDEVVSVSKGVD-DVDAKAKSSALVKKKED  193

Query  720   SMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHH  899
             S    GG G D  +   E +     A E++TA+RQ+LQMKK KL++M+DEVEQRYRQYH 
Sbjct  194   SEGLSGGGGEDGASGAKEGAP----APEMSTAERQELQMKKGKLVNMLDEVEQRYRQYHQ  249

Query  900   QMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEE------  1061
             QM  + +SFE  AG GSAR+YT LAL TIS+QFRCL+ AIASQ++A S++LGE+      
Sbjct  250   QMASVSSSFEAVAGAGSARTYTALALRTISRQFRCLRDAIASQVRAASRALGEDCDADGL  309

Query  1062  ------EGVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHF  1223
                       GSRL++IDH L QQRALQ LGMMQ +AWRPQRGLPER+VS+LRAWLFEHF
Sbjct  310   GGGLGGGRGVGSRLRYIDHQLRQQRALQQLGMMQSSAWRPQRGLPERSVSILRAWLFEHF  369

Query  1224  LHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             LHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV
Sbjct  370   LHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  402



>ref|XP_006362026.1| PREDICTED: BEL1-related homeotic protein 30 [Solanum tuberosum]
Length=645

 Score =   291 bits (744),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 193/264 (73%), Gaps = 9/264 (3%)
 Frame = +3

Query  549   GASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMP  728
             G +S   T  I+  I  SKYLKAAQ LLDEVV+V K++K   +++   K+  +   +S  
Sbjct  187   GYNSPYGTSSIARTIPSSKYLKAAQYLLDEVVSVRKAIKEQNSKKELTKDSRESDVDSKN  246

Query  729   PFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQ  908
                    +  ++  ES   K   +EL+  ++Q++Q K AKLLSM+DE+++RYRQY+HQMQ
Sbjct  247   ISSDTPANGGSNPHES---KNNQSELSPTEKQEVQNKLAKLLSMLDEIDRRYRQYYHQMQ  303

Query  909   VIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGS---  1079
             ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI  QI+A+ +SLGE++    S   
Sbjct  304   IVVSSFDVVAGEGAAKPYTALALQTISRHFRCLRDAICDQIRASRRSLGEQDASENSKAI  363

Query  1080  ---RLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
                RL+F+DHH+ QQRALQ LGMMQ +AWRPQRGLPE +VSVLRAWLFEHFLHPYPKDSD
Sbjct  364   GISRLRFVDHHIRQQRALQQLGMMQQHAWRPQRGLPESSVSVLRAWLFEHFLHPYPKDSD  423

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             KIMLA+QTGLTRSQVSNWFINARV
Sbjct  424   KIMLARQTGLTRSQVSNWFINARV  447



>ref|XP_008382306.1| PREDICTED: BEL1-like homeodomain protein 6 [Malus domestica]
Length=690

 Score =   291 bits (746),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 167/339 (49%), Positives = 216/339 (64%), Gaps = 23/339 (7%)
 Frame = +3

Query  333   GQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGL  512
             G Q+PS  +S       FAS L  + SV      + G      P+   +          L
Sbjct  139   GMQMPS--ISYRNTNMGFASFLSPNASVSSEGDGRNGSFRDEQPRNVEY----------L  186

Query  513   LSARPGAAHDNSGASSSSITHGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaee  683
              S  PG   D+S    S   +G+S     I+ +KYLKAAQ+LLDEVVNV+K+LK    E+
Sbjct  187   QSGFPGGNPDSSKGDLS--PYGMSSMARTISHNKYLKAAQQLLDEVVNVQKALKQHDREK  244

Query  684   aankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMV  863
               +    +   +          +   S         +  EL+ A++Q+LQ K  KLLSM+
Sbjct  245   NQSTHDHQKSFKEGDDGSKNDLESGVSTNPQELASNSTCELSHAEKQELQSKLTKLLSML  304

Query  864   DEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATS  1043
             DEV++RY+QY+HQMQ++V+SF+  AG+GSA+ YT +AL TIS+ FRCL+ AI  QI+AT 
Sbjct  305   DEVDRRYKQYYHQMQIVVSSFDVIAGIGSAKPYTAVALQTISRHFRCLRDAITGQIRATR  364

Query  1044  KSLGEE------EGVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRA  1205
             KSLGE+      +GV  SRL+++D HL QQRALQ LGMMQ +AWRPQRGLPE +VS+LRA
Sbjct  365   KSLGEQGASGSMKGVGISRLRYVDQHLRQQRALQQLGMMQQHAWRPQRGLPESSVSILRA  424

Query  1206  WLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             WLFEHFLHPYPKDSDKI+LA+QTGLTRSQVSNWFINARV
Sbjct  425   WLFEHFLHPYPKDSDKILLARQTGLTRSQVSNWFINARV  463



>ref|NP_001275368.1| BEL1-related homeotic protein 30 [Solanum tuberosum]
 gb|AAN03627.1|AF406703_1 BEL1-related homeotic protein 30 [Solanum tuberosum]
Length=645

 Score =   290 bits (743),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 149/264 (56%), Positives = 193/264 (73%), Gaps = 9/264 (3%)
 Frame = +3

Query  549   GASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMP  728
             G +S   T  I+  I  SKYLKAAQ LLDEVV+V K++K   +++   K+  +   +S  
Sbjct  187   GYNSPYGTSSIARTIPSSKYLKAAQYLLDEVVSVRKAIKEQNSKKELTKDSRESDVDSKN  246

Query  729   PFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQ  908
                    +  ++  ES   K   +EL+  ++Q++Q K AKLLSM+DE+++RYRQY+HQMQ
Sbjct  247   ISSDTPANGGSNPHES---KNNQSELSPTEKQEVQNKLAKLLSMLDEIDRRYRQYYHQMQ  303

Query  909   VIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGS---  1079
             ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI  QI+A+ +SLGE++    S   
Sbjct  304   IVVSSFDVVAGEGAAKPYTALALQTISRHFRCLRDAICDQIRASRRSLGEQDASENSKAI  363

Query  1080  ---RLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
                RL+F+DHH+ QQRALQ LGMMQ +AWRPQRGLPE +VSVLRAWLFEHFLHPYPKDSD
Sbjct  364   GISRLRFVDHHIRQQRALQQLGMMQQHAWRPQRGLPESSVSVLRAWLFEHFLHPYPKDSD  423

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             KIMLA+QTGLTRSQVSNWFINARV
Sbjct  424   KIMLARQTGLTRSQVSNWFINARV  447



>ref|XP_011037163.1| PREDICTED: BEL1-like homeodomain protein 6 [Populus euphratica]
Length=678

 Score =   291 bits (745),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 196/272 (72%), Gaps = 12/272 (4%)
 Frame = +3

Query  528   GAAHD-NSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankeka  704
             G  HD N G  S    + I+  I  SKYLKAAQ+LLDEVVNV K++K    ++  N+  +
Sbjct  189   GGNHDVNKGDLSPYGMNNIARTIPNSKYLKAAQQLLDEVVNVRKAIK--QPDKEKNQTTS  246

Query  705   kmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRY  884
             +    S         +  ++  ES+    + +EL+ A+RQ+LQ K  KLLSM+DEV++RY
Sbjct  247   EHGLNSAKDGDSGSKNGASNLQEST---NSPSELSHAERQELQNKLTKLLSMLDEVDRRY  303

Query  885   RQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE  1064
             +QY+HQMQ++V+SF+  +G G+A+ YT LAL TIS+ FRCL+ AI  QI AT KSLGE+E
Sbjct  304   KQYYHQMQIVVSSFDVISGCGAAKPYTALALQTISRHFRCLRDAITGQIHATRKSLGEQE  363

Query  1065  ------GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFL  1226
                   GV  +RL+++D HL QQRAL  LGMMQ +AWRPQRGLPE +VS+LRAWLFEHFL
Sbjct  364   TSENSKGVGITRLRYVDQHLRQQRALHQLGMMQQHAWRPQRGLPESSVSILRAWLFEHFL  423

Query  1227  HPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             HPYPKDSDKIMLA+QTGLTRSQVSNWFINARV
Sbjct  424   HPYPKDSDKIMLARQTGLTRSQVSNWFINARV  455



>ref|XP_009372989.1| PREDICTED: BEL1-like homeodomain protein 6 [Pyrus x bretschneideri]
Length=685

 Score =   291 bits (745),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 202/481 (42%), Positives = 262/481 (54%), Gaps = 73/481 (15%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSG---NALHAGGMPHA  206
             M+ YY GS+  Q D    LYL  P    + +  L      M++NSG   +AL        
Sbjct  1     MSSYYTGSNS-QKDATPMLYLREPLPSSYPEAPLVSGNMMMYMNSGSYSDALAGSSQQQN  59

Query  207   RL---------PQSQHFVGVPLPASALGSAQLHDPARSLW----------------AGLE  311
              L          Q QH V      S LG   + +   S W                +G+ 
Sbjct  60    NLGSAVGGSDSNQQQHDV-----LSHLGGTHVGEQGFSPWREGRNEMLVTHPMGGSSGIL  114

Query  312   QAGSGSGGQ--------QIPSAV----VSGGGGTTDFASQLGFHRSVVVSPTAQQGlsls  455
               G    GQ        QIPS +    +S       FAS L  + SV      + G    
Sbjct  115   HGGHNLQGQGLSLSLSTQIPSGMQMPSISYRNNNMGFASFLSPNASVSSEGDGRNGSFRD  174

Query  456   lsPQQHPFRSLPMESPVGLLSARPGAAHDNSGASSSSITHGISGF---ITGSKYLKAAQE  626
               P+   +          L S  PG   D+S    S   +G+S     I  +KYLKAAQ+
Sbjct  175   EQPRNVEY----------LQSGFPGGNPDSSKGDLS--PYGMSSMARTIPHNKYLKAAQQ  222

Query  627   LLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAA---  797
             LLDEVVNV+K+LK     +    +     ++S         +   SG  ++ Q+ A+   
Sbjct  223   LLDEVVNVQKALK---QHDREKNQSTHNHQKSFKEGDDGSKNDLESGVSTNPQEPASNPP  279

Query  798   AELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLAL  977
              EL+ A++Q+LQ K  KLLSM+DEV++RY+QY+HQMQ++V+SF+  AG GSA+ YT +AL
Sbjct  280   CELSHAEKQELQSKLTKLLSMLDEVDRRYKQYYHQMQIVVSSFDAIAGSGSAKPYTAVAL  339

Query  978   NTISKQFRCLKVAIASQIKATSKSLGEE------EGVRGSRLKFIDHHLPQQRALQHLGM  1139
              TIS+ FRCL  AI  QI+AT KSLGE+      +GV  SRL+++D HL QQRALQ LGM
Sbjct  340   QTISRHFRCLHDAITGQIRATRKSLGEQGTSGSMKGVGISRLRYVDQHLRQQRALQQLGM  399

Query  1140  MQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINAR  1319
             MQ +AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDSDKI+LA+QTGLTRSQVSNWFINAR
Sbjct  400   MQQHAWRPQRGLPESSVSILRAWLFEHFLHPYPKDSDKILLARQTGLTRSQVSNWFINAR  459

Query  1320  V  1322
             V
Sbjct  460   V  460



>gb|ACD39466.1| BEL29 protein [Solanum palustre]
Length=516

 Score =   286 bits (732),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 180/242 (74%), Gaps = 11/242 (5%)
 Frame = +3

Query  609   LKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQK  788
             + AAQELLDEVVNV KS+K       +      +    +              G +    
Sbjct  1     MGAAQELLDEVVNVGKSMK-------STNSTDVVVNNDVKKSKNMADMDGQIDGGADKDG  53

Query  789   TAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTH  968
             T   EL+TA+RQ++QMKKAKL++M+DEVEQRYR YHHQMQ ++   EQAAG+GSA++YT 
Sbjct  54    TPTTELSTAERQEIQMKKAKLVNMLDEVEQRYRHYHHQMQSVIHWLEQAAGIGSAKTYTA  113

Query  969   LALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLG  1136
             LAL TISKQFRCLK AI  QI++ SK+LGEE+     + GSRLKF+D+ L QQRALQ LG
Sbjct  114   LALQTISKQFRCLKDAIIGQIRSASKTLGEEDSLGGKIEGSRLKFVDNQLRQQRALQQLG  173

Query  1137  MMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINA  1316
             M+Q NAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK+MLAKQTGLTRSQVSNWFINA
Sbjct  174   MIQNNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKMMLAKQTGLTRSQVSNWFINA  233

Query  1317  RV  1322
             RV
Sbjct  234   RV  235



>ref|XP_010557975.1| PREDICTED: BEL1-like homeodomain protein 1 [Tarenaya hassleriana]
Length=675

 Score =   290 bits (742),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 157/273 (58%), Positives = 188/273 (69%), Gaps = 25/273 (9%)
 Frame = +3

Query  561   SSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFgg  740
             S +  G+ G +  SKYLKAAQELLDEV  V +    +         K  +  ++     G
Sbjct  145   SFVVSGMQGSVLSSKYLKAAQELLDEVATVNE----NNTSTENKNRKCLLSNKNGDEVDG  200

Query  741   cggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVA  920
                   T G E+  +   AAELT  +RQ++QMKKA+L++M+DEV+QRY+QYH+QM++IV+
Sbjct  201   KSAGESTRGAETGDK--VAAELTVPERQEIQMKKARLVTMLDEVDQRYKQYHNQMRIIVS  258

Query  921   SFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSL--------------GE  1058
             SFEQAAG GSA++YT LAL TISKQFRCL  AI +QIKA +KSL                
Sbjct  259   SFEQAAGSGSAKTYTSLALKTISKQFRCLNDAIKAQIKALNKSLGGEEREEDEEEGKAEG  318

Query  1059  EEGVRGSRLKFIDHHLPQQRALQHLGMM-----QPNAWRPQRGLPERAVSVLRAWLFEHF  1223
                   SRLKF+DHHL QQRALQ LGM+       NAWRPQRGLPERAVSVLR+WLFEHF
Sbjct  319   GSSSSSSRLKFVDHHLRQQRALQQLGMIHHSNNNNNAWRPQRGLPERAVSVLRSWLFEHF  378

Query  1224  LHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             LHPYPKDSDK+MLAKQTGLTRSQVSNWFINARV
Sbjct  379   LHPYPKDSDKVMLAKQTGLTRSQVSNWFINARV  411



>gb|EYU37829.1| hypothetical protein MIMGU_mgv1a003764mg [Erythranthe guttata]
Length=565

 Score =   287 bits (734),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/251 (58%), Positives = 187/251 (75%), Gaps = 17/251 (7%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             +  SKYL+AAQ+LLDEVV+V+KS+K   A+    K   ++++ES   +            
Sbjct  146   VPNSKYLRAAQQLLDEVVSVKKSMKDQNAKREFPKNSKQVEEESCEEYPSS---------  196

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
              S   K + +E++ A++QDLQ K +KLLSM+DEV++RYRQY+HQMQ++V+SF+  AG G+
Sbjct  197   -SPTVKASRSEISVAEKQDLQNKMSKLLSMLDEVDRRYRQYYHQMQIVVSSFDVIAGAGA  255

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE-------GVRGSRLKFIDHHLP  1109
             A+ YT +AL TIS+ FRCL+ +I +QI    KSLGEE+       GV  SRL+F+DH L 
Sbjct  256   AKPYTAVALETISRHFRCLRDSINNQIHLARKSLGEEDSSSNDNKGVGISRLRFVDHQLR  315

Query  1110  QQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRS  1289
             Q RALQ LG+MQ +AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDSDKIMLA+QTGLTRS
Sbjct  316   QHRALQQLGIMQQHAWRPQRGLPETSVSILRAWLFEHFLHPYPKDSDKIMLARQTGLTRS  375

Query  1290  QVSNWFINARV  1322
             QVSNWFINARV
Sbjct  376   QVSNWFINARV  386



>ref|XP_003554466.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006604654.1| PREDICTED: BEL1-like homeodomain protein 1-like isoform X2 [Glycine 
max]
Length=680

 Score =   290 bits (741),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 200/264 (76%), Gaps = 18/264 (7%)
 Frame = +3

Query  543   NSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeS  722
             N+GAS      GI      SKYLKAA ELL+EV NV   +  +  +++  + +   +  +
Sbjct  170   NNGAS------GIHSVPLSSKYLKAAHELLEEVANVNNGIGTELRKKSGGQTRVIGESSA  223

Query  723   MPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQ  902
                    G    + GGE + ++++  EL+TA+RQ++QMKKAKL+ M+DEVEQRYRQY  Q
Sbjct  224   ------AGSGDGSVGGEGNGKRSS--ELSTAERQEIQMKKAKLIGMLDEVEQRYRQYQQQ  275

Query  903   MQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----V  1070
             M+++V+SFEQAAG+GSAR+YT LAL TISKQFRCLK AIA Q++  +KSLGEE+     +
Sbjct  276   MEIVVSSFEQAAGIGSARTYTALALQTISKQFRCLKDAIAGQVRTANKSLGEEDCFGGKM  335

Query  1071  RGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
              GSRLK++DHHL QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSD
Sbjct  336   EGSRLKYVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSD  395

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             K MLAKQTGLTRSQVSNWFINARV
Sbjct  396   KHMLAKQTGLTRSQVSNWFINARV  419


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 50/89 (56%), Gaps = 18/89 (20%)
 Frame = +3

Query  36   MAMYYQ-GSSEVQ---GDGLQTLYLMNPNYIGFSDTALPQSQQA-------MFLNSGNAL  182
            MA Y+  G+SE+Q    DGLQTL LMNP YI +SD    Q QQ+       +FLN   A 
Sbjct  1    MATYFHHGNSEIQSGGADGLQTLVLMNPGYIHYSDAPQQQQQQSSLAAGNLVFLNP--AA  58

Query  183  HAGG-----MPHARLPQSQHFVGVPLPAS  254
             AGG      PHA    +Q FVGVPLP S
Sbjct  59   VAGGNNNSFNPHAPPSHTQQFVGVPLPNS  87



>ref|XP_008812787.1| PREDICTED: BEL1-like homeodomain protein 7 [Phoenix dactylifera]
 ref|XP_008812788.1| PREDICTED: BEL1-like homeodomain protein 7 [Phoenix dactylifera]
 ref|XP_008812789.1| PREDICTED: BEL1-like homeodomain protein 7 [Phoenix dactylifera]
 ref|XP_008812790.1| PREDICTED: BEL1-like homeodomain protein 7 [Phoenix dactylifera]
Length=671

 Score =   290 bits (741),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 151/258 (59%), Positives = 189/258 (73%), Gaps = 10/258 (4%)
 Frame = +3

Query  573   HGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggc  743
             +G+S     I+ SKYLKAAQELLDEVVNV K+LK  A +  +    A             
Sbjct  214   YGVSSLTNPISNSKYLKAAQELLDEVVNVRKALKDKADKSQSVHTSAGTAGCKDTDGATK  273

Query  744   ggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVAS  923
                 P++  ES+A   +  EL+ + RQDLQ K  KLL+M+DEV++RY+QY+HQMQ++V+S
Sbjct  274   SEGMPSNAQESTA--NSPGELSPSGRQDLQNKVTKLLAMLDEVDRRYKQYYHQMQIVVSS  331

Query  924   FEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE-----GVRGSRLK  1088
             F+  AG G+A+ YT LAL TIS+ FRCL+ AI+ QI+AT KSLGE++     G   SRL+
Sbjct  332   FDVFAGSGAAKPYTALALQTISRHFRCLRDAISGQIRATRKSLGEQDSSISKGGGISRLR  391

Query  1089  FIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAK  1268
             +IDH L QQRA+Q  GMMQ +AWRPQRGLPE +VSVLRAWLFEHFLHPYPKDS+K+MLA+
Sbjct  392   YIDHQLRQQRAMQQFGMMQQHAWRPQRGLPESSVSVLRAWLFEHFLHPYPKDSEKLMLAR  451

Query  1269  QTGLTRSQVSNWFINARV  1322
             QTGLTRSQVSNWFINARV
Sbjct  452   QTGLTRSQVSNWFINARV  469



>gb|KHN08605.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=679

 Score =   290 bits (741),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 200/264 (76%), Gaps = 18/264 (7%)
 Frame = +3

Query  543   NSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeS  722
             N+GAS      GI      SKYLKAA ELL+EV NV   +  +  +++  + +   +  +
Sbjct  169   NNGAS------GIHSVPLSSKYLKAAHELLEEVANVNNGIGTELRKKSGGQTRVIGESSA  222

Query  723   MPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQ  902
                    G    + GGE + ++++  EL+TA+RQ++QMKKAKL+ M+DEVEQRYRQY  Q
Sbjct  223   ------AGSGDGSVGGEGNGKRSS--ELSTAERQEIQMKKAKLIGMLDEVEQRYRQYQQQ  274

Query  903   MQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----V  1070
             M+++V+SFEQAAG+GSAR+YT LAL TISKQFRCLK AIA Q++  +KSLGEE+     +
Sbjct  275   MEIVVSSFEQAAGIGSARTYTALALQTISKQFRCLKDAIAGQVRTANKSLGEEDCFGGKM  334

Query  1071  RGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
              GSRLK++DHHL QQRALQ LGM+Q NAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSD
Sbjct  335   EGSRLKYVDHHLRQQRALQQLGMIQHNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSD  394

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             K MLAKQTGLTRSQVSNWFINARV
Sbjct  395   KHMLAKQTGLTRSQVSNWFINARV  418


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 50/88 (57%), Gaps = 17/88 (19%)
 Frame = +3

Query  36   MAMYYQ-GSSEVQ---GDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSGN------ALH  185
            MA Y+  G+SE+Q    DGLQTL LMNP YI +SD   PQ QQ   L +GN      A  
Sbjct  1    MATYFHHGNSEIQSGGADGLQTLVLMNPGYIHYSDA--PQQQQQSSLAAGNLVFLNPAAV  58

Query  186  AGG-----MPHARLPQSQHFVGVPLPAS  254
            AGG      PHA    +Q FVGVPLP S
Sbjct  59   AGGNNNSFNPHAPPSHTQQFVGVPLPNS  86



>gb|KHN33154.1| BEL1-like homeodomain protein 1 [Glycine soja]
Length=428

 Score =   282 bits (721),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/167 (78%), Positives = 148/167 (89%), Gaps = 4/167 (2%)
 Frame = +3

Query  834   MKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKV  1013
             MKKAKL+ M+DEVEQRYRQYH QM+++ +SFEQAAG+GSAR+YT LAL TISKQFRCLK 
Sbjct  1     MKKAKLIGMLDEVEQRYRQYHQQMEIVGSSFEQAAGIGSARTYTALALQTISKQFRCLKD  60

Query  1014  AIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPE  1181
             AIA Q++  +KSLGEE+     + GSRLK++DHHL QQRALQ LGM+Q NAWRPQRGLPE
Sbjct  61    AIAGQVRTANKSLGEEDCFGGKMEGSRLKYVDHHLRQQRALQQLGMIQHNAWRPQRGLPE  120

Query  1182  RAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             R+VSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWFINARV
Sbjct  121   RSVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWFINARV  167



>ref|XP_010254698.1| PREDICTED: BEL1-like homeodomain protein 6 [Nelumbo nucifera]
Length=751

 Score =   290 bits (743),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 156/274 (57%), Positives = 193/274 (70%), Gaps = 34/274 (12%)
 Frame = +3

Query  573   HGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggc  743
             +G+SGF   I  SKYLKAAQ+LLDEVVNV K+LK          +    K++S+  FG  
Sbjct  264   YGMSGFASVIPNSKYLKAAQQLLDEVVNVRKALK----------QAEVDKQQSLNQFGLK  313

Query  744   ggdpptsggESSA---------------QKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQ  878
             G        +  A                 +++A+L+ A+RQDLQ K  KLL+M+DEV++
Sbjct  314   GSKETEGESKGGASLPSTTGVPSNPQESSTSSSADLSPAERQDLQNKMTKLLAMLDEVDR  373

Query  879   RYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGE  1058
             RYRQY+HQMQ++V+SF+  AG G+A+ YT LAL TIS  FRCL  AI  QI+AT KSLGE
Sbjct  374   RYRQYYHQMQIVVSSFDVIAGSGAAKPYTALALQTISCHFRCLHDAINDQIRATRKSLGE  433

Query  1059  EE------GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEH  1220
             ++      GV  +RL++ID H+ QQRALQ LGMMQ +AWRPQRGLPE +VS+LRAWLFEH
Sbjct  434   QDTSANSKGVGITRLRYIDQHIRQQRALQQLGMMQQHAWRPQRGLPESSVSILRAWLFEH  493

Query  1221  FLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             FLHPYPKDSDKIMLA+QTGLTRSQVSNWFINARV
Sbjct  494   FLHPYPKDSDKIMLARQTGLTRSQVSNWFINARV  527



>ref|XP_010932911.1| PREDICTED: BEL1-like homeodomain protein 7 [Elaeis guineensis]
Length=669

 Score =   288 bits (737),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 190/258 (74%), Gaps = 10/258 (4%)
 Frame = +3

Query  573   HGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggc  743
             +G+S     I+ SKYLKAAQELLDEVVNV K+LK  A +  +    A             
Sbjct  214   YGVSSLTNPISNSKYLKAAQELLDEVVNVRKALKDKADKSQSVHASAGTTGCKDTDGATK  273

Query  744   ggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVAS  923
                 P++  ES+A   +++EL+ ++RQDLQ K  KLL+M+DEV++RY+QY+HQMQ++V+S
Sbjct  274   SEGMPSNPQESTA--NSSSELSPSERQDLQNKVTKLLAMLDEVDRRYKQYYHQMQIVVSS  331

Query  924   FEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLK  1088
             F+  AG G+A+ YT LAL TIS+ FRCL+ AI+ QI+AT KSLGE++         SRL+
Sbjct  332   FDVFAGSGAAKPYTALALQTISRHFRCLRDAISGQIRATQKSLGEQDSSINKAGGISRLR  391

Query  1089  FIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAK  1268
             +ID  + QQRA+Q  GMMQ +AWRPQRGLPE +VSVLRAWLFEHFLHPYPKDS+K+MLA+
Sbjct  392   YIDQQIKQQRAVQQFGMMQQHAWRPQRGLPESSVSVLRAWLFEHFLHPYPKDSEKLMLAR  451

Query  1269  QTGLTRSQVSNWFINARV  1322
             QTGLTRSQVSNWFINARV
Sbjct  452   QTGLTRSQVSNWFINARV  469



>ref|XP_008377277.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X1 [Malus 
domestica]
Length=689

 Score =   288 bits (736),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 171/340 (50%), Positives = 219/340 (64%), Gaps = 25/340 (7%)
 Frame = +3

Query  333   GQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGL  512
             G Q+PS  +S       FAS L  + SV      + G      P+   +          L
Sbjct  140   GMQMPS--ISYRNPNMGFASFLSPNPSVSSEGDGRNGSFRDEQPRNVEY----------L  187

Query  513   LSARPGAAHDNS-GASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaa  689
              S  PG   D+S G  S      I+  I  +KYLKAAQ+LLDEVVNV+K+LK     +  
Sbjct  188   PSGFPGGNPDSSKGDLSPYGMSSIARTIPHNKYLKAAQQLLDEVVNVQKALK---QHDRE  244

Query  690   nkekakmkkeSMPPFggcggdpptsggESSAQKTAA---AELTTAQRQDLQMKKAKLLSM  860
               +      +S         +   SG  S+ Q++A+    EL+ A++Q+LQ K  KLLSM
Sbjct  245   KNQSTHDHHKSFKEGDDGSKNDLESGVSSNPQESASNSPCELSHAEKQELQSKLTKLLSM  304

Query  861   VDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKAT  1040
             +DEV++RY+QY+HQMQ++V+SF+  AG GSA+ YT +AL TIS+ FRCL+ AI  QI+AT
Sbjct  305   LDEVDRRYKQYYHQMQIVVSSFDVIAGGGSAKPYTAVALQTISRHFRCLRDAITGQIQAT  364

Query  1041  SKSLGEE------EGVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLR  1202
              KSLGE+      +GV  SRL+++D HL QQRALQ LGMMQ +AWRPQRGLPE +VS+LR
Sbjct  365   RKSLGEQGASGSMKGVGISRLRYVDQHLRQQRALQQLGMMQQHAWRPQRGLPESSVSILR  424

Query  1203  AWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             AWLFEHFLHPYPKDSDKI+LA+QTGLTRSQVSNWFINARV
Sbjct  425   AWLFEHFLHPYPKDSDKILLARQTGLTRSQVSNWFINARV  464



>ref|XP_009619241.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X2 [Nicotiana 
tomentosiformis]
Length=562

 Score =   284 bits (727),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 183/262 (70%), Gaps = 19/262 (7%)
 Frame = +3

Query  570   THGISGFITGSKYLKAAQELLDEVVNVEKSLK-----LDaaeeaankekakmkkeSMPPF  734
             T  I   +  SKYLKAAQ LLDEVVNV K++K      +  +E+   +     K S PP 
Sbjct  194   TSSIGRKVPNSKYLKAAQYLLDEVVNVRKAIKEHNSKKEFTKESRESDGDSKNKSSDPP-  252

Query  735   ggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVI  914
                              K   +EL+  ++Q++Q K  KLLSM+DE+++RYRQY+HQMQ++
Sbjct  253   -------ANGSSNPQDSKNHQSELSQTEKQEVQNKLTKLLSMLDEIDRRYRQYYHQMQIV  305

Query  915   VASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGS-----  1079
             V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI  QI+A+ +S+GE++    S     
Sbjct  306   VSSFDVVAGDGAAKPYTALALQTISRHFRCLRDAICDQIRASRRSVGEQDASENSKAIGI  365

Query  1080  -RLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKI  1256
              RL+++D H+ QQRALQ LGMMQ +AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDSDKI
Sbjct  366   SRLRYVDQHIRQQRALQQLGMMQQHAWRPQRGLPESSVSILRAWLFEHFLHPYPKDSDKI  425

Query  1257  MLAKQTGLTRSQVSNWFINARV  1322
             MLA+QTGLTRSQVSNWFINARV
Sbjct  426   MLARQTGLTRSQVSNWFINARV  447



>ref|XP_010676226.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=669

 Score =   286 bits (732),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 157/264 (59%), Positives = 186/264 (70%), Gaps = 21/264 (8%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVV-----NVEKSLKLDaaeeaankekakmkkeSMPPFg----gc  743
             I GSKYLKAAQELL+EVV     N    +  +      N         S+  +G      
Sbjct  171   IYGSKYLKAAQELLEEVVHLGDHNSTSVIYKNNTSTTTNTNNDNDNDGSIKKYGGESPSN  230

Query  744   ggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVAS  923
               D    GG          +L+TA+RQ++ MKK KL++M+DE EQRYRQY+HQMQ+++ S
Sbjct  231   ERDGGRGGGGGGGGGGGGGQLSTAERQEILMKKTKLVTMLDEAEQRYRQYNHQMQIVIES  290

Query  924   FEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEE-EG---------VR  1073
             FEQ A VGSA++YT LAL TISKQFRCLK AI  QI+A +K+LG++ EG         + 
Sbjct  291   FEQGA-VGSAKTYTALALKTISKQFRCLKDAIQGQIRAANKTLGDDQEGGSGSLAGGKIE  349

Query  1074  GSRLKFIDHHLPQQRALQHLGMMQ-PNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
             GSRLK+IDH + QQRALQ LGM+Q PNAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSD
Sbjct  350   GSRLKYIDHQIRQQRALQQLGMIQNPNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSD  409

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             KIMLAKQTGLTRSQVSNWFINARV
Sbjct  410   KIMLAKQTGLTRSQVSNWFINARV  433



>ref|XP_010676227.1| PREDICTED: BEL1-like homeodomain protein 1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=627

 Score =   285 bits (729),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 157/264 (59%), Positives = 186/264 (70%), Gaps = 21/264 (8%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVV-----NVEKSLKLDaaeeaankekakmkkeSMPPFg----gc  743
             I GSKYLKAAQELL+EVV     N    +  +      N         S+  +G      
Sbjct  171   IYGSKYLKAAQELLEEVVHLGDHNSTSVIYKNNTSTTTNTNNDNDNDGSIKKYGGESPSN  230

Query  744   ggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVAS  923
               D    GG          +L+TA+RQ++ MKK KL++M+DE EQRYRQY+HQMQ+++ S
Sbjct  231   ERDGGRGGGGGGGGGGGGGQLSTAERQEILMKKTKLVTMLDEAEQRYRQYNHQMQIVIES  290

Query  924   FEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEE-EG---------VR  1073
             FEQ A VGSA++YT LAL TISKQFRCLK AI  QI+A +K+LG++ EG         + 
Sbjct  291   FEQGA-VGSAKTYTALALKTISKQFRCLKDAIQGQIRAANKTLGDDQEGGSGSLAGGKIE  349

Query  1074  GSRLKFIDHHLPQQRALQHLGMMQ-PNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
             GSRLK+IDH + QQRALQ LGM+Q PNAWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSD
Sbjct  350   GSRLKYIDHQIRQQRALQQLGMIQNPNAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSD  409

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             KIMLAKQTGLTRSQVSNWFINARV
Sbjct  410   KIMLAKQTGLTRSQVSNWFINARV  433



>ref|XP_002313027.2| hypothetical protein POPTR_0009s12360g [Populus trichocarpa]
 gb|EEE86982.2| hypothetical protein POPTR_0009s12360g [Populus trichocarpa]
Length=584

 Score =   284 bits (726),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 152/285 (53%), Positives = 191/285 (67%), Gaps = 28/285 (10%)
 Frame = +3

Query  486   LPMESPVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLK  665
             L M+S  G  S   G    N G  S    + +   I  SKYLKAAQ+LLDEVVNV+K+LK
Sbjct  99    LVMQSVSGASSILHGNHDVNKGDLSPYGMNSVGRTIPNSKYLKAAQQLLDEVVNVQKALK  158

Query  666   LDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKA  845
                 E+     +  + + +  P                      +EL+ A+RQ+LQ K  
Sbjct  159   QPDKEKNQTTSEHGLNQSTNSP----------------------SELSHAERQELQNKLT  196

Query  846   KLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIAS  1025
             KLLSM+DEV++RY+QY+HQMQ++V+SF+  AG G+A+ Y  LAL TIS+ FRCL+ AI  
Sbjct  197   KLLSMLDEVDRRYKQYYHQMQIVVSSFDVIAGCGAAKPYIALALQTISQHFRCLRDAITG  256

Query  1026  QIKATSKSLGEEE------GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERA  1187
             QI+AT  +LGE+E      GV  SRL+++D  L Q RALQ LGMM+ +AWRPQRGLPE +
Sbjct  257   QIRATRNNLGEQETSENSKGVGISRLRYVDQQLRQHRALQQLGMMKQHAWRPQRGLPESS  316

Query  1188  VSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             VS+LRAWLFEHFLHPYPKDSDKIMLA+QTGLTRSQVSNWFINARV
Sbjct  317   VSILRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARV  361



>ref|XP_010932672.1| PREDICTED: BEL1-like homeodomain protein 7 [Elaeis guineensis]
 ref|XP_010932680.1| PREDICTED: BEL1-like homeodomain protein 7 [Elaeis guineensis]
 ref|XP_010932687.1| PREDICTED: BEL1-like homeodomain protein 7 [Elaeis guineensis]
Length=671

 Score =   286 bits (731),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 148/264 (56%), Positives = 186/264 (70%), Gaps = 8/264 (3%)
 Frame = +3

Query  546   SGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSM  725
             S AS   I+  I+  I  S+YLKAAQ+LLDEVVNV+K+L     +  +    A       
Sbjct  208   SNASPYDIS-SITSTIPNSRYLKAAQQLLDEVVNVQKALNQKTGKTQSLDNSAGATDTKN  266

Query  726   PPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQM  905
                         +   S+ Q  +  EL  ++RQDLQ K  KLL+M+DEV++RY+QY+HQM
Sbjct  267   NNAVSKADGMSLNPQGSNDQ--SPTELLPSERQDLQNKMTKLLAMLDEVDRRYKQYYHQM  324

Query  906   QVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG---  1076
             Q++V+SF+  AG GSA+ YT LAL TIS+QFRCL+ AI  QI+AT K+LGE++       
Sbjct  325   QIVVSSFDGVAGCGSAKPYTALALKTISRQFRCLRDAINCQIQATKKNLGEKDSSNSKGG  384

Query  1077  --SRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
               SRLK+ID  L QQRA+Q LGM+Q NAWRPQRGLPE +VSVLRAWLFEHFLHPYPKDS+
Sbjct  385   GISRLKYIDQQLRQQRAMQQLGMVQHNAWRPQRGLPETSVSVLRAWLFEHFLHPYPKDSE  444

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             K+MLA+QTGLTRSQ+SNWFINARV
Sbjct  445   KLMLARQTGLTRSQISNWFINARV  468



>ref|XP_008679683.1| PREDICTED: BEL1-like homeodomain protein 1 [Zea mays]
 ref|XP_008679684.1| PREDICTED: BEL1-like homeodomain protein 1 [Zea mays]
 ref|XP_008679685.1| PREDICTED: BEL1-like homeodomain protein 1 [Zea mays]
 gb|AFW65581.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 1 [Zea mays]
 gb|AFW65582.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 2 [Zea mays]
 gb|AFW65583.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 3 [Zea mays]
 gb|AFW65584.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 4 [Zea mays]
 gb|AFW65585.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 5 [Zea mays]
 gb|AFW65586.1| putative POX domain/homeobox DNA-binding domain family protein 
isoform 6 [Zea mays]
Length=671

 Score =   285 bits (730),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 163/252 (65%), Positives = 193/252 (77%), Gaps = 8/252 (3%)
 Frame = +3

Query  588   FITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsg  767
              +  SKYLKAAQELLDEVV+V K ++ DA   AA   K+    +      G  G     G
Sbjct  164   MVMSSKYLKAAQELLDEVVSVSKGVE-DAKTAAAAATKSLAAVKKKEDSEGASGGGTDDG  222

Query  768   gESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVG  947
               + +   AA E++TA+RQ++QMKK+KLL+M+DEVEQRYRQYH QMQ + +SFE AAG G
Sbjct  223   AGAKSGGGAAPEMSTAERQEMQMKKSKLLNMLDEVEQRYRQYHGQMQAVSSSFEAAAGAG  282

Query  948   SARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE-----GVR--GSRLKFIDHHL  1106
             SAR+YT LAL TIS+QFRCL+ AIASQ++A S++LGE+      G R  GSRL++IDH L
Sbjct  283   SARTYTALALRTISRQFRCLRDAIASQVRAASRALGEDADAAVAGGRTVGSRLRYIDHQL  342

Query  1107  PQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTR  1286
              QQRALQ LGMMQ  AWRPQRGLPER+VS+LRAWLFEHFLHPYPKDSDKIMLAKQTGLTR
Sbjct  343   RQQRALQQLGMMQGGAWRPQRGLPERSVSILRAWLFEHFLHPYPKDSDKIMLAKQTGLTR  402

Query  1287  SQVSNWFINARV  1322
             SQVSNWFINARV
Sbjct  403   SQVSNWFINARV  414



>ref|XP_004230877.1| PREDICTED: BEL1-like homeodomain protein 7 [Solanum lycopersicum]
 ref|XP_010315320.1| PREDICTED: BEL1-like homeodomain protein 7 [Solanum lycopersicum]
Length=645

 Score =   284 bits (726),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 146/264 (55%), Positives = 191/264 (72%), Gaps = 9/264 (3%)
 Frame = +3

Query  549   GASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMP  728
             G +S   T  I+  I  SKYLKAAQ LLDEVV+V K++K   +++   K+  +   +S  
Sbjct  187   GYNSPYGTSSIARTIPSSKYLKAAQYLLDEVVSVRKAIKEQNSKKELTKDSREPDLDSKN  246

Query  729   PFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQ  908
                    +  ++  ES   K   +EL+  ++Q++Q K  KLLSM+DE+++RYRQY+HQMQ
Sbjct  247   ISSDTPANGGSNPHES---KNNQSELSATEKQEVQNKLTKLLSMLDEIDRRYRQYYHQMQ  303

Query  909   VIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGS---  1079
             ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI  QI+A+ +SLGE++    S   
Sbjct  304   IVVSSFDVVAGDGAAKPYTALALQTISRHFRCLRDAICDQIRASRRSLGEQDASENSKAI  363

Query  1080  ---RLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
                RL+F+D H+ QQRALQ LGMMQ +AWRPQRGLPE +VSVLRAWLFEHFLHPYPKDS+
Sbjct  364   GISRLRFVDQHIRQQRALQQLGMMQQHAWRPQRGLPESSVSVLRAWLFEHFLHPYPKDSE  423

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             KIMLA+QTGLTRSQVSNWFINARV
Sbjct  424   KIMLARQTGLTRSQVSNWFINARV  447



>ref|XP_010066189.1| PREDICTED: BEL1-like homeodomain protein 6 [Eucalyptus grandis]
 ref|XP_010066190.1| PREDICTED: BEL1-like homeodomain protein 6 [Eucalyptus grandis]
 gb|KCW64025.1| hypothetical protein EUGRSUZ_G01703 [Eucalyptus grandis]
Length=660

 Score =   284 bits (727),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 148/273 (54%), Positives = 188/273 (69%), Gaps = 15/273 (5%)
 Frame = +3

Query  525   PGAAHD-NSGASSSSITHGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaan  692
             PG   D N G     I +G+S     I  S+YL+ AQ+LLDE+VNV K+LK        +
Sbjct  177   PGGDEDVNKGGD---IPYGMSTIVRVIPNSRYLRVAQQLLDEIVNVRKALK-----RPDD  228

Query  693   kekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEV  872
                    +    P    GG    +        + ++EL+ A++QDLQ K  KLLSM+DEV
Sbjct  229   ANDQSRHENQRSPKDADGGSKNEASSNPQESASNSSELSAAEKQDLQNKLTKLLSMLDEV  288

Query  873   EQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSL  1052
             ++RY+QY+HQMQ++V SF+  AG G+A+ YT LAL  IS+ FRCL  AI  QI+AT KSL
Sbjct  289   DKRYKQYYHQMQIVVQSFDTIAGSGAAKPYTALALQRISRHFRCLHDAITGQIQATRKSL  348

Query  1053  GEEEGVRG---SRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHF  1223
             GE++       SRL+++D HL QQR++QHLG+MQ +AWRPQRGLPE +VS+LRAWLFEHF
Sbjct  349   GEQDTSNSNGISRLRYVDQHLRQQRSMQHLGIMQQHAWRPQRGLPENSVSILRAWLFEHF  408

Query  1224  LHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             LHPYPKDSDKIMLA+QTGLTRSQVSNWFINARV
Sbjct  409   LHPYPKDSDKIMLARQTGLTRSQVSNWFINARV  441



>ref|XP_009619240.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X1 [Nicotiana 
tomentosiformis]
Length=647

 Score =   283 bits (725),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 183/262 (70%), Gaps = 19/262 (7%)
 Frame = +3

Query  570   THGISGFITGSKYLKAAQELLDEVVNVEKSLK-----LDaaeeaankekakmkkeSMPPF  734
             T  I   +  SKYLKAAQ LLDEVVNV K++K      +  +E+   +     K S PP 
Sbjct  194   TSSIGRKVPNSKYLKAAQYLLDEVVNVRKAIKEHNSKKEFTKESRESDGDSKNKSSDPP-  252

Query  735   ggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVI  914
                              K   +EL+  ++Q++Q K  KLLSM+DE+++RYRQY+HQMQ++
Sbjct  253   -------ANGSSNPQDSKNHQSELSQTEKQEVQNKLTKLLSMLDEIDRRYRQYYHQMQIV  305

Query  915   VASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGS-----  1079
             V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI  QI+A+ +S+GE++    S     
Sbjct  306   VSSFDVVAGDGAAKPYTALALQTISRHFRCLRDAICDQIRASRRSVGEQDASENSKAIGI  365

Query  1080  -RLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKI  1256
              RL+++D H+ QQRALQ LGMMQ +AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDSDKI
Sbjct  366   SRLRYVDQHIRQQRALQQLGMMQQHAWRPQRGLPESSVSILRAWLFEHFLHPYPKDSDKI  425

Query  1257  MLAKQTGLTRSQVSNWFINARV  1322
             MLA+QTGLTRSQVSNWFINARV
Sbjct  426   MLARQTGLTRSQVSNWFINARV  447



>ref|XP_008794017.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008794018.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008794019.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X2 [Phoenix 
dactylifera]
Length=671

 Score =   284 bits (726),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 152/301 (50%), Positives = 198/301 (66%), Gaps = 20/301 (7%)
 Frame = +3

Query  474   PFRSLPMESPVGLLSARPGAAHD----------NSGASSSSITHGISGF---ITGSKYLK  614
             PF+  P  S + +LS+      D          N    S++  + +S F   I  S+YLK
Sbjct  170   PFQFQPANSDISILSSHQSNLGDGRAFRDDICRNKLMHSNASPYDLSSFTSTIPNSRYLK  229

Query  615   AAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTA  794
              AQ+LLDEVVNV+K+LK       +                  G     +   S+ Q  +
Sbjct  230   VAQQLLDEVVNVQKALKQKTGRTQSLDNSVGATDSRDNDAESKGDGMSLNPQGSNDQ--S  287

Query  795   AAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLA  974
               EL+ ++RQDLQ K  KLL+M+DEV++R++QY+HQMQ++ +SF+  AG G+A+ YT LA
Sbjct  288   PTELSPSERQDLQNKMMKLLAMLDEVDRRHKQYYHQMQIVASSFDVVAGCGAAKPYTALA  347

Query  975   LNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQRALQHLGM  1139
             L TIS+QFRCL+ AI+ QI+AT KSLGE++         SRLK+ID  L QQRA+Q LGM
Sbjct  348   LETISRQFRCLRDAISCQIRATKKSLGEKDSSNSKGGGISRLKYIDQQLKQQRAMQQLGM  407

Query  1140  MQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINAR  1319
             +Q NAWRPQRGLPE +VSVLRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQ+SNWFINAR
Sbjct  408   VQHNAWRPQRGLPETSVSVLRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQISNWFINAR  467

Query  1320  V  1322
             V
Sbjct  468   V  468



>ref|XP_008794014.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008794015.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008794016.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X1 [Phoenix 
dactylifera]
Length=696

 Score =   283 bits (725),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 152/301 (50%), Positives = 198/301 (66%), Gaps = 20/301 (7%)
 Frame = +3

Query  474   PFRSLPMESPVGLLSARPGAAHD----------NSGASSSSITHGISGF---ITGSKYLK  614
             PF+  P  S + +LS+      D          N    S++  + +S F   I  S+YLK
Sbjct  195   PFQFQPANSDISILSSHQSNLGDGRAFRDDICRNKLMHSNASPYDLSSFTSTIPNSRYLK  254

Query  615   AAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTA  794
              AQ+LLDEVVNV+K+LK       +                  G     +   S+ Q  +
Sbjct  255   VAQQLLDEVVNVQKALKQKTGRTQSLDNSVGATDSRDNDAESKGDGMSLNPQGSNDQ--S  312

Query  795   AAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLA  974
               EL+ ++RQDLQ K  KLL+M+DEV++R++QY+HQMQ++ +SF+  AG G+A+ YT LA
Sbjct  313   PTELSPSERQDLQNKMMKLLAMLDEVDRRHKQYYHQMQIVASSFDVVAGCGAAKPYTALA  372

Query  975   LNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQRALQHLGM  1139
             L TIS+QFRCL+ AI+ QI+AT KSLGE++         SRLK+ID  L QQRA+Q LGM
Sbjct  373   LETISRQFRCLRDAISCQIRATKKSLGEKDSSNSKGGGISRLKYIDQQLKQQRAMQQLGM  432

Query  1140  MQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINAR  1319
             +Q NAWRPQRGLPE +VSVLRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQ+SNWFINAR
Sbjct  433   VQHNAWRPQRGLPETSVSVLRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQISNWFINAR  492

Query  1320  V  1322
             V
Sbjct  493   V  493



>ref|XP_009757871.1| PREDICTED: BEL1-like homeodomain protein 7 [Nicotiana sylvestris]
Length=647

 Score =   282 bits (722),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 147/279 (53%), Positives = 188/279 (67%), Gaps = 21/279 (8%)
 Frame = +3

Query  525   PGAAHD--NSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLK-----LDaaee  683
             PG+  D    G +S   T  I   +  SKYLKAAQ LLDEVVNV K++K      +  +E
Sbjct  177   PGSNSDAMKGGYNSPYGTSSIGRNVPNSKYLKAAQYLLDEVVNVRKAIKEHNSKKELTKE  236

Query  684   aankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMV  863
             +         K S PP                  K   +EL+  ++Q++Q K  KLLSM+
Sbjct  237   SRESNGDSKNKSSDPP--------ANGSTNPQDSKNHQSELSQTEKQEVQNKLTKLLSML  288

Query  864   DEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATS  1043
             DE+++RYRQY+HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ A+  QI+ + 
Sbjct  289   DEIDRRYRQYYHQMQIVVSSFDVVAGDGAAKPYTALALQTISRHFRCLRDAMCDQIRVSR  348

Query  1044  KSLGEEEGVRGS------RLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRA  1205
             +SLGE++    S      RL+++D H+ QQRALQ LGMMQ +AWRPQRGLPE +VS+LRA
Sbjct  349   RSLGEQDASENSKAVGISRLRYVDQHIRQQRALQQLGMMQQHAWRPQRGLPESSVSILRA  408

Query  1206  WLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             WLFEHFLHPYPKDSDKIMLA+QTGLTRSQVSNWFINARV
Sbjct  409   WLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARV  447



>ref|NP_001065808.2| Os11g0158600 [Oryza sativa Japonica Group]
 gb|ABA91569.1| Associated with HOX family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEC67717.1| hypothetical protein OsI_35198 [Oryza sativa Indica Group]
 dbj|BAF27653.2| Os11g0158600 [Oryza sativa Japonica Group]
Length=678

 Score =   283 bits (723),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 162/252 (64%), Positives = 188/252 (75%), Gaps = 9/252 (4%)
 Frame = +3

Query  588   FITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsg  767
              +  SKYLKAAQELLDEVV+V K +  D  + AA  +     K+     G  GG     G
Sbjct  169   MVMSSKYLKAAQELLDEVVSVSKGV--DDVKAAAAAKSPASVKKKEDSEGVSGGGTEDGG  226

Query  768   gESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVG  947
             G  S       E++TA+RQ+LQMKK KL++M+DEVEQRYRQYH QMQV+VASFE  AG G
Sbjct  227   GAKSGGAPPPPEMSTAERQELQMKKGKLINMLDEVEQRYRQYHQQMQVVVASFEAVAGGG  286

Query  948   SARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-------SRLKFIDHHL  1106
             SAR+YT LAL TIS+QFRCL+ AIA Q++A S++LGE     G       SRL++IDH L
Sbjct  287   SARTYTALALRTISRQFRCLRDAIAGQVRAASRALGEAVDADGGCGRTVGSRLRYIDHQL  346

Query  1107  PQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTR  1286
              QQRALQ LGMMQ +AWRPQRGLPER+VS+LRAWLFEHFLHPYPKDSDKIMLAKQTGLTR
Sbjct  347   RQQRALQQLGMMQSSAWRPQRGLPERSVSILRAWLFEHFLHPYPKDSDKIMLAKQTGLTR  406

Query  1287  SQVSNWFINARV  1322
             SQVSNWFINARV
Sbjct  407   SQVSNWFINARV  418



>ref|XP_009347845.1| PREDICTED: BEL1-like homeodomain protein 7 [Pyrus x bretschneideri]
Length=687

 Score =   283 bits (724),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 169/340 (50%), Positives = 218/340 (64%), Gaps = 25/340 (7%)
 Frame = +3

Query  333   GQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRSLPMESPVGL  512
             G Q+PS  +S       FAS L  + SV      + G      P+   +          L
Sbjct  140   GMQMPS--ISYRNPNMGFASFLSPNPSVSSEGDGRNGSFRDEQPRNVEY----------L  187

Query  513   LSARPGAAHDNS-GASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaa  689
              S  PG   D+S G  S      I+  I  +KYLKAAQ+LLDEVVNV+K+LK     +  
Sbjct  188   PSGFPGGNPDSSKGDLSPYGMSSIARTIPHNKYLKAAQQLLDEVVNVQKALK---QHDIE  244

Query  690   nkekakmkkeSMPPFggcggdpptsggESSAQKTAA---AELTTAQRQDLQMKKAKLLSM  860
               +     ++S         +   SG  S+ Q++A+    EL+ A++ +LQ K  KLLSM
Sbjct  245   KNQSTHDHQKSFKEGDDGSKNDLESGVSSNPQESASNSPCELSHAEKLELQSKLTKLLSM  304

Query  861   VDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKAT  1040
             +DEV++RY+QY+HQMQ++V+SF+  AG GSA+ YT +AL TIS+ FRCL+ AI  QI+AT
Sbjct  305   LDEVDRRYKQYYHQMQIVVSSFDVIAGGGSAKPYTAVALQTISRHFRCLRDAITGQIQAT  364

Query  1041  SKSLGEE------EGVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLR  1202
              KSLGE+      +GV  SRL+++D HL QQRALQ LGMMQ + WRPQRGLPE +VS+LR
Sbjct  365   RKSLGEQGASGSMKGVGISRLRYVDQHLRQQRALQQLGMMQQHPWRPQRGLPESSVSILR  424

Query  1203  AWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             AWLFEHFLHPYPKDSDKI+LA+QTGLTRSQVSNWFINARV
Sbjct  425   AWLFEHFLHPYPKDSDKILLARQTGLTRSQVSNWFINARV  464



>ref|XP_007160715.1| hypothetical protein PHAVU_001G011000g [Phaseolus vulgaris]
 ref|XP_007160716.1| hypothetical protein PHAVU_001G011000g [Phaseolus vulgaris]
 gb|ESW32709.1| hypothetical protein PHAVU_001G011000g [Phaseolus vulgaris]
 gb|ESW32710.1| hypothetical protein PHAVU_001G011000g [Phaseolus vulgaris]
Length=637

 Score =   281 bits (719),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/249 (57%), Positives = 181/249 (73%), Gaps = 3/249 (1%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             G S  +  S+YLKAAQELLDE+VNV K+LK    E+  +     +               
Sbjct  192   GFSSNVLNSQYLKAAQELLDEIVNVRKALKQTGLEKQQSFRDIGLDGSKDSDGKSTSQSG  251

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
               S   +S+    + EL+ A+RQ+L  KK KLLSM+DEV++RYRQY HQMQ++V+SF+  
Sbjct  252   QISSCPNSSAANTSCELSPAERQNLLDKKTKLLSMLDEVDKRYRQYCHQMQIVVSSFDMV  311

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGSRLKFIDHHLPQQ  1115
             AGVG+A  YT LAL TIS+ FRCL+ AI+ QI+ T +SLGE+EG+   RL+++D  L QQ
Sbjct  312   AGVGAAEPYTALALRTISRHFRCLRDAISGQIQVTQRSLGEQEGI--PRLRYVDQQLRQQ  369

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             +ALQ LG+M+  AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+KIMLA+QTGLTR+QV
Sbjct  370   KALQQLGVMR-QAWRPQRGLPETSVSILRAWLFEHFLHPYPKDSEKIMLARQTGLTRNQV  428

Query  1296  SNWFINARV  1322
             +NWFINARV
Sbjct  429   ANWFINARV  437



>ref|XP_008812200.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X3 [Phoenix 
dactylifera]
Length=645

 Score =   280 bits (715),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 188/258 (73%), Gaps = 10/258 (4%)
 Frame = +3

Query  573   HGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggc  743
             +G+S     I  SKYLKAAQELLDEVVN  K+LK  A +  +    A             
Sbjct  188   YGVSSLTSSIPNSKYLKAAQELLDEVVNARKTLKHKADKSQSVHSSAGTTGCKDTDGVSK  247

Query  744   ggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVAS  923
                 P++  ES+A   +++EL+ ++RQDLQ K  KLL+M+DEV+ RY+QY+HQMQ++V+S
Sbjct  248   SKGMPSNPQESTA--NSSSELSPSERQDLQNKVMKLLAMLDEVDGRYKQYYHQMQIVVSS  305

Query  924   FEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE-----GVRGSRLK  1088
             F+  AG G+A+ YT LAL TIS+ FRCL+ AI+ QI+AT K+LGE++     G   +RL+
Sbjct  306   FDVIAGSGAAKPYTALALQTISQHFRCLRDAISGQIQATRKTLGEQDSSISQGGGIARLR  365

Query  1089  FIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAK  1268
             +ID  L QQRA+Q  GMMQ ++WRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+
Sbjct  366   YIDQQLRQQRAMQQFGMMQQHSWRPQRGLPESSVSILRAWLFEHFLHPYPKDSEKLMLAR  425

Query  1269  QTGLTRSQVSNWFINARV  1322
             QTGLTRSQVSNWFINARV
Sbjct  426   QTGLTRSQVSNWFINARV  443



>ref|XP_010685441.1| PREDICTED: BEL1-like homeodomain protein 1 [Beta vulgaris subsp. 
vulgaris]
Length=747

 Score =   282 bits (721),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 160/185 (86%), Gaps = 11/185 (6%)
 Frame = +3

Query  801   ELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALN  980
             E++TAQRQ+LQMKKAKLL+M++EVEQRYRQY+ QMQV+V+SFEQAAGVGSA+ YT LAL 
Sbjct  284   EISTAQRQELQMKKAKLLNMLEEVEQRYRQYNTQMQVVVSSFEQAAGVGSAKLYTSLALK  343

Query  981   TISKQFRCLKVAIASQIKATSKSLGEE-----------EGVRGSRLKFIDHHLPQQRALQ  1127
             TISKQFRCLK AI SQIKAT KSLGEE           EG  GSRL+++DH L QQRALQ
Sbjct  344   TISKQFRCLKDAIMSQIKATYKSLGEEDTTSNGTGIKLEGGAGSRLRYVDHQLRQQRALQ  403

Query  1128  HLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWF  1307
              LGMMQ NAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK MLAKQTGLTRSQVSNWF
Sbjct  404   QLGMMQHNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKHMLAKQTGLTRSQVSNWF  463

Query  1308  INARV  1322
             INARV
Sbjct  464   INARV  468


 Score = 70.9 bits (172),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 83/239 (35%), Positives = 110/239 (46%), Gaps = 52/239 (22%)
 Frame = +3

Query  33   FMAMYYQGSSEVQGDG------LQTLYLMNPNYIG-FSDTALPQSQQAMFLNSGNALHAG  191
             MA Y+ G SE+Q  G      LQTLYLMNPN+I  +S+   P +   +FLN  NAL  G
Sbjct  1    MMATYFHGGSEIQAAGAAGDHNLQTLYLMNPNFIAAYSEGQTPPNM--LFLNPANALSQG  58

Query  192  GMPHARLPQSQH---FVGVPLPASALGSAQLHDPARSLWAGLEQAGSGSGGQQIPSAV--  356
             +PHA  PQ      F+G+PL     G+    D  R        +       QIP+A+  
Sbjct  59   NLPHAPPPQQPQQQQFIGIPLG----GTHPSEDHGRPS-PSSSSSLQHHHHHQIPTALHG  113

Query  357  ---------------VSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsP-QQHPFRSL  488
                           +      +D    +GF R     P   QGLSLSLSP QQ      
Sbjct  114  LSVSRVHPNLWNQGSIPATASESDMTDHMGFRR-----PMTAQGLSLSLSPGQQQQQHQQ  168

Query  489  PMESPVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLK  665
              +S V ++           G S++S+    +G I GSK+LKA QELL+EVVNV  + K
Sbjct  169  QHQSQVTVV-----------GGSATSVA-ASNGVIIGSKFLKATQELLEEVVNVGNNNK  215



>gb|KHG12221.1| BEL1-like homeodomain protein 6 [Gossypium arboreum]
Length=661

 Score =   280 bits (716),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 154/280 (55%), Positives = 192/280 (69%), Gaps = 19/280 (7%)
 Frame = +3

Query  501   PVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaae  680
             P G   A  G    N G   +     +S  I  SKYLKAAQ+LLDEVVNV K+LK     
Sbjct  171   PHGFSGANQGT---NKGDLYACGMSSMSRAIPNSKYLKAAQQLLDEVVNVPKALK-----  222

Query  681   eaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSM  860
                  E  K   +S         + P++  ESS       EL+ A+RQ+LQ K  KLLSM
Sbjct  223   ---QAEGEKNPMKSCKEDDEGSKNVPSNQQESS--NNIQKELSHAERQELQSKLTKLLSM  277

Query  861   VDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKAT  1040
             +DEV++RY+QY+HQMQ++V+SF+  AG G+A+ YT +AL TIS+ FRCLK  I  QI+AT
Sbjct  278   LDEVDRRYKQYYHQMQIVVSSFDAIAGCGAAKPYTAVALQTISRHFRCLKDTINGQIQAT  337

Query  1041  SKSLGEEE------GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLR  1202
              KSLGE++      GVR +RL++++  L QQ+ALQ LGMM  +AWRPQRGLPE +VS+LR
Sbjct  338   RKSLGEQDTLEDGKGVRITRLRYVEQQLRQQKALQQLGMMPQHAWRPQRGLPESSVSILR  397

Query  1203  AWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             AWLFEHFLHPYPKDS+KIMLA+QTGLTRSQVSNWFINARV
Sbjct  398   AWLFEHFLHPYPKDSEKIMLARQTGLTRSQVSNWFINARV  437



>ref|XP_006595918.1| PREDICTED: BEL1-like homeodomain protein 3-like isoform X1 [Glycine 
max]
 ref|XP_006595919.1| PREDICTED: BEL1-like homeodomain protein 3-like isoform X2 [Glycine 
max]
 gb|KHN20947.1| BEL1-like homeodomain protein 10 [Glycine soja]
Length=636

 Score =   279 bits (714),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 141/249 (57%), Positives = 182/249 (73%), Gaps = 3/249 (1%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             G S  +  S+YLKAAQELLDE+VNV K+LK    E+  +     +               
Sbjct  190   GFSNNVLNSQYLKAAQELLDEIVNVRKALKQTGLEKQQSFRDIGLDGSKDSDGKSTSQSV  249

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
               S G + +   ++ EL+ A+RQ+L  KK KLLSM+DEV++RYRQY HQMQ++V+SF+  
Sbjct  250   QISSGPNGSAANSSCELSPAERQNLLDKKTKLLSMLDEVDKRYRQYCHQMQIVVSSFDMV  309

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGSRLKFIDHHLPQQ  1115
             AG G+A  YT LAL TIS+ FRCL+ AI+SQI+ T ++LGE+EG+   RL+++D  L QQ
Sbjct  310   AGCGAAEPYTALALRTISRHFRCLRDAISSQIQVTQRNLGEQEGI--PRLRYVDQQLRQQ  367

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             +ALQ LG+M+  AWRPQRGLPE +VSVLRAWLFEHFLHPYPKDS+KIMLA+QTGLTR+QV
Sbjct  368   KALQQLGVMR-QAWRPQRGLPETSVSVLRAWLFEHFLHPYPKDSEKIMLARQTGLTRNQV  426

Query  1296  SNWFINARV  1322
             +NWFINARV
Sbjct  427   ANWFINARV  435



>ref|XP_008812195.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008812197.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X1 [Phoenix 
dactylifera]
Length=671

 Score =   280 bits (715),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 188/258 (73%), Gaps = 10/258 (4%)
 Frame = +3

Query  573   HGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggc  743
             +G+S     I  SKYLKAAQELLDEVVN  K+LK  A +  +    A             
Sbjct  214   YGVSSLTSSIPNSKYLKAAQELLDEVVNARKTLKHKADKSQSVHSSAGTTGCKDTDGVSK  273

Query  744   ggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVAS  923
                 P++  ES+A   +++EL+ ++RQDLQ K  KLL+M+DEV+ RY+QY+HQMQ++V+S
Sbjct  274   SKGMPSNPQESTA--NSSSELSPSERQDLQNKVMKLLAMLDEVDGRYKQYYHQMQIVVSS  331

Query  924   FEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE-----GVRGSRLK  1088
             F+  AG G+A+ YT LAL TIS+ FRCL+ AI+ QI+AT K+LGE++     G   +RL+
Sbjct  332   FDVIAGSGAAKPYTALALQTISQHFRCLRDAISGQIQATRKTLGEQDSSISQGGGIARLR  391

Query  1089  FIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAK  1268
             +ID  L QQRA+Q  GMMQ ++WRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+
Sbjct  392   YIDQQLRQQRAMQQFGMMQQHSWRPQRGLPESSVSILRAWLFEHFLHPYPKDSEKLMLAR  451

Query  1269  QTGLTRSQVSNWFINARV  1322
             QTGLTRSQVSNWFINARV
Sbjct  452   QTGLTRSQVSNWFINARV  469



>ref|NP_179233.1| BEL1-like homeodomain 7 [Arabidopsis thaliana]
 sp|Q9SIW1.1|BLH7_ARATH RecName: Full=BEL1-like homeodomain protein 7; Short=BEL1-like 
protein 7 [Arabidopsis thaliana]
 gb|AAD22299.1| putative homeodomain transcription factor [Arabidopsis thaliana]
 gb|AEC06493.1| BEL1-like homeodomain 7 [Arabidopsis thaliana]
Length=482

 Score =   274 bits (701),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 148/285 (52%), Positives = 189/285 (66%), Gaps = 29/285 (10%)
 Frame = +3

Query  486   LPMESPVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLK  665
              P+   +GL S    +  +N+   ++ +  G +  I  SKYLKAAQELLDE VNV+K+LK
Sbjct  80    FPVMRRLGLSSQIETSRGNNNNEYATQVVSGFTRTIHNSKYLKAAQELLDETVNVKKALK  139

Query  666   LDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKA  845
                                  P     GD      E + Q T  AE+  A+RQ+LQ K +
Sbjct  140   ------------------QFQP----EGDKINEVKEKNLQ-TNTAEIPQAERQELQSKLS  176

Query  846   KLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIAS  1025
             KLLS++DEV++ Y+QY+HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI+ 
Sbjct  177   KLLSILDEVDRNYKQYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAISG  236

Query  1026  QIKATSKSLGEEE------GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERA  1187
             QI    KSLG E+      GV  SRL+ +D  + QQRALQ LG+MQP+ WRPQRGLP+ +
Sbjct  237   QILVIRKSLGGEQDGSDGRGVGISRLRNVDQQVRQQRALQRLGVMQPHTWRPQRGLPDSS  296

Query  1188  VSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             V VLRAWLFEHFLHPYPKDSDKIMLA+QTGL+R QVSNWFINARV
Sbjct  297   VLVLRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARV  341



>ref|XP_008812196.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X2 [Phoenix 
dactylifera]
Length=671

 Score =   279 bits (714),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/258 (56%), Positives = 188/258 (73%), Gaps = 10/258 (4%)
 Frame = +3

Query  573   HGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggc  743
             +G+S     I  SKYLKAAQELLDEVVN  K+LK  A +  +    A             
Sbjct  214   YGVSSLTSSIPNSKYLKAAQELLDEVVNARKTLKHKADKSQSVHSSAGTTGCKDTDGVSK  273

Query  744   ggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVAS  923
                 P++  ES+A   +++EL+ ++RQDLQ K  KLL+M+DEV+ RY+QY+HQMQ++V+S
Sbjct  274   SKGMPSNPQESTA--NSSSELSPSERQDLQNKVMKLLAMLDEVDGRYKQYYHQMQIVVSS  331

Query  924   FEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE-----GVRGSRLK  1088
             F+  AG G+A+ YT LAL TIS+ FRCL+ AI+ QI+AT K+LGE++     G   +RL+
Sbjct  332   FDVIAGSGAAKPYTALALQTISQHFRCLRDAISGQIQATRKTLGEQDSSISQGGGIARLR  391

Query  1089  FIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAK  1268
             +ID  L QQRA+Q  GMMQ ++WRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+
Sbjct  392   YIDQQLRQQRAMQQFGMMQQHSWRPQRGLPESSVSILRAWLFEHFLHPYPKDSEKLMLAR  451

Query  1269  QTGLTRSQVSNWFINARV  1322
             QTGLTRSQVSNWFINARV
Sbjct  452   QTGLTRSQVSNWFINARV  469



>ref|XP_010917677.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X4 [Elaeis 
guineensis]
Length=645

 Score =   278 bits (712),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 182/249 (73%), Gaps = 7/249 (3%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             +  SKYLKAAQELL EVVNV K+LK  A    +    A                 P++  
Sbjct  197   VPNSKYLKAAQELLVEVVNVRKALKHKADNGQSVHSSAGTTGCKDTDGASKSEGMPSNPQ  256

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES+A   +++EL+ ++RQDLQ K  KLL+M+DEV+ RY+QY+HQMQ++V+SF+  AG G+
Sbjct  257   ESTA--NSSSELSPSERQDLQNKVTKLLAMLDEVDSRYKQYYHQMQIVVSSFDIIAGFGA  314

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE-----GVRGSRLKFIDHHLPQQ  1115
             A+ YT LAL TIS+ FRCL+ AI  QI+AT KSLGE++     G   +RL++ID  L QQ
Sbjct  315   AKPYTALALQTISQHFRCLRDAIGGQIRATRKSLGEQDSSISQGGGIARLRYIDQQLRQQ  374

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA+Q  GMMQ ++WRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQV
Sbjct  375   RAMQQFGMMQQHSWRPQRGLPESSVSILRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQV  434

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  435   SNWFINARV  443



>gb|AAL10487.1| At2g16400/F16F14.10 [Arabidopsis thaliana]
 gb|AAN18176.1| At2g16400/F16F14.10 [Arabidopsis thaliana]
Length=482

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 148/285 (52%), Positives = 189/285 (66%), Gaps = 29/285 (10%)
 Frame = +3

Query  486   LPMESPVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLK  665
              P+   +GL S    +  +N+   ++ +  G +  I  SKYLKAAQELLDE VNV+K+LK
Sbjct  80    FPVMRRLGLSSQIETSRGNNNNEYATQVVSGFTRTIHNSKYLKAAQELLDETVNVKKALK  139

Query  666   LDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKA  845
                                  P     GD      E + Q T  AE+  A+RQ+LQ K +
Sbjct  140   ------------------QFQP----EGDKINEVKEKNLQ-TNTAEIPQAERQELQSKLS  176

Query  846   KLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIAS  1025
             KLLS++DEV++ Y+QY+HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI+ 
Sbjct  177   KLLSILDEVDRNYKQYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAISG  236

Query  1026  QIKATSKSLGEEE------GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERA  1187
             QI    KSLG E+      GV  SRL+ +D  + QQRALQ LG+MQP+ WRPQRGLP+ +
Sbjct  237   QILVIRKSLGGEQDGSDGRGVGISRLRNVDQQVRQQRALQRLGVMQPHTWRPQRGLPDSS  296

Query  1188  VSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             V VLRAWLFEHFLHPYPKDSDKIMLA+QTGL+R QVSNWFINARV
Sbjct  297   VLVLRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARV  341



>ref|XP_007160717.1| hypothetical protein PHAVU_001G011100g [Phaseolus vulgaris]
 gb|ESW32711.1| hypothetical protein PHAVU_001G011100g [Phaseolus vulgaris]
Length=638

 Score =   278 bits (711),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 138/249 (55%), Positives = 181/249 (73%), Gaps = 3/249 (1%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             G S  +  S+YLKAAQELLDE+VNV K+LK    E+  +     +               
Sbjct  192   GFSSNVLNSQYLKAAQELLDEIVNVRKALKQTGLEKQQSFRDIGLDGSKDSDGKSTSQTG  251

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
               S   +S+   ++ EL+ A+RQ+L  KK KLL+M+DEV++RYRQY HQMQ++V+SF+  
Sbjct  252   QISSCPNSSAANSSCELSPAERQNLLDKKTKLLTMLDEVDKRYRQYCHQMQIVVSSFDMV  311

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGSRLKFIDHHLPQQ  1115
             AG G++  YT LAL TIS+ FRCL+ AI+ QI+ T +SLGE+EG+   RL+++D  L QQ
Sbjct  312   AGCGASEPYTALALRTISRHFRCLRDAISGQIQVTQRSLGEQEGI--PRLRYVDQQLRQQ  369

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             +ALQ LG+M+  AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+KIMLA+QTGLTR+QV
Sbjct  370   KALQQLGVMR-QAWRPQRGLPETSVSILRAWLFEHFLHPYPKDSEKIMLARQTGLTRNQV  428

Query  1296  SNWFINARV  1322
             +NWFINARV
Sbjct  429   ANWFINARV  437



>ref|XP_010917673.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X3 [Elaeis 
guineensis]
 ref|XP_010917674.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X3 [Elaeis 
guineensis]
 ref|XP_010917675.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X3 [Elaeis 
guineensis]
 ref|XP_010917676.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X3 [Elaeis 
guineensis]
 ref|XP_010917679.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X3 [Elaeis 
guineensis]
Length=671

 Score =   278 bits (712),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 182/249 (73%), Gaps = 7/249 (3%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             +  SKYLKAAQELL EVVNV K+LK  A    +    A                 P++  
Sbjct  223   VPNSKYLKAAQELLVEVVNVRKALKHKADNGQSVHSSAGTTGCKDTDGASKSEGMPSNPQ  282

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES+A   +++EL+ ++RQDLQ K  KLL+M+DEV+ RY+QY+HQMQ++V+SF+  AG G+
Sbjct  283   ESTA--NSSSELSPSERQDLQNKVTKLLAMLDEVDSRYKQYYHQMQIVVSSFDIIAGFGA  340

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE-----GVRGSRLKFIDHHLPQQ  1115
             A+ YT LAL TIS+ FRCL+ AI  QI+AT KSLGE++     G   +RL++ID  L QQ
Sbjct  341   AKPYTALALQTISQHFRCLRDAIGGQIRATRKSLGEQDSSISQGGGIARLRYIDQQLRQQ  400

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA+Q  GMMQ ++WRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQV
Sbjct  401   RAMQQFGMMQQHSWRPQRGLPESSVSILRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQV  460

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  461   SNWFINARV  469



>gb|KHN22224.1| BEL1-like homeodomain protein 3 [Glycine soja]
Length=556

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 142/260 (55%), Positives = 189/260 (73%), Gaps = 28/260 (11%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLK-----------LDaaeeaankekakmkkeS  722
             G S  I  S+YLKAAQ+LLDE+V+V K+LK           LD ++++  K  ++  + S
Sbjct  109   GYSNSILNSQYLKAAQDLLDEIVSVRKALKQSGMEKQENTGLDGSKDSDGKSTSQSMQMS  168

Query  723   MPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQ  902
               P              + +   A++EL++A+RQ+L  KK KLLSM+DEV++RYRQY HQ
Sbjct  169   SGP--------------NGSTANASSELSSAERQNLLDKKTKLLSMLDEVDKRYRQYCHQ  214

Query  903   MQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGSR  1082
             MQ++V+SF+  AG G+A  YT LAL TIS+ FRCL+ AI+ QI+ T +SLGE+EG+   R
Sbjct  215   MQIVVSSFDMVAGCGAAEPYTTLALRTISRHFRCLRDAISGQIQVTQRSLGEQEGI--PR  272

Query  1083  LKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIML  1262
             L+++D  L QQ+ALQ LG+M+  AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+KIML
Sbjct  273   LRYVDQQLRQQKALQQLGVMR-QAWRPQRGLPESSVSILRAWLFEHFLHPYPKDSEKIML  331

Query  1263  AKQTGLTRSQVSNWFINARV  1322
             A+QTGLTR+QV+NWFINARV
Sbjct  332   ARQTGLTRNQVANWFINARV  351



>ref|XP_006650407.1| PREDICTED: BEL1-like homeodomain protein 6-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006650408.1| PREDICTED: BEL1-like homeodomain protein 6-like isoform X2 [Oryza 
brachyantha]
Length=643

 Score =   278 bits (710),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 167/318 (53%), Positives = 213/318 (67%), Gaps = 21/318 (7%)
 Frame = +3

Query  396   LGFHRSVVVSPTAQQGlslslsPQ----QHPFRSLPMESPVGLLSARPGAAHDNSGASSS  563
             L  H S+ V+PT  QGLSLSL+       +P+ S   E    LL+       DN   +  
Sbjct  132   LNNHNSMSVAPTPGQGLSLSLNTHILAPSYPYWSAKQE----LLTPHSYQGDDNRMKNMQ  187

Query  564   SITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggc  743
             S     S  I  SKYLKAAQELLDEVV+V KS+K  A ++ A   K+  K+      G  
Sbjct  188   SEA---SQAIRHSKYLKAAQELLDEVVSVWKSIKQKAQKDQAEAGKSDNKEAD---GGSK  241

Query  744   ggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVAS  923
             G    ++  ES+A   AA EL+ A++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ++V+S
Sbjct  242   GEGVSSNPQESTA--NAAPELSAAEKQELQNKMAKLMAMLDEVDRKYKHYYHQMQIVVSS  299

Query  924   FEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLK  1088
             F+  AG G+A+ YT +AL TISK FRCLK AI  QI    K LGEEE   G     +RL+
Sbjct  300   FDMVAGSGAAKPYTAVALQTISKHFRCLKDAINDQINVIRKKLGEEESSSGKEGKLTRLR  359

Query  1089  FIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAK  1268
             +ID  L QQRA Q  G++Q NAWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+
Sbjct  360   YIDQQLRQQRAFQQYGLLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLAR  419

Query  1269  QTGLTRSQVSNWFINARV  1322
             QTGLTRSQ+SNWFINARV
Sbjct  420   QTGLTRSQISNWFINARV  437



>ref|XP_010917672.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X2 [Elaeis 
guineensis]
Length=687

 Score =   278 bits (711),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 182/249 (73%), Gaps = 7/249 (3%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             +  SKYLKAAQELL EVVNV K+LK  A    +    A                 P++  
Sbjct  239   VPNSKYLKAAQELLVEVVNVRKALKHKADNGQSVHSSAGTTGCKDTDGASKSEGMPSNPQ  298

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES+A   +++EL+ ++RQDLQ K  KLL+M+DEV+ RY+QY+HQMQ++V+SF+  AG G+
Sbjct  299   ESTA--NSSSELSPSERQDLQNKVTKLLAMLDEVDSRYKQYYHQMQIVVSSFDIIAGFGA  356

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE-----GVRGSRLKFIDHHLPQQ  1115
             A+ YT LAL TIS+ FRCL+ AI  QI+AT KSLGE++     G   +RL++ID  L QQ
Sbjct  357   AKPYTALALQTISQHFRCLRDAIGGQIRATRKSLGEQDSSISQGGGIARLRYIDQQLRQQ  416

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA+Q  GMMQ ++WRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQV
Sbjct  417   RAMQQFGMMQQHSWRPQRGLPESSVSILRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQV  476

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  477   SNWFINARV  485



>ref|XP_003523566.1| PREDICTED: BEL1-like homeodomain protein 10-like isoform X1 [Glycine 
max]
 ref|XP_006577981.1| PREDICTED: BEL1-like homeodomain protein 10-like isoform X2 [Glycine 
max]
 ref|XP_006577982.1| PREDICTED: BEL1-like homeodomain protein 10-like isoform X3 [Glycine 
max]
 gb|KHN45880.1| BEL1-like homeodomain protein 3 [Glycine soja]
Length=646

 Score =   277 bits (708),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 182/249 (73%), Gaps = 3/249 (1%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             G S  I  S+YLKAAQELLDE+V+V+K+LK    E+  N     +               
Sbjct  190   GYSNSILNSQYLKAAQELLDEIVSVQKALKQSGMEKQENNRDIGLDGSKDADGKSTSQSM  249

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
               S   + +   A+++L++A+RQ L  KK KLLSM+DEV++RYRQY HQMQ++V+SF+  
Sbjct  250   QMSSAPNGSSANASSDLSSAERQTLLDKKTKLLSMLDEVDKRYRQYCHQMQIVVSSFDMV  309

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGSRLKFIDHHLPQQ  1115
             AG G+A  YT LAL TIS+ FRCL+ AI+ QI+ T +SLGE+EG+   RL+++D  L QQ
Sbjct  310   AGCGAAEPYTTLALRTISRHFRCLRDAISGQIQVTQRSLGEQEGI--PRLRYVDQQLRQQ  367

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             +ALQ LG+M+  AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+KIMLA+QTGLTR+QV
Sbjct  368   KALQQLGVMR-QAWRPQRGLPESSVSILRAWLFEHFLHPYPKDSEKIMLARQTGLTRNQV  426

Query  1296  SNWFINARV  1322
             +NWFINARV
Sbjct  427   ANWFINARV  435



>ref|XP_009418396.1| PREDICTED: BEL1-like homeodomain protein 7 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418397.1| PREDICTED: BEL1-like homeodomain protein 7 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418398.1| PREDICTED: BEL1-like homeodomain protein 7 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418399.1| PREDICTED: BEL1-like homeodomain protein 7 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009418401.1| PREDICTED: BEL1-like homeodomain protein 7 [Musa acuminata subsp. 
malaccensis]
Length=668

 Score =   278 bits (710),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 142/244 (58%), Positives = 180/244 (74%), Gaps = 6/244 (2%)
 Frame = +3

Query  603   KYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSA  782
             KYL+AAQELLDEV+NV K+L+  A +       A          G  G     +  ++SA
Sbjct  224   KYLRAAQELLDEVINVRKALRQKAEKNQCLYTSAGSMTCKDATGGSNGEGMTPNPQDASA  283

Query  783   QKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSY  962
                +++EL+ ++RQDLQ K + LL M+DEV++RY+QYH+QMQ+IV+ F+  AG G+A+ Y
Sbjct  284   --NSSSELSPSERQDLQNKVSNLLGMLDEVDRRYKQYHNQMQIIVSCFDAIAGCGAAKPY  341

Query  963   THLALNTISKQFRCLKVAIASQIKATSKSLGEEEG----VRGSRLKFIDHHLPQQRALQH  1130
             T LAL TIS+ FRCL+ AI+ QI+AT KSLGE +     V  SRL++ID  L QQRA+Q 
Sbjct  342   TALALQTISRHFRCLRDAISGQIRATRKSLGEPDSSSKSVGLSRLRYIDQQLRQQRAMQQ  401

Query  1131  LGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFI  1310
              GMMQ +AWRPQRGLPE +VSVLRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQVSNWFI
Sbjct  402   FGMMQQHAWRPQRGLPESSVSVLRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQVSNWFI  461

Query  1311  NARV  1322
             NARV
Sbjct  462   NARV  465



>ref|XP_010516766.1| PREDICTED: BEL1-like homeodomain protein 7 [Camelina sativa]
Length=484

 Score =   272 bits (696),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 183/269 (68%), Gaps = 29/269 (11%)
 Frame = +3

Query  534   AHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmk  713
             + +N+ A ++ +  G++  I  SKYLKAAQ+LLDE VNV+K+LK                
Sbjct  98    SKNNNNAYATRVVPGLTRTIHNSKYLKAAQQLLDEAVNVKKALK----------------  141

Query  714   keSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQY  893
                  P             +    +T  AE+  A+RQ+LQ K +KLLS++DEV+++Y+QY
Sbjct  142   --QFQP-----EGDKIGEEKEKILQTNIAEIPQAERQELQSKLSKLLSILDEVDRKYKQY  194

Query  894   HHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEE----  1061
             +HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI+ QI    KSLG E    
Sbjct  195   YHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAISGQILVVRKSLGGEHDGS  254

Query  1062  --EGVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPY  1235
                GV  SRL+ +D  + QQRALQ LG+MQP+ WRPQRGLP+ +V VLRAWLFEHFLHPY
Sbjct  255   EGRGVGISRLRNVDQQVRQQRALQRLGVMQPHTWRPQRGLPDSSVLVLRAWLFEHFLHPY  314

Query  1236  PKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PKDSDKIMLA+QTGL+RSQVSNWFINARV
Sbjct  315   PKDSDKIMLARQTGLSRSQVSNWFINARV  343



>ref|XP_004500978.1| PREDICTED: BEL1-like homeodomain protein 10-like [Cicer arietinum]
Length=587

 Score =   275 bits (704),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 175/249 (70%), Gaps = 3/249 (1%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             G S     S+YLKA QELLDE+VNV K+LK    E+        +               
Sbjct  157   GFSNIFLNSQYLKATQELLDEIVNVRKALKQHGMEKQEKTSDIGLDNSKDADGKETSHSM  216

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
               S G +     +  EL+ A+RQ+L  KK KLLSM+DEV++RYRQY H MQ +V+S +  
Sbjct  217   QMSSGPNGDNSNSCCELSPAERQNLLDKKTKLLSMLDEVDKRYRQYCHHMQTVVSSLDMV  276

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGSRLKFIDHHLPQQ  1115
             AG G+A  YT LAL TIS+ FRCL+ AI+SQI+   ++LGE+EG+   RL+++D HL QQ
Sbjct  277   AGCGAAEPYTSLALRTISRHFRCLRDAISSQIQVIQRNLGEQEGI--PRLRYVDQHLRQQ  334

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             +ALQHLG+M+  AWRPQRGLPE +VS+LRAWLFEHFL+PYPKDS+KIMLA+QTGLTR+QV
Sbjct  335   KALQHLGVMRQ-AWRPQRGLPENSVSILRAWLFEHFLNPYPKDSEKIMLARQTGLTRNQV  393

Query  1296  SNWFINARV  1322
             +NWFINARV
Sbjct  394   ANWFINARV  402



>ref|XP_006297524.1| hypothetical protein CARUB_v10013548mg [Capsella rubella]
 gb|EOA30422.1| hypothetical protein CARUB_v10013548mg [Capsella rubella]
Length=489

 Score =   272 bits (696),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 145/279 (52%), Positives = 184/279 (66%), Gaps = 32/279 (11%)
 Frame = +3

Query  513   LSARPGAAHDNSGASSSSITHGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaee  683
             LS++   +  N+    ++ TH +SGF   I  SKYLKAAQELLDE VNV+K+LK      
Sbjct  93    LSSQIETSRSNNNNEYANATHVVSGFTRTIHNSKYLKAAQELLDEAVNVKKALK------  146

Query  684   aankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMV  863
                            P             +    +T  AE+  A+RQ+LQ K +KLLS++
Sbjct  147   ------------QFQP-----EGDKIGEEKEKFLQTNVAEIPQAERQELQSKLSKLLSIL  189

Query  864   DEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATS  1043
             DEV++ Y+QY+HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI+ QI    
Sbjct  190   DEVDRTYKQYYHQMQIVVSSFDVIAGCGAAKPYTSLALQTISRHFRCLRDAISGQILVIR  249

Query  1044  KSLGEE------EGVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRA  1205
             KSLG E       GV  SRL+ +D  + QQR LQ LG+MQP+ WRPQRGLP+ +V VLRA
Sbjct  250   KSLGGEHDGSDGRGVGISRLRNVDQQVRQQRTLQRLGVMQPHTWRPQRGLPDSSVLVLRA  309

Query  1206  WLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             WLFEHFLHPYPKDSDKIMLA+QTGL+R QVSNWFINARV
Sbjct  310   WLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARV  348



>ref|XP_003527678.1| PREDICTED: BEL1-like homeodomain protein 3-like isoform X1 [Glycine 
max]
 ref|XP_006581186.1| PREDICTED: BEL1-like homeodomain protein 3-like isoform X2 [Glycine 
max]
Length=637

 Score =   276 bits (707),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 142/260 (55%), Positives = 189/260 (73%), Gaps = 28/260 (11%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLK-----------LDaaeeaankekakmkkeS  722
             G S  I  S+YLKAAQ+LLDE+V+V K+LK           LD ++++  K  ++  + S
Sbjct  190   GYSNSILNSQYLKAAQDLLDEIVSVRKALKQSGMEKQENTGLDGSKDSDGKSTSQSMQMS  249

Query  723   MPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQ  902
               P              + +   A++EL++A+RQ+L  KK KLLSM+DEV++RYRQY HQ
Sbjct  250   SGP--------------NGSTANASSELSSAERQNLLDKKTKLLSMLDEVDKRYRQYCHQ  295

Query  903   MQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGSR  1082
             MQ++V+SF+  AG G+A  YT LAL TIS+ FRCL+ AI+ QI+ T +SLGE+EG+   R
Sbjct  296   MQIVVSSFDMVAGCGAAEPYTTLALRTISRHFRCLRDAISGQIQVTQRSLGEQEGI--PR  353

Query  1083  LKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIML  1262
             L+++D  L QQ+ALQ LG+M+  AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+KIML
Sbjct  354   LRYVDQQLRQQKALQQLGVMRQ-AWRPQRGLPESSVSILRAWLFEHFLHPYPKDSEKIML  412

Query  1263  AKQTGLTRSQVSNWFINARV  1322
             A+QTGLTR+QV+NWFINARV
Sbjct  413   ARQTGLTRNQVANWFINARV  432



>ref|XP_010917671.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X1 [Elaeis 
guineensis]
Length=713

 Score =   278 bits (710),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 182/249 (73%), Gaps = 7/249 (3%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             +  SKYLKAAQELL EVVNV K+LK  A    +    A                 P++  
Sbjct  265   VPNSKYLKAAQELLVEVVNVRKALKHKADNGQSVHSSAGTTGCKDTDGASKSEGMPSNPQ  324

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES+A   +++EL+ ++RQDLQ K  KLL+M+DEV+ RY+QY+HQMQ++V+SF+  AG G+
Sbjct  325   ESTA--NSSSELSPSERQDLQNKVTKLLAMLDEVDSRYKQYYHQMQIVVSSFDIIAGFGA  382

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE-----GVRGSRLKFIDHHLPQQ  1115
             A+ YT LAL TIS+ FRCL+ AI  QI+AT KSLGE++     G   +RL++ID  L QQ
Sbjct  383   AKPYTALALQTISQHFRCLRDAIGGQIRATRKSLGEQDSSISQGGGIARLRYIDQQLRQQ  442

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA+Q  GMMQ ++WRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQV
Sbjct  443   RAMQQFGMMQQHSWRPQRGLPESSVSILRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQV  502

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  503   SNWFINARV  511



>emb|CAD89693.1| BEL1-like homeodomain protein HB2 [Oryza sativa Japonica Group]
Length=579

 Score =   274 bits (701),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 184/249 (74%), Gaps = 10/249 (4%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  SKYLKAAQELLDEVV+V KS+K  A ++ A   K+  K+      G  G    ++  
Sbjct  194   IRNSKYLKAAQELLDEVVSVWKSIKQKAQKDQAEAGKSDNKEAE---GGSKGEGVSSNPQ  250

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES+A   AA E++ A++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ++V+SF+  AG G+
Sbjct  251   ESTA--NAAPEISAAEKQELQNKMAKLMAMLDEVDRKYKHYYHQMQIVVSSFDMVAGSGA  308

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQ  1115
             A+ YT +AL TISK FRCLK A+  QI    K LGEEE   G     +RL++ID  L QQ
Sbjct  309   AKPYTAVALQTISKHFRCLKDAVNDQINVIRKKLGEEESSSGKEGKLTRLRYIDQQLRQQ  368

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA Q  G++Q NAWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQ+
Sbjct  369   RAFQQYGLLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQI  428

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  429   SNWFINARV  437



>ref|XP_010093716.1| BEL1-like homeodomain protein 1 [Morus notabilis]
 gb|EXC39356.1| BEL1-like homeodomain protein 1 [Morus notabilis]
Length=422

 Score =   270 bits (689),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 143/159 (90%), Gaps = 4/159 (3%)
 Frame = +3

Query  858   MVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKA  1037
             ++ +VEQRYRQYHHQMQV++++FE+AAG GSA+SYT LAL TISKQFRCLK AI+SQIKA
Sbjct  27    VIIKVEQRYRQYHHQMQVVISTFEEAAGFGSAKSYTALALKTISKQFRCLKDAISSQIKA  86

Query  1038  TSKSLGEEEG----VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRA  1205
              SKSLGEEE     + GSRL+++DHHL QQRALQ LGM+Q NAWRPQRGLPERAVSVLRA
Sbjct  87    ASKSLGEEECLGVKIEGSRLRYVDHHLRQQRALQQLGMIQHNAWRPQRGLPERAVSVLRA  146

Query  1206  WLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             WLFEHFLHPYPK +DK++LAKQTGLTRSQVSNWFINARV
Sbjct  147   WLFEHFLHPYPKTADKVILAKQTGLTRSQVSNWFINARV  185



>gb|AAS18416.1| benzothiadiazole-induced homeodomain protein 1 [Oryza sativa 
Indica Group]
Length=642

 Score =   275 bits (704),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 184/249 (74%), Gaps = 10/249 (4%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  SKYLKAAQELLDEVV+V KS+K  A ++ A   K+  K+      G  G    ++  
Sbjct  194   IRNSKYLKAAQELLDEVVSVWKSIKQKAQKDQAEAGKSDNKEAE---GGSKGEGVSSNPQ  250

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES+A   AA E++ A++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ++V+SF+  AG G+
Sbjct  251   ESTA--NAAPEISAAEKQELQNKMAKLMAMLDEVDRKYKHYYHQMQIVVSSFDMVAGSGA  308

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQ  1115
             A+ YT +AL TISK FRCLK AI  QI    K LGEEE   G     +RL++ID  L QQ
Sbjct  309   AKPYTAVALQTISKHFRCLKDAINDQINVIRKKLGEEESSSGKEGKLTRLRYIDQQLRQQ  368

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA Q  G++Q NAWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQ+
Sbjct  369   RAFQQYGLLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQI  428

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  429   SNWFINARV  437



>ref|XP_002886224.1| hypothetical protein ARALYDRAFT_480804 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62483.1| hypothetical protein ARALYDRAFT_480804 [Arabidopsis lyrata subsp. 
lyrata]
Length=480

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 147/285 (52%), Positives = 188/285 (66%), Gaps = 29/285 (10%)
 Frame = +3

Query  486   LPMESPVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLK  665
              P+   +GL S    +   N+   ++ +  G +  I  SKYLKAAQELLDE VNV+K+LK
Sbjct  80    FPVMMRLGLSSQIETSRGTNNNEYATQVVSGFTRTIHNSKYLKAAQELLDEAVNVKKALK  139

Query  666   LDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKA  845
                                  P     GD      E + Q T  AE+  A+RQ+LQ K +
Sbjct  140   ------------------QFQP----QGDKIDEVKEKNLQ-TNIAEIPQAERQELQSKLS  176

Query  846   KLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIAS  1025
             KLLS++DEV++ Y+QY+HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI+ 
Sbjct  177   KLLSILDEVDRNYKQYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAISG  236

Query  1026  QIKATSKSLGEEE------GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERA  1187
             QI    K+LG E+      GV  SRL+ +D  + QQRALQ LG+MQP+ WRPQRGLP+ +
Sbjct  237   QILVIRKTLGGEQDGSDGRGVGISRLRNVDQQVRQQRALQRLGVMQPHTWRPQRGLPDSS  296

Query  1188  VSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             V VLRAWLFEHFLHPYPKDSDKIMLA+QTGL+R QVSNWFINARV
Sbjct  297   VLVLRAWLFEHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARV  341



>gb|AAK00972.1|AC079736_12 putative homeodomain protein [Oryza sativa Japonica Group]
 gb|ABF98212.1| Associated with HOX family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG91718.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADB84631.1| homeodomain protein [Oryza sativa Japonica Group]
Length=642

 Score =   275 bits (703),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 144/249 (58%), Positives = 184/249 (74%), Gaps = 10/249 (4%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  SKYLKAAQELLDEVV+V KS+K  A ++ A   K+  K+      G  G    ++  
Sbjct  194   IRNSKYLKAAQELLDEVVSVWKSIKQKAQKDQAEAGKSDNKEAE---GGSKGEGVSSNPQ  250

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES+A   AA E++ A++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ++V+SF+  AG G+
Sbjct  251   ESTA--NAAPEISAAEKQELQNKMAKLMAMLDEVDRKYKHYYHQMQIVVSSFDMVAGSGA  308

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQ  1115
             A+ YT +AL TISK FRCLK AI  QI    K LGEEE   G     +RL++ID  L QQ
Sbjct  309   AKPYTAVALQTISKHFRCLKDAINDQINVIRKKLGEEESSSGKEGKLTRLRYIDQQLRQQ  368

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA Q  G++Q NAWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQ+
Sbjct  369   RAFQQYGLLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQI  428

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  429   SNWFINARV  437



>ref|XP_007136630.1| hypothetical protein PHAVU_009G060400g [Phaseolus vulgaris]
 ref|XP_007136631.1| hypothetical protein PHAVU_009G060400g [Phaseolus vulgaris]
 gb|ESW08624.1| hypothetical protein PHAVU_009G060400g [Phaseolus vulgaris]
 gb|ESW08625.1| hypothetical protein PHAVU_009G060400g [Phaseolus vulgaris]
Length=518

 Score =   271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/251 (57%), Positives = 182/251 (73%), Gaps = 18/251 (7%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             G S  I  S+YL+AAQELLDE+V+V K+LK             +   E        G D 
Sbjct  88    GYSNSILNSQYLRAAQELLDEIVSVRKALK-------------QPGMEKQENHRDIGLDG  134

Query  756   ptsggESSAQKTAA--AELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFE  929
               +  E S Q ++A   EL++A+RQ+L  KK KLLSM+DEV++RYRQY HQMQ++V+SF+
Sbjct  135   SKNSYEKSTQMSSAPNGELSSAERQNLLDKKTKLLSMLDEVDKRYRQYCHQMQIVVSSFD  194

Query  930   QAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGSRLKFIDHHLP  1109
               AG G+   YT LAL TIS+ FRCL+ AI+ QI+ T +SLGE+EG+   RL+++D  L 
Sbjct  195   MVAGFGAVEPYTALALRTISRHFRCLRDAISVQIQVTQRSLGEQEGI--PRLRYVDQQLR  252

Query  1110  QQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRS  1289
             QQ+ALQ LG+M+  AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+KIMLA+QTGLTR+
Sbjct  253   QQKALQQLGVMR-QAWRPQRGLPESSVSILRAWLFEHFLHPYPKDSEKIMLARQTGLTRN  311

Query  1290  QVSNWFINARV  1322
             QV+NWFINARV
Sbjct  312   QVANWFINARV  322



>ref|XP_006409439.1| hypothetical protein EUTSA_v10022660mg [Eutrema salsugineum]
 gb|ESQ50892.1| hypothetical protein EUTSA_v10022660mg [Eutrema salsugineum]
Length=492

 Score =   271 bits (692),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 139/276 (50%), Positives = 182/276 (66%), Gaps = 27/276 (10%)
 Frame = +3

Query  513   LSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaan  692
             LS++      N+   ++ +  G +  I  SKYLKAAQ+LLDE VNV+K+LK         
Sbjct  102   LSSQIETTRGNNNEYATQVVSGFTRTIHNSKYLKAAQQLLDEAVNVKKALK---------  152

Query  693   kekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEV  872
                          F   G        ++  +     ++   +RQ+LQ K +KLLS++DEV
Sbjct  153   ------------QFQPEGDKIDEEKEKTLQESCTNPDIPQGERQELQSKLSKLLSILDEV  200

Query  873   EQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSL  1052
             +++Y+QY+HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI+ QI    KSL
Sbjct  201   DRKYKQYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAISGQILVIRKSL  260

Query  1053  GEE------EGVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLF  1214
             G E      +GV  SRL+ +D  + QQRALQ LGMMQP+ WRPQRGLP+ +V +LRAWLF
Sbjct  261   GGEHDGLDGKGVGISRLRNVDQQVRQQRALQRLGMMQPHTWRPQRGLPDSSVLILRAWLF  320

Query  1215  EHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             EHFLHPYPKDSDKIMLA+QTGLTR QVSNWFINARV
Sbjct  321   EHFLHPYPKDSDKIMLARQTGLTRGQVSNWFINARV  356



>emb|CDX89711.1| BnaC03g46250D [Brassica napus]
Length=455

 Score =   270 bits (689),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 142/264 (54%), Positives = 181/264 (69%), Gaps = 28/264 (11%)
 Frame = +3

Query  549   GASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMP  728
             G SS   T  +SGF   SKYL+AAQELLDE VNV+K+LK                     
Sbjct  98    GISSQIETQVVSGF-HNSKYLEAAQELLDEAVNVKKALK---------------------  135

Query  729   PFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQ  908
              F   G        ++  +     +L  A+RQ+LQ K +KLLS++DEV++RY+QY+HQMQ
Sbjct  136   QFQPEGDKTEEDKEKNLQESITNPDLPQAERQELQNKLSKLLSILDEVDRRYKQYYHQMQ  195

Query  909   VIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLG-EEEGVRG---  1076
             ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI+ QI    +SLG E +G+ G   
Sbjct  196   IVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAISGQILVIRRSLGGEHDGLDGRGV  255

Query  1077  --SRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
               SRL+ +D  + QQRALQ LG+MQP+AWRPQRGLP+ +V +LRAWLFEHFLHPYPKDSD
Sbjct  256   GISRLRNVDQKVRQQRALQRLGVMQPHAWRPQRGLPDSSVLILRAWLFEHFLHPYPKDSD  315

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             KIMLA+QTGL+R QVSNWFINARV
Sbjct  316   KIMLARQTGLSRGQVSNWFINARV  339



>ref|XP_010467364.1| PREDICTED: BEL1-like homeodomain protein 7 [Camelina sativa]
 ref|XP_010467365.1| PREDICTED: BEL1-like homeodomain protein 7 [Camelina sativa]
 ref|XP_010467366.1| PREDICTED: BEL1-like homeodomain protein 7 [Camelina sativa]
Length=484

 Score =   270 bits (691),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/269 (52%), Positives = 182/269 (68%), Gaps = 29/269 (11%)
 Frame = +3

Query  534   AHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmk  713
             +++N+   ++ +  G +  I  SKYLKAAQ+LLDE VNV+K+LK                
Sbjct  98    SNNNNNEYATQVASGFTRTIHNSKYLKAAQQLLDEAVNVKKALK----------------  141

Query  714   keSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQY  893
                  P          S  +    +T  AE+  A+RQ+LQ K +KLLS++DEV+++Y+QY
Sbjct  142   --QFQP-----EGDKISEEKEKILQTNIAEIPQAERQELQSKLSKLLSILDEVDRKYKQY  194

Query  894   HHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEE----  1061
             +HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI+ QI    KSLG E    
Sbjct  195   YHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAISGQILVIRKSLGGEHDGS  254

Query  1062  --EGVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPY  1235
                GV  SRL+ +D  + QQRALQ LG+MQP+ WRPQRGLP+ +V VLRAWLFEHFLHPY
Sbjct  255   DGRGVGISRLRNVDQQVRQQRALQRLGVMQPHTWRPQRGLPDSSVLVLRAWLFEHFLHPY  314

Query  1236  PKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PKDSDKIMLA+QTGL+R QVSNWFINARV
Sbjct  315   PKDSDKIMLARQTGLSRGQVSNWFINARV  343



>dbj|BAJ96483.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=636

 Score =   274 bits (701),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 179/249 (72%), Gaps = 10/249 (4%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  SKYLKAAQELLDE+V+V KS+K +A ++     K   K               ++  
Sbjct  191   IRNSKYLKAAQELLDEIVSVWKSIKQNAQKDKVEAGKMDGKDADE---VLKSEGVSSNPQ  247

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES+A   A AE++ A++Q+LQ K AKLL+M+DEV+++Y+ Y HQMQ++V+SF+  AG G+
Sbjct  248   ESAA--NAEAEISAAEKQELQNKMAKLLAMLDEVDRKYKHYFHQMQIVVSSFDMIAGSGA  305

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQ  1115
             A+ YT +AL TIS+ FRCLK AI  Q+    K LGEE+   G     +RL+FID  L QQ
Sbjct  306   AKPYTAVALQTISRHFRCLKDAINDQVNVIRKKLGEEDNSSGREGKLTRLRFIDQQLRQQ  365

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA Q  GM+Q NAWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQ+
Sbjct  366   RAFQQYGMLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQI  425

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  426   SNWFINARV  434



>ref|XP_006664239.1| PREDICTED: BEL1-like homeodomain protein 6-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006664240.1| PREDICTED: BEL1-like homeodomain protein 6-like isoform X2 [Oryza 
brachyantha]
Length=648

 Score =   275 bits (702),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 182/249 (73%), Gaps = 10/249 (4%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  S+YLKAAQELLDEVV+V KS+K  A +E A   KA  K+    P    G    ++  
Sbjct  200   IRNSRYLKAAQELLDEVVSVWKSIKEKAQKEKAESGKADGKETDGGP---KGEGVSSNPQ  256

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES A   AA EL+TA++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ +V+SF+  AG GS
Sbjct  257   ESGA--NAAPELSTAEKQELQNKMAKLMAMLDEVDRKYKHYYHQMQTVVSSFDMVAGPGS  314

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQ  1115
             A+ YT +AL TIS+ FRCLK AI  QI    K LGEEE   G     +RL++ID  L QQ
Sbjct  315   AKPYTAVALQTISRHFRCLKDAINDQINVIRKKLGEEENSSGKEGKLTRLRYIDQQLRQQ  374

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA Q  GM+  NAWRPQRGLPE +V++LRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQ+
Sbjct  375   RAFQQYGMIPQNAWRPQRGLPENSVTILRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQI  434

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  435   SNWFINARV  443



>ref|XP_010489213.1| PREDICTED: BEL1-like homeodomain protein 7 [Camelina sativa]
Length=479

 Score =   270 bits (689),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 141/276 (51%), Positives = 186/276 (67%), Gaps = 29/276 (11%)
 Frame = +3

Query  513   LSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaan  692
             +S++   +++N+   ++    G +  I  SKYLKAAQ+LLDE VNV+K+LK         
Sbjct  89    ISSQTTRSNNNNNEYATQAVSGFTRTIHNSKYLKAAQQLLDEAVNVKKALK---------  139

Query  693   kekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEV  872
                         P          S  +    +T  AE+  A+RQ+LQ K +KLLS++DEV
Sbjct  140   ---------QFQP-----EGDKVSEEKEKILQTNVAEIPQAERQELQSKLSKLLSILDEV  185

Query  873   EQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSL  1052
             +++Y+QY+HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI+ QI    KSL
Sbjct  186   DRKYKQYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAISGQILVIRKSL  245

Query  1053  G-EEEGVRG-----SRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLF  1214
             G E +G  G     SRL+ +D  + QQRALQ LG+MQP+ WRPQRGLP+ +V VLRAWLF
Sbjct  246   GGEHDGTDGRGVGISRLRNVDQQVRQQRALQRLGVMQPHTWRPQRGLPDSSVLVLRAWLF  305

Query  1215  EHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             EHFLHPYPKDSDKIMLA+QTGL+R QVSNWFINARV
Sbjct  306   EHFLHPYPKDSDKIMLARQTGLSRGQVSNWFINARV  341



>gb|EAY84030.1| hypothetical protein OsI_39262 [Oryza sativa Indica Group]
Length=647

 Score =   274 bits (701),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 149/274 (54%), Positives = 188/274 (69%), Gaps = 13/274 (5%)
 Frame = +3

Query  525   PGAAHDN---SGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaank  695
             P + HDN         ++    S  I  S+YLKAAQELLDEVV+V KS+K  A +E    
Sbjct  175   PQSYHDNLRGEDMRMKNLQSEASRAIRNSRYLKAAQELLDEVVSVWKSIKQKAQKEKVES  234

Query  696   ekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVE  875
              KA  K+    P         ++  ES A   AA EL+TA++Q+LQ K AKL++M+DEV+
Sbjct  235   GKADGKETDGGP---KSEGVSSNPQESGA--NAAPELSTAEKQELQNKMAKLMAMLDEVD  289

Query  876   QRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLG  1055
             ++Y+ Y+HQMQ +V+SF+  AG GSA+ YT +AL TIS+ FRCLK AI  QI    K LG
Sbjct  290   RKYKHYYHQMQTVVSSFDVVAGPGSAKPYTAVALQTISRHFRCLKDAINDQINVIRKKLG  349

Query  1056  EEEGVRG-----SRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEH  1220
             EEE   G     +RL++ID  L QQRA Q  GM+  NAWRPQRGLPE +V++LRAWLFEH
Sbjct  350   EEENSSGKEGKLTRLRYIDQQLRQQRAFQQYGMIPQNAWRPQRGLPENSVTILRAWLFEH  409

Query  1221  FLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             FLHPYPKDS+K+MLA+QTGLTRSQ+SNWFINARV
Sbjct  410   FLHPYPKDSEKLMLARQTGLTRSQISNWFINARV  443



>ref|NP_001067363.1| Os12g0636200 [Oryza sativa Japonica Group]
 gb|ABA99971.1| Associated with HOX family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30382.1| Os12g0636200 [Oryza sativa Japonica Group]
 gb|EAZ21338.1| hypothetical protein OsJ_36996 [Oryza sativa Japonica Group]
 dbj|BAG91970.1| unnamed protein product [Oryza sativa Japonica Group]
Length=647

 Score =   274 bits (701),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 149/274 (54%), Positives = 188/274 (69%), Gaps = 13/274 (5%)
 Frame = +3

Query  525   PGAAHDN---SGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaank  695
             P + HDN         ++    S  I  S+YLKAAQELLDEVV+V KS+K  A +E    
Sbjct  175   PQSYHDNLRGEDMRMKNLQSEASRAIRNSRYLKAAQELLDEVVSVWKSIKQKAQKEKVES  234

Query  696   ekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVE  875
              KA  K+    P         ++  ES A   AA EL+TA++Q+LQ K AKL++M+DEV+
Sbjct  235   GKADGKETDGGP---KSEGVSSNPQESGA--NAAPELSTAEKQELQNKMAKLMAMLDEVD  289

Query  876   QRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLG  1055
             ++Y+ Y+HQMQ +V+SF+  AG GSA+ YT +AL TIS+ FRCLK AI  QI    K LG
Sbjct  290   RKYKHYYHQMQTVVSSFDVVAGPGSAKPYTAVALQTISRHFRCLKDAINDQINVIRKKLG  349

Query  1056  EEEGVRG-----SRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEH  1220
             EEE   G     +RL++ID  L QQRA Q  GM+  NAWRPQRGLPE +V++LRAWLFEH
Sbjct  350   EEENSSGKEGKLTRLRYIDQQLRQQRAFQQYGMIPQNAWRPQRGLPENSVTILRAWLFEH  409

Query  1221  FLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             FLHPYPKDS+K+MLA+QTGLTRSQ+SNWFINARV
Sbjct  410   FLHPYPKDSEKLMLARQTGLTRSQISNWFINARV  443



>gb|EEC75936.1| hypothetical protein OsI_13031 [Oryza sativa Indica Group]
Length=675

 Score =   275 bits (702),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 165/318 (52%), Positives = 212/318 (67%), Gaps = 21/318 (7%)
 Frame = +3

Query  396   LGFHRSVVVSPTAQQGlslslsPQ----QHPFRSLPMESPVGLLSARPGAAHDNSGASSS  563
             L  H S+ V+P   QGLSLSL+       +P+ S   E    LL+       DN   +  
Sbjct  132   LNNHNSMSVAPAPGQGLSLSLNTHILAPSYPYWSAKTE----LLTPHSYHGDDNRMKNMQ  187

Query  564   SITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggc  743
             S     S  I  SKYLKAAQELLDEVV+V KS+K  A ++ A   K+  K+      G  
Sbjct  188   SEA---SQAIRNSKYLKAAQELLDEVVSVWKSIKQKAQKDQAEAGKSDNKEAE---GGSK  241

Query  744   ggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVAS  923
             G    ++  ES+A   AA E++ A++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ++V+S
Sbjct  242   GEGVSSNPQESTA--NAAPEISAAEKQELQNKMAKLMAMLDEVDRKYKHYYHQMQIVVSS  299

Query  924   FEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLK  1088
             F+  AG G+A+ YT +AL TISK FRCLK AI  QI    K LGEEE   G     +RL+
Sbjct  300   FDMVAGSGAAKPYTAVALQTISKHFRCLKDAINDQINVIRKKLGEEESSSGKEGKLTRLR  359

Query  1089  FIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAK  1268
             +ID  L QQRA Q  G++Q NAWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+
Sbjct  360   YIDQQLRQQRAFQQYGLLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLAR  419

Query  1269  QTGLTRSQVSNWFINARV  1322
             QTGLTRSQ+SNWFINARV
Sbjct  420   QTGLTRSQISNWFINARV  437



>ref|NP_001050904.1| Os03g0680800 [Oryza sativa Japonica Group]
 gb|AAW34245.1| putative homeodomain protein [Oryza sativa Japonica Group]
 gb|ABF98213.1| Associated with HOX family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12818.1| Os03g0680800 [Oryza sativa Japonica Group]
 dbj|BAG90673.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59695.1| hypothetical protein OsJ_12119 [Oryza sativa Japonica Group]
Length=675

 Score =   275 bits (702),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 165/318 (52%), Positives = 212/318 (67%), Gaps = 21/318 (7%)
 Frame = +3

Query  396   LGFHRSVVVSPTAQQGlslslsPQ----QHPFRSLPMESPVGLLSARPGAAHDNSGASSS  563
             L  H S+ V+P   QGLSLSL+       +P+ S   E    LL+       DN   +  
Sbjct  132   LNNHNSMSVAPAPGQGLSLSLNTHILAPSYPYWSAKTE----LLTPHSYHGDDNRMKNMQ  187

Query  564   SITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggc  743
             S     S  I  SKYLKAAQELLDEVV+V KS+K  A ++ A   K+  K+      G  
Sbjct  188   SEA---SQAIRNSKYLKAAQELLDEVVSVWKSIKQKAQKDQAEAGKSDNKEAE---GGSK  241

Query  744   ggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVAS  923
             G    ++  ES+A   AA E++ A++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ++V+S
Sbjct  242   GEGVSSNPQESTA--NAAPEISAAEKQELQNKMAKLMAMLDEVDRKYKHYYHQMQIVVSS  299

Query  924   FEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLK  1088
             F+  AG G+A+ YT +AL TISK FRCLK AI  QI    K LGEEE   G     +RL+
Sbjct  300   FDMVAGSGAAKPYTAVALQTISKHFRCLKDAINDQINVIRKKLGEEESSSGKEGKLTRLR  359

Query  1089  FIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAK  1268
             +ID  L QQRA Q  G++Q NAWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+
Sbjct  360   YIDQQLRQQRAFQQYGLLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLAR  419

Query  1269  QTGLTRSQVSNWFINARV  1322
             QTGLTRSQ+SNWFINARV
Sbjct  420   QTGLTRSQISNWFINARV  437



>ref|XP_009137061.1| PREDICTED: BEL1-like homeodomain protein 7 [Brassica rapa]
Length=426

 Score =   268 bits (684),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 141/264 (53%), Positives = 181/264 (69%), Gaps = 28/264 (11%)
 Frame = +3

Query  549   GASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMP  728
             G SS   T  +SGF   SKYL+AAQELLDE VNV+K+LK                     
Sbjct  92    GISSQIETQVVSGF-HNSKYLEAAQELLDEAVNVKKALK---------------------  129

Query  729   PFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQ  908
              F   G        ++  +     +L  A+RQ+LQ K +KLLS++DEV++RY+QY+HQMQ
Sbjct  130   QFQPEGDKTEEDKEKNLQESITNPDLPQAERQELQNKLSKLLSILDEVDRRYKQYYHQMQ  189

Query  909   VIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLG-EEEGVRG---  1076
             ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI+ QI    +SLG E +G+ G   
Sbjct  190   IVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAISGQILVIRRSLGGEHDGLDGRGV  249

Query  1077  --SRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
               SRL+ +D  + QQRALQ LG++QP+AWRPQRGLP+ +V +LRAWLFEHFLHPYPKDSD
Sbjct  250   GISRLRNVDQKVRQQRALQRLGVVQPHAWRPQRGLPDSSVLILRAWLFEHFLHPYPKDSD  309

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             KIMLA+QTGL+R QVSNWFINARV
Sbjct  310   KIMLARQTGLSRGQVSNWFINARV  333



>dbj|BAK01775.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   274 bits (700),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 180/249 (72%), Gaps = 13/249 (5%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  S+YLKAAQE+LDEVVNV K++K  A +E A   KA  K+    P          +  
Sbjct  203   IRHSRYLKAAQEVLDEVVNVWKNIKRKAQKEQAEPGKADGKESDGGP------KSEGASQ  256

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES A   AA EL+TA++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ +VASF+  AG GS
Sbjct  257   ESGA--NAAPELSTAEKQELQNKMAKLMAMLDEVDRKYKHYYHQMQNVVASFDMVAGPGS  314

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQ  1115
             A+ YT +AL TIS+ FRCLK AI  QI    K LGEEE   G     +RL++ID  L QQ
Sbjct  315   AKPYTAVALQTISRHFRCLKDAINDQINVIRKKLGEEENSSGKEGKLTRLRYIDQQLRQQ  374

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA Q  GM+  NAWRPQRGLPE +V+VLRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQ+
Sbjct  375   RAFQQYGMIPQNAWRPQRGLPENSVTVLRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQI  434

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  435   SNWFINARV  443



>ref|XP_002464081.1| hypothetical protein SORBIDRAFT_01g011960 [Sorghum bicolor]
 gb|EER91079.1| hypothetical protein SORBIDRAFT_01g011960 [Sorghum bicolor]
Length=649

 Score =   273 bits (699),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 141/249 (57%), Positives = 181/249 (73%), Gaps = 10/249 (4%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  SKYLKAAQELLDE+V+V KS+K    +  A   KA  K+      G       +   
Sbjct  194   IRNSKYLKAAQELLDEIVSVWKSVKQKTDKGPAEAGKADGKETDG---GTKSDGVSSDPQ  250

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES A   AAAEL+TA++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ++++SF+  AG G+
Sbjct  251   ESGA--NAAAELSTAEKQELQNKMAKLMAMLDEVDRKYKHYYHQMQLVMSSFDMVAGSGA  308

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQ  1115
             A+ YT +AL TIS+ FRCLK AI  QI    K LGE++   G     +RL++ID  + QQ
Sbjct  309   AKPYTAVALQTISRHFRCLKDAINDQISVIRKKLGEDDTTSGKEGKLTRLRYIDQQIRQQ  368

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA Q  GM+Q NAWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+KIML++QTGLTRSQ+
Sbjct  369   RAFQQYGMLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKIMLSRQTGLTRSQI  428

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  429   SNWFINARV  437



>gb|EMS47188.1| BEL1-like homeodomain protein 6 [Triticum urartu]
Length=632

 Score =   273 bits (698),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/249 (57%), Positives = 180/249 (72%), Gaps = 10/249 (4%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  SKYLKAAQELLDE+V+V KS+K +A +E A   K   K               ++  
Sbjct  178   IRNSKYLKAAQELLDEIVSVWKSIKQNAQKEKAEAGKMDGKDADE---VLKSEGVSSNPQ  234

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES+A   A AE++ A++Q+LQ K AKLL+M+DEV+++Y+ Y HQMQ++V+SF+  AG G+
Sbjct  235   ESTA--NAEAEISAAEKQELQNKMAKLLAMLDEVDRKYKHYFHQMQIVVSSFDMIAGSGA  292

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQ  1115
             A+ YT +AL TIS+ FRCLK AI  Q+    K LGEE+   G     +RL++ID  L QQ
Sbjct  293   AKPYTAVALQTISRHFRCLKDAINDQVNVIRKKLGEEDSSSGREGKLTRLRYIDQQLRQQ  352

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA Q  GM+Q NAWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQ+
Sbjct  353   RAFQQYGMLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQI  412

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  413   SNWFINARV  421



>ref|XP_002443654.1| hypothetical protein SORBIDRAFT_08g022960 [Sorghum bicolor]
 gb|EES17492.1| hypothetical protein SORBIDRAFT_08g022960 [Sorghum bicolor]
Length=658

 Score =   273 bits (699),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 179/249 (72%), Gaps = 10/249 (4%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  S+YLKAAQELLDEVVNV K++K  A +E     K   K+    P         ++  
Sbjct  201   IRNSRYLKAAQELLDEVVNVWKNIKQKAQKEQVEAGKTDGKETEGGP---KSEGVSSNPQ  257

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES A   AA EL+TA++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ +V+SF+  AG G+
Sbjct  258   ESGA--NAAPELSTAEKQELQNKMAKLMAMLDEVDRKYKHYYHQMQSVVSSFDMVAGPGA  315

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQ  1115
             A+ YT +AL TIS+ FRCLK AI  QI    K LGEEE   G     +RL++ID  L QQ
Sbjct  316   AKPYTAVALQTISRHFRCLKDAINDQINVIRKKLGEEESSSGKEGKLTRLRYIDQQLRQQ  375

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA Q  GM+  NAWRPQRGLPE +V++LRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQ+
Sbjct  376   RAFQQYGMIPQNAWRPQRGLPENSVTILRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQI  435

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  436   SNWFINARV  444



>ref|XP_009136305.1| PREDICTED: BEL1-like homeodomain protein 7 [Brassica rapa]
 ref|XP_009136306.1| PREDICTED: BEL1-like homeodomain protein 7 [Brassica rapa]
Length=450

 Score =   268 bits (684),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 141/264 (53%), Positives = 181/264 (69%), Gaps = 28/264 (11%)
 Frame = +3

Query  549   GASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMP  728
             G SS   T  +SGF   SKYL+AAQELLDE VNV+K+LK                     
Sbjct  92    GISSQIETQVVSGF-HNSKYLEAAQELLDEAVNVKKALK---------------------  129

Query  729   PFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQ  908
              F   G        ++  +     +L  A+RQ+LQ K +KLLS++DEV++RY+QY+HQMQ
Sbjct  130   QFQPEGDKTEEDKEKNLQESITNPDLPQAERQELQNKLSKLLSILDEVDRRYKQYYHQMQ  189

Query  909   VIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLG-EEEGVRG---  1076
             ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI+ QI    +SLG E +G+ G   
Sbjct  190   IVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAISGQILVIRRSLGGEHDGLDGRGV  249

Query  1077  --SRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
               SRL+ +D  + QQRALQ LG++QP+AWRPQRGLP+ +V +LRAWLFEHFLHPYPKDSD
Sbjct  250   GISRLRNVDQKVRQQRALQRLGVVQPHAWRPQRGLPDSSVLILRAWLFEHFLHPYPKDSD  309

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             KIMLA+QTGL+R QVSNWFINARV
Sbjct  310   KIMLARQTGLSRGQVSNWFINARV  333



>ref|XP_006487350.1| PREDICTED: BEL1-like homeodomain protein 6-like isoform X2 [Citrus 
sinensis]
Length=665

 Score =   273 bits (699),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 193/271 (71%), Gaps = 10/271 (4%)
 Frame = +3

Query  528   GAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekak  707
             G   D  G  S      I+  I  SKYLKAAQ+LLDEVVNV K+L+    +    +   +
Sbjct  190   GGNQDGKGDLSPYGMPSIARAIPSSKYLKAAQQLLDEVVNVRKALR--QPDGEKIQSTHE  247

Query  708   mkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYR  887
              +  +     G   D  ++  ES +   +  EL+ A+RQ+LQ K  KLLSM+DEV++RY+
Sbjct  248   QQMNNSKDGDGGSKDVTSNTQESPS--NSPNELSHAERQELQNKLTKLLSMLDEVDRRYK  305

Query  888   QYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE-  1064
             QY+HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI  QI+AT KSLGE+E 
Sbjct  306   QYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAICGQIRATRKSLGEQEN  365

Query  1065  -----GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLH  1229
                  GV  +RL+++D  L QQRALQHLGMMQ +AWRPQRGLPE +VS+LRAWLFEHFLH
Sbjct  366   SENSKGVGITRLRYVDQQLRQQRALQHLGMMQQHAWRPQRGLPESSVSILRAWLFEHFLH  425

Query  1230  PYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PYPKD+DKIMLA+QTGLTRSQVSNWFINARV
Sbjct  426   PYPKDTDKIMLARQTGLTRSQVSNWFINARV  456



>ref|XP_004982177.1| PREDICTED: BEL1-like homeodomain protein 6-like isoform X1 [Setaria 
italica]
 ref|XP_004982178.1| PREDICTED: BEL1-like homeodomain protein 6-like isoform X2 [Setaria 
italica]
Length=650

 Score =   273 bits (697),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 182/249 (73%), Gaps = 10/249 (4%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  SKYLKAAQELLDE+V+V KS+K  A +  A   K   K+      G       ++  
Sbjct  195   IRNSKYLKAAQELLDEIVSVWKSVKQKADKGPAESGKTDGKETD---GGTKSEGVSSNPQ  251

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES A   AAAEL+TA++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ++++SF+  AG G+
Sbjct  252   ESGA--NAAAELSTAEKQELQNKMAKLMAMLDEVDRKYKHYYHQMQLVMSSFDMVAGSGA  309

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQ  1115
             A+ YT +AL TIS+ FRCLK AI  QI    K LGE++   G     +RL++ID  + QQ
Sbjct  310   AKPYTAVALQTISRHFRCLKDAINDQIAVIRKKLGEDDSTSGKEGKLTRLRYIDQQIRQQ  369

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA Q  GM+Q NAWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+ML++QTGLTRSQ+
Sbjct  370   RAFQQYGMLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLSRQTGLTRSQI  429

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  430   SNWFINARV  438



>ref|XP_003575568.1| PREDICTED: BEL1-like homeodomain protein 7 [Brachypodium distachyon]
 ref|XP_010236965.1| PREDICTED: BEL1-like homeodomain protein 7 [Brachypodium distachyon]
 ref|XP_010236966.1| PREDICTED: BEL1-like homeodomain protein 7 [Brachypodium distachyon]
Length=650

 Score =   272 bits (696),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 146/249 (59%), Positives = 182/249 (73%), Gaps = 10/249 (4%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  S+YLKAAQE+LDEVVNV K++K  A +E A  EKA  K+    P         ++  
Sbjct  202   IRHSRYLKAAQEVLDEVVNVWKNIKQKAQKEQAEPEKADGKETDGGP---KSEGVSSNPQ  258

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES A   AA EL+TA++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ +V+SF+  AG GS
Sbjct  259   ESGA--NAAPELSTAEKQELQNKMAKLMAMLDEVDRKYKHYYHQMQNVVSSFDVVAGPGS  316

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQ  1115
             A+ YT +AL TIS+ FRCLK AI  QI    K LGEEE   G     +RL++ID  L QQ
Sbjct  317   AKPYTAVALQTISRHFRCLKDAINEQINVIRKKLGEEENSSGKEGKLTRLRYIDQQLRQQ  376

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA Q  GM+  NAWRPQRGLPE +V+VLRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQ+
Sbjct  377   RAFQQYGMIPQNAWRPQRGLPENSVTVLRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQI  436

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  437   SNWFINARV  445



>gb|KDO49465.1| hypothetical protein CISIN_1g038021mg [Citrus sinensis]
Length=675

 Score =   273 bits (697),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 193/271 (71%), Gaps = 10/271 (4%)
 Frame = +3

Query  528   GAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekak  707
             G   D  G  S      I+  I  SKYLKAAQ+LLDEVVNV K+L+    E++ +  + +
Sbjct  190   GGNQDGKGDLSPYGMPSIARAIPSSKYLKAAQQLLDEVVNVRKALRQPDGEKSQSTHEQR  249

Query  708   mkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYR  887
             M         G GG    +     +   +  EL+ A+RQ+LQ K  KLLSM+DEV++RY+
Sbjct  250   MNNSK----DGDGGSKDVTSNTQESPSNSPNELSHAERQELQNKLTKLLSMLDEVDRRYK  305

Query  888   QYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE-  1064
             QY+HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI  QI+AT KSLGE+E 
Sbjct  306   QYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAICGQIRATRKSLGEQEN  365

Query  1065  -----GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLH  1229
                  GV  +RL+++D  L QQRALQHLGMMQ +AWRPQRGLPE +VS+LRAWLFEHFLH
Sbjct  366   SENSKGVGITRLRYVDQQLRQQRALQHLGMMQQHAWRPQRGLPESSVSILRAWLFEHFLH  425

Query  1230  PYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PYPKD+DKIMLA+QTGLTRSQVSNWFINARV
Sbjct  426   PYPKDTDKIMLARQTGLTRSQVSNWFINARV  456



>ref|XP_006423388.1| hypothetical protein CICLE_v10027952mg [Citrus clementina]
 gb|ESR36628.1| hypothetical protein CICLE_v10027952mg [Citrus clementina]
Length=675

 Score =   273 bits (697),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 193/271 (71%), Gaps = 10/271 (4%)
 Frame = +3

Query  528   GAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekak  707
             G   D  G  S      I+  I  SKYLKAAQ+LLDEVVNV K+L+    E++ +  + +
Sbjct  190   GGNQDGKGDLSPYGMPSIARAIPSSKYLKAAQQLLDEVVNVRKALRQPDGEKSQSTHEQR  249

Query  708   mkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYR  887
             M         G GG    +     +   +  EL+ A+RQ+LQ K  KLLSM+DEV++RY+
Sbjct  250   MNNSK----DGDGGSKDVTSNTQESPSNSPNELSHAERQELQNKLTKLLSMLDEVDRRYK  305

Query  888   QYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE-  1064
             QY+HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI  QI+AT KSLGE+E 
Sbjct  306   QYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAICGQIRATRKSLGEQEN  365

Query  1065  -----GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLH  1229
                  GV  +RL+++D  L QQRALQHLGMMQ +AWRPQRGLPE +VS+LRAWLFEHFLH
Sbjct  366   SENSKGVGITRLRYVDQQLRQQRALQHLGMMQQHAWRPQRGLPESSVSILRAWLFEHFLH  425

Query  1230  PYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PYPKD+DKIMLA+QTGLTRSQVSNWFINARV
Sbjct  426   PYPKDTDKIMLARQTGLTRSQVSNWFINARV  456



>gb|KDP41749.1| hypothetical protein JCGZ_26767 [Jatropha curcas]
Length=678

 Score =   273 bits (697),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 161/304 (53%), Positives = 203/304 (67%), Gaps = 30/304 (10%)
 Frame = +3

Query  489   PMESPVGLLSARPGAAHDNSGASSSSITHGISG--------------------FITGSKY  608
             P  S VG  S R G++ D    +   +  G SG                     I  SKY
Sbjct  154   PNPSIVGDGSGRNGSSRDEQSKNVEYLPAGFSGGNQDSNKGDISPYGMTSIARTIPHSKY  213

Query  609   LKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQK  788
             LKAAQ+LLDEVVNV K+LK    ++  N+   +   +S         +   +  ES+   
Sbjct  214   LKAAQQLLDEVVNVRKALK--QPDKEKNQSTNEHGMDSSKDGDSKSKNGSANPQESA--N  269

Query  789   TAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTH  968
              +A+EL+ A+RQ+LQ K  KLLSM+DEV++RY+QY+HQMQ++V+SF+  AG G+A+ YT 
Sbjct  270   NSASELSHAERQELQNKLTKLLSMLDEVDRRYKQYYHQMQIVVSSFDVIAGCGAAKPYTA  329

Query  969   LALNTISKQFRCLKVAIASQIKATSKSLGEEE------GVRGSRLKFIDHHLPQQRALQH  1130
             LAL TIS+ FRCL+ AI  QI+AT KSLGE+E      GV  +RL+++D  L QQRALQ 
Sbjct  330   LALQTISRHFRCLRDAIYGQIRATRKSLGEQETSENGKGVGITRLRYVDQQLRQQRALQQ  389

Query  1131  LGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFI  1310
             LGMMQ +AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDSDKIMLA+QTGLTRSQVSNWFI
Sbjct  390   LGMMQQHAWRPQRGLPESSVSILRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFI  449

Query  1311  NARV  1322
             NARV
Sbjct  450   NARV  453



>ref|XP_006487349.1| PREDICTED: BEL1-like homeodomain protein 6-like isoform X1 [Citrus 
sinensis]
Length=675

 Score =   273 bits (697),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 193/271 (71%), Gaps = 10/271 (4%)
 Frame = +3

Query  528   GAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekak  707
             G   D  G  S      I+  I  SKYLKAAQ+LLDEVVNV K+L+    +    +   +
Sbjct  190   GGNQDGKGDLSPYGMPSIARAIPSSKYLKAAQQLLDEVVNVRKALR--QPDGEKIQSTHE  247

Query  708   mkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYR  887
              +  +     G   D  ++  ES +   +  EL+ A+RQ+LQ K  KLLSM+DEV++RY+
Sbjct  248   QQMNNSKDGDGGSKDVTSNTQESPS--NSPNELSHAERQELQNKLTKLLSMLDEVDRRYK  305

Query  888   QYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE-  1064
             QY+HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI  QI+AT KSLGE+E 
Sbjct  306   QYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAICGQIRATRKSLGEQEN  365

Query  1065  -----GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLH  1229
                  GV  +RL+++D  L QQRALQHLGMMQ +AWRPQRGLPE +VS+LRAWLFEHFLH
Sbjct  366   SENSKGVGITRLRYVDQQLRQQRALQHLGMMQQHAWRPQRGLPESSVSILRAWLFEHFLH  425

Query  1230  PYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PYPKD+DKIMLA+QTGLTRSQVSNWFINARV
Sbjct  426   PYPKDTDKIMLARQTGLTRSQVSNWFINARV  456



>ref|XP_008796600.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X2 [Phoenix 
dactylifera]
Length=543

 Score =   269 bits (688),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 179/245 (73%), Gaps = 7/245 (3%)
 Frame = +3

Query  603   KYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSA  782
             +YLK A++LLDEVV+V K+LK +  +  +        +               +  ES+ 
Sbjct  98    RYLKVARQLLDEVVSVRKALKQETDKTQSLDNSGGTAECKDSDEVSKCDGMSLNPQESNV  157

Query  783   QKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSY  962
             Q  +  EL+ ++RQ LQ K  +LL+M+DEV++RY+QY++QMQ++V+SF+  AG  +A+ Y
Sbjct  158   Q--SPTELSPSERQGLQNKMTELLAMLDEVDRRYKQYYYQMQIVVSSFDVVAGCEAAKPY  215

Query  963   THLALNTISKQFRCLKVAIASQIKATSKSLGEEE-----GVRGSRLKFIDHHLPQQRALQ  1127
             T LAL TIS+QFR L+ AI  QI+AT KSLGE++     GV  SRLK+ID  L QQRA+Q
Sbjct  216   TALALQTISRQFRRLRDAINGQIRATRKSLGEQDNSSSKGVGISRLKYIDQQLRQQRAMQ  275

Query  1128  HLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWF  1307
             HLGM+Q NAWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+QTGLT+SQ+SNWF
Sbjct  276   HLGMVQHNAWRPQRGLPETSVSILRAWLFEHFLHPYPKDSEKLMLARQTGLTKSQISNWF  335

Query  1308  INARV  1322
             INARV
Sbjct  336   INARV  340



>ref|XP_010907730.1| PREDICTED: BEL1-like homeodomain protein 7 [Elaeis guineensis]
Length=664

 Score =   272 bits (696),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 137/245 (56%), Positives = 178/245 (73%), Gaps = 7/245 (3%)
 Frame = +3

Query  603   KYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSA  782
             +YLK AQ+LLDEVV+V K+LK  + +  +    A   +               +  ES+ 
Sbjct  219   RYLKVAQQLLDEVVSVRKALKQKSGKSQSLDSSAGTAECKDSDGISKCDGASLNSQESNV  278

Query  783   QKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSY  962
             Q  +  EL  ++RQDLQ K  KLL+M DE+++RY+QY+HQMQ++V+SF+ AAG G+A  Y
Sbjct  279   Q--SPTELAPSERQDLQNKMTKLLAMSDEIDRRYKQYYHQMQIVVSSFDVAAGCGAAEPY  336

Query  963   THLALNTISKQFRCLKVAIASQIKATSKSLGEEE-----GVRGSRLKFIDHHLPQQRALQ  1127
             T +AL TIS+QF  L+ AI  QI+AT KSLG+++     GV  SRLK+ID  L QQRA+Q
Sbjct  337   TAVALQTISRQFCHLRDAINGQIQATRKSLGKQDNSSSKGVGISRLKYIDQQLRQQRAMQ  396

Query  1128  HLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWF  1307
             HLGM+Q NAWRPQRGLPE +VS+LR+W FEHFLHPYPKDS+K+MLA+QTGLTRSQ+SNWF
Sbjct  397   HLGMVQHNAWRPQRGLPETSVSILRSWFFEHFLHPYPKDSEKLMLARQTGLTRSQISNWF  456

Query  1308  INARV  1322
             INARV
Sbjct  457   INARV  461



>ref|XP_004963319.1| PREDICTED: BEL1-like homeodomain protein 6-like isoform X1 [Setaria 
italica]
 ref|XP_004963320.1| PREDICTED: BEL1-like homeodomain protein 6-like isoform X2 [Setaria 
italica]
 ref|XP_004963321.1| PREDICTED: BEL1-like homeodomain protein 6-like isoform X3 [Setaria 
italica]
Length=647

 Score =   271 bits (694),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 180/249 (72%), Gaps = 12/249 (5%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  S+YLKAAQELLDEVVNV K++K  A +E     K   K+       G      ++  
Sbjct  201   IRNSRYLKAAQELLDEVVNVWKNIKQKAQKEQVEAGKTDGKETE-----GGAKSEGSNPQ  255

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES+A   AA EL+TA++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ +V+SF+  AG G+
Sbjct  256   ESAA--NAAPELSTAEKQELQNKMAKLMAMLDEVDRKYKHYYHQMQSVVSSFDVVAGPGA  313

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQ  1115
             A+ YT +AL TIS+ FRCLK AI  QI    K LGEEE   G     +RL++ID  L QQ
Sbjct  314   AKPYTAVALQTISRHFRCLKDAINDQINVIRKKLGEEENSSGKEGKLTRLRYIDQQLRQQ  373

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA Q  GM+  NAWRPQRGLPE +V++LRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQ+
Sbjct  374   RAFQQYGMIPQNAWRPQRGLPENSVTILRAWLFEHFLHPYPKDSEKMMLARQTGLTRSQI  433

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  434   SNWFINARV  442



>gb|EMS62949.1| BEL1-like homeodomain protein 6 [Triticum urartu]
Length=650

 Score =   271 bits (694),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 180/249 (72%), Gaps = 13/249 (5%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  S+YLKAAQE+LDEVVNV K++K  A +E A   KA  K+    P          +  
Sbjct  205   IRHSRYLKAAQEVLDEVVNVWKNIKQKAQKEQAEPGKADGKETDGGP------KSEGASQ  258

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES A   AA EL+TA++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ +VASF+  AG GS
Sbjct  259   ESGA--NAAPELSTAEKQELQNKMAKLMAMLDEVDRKYKHYYHQMQNVVASFDMVAGPGS  316

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGV-----RGSRLKFIDHHLPQQ  1115
             A+ YT +AL TIS+ FRCLK AI  QI    K LGEEE       + +RL++ID  L QQ
Sbjct  317   AKPYTAVALQTISRHFRCLKDAINDQINVIRKKLGEEENSSSKEGKLTRLRYIDQQLRQQ  376

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA Q  GM+  NAWRPQRGLPE +V+VLRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQ+
Sbjct  377   RAFQQYGMIPQNAWRPQRGLPENSVTVLRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQI  436

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  437   SNWFINARV  445



>gb|EMT29295.1| BEL1-like homeodomain protein 6 [Aegilops tauschii]
Length=650

 Score =   271 bits (694),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 145/249 (58%), Positives = 180/249 (72%), Gaps = 13/249 (5%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  S+YLKAAQE+LDEVVNV K++K  A +E A   KA  K+    P          +  
Sbjct  205   IRHSRYLKAAQEVLDEVVNVWKNIKQKAQKEQAEPGKADGKETDGGP------KSEGASQ  258

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES A   AA EL+TA++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ +VASF+  AG GS
Sbjct  259   ESGA--NAAPELSTAEKQELQNKMAKLMAMLDEVDRKYKHYYHQMQNVVASFDMVAGPGS  316

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGV-----RGSRLKFIDHHLPQQ  1115
             A+ YT +AL TIS+ FRCLK AI  QI    K LGEEE       + +RL++ID  L QQ
Sbjct  317   AKPYTAVALQTISRHFRCLKDAINDQINVIRKKLGEEENSSSKEGKLTRLRYIDQQLRQQ  376

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA Q  GM+  NAWRPQRGLPE +V+VLRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQ+
Sbjct  377   RAFQQYGMIPQNAWRPQRGLPENSVTVLRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQI  436

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  437   SNWFINARV  445



>ref|XP_003589334.1| BEL1-like homeodomain protein [Medicago truncatula]
 gb|AES59585.1| BEL1-related homeotic protein [Medicago truncatula]
Length=627

 Score =   271 bits (692),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 181/256 (71%), Gaps = 30/256 (12%)
 Frame = +3

Query  597   GSKYLKAAQELLDEVVNVEKSLK--------------LDaaeeaankekakmkkeSMPPF  734
              S YLKAAQELLDE+VNV K LK              LDA++++  K  ++  + S  P 
Sbjct  173   NSHYLKAAQELLDEIVNVRKGLKQTGLEKQQSFHDAGLDASKDSDGKSTSQSMQVSSGP-  231

Query  735   ggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVI  914
                           S    ++ EL+ A+RQ L  KK KLLSM+DE+++RYRQY HQMQ++
Sbjct  232   ------------NGSNANNSSCELSPAERQHLLDKKTKLLSMLDELDKRYRQYCHQMQIV  279

Query  915   VASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGSRLKFI  1094
             V+SF+  AG G+A  YT LAL TIS+ FRCL+ AI+ QI+ T +SLGE+EG+   RL+++
Sbjct  280   VSSFDMVAGCGAAEPYTALALRTISRHFRCLRDAISGQIQLTQRSLGEQEGI--PRLRYV  337

Query  1095  DHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQT  1274
             D  L QQ+ALQ LG+M+  AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+KIMLA+QT
Sbjct  338   DQQLRQQKALQQLGVMR-QAWRPQRGLPESSVSILRAWLFEHFLHPYPKDSEKIMLARQT  396

Query  1275  GLTRSQVSNWFINARV  1322
             GLTR+QV+NWFINARV
Sbjct  397   GLTRNQVANWFINARV  412



>ref|XP_002963328.1| hypothetical protein SELMODRAFT_80869, partial [Selaginella moellendorffii]
 gb|EFJ35199.1| hypothetical protein SELMODRAFT_80869, partial [Selaginella moellendorffii]
Length=293

 Score =   260 bits (665),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 141/293 (48%), Positives = 190/293 (65%), Gaps = 36/293 (12%)
 Frame = +3

Query  477   FRSLPME---SPVGLLSARPGAAH---DNSGASSSSITHGISGFITGSKYLKAAQELLDE  638
             FR+ P +   S V L S+  G  H   D +G   S++++  S F++GS+YL+AAQ+LLDE
Sbjct  24    FRTSPRDGGASYVNLPSS-AGTKHSYFDVAGPGPSAVSNSFS-FVSGSRYLRAAQQLLDE  81

Query  639   VVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQ  818
             V +V + LK  +  + + +                         +SS      + LT  +
Sbjct  82    VCSVGRGLKQSSKSKGSQQGLGG---------------------QSSPAAENVSVLTPDE  120

Query  819   RQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQF  998
             RQ+ + KK KLL+M+ EV++RYRQY+ QMQV++ SF+  AG G+A  YT LAL  +S+ F
Sbjct  121   RQEYEGKKTKLLAMLQEVDRRYRQYYDQMQVVITSFDAVAGAGAATPYTALALQAMSRYF  180

Query  999   RCLKVAIASQIKATSKSLGEEEGVRG-------SRLKFIDHHLPQQRALQHLGMMQPNAW  1157
             RCL+ AI  QI+ T K+LGEE+  +        SRL+FID  + QQRA Q  GM+Q +AW
Sbjct  181   RCLRDAITGQIQTTCKALGEEDVTKSITSRPLTSRLRFIDQQIRQQRAYQQYGMLQQHAW  240

Query  1158  RPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINA  1316
             RPQRGLPER+VS+LRAWLFEHFLHPYPKD+DK+MLA+QTGLTR QVSNWFINA
Sbjct  241   RPQRGLPERSVSILRAWLFEHFLHPYPKDADKMMLARQTGLTRGQVSNWFINA  293



>ref|XP_008675002.1| PREDICTED: BEL1-related homeotic protein 30 isoform X1 [Zea mays]
 ref|XP_008675010.1| PREDICTED: BEL1-related homeotic protein 30 isoform X1 [Zea mays]
 ref|XP_008675015.1| PREDICTED: BEL1-related homeotic protein 30 isoform X1 [Zea mays]
 tpg|DAA50500.1| TPA: putative POX domain/homeobox DNA-binding domain family protein 
isoform 1 [Zea mays]
 tpg|DAA50501.1| TPA: putative POX domain/homeobox DNA-binding domain family protein 
isoform 2 [Zea mays]
Length=651

 Score =   271 bits (693),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 138/251 (55%), Positives = 178/251 (71%), Gaps = 14/251 (6%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLK--LDaaeeaankekakmkkeSMPPFggcggdppts  764
             I  SKYLKAAQELLDE+V+V K +K   D     A K   K     +           ++
Sbjct  195   IRNSKYLKAAQELLDEIVSVWKCVKQKTDKGPAEAGKADGKETDGGI-----KSEGVSSN  249

Query  765   ggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGV  944
               ES A   AAAEL+TA++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ++++SF   AG 
Sbjct  250   PQESGA--NAAAELSTAEKQELQNKMAKLMTMLDEVDRKYKHYYHQMQLVMSSFNMVAGA  307

Query  945   GSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLP  1109
             G+A+ YT +AL TIS+ FRCLK AI  QI    K LGE++   G     +RL++ID  + 
Sbjct  308   GAAKPYTAVALQTISRHFRCLKDAINDQISVIRKKLGEDDNTSGKEGKLTRLRYIDQQIR  367

Query  1110  QQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRS  1289
             QQRA Q  GM+Q NAWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+ML++QTGLTRS
Sbjct  368   QQRAFQQYGMLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLSRQTGLTRS  427

Query  1290  QVSNWFINARV  1322
             Q+SNWFINARV
Sbjct  428   QISNWFINARV  438



>ref|XP_006838675.1| hypothetical protein AMTR_s00002p00243900 [Amborella trichopoda]
 gb|ERN01244.1| hypothetical protein AMTR_s00002p00243900 [Amborella trichopoda]
Length=697

 Score =   272 bits (695),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/255 (58%), Positives = 181/255 (71%), Gaps = 10/255 (4%)
 Frame = +3

Query  576   GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdp  755
             G+S  I+ SKYLKAAQ+LLDEVVNV  +LK + +    +   A                P
Sbjct  245   GLSSTISNSKYLKAAQQLLDEVVNVGNALKPNESGRPKSFSMATASMA----LKVSENTP  300

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
                  +  A   A  EL+  +RQDLQ K  KLL M+DEV++RY+QY+HQMQ++V+SF+  
Sbjct  301   SNLSDQQEANADAPNELSPTERQDLQTKLTKLLGMLDEVDRRYKQYYHQMQIVVSSFDAI  360

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG------SRLKFID  1097
             AG G+A++YT LAL TISK FRCL+ AI  QI+AT KSLGE++          SRL+F+D
Sbjct  361   AGAGAAKTYTALALQTISKHFRCLRDAINGQIRATQKSLGEQDPTSNKSGGGLSRLRFVD  420

Query  1098  HHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTG  1277
               L QQRALQ LGMMQ +AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDSDK+MLA+QTG
Sbjct  421   QQLRQQRALQQLGMMQQHAWRPQRGLPESSVSILRAWLFEHFLHPYPKDSDKLMLARQTG  480

Query  1278  LTRSQVSNWFINARV  1322
             L+RSQVSNWFINARV
Sbjct  481   LSRSQVSNWFINARV  495



>ref|NP_001147963.1| BEL1-related homeotic protein 30 [Zea mays]
 gb|ACG29257.1| BEL1-related homeotic protein 30 [Zea mays]
Length=651

 Score =   271 bits (692),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 138/251 (55%), Positives = 178/251 (71%), Gaps = 14/251 (6%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLK--LDaaeeaankekakmkkeSMPPFggcggdppts  764
             I  SKYLKAAQELLDE+V+V K +K   D     A K   K     +           ++
Sbjct  195   IRNSKYLKAAQELLDEIVSVWKCVKQKTDKGPAEAGKADGKETDGGI-----KSEGVSSN  249

Query  765   ggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGV  944
               ES A   AAAEL+TA++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ++++SF   AG 
Sbjct  250   PQESGA--NAAAELSTAEKQELQNKMAKLMTMLDEVDRKYKHYYHQMQLVMSSFNMVAGA  307

Query  945   GSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLP  1109
             G+A+ YT +AL TIS+ FRCLK AI  QI    K LGE++   G     +RL++ID  + 
Sbjct  308   GAAKPYTAVALQTISRHFRCLKDAINDQISVIRKKLGEDDNTSGKEGKLTRLRYIDQQIR  367

Query  1110  QQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRS  1289
             QQRA Q  GM+Q NAWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+ML++QTGLTRS
Sbjct  368   QQRAFQQYGMLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLSRQTGLTRS  427

Query  1290  QVSNWFINARV  1322
             Q+SNWFINARV
Sbjct  428   QISNWFINARV  438



>ref|XP_007199727.1| hypothetical protein PRUPE_ppa002499mg [Prunus persica]
 gb|EMJ00926.1| hypothetical protein PRUPE_ppa002499mg [Prunus persica]
Length=666

 Score =   271 bits (692),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 197/469 (42%), Positives = 257/469 (55%), Gaps = 65/469 (14%)
 Frame = +3

Query  36    MAMYYQGSSEVQGDGLQTLYLMNPNYIGFSDTALPQSQQAMFLNSG--------------  173
             M+ YY GS+  Q D    LYL  P    + +  +      M++NSG              
Sbjct  1     MSTYYTGSNN-QKDATPMLYLREPLPSSYPEAPVLPGNMMMYMNSGSYSDALAGSSQQQN  59

Query  174   --------------NALHAGGMPHARLPQSQHFVGVPLPASALGSAQLHDPARSLWAGLE  311
                           N+    G    R  +++  V  P+  SA   A LH        GL 
Sbjct  60    NCIDVVSSAGASDNNSQQQDGFSPWREGRNEMLVTQPMGGSA---AILHGGQNLQGQGLS  116

Query  312   QAGSGS--GGQQIPSAVVSGGGGTTDFASQLGFHRSVVVSPTAQQGlslslsPQQHPFRS  485
              + S     G Q+PS  +        FAS L  + S+      + G      P+   +  
Sbjct  117   LSLSTQIPSGMQMPS--IPYRNPNMGFASFLSPNPSISSEGDCRNGSFRDEQPRNVEY--  172

Query  486   LPMESPVGLLSARPGAAHDNS-GASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSL  662
                     L S  PG   D+S G  S      I+  I  +KYLKAAQ+LLDEVVNV+K+L
Sbjct  173   --------LQSGFPGGNPDSSKGDLSPYGMSSIARAIPNNKYLKAAQQLLDEVVNVQKAL  224

Query  663   KLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAA---AELTTAQRQDLQ  833
             K    E+  +  + +              +   SG  S+ Q TA+    EL+ A++Q+LQ
Sbjct  225   KQHDREKNQSTHEHRDDGS---------KNELESGVSSNPQDTASNSQCELSHAEKQELQ  275

Query  834   MKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKV  1013
              K  KLLSM+DEV++RY+ Y+HQMQ++V+SF+  AG G+A+ YT +AL TIS+ FRCL+ 
Sbjct  276   SKLTKLLSMLDEVDRRYKHYYHQMQIVVSSFDVVAGCGAAKPYTAVALQTISRHFRCLRD  335

Query  1014  AIASQIKATSKSLGEE------EGVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGL  1175
             AI  QI+AT KSLGEE      +GV  SRL+++D  L QQRALQ LGMMQ +AWRPQRGL
Sbjct  336   AITGQIRATRKSLGEEGTSGSIKGVGISRLRYVDQQLRQQRALQQLGMMQQHAWRPQRGL  395

Query  1176  PERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PE +VS+LRAWLFEHFLHPYPKDSDKIMLA+QTGLTRSQVSNWFINARV
Sbjct  396   PESSVSILRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARV  444



>ref|XP_010107836.1| BEL1-like homeodomain protein 6 [Morus notabilis]
 gb|EXC17236.1| BEL1-like homeodomain protein 6 [Morus notabilis]
Length=684

 Score =   271 bits (693),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 149/252 (59%), Positives = 182/252 (72%), Gaps = 13/252 (5%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             +  SKYLKA Q+LLDEVVNV K+LK     +  N+     +++ M               
Sbjct  214   VPSSKYLKAVQQLLDEVVNVRKALK-----QHDNERGQTGQEQRMKSSKEGDEGSKNEST  268

Query  771   ESSAQKTAAA--ELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGV  944
                 + T  +  EL+ A++QDLQ K  KLLSM+DEV++RY+QY+HQMQ++V+SF+  AG 
Sbjct  269   PGGGESTTNSQPELSHAEKQDLQNKLTKLLSMLDEVDRRYKQYYHQMQIVVSSFDAIAGC  328

Query  945   GSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE------GVRGSRLKFIDHHL  1106
             GSA+ YT LAL TIS+ FRCL+ AI  QIKAT KSLGEE+      GV  SRL+++D  L
Sbjct  329   GSAKPYTALALQTISRHFRCLRDAITGQIKATRKSLGEEDAPGNVKGVGISRLRYVDQQL  388

Query  1107  PQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTR  1286
              QQRALQ LGMMQ +AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDSDKIMLA+QTGLTR
Sbjct  389   RQQRALQQLGMMQQHAWRPQRGLPESSVSILRAWLFEHFLHPYPKDSDKIMLARQTGLTR  448

Query  1287  SQVSNWFINARV  1322
             SQVSNWFINARV
Sbjct  449   SQVSNWFINARV  460



>gb|ACD39467.1| BEL30 protein [Solanum palustre]
Length=645

 Score =   270 bits (689),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 190/264 (72%), Gaps = 9/264 (3%)
 Frame = +3

Query  549   GASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMP  728
             G +S   T  I+  I  SKYLKAAQ LLDEVV+V K++K   +++   K+  +   +S  
Sbjct  187   GYNSPYGTSSIARTIPSSKYLKAAQYLLDEVVSVRKAIKEQNSKKELTKDSRESDVDSKN  246

Query  729   PFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQ  908
                    +  ++  ES   K   +EL+  ++Q++Q K  KLLSM+DE+++RYRQY+HQMQ
Sbjct  247   ISSDTPANGGSNPHES---KNNQSELSATEKQEVQNKLTKLLSMLDEIDRRYRQYYHQMQ  303

Query  909   VIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGS---  1079
             ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI  QI+A+ +SLGE++    S   
Sbjct  304   IVVSSFDVVAGDGAAKPYTALALQTISRHFRCLRDAICDQIRASRRSLGEQDASENSKAI  363

Query  1080  ---RLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
                RL+F+D H+ QQRALQ LGMMQ  AWRPQRGLPE +VSVLRAWLFEHFLHPYPKDSD
Sbjct  364   GISRLRFVDQHIRQQRALQQLGMMQQQAWRPQRGLPESSVSVLRAWLFEHFLHPYPKDSD  423

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             KIMLA+QTGLTRSQVSNWFINARV
Sbjct  424   KIMLARQTGLTRSQVSNWFINARV  447



>emb|CBI38029.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 148/254 (58%), Positives = 184/254 (72%), Gaps = 23/254 (9%)
 Frame = +3

Query  579   ISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpp  758
             I+  I  SKYLKAAQ+LLDEVVNV K+LK   +E+  N  +         P         
Sbjct  181   IARTIPHSKYLKAAQQLLDEVVNVRKALKQPDSEKNQNIHELWKASNPQEPV--------  232

Query  759   tsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAA  938
                        +++EL+ A+RQDLQ K  KLL+M+DEV++RY+QY+HQMQ++V+SF+  A
Sbjct  233   ---------SNSSSELSPAERQDLQNKLTKLLAMLDEVDRRYKQYYHQMQIVVSSFDVIA  283

Query  939   GVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE------GVRGSRLKFIDH  1100
             G G+A+ YT LAL TIS+ FRCL+ AI  QI+AT +SLGE++      GV  SRL+++D 
Sbjct  284   GSGAAKPYTALALQTISRHFRCLRDAITGQIRATRRSLGEQDTSGNGKGVGISRLRYVDQ  343

Query  1101  HLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGL  1280
              L QQRALQ LGMMQ +AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDSDKIMLA+QTGL
Sbjct  344   QLRQQRALQQLGMMQQHAWRPQRGLPESSVSILRAWLFEHFLHPYPKDSDKIMLARQTGL  403

Query  1281  TRSQVSNWFINARV  1322
             TRSQVSNWFINARV
Sbjct  404   TRSQVSNWFINARV  417



>ref|NP_001131173.1| uncharacterized protein LOC100192481 [Zea mays]
 ref|XP_008677487.1| PREDICTED: uncharacterized protein LOC100192481 isoform X1 [Zea 
mays]
 gb|ACF79473.1| unknown [Zea mays]
 tpg|DAA47673.1| TPA: putative POX domain/homeobox DNA-binding domain family protein 
[Zea mays]
 gb|AIB05098.1| HB transcription factor, partial [Zea mays]
Length=668

 Score =   270 bits (690),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 143/249 (57%), Positives = 178/249 (71%), Gaps = 13/249 (5%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  S+YLKAAQELLDEVVNV  S+K  A +E     K + K+         GG       
Sbjct  200   IRNSRYLKAAQELLDEVVNVWNSIKQKAQKEQVEAGKTEGKENE------GGGPKSEGPQ  253

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES A   AA EL+TA++Q+LQ K AKL++M+DEV+++Y+ Y+HQMQ +V+SF+  AG G+
Sbjct  254   ESGA--NAAPELSTAEKQELQNKMAKLMAMLDEVDRKYKHYYHQMQSVVSSFDMVAGAGA  311

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQ  1115
             A+ YT +AL TIS+ FRCLK AI  QI    K LGEEE   G     +RL++ID  L QQ
Sbjct  312   AKPYTAVALQTISRHFRCLKDAINDQISVIRKKLGEEESSSGREGRLTRLRYIDQQLRQQ  371

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA Q  GM+  NAWRPQRGLPE +V++LRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQ+
Sbjct  372   RAFQQYGMIPQNAWRPQRGLPENSVTILRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQI  431

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  432   SNWFINARV  440



>ref|XP_003549446.2| PREDICTED: BEL1-like homeodomain protein 3-like [Glycine max]
Length=611

 Score =   268 bits (686),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 137/254 (54%), Positives = 178/254 (70%), Gaps = 8/254 (3%)
 Frame = +3

Query  570   THGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFgg  740
             +HG  GF   +  S+YLKAAQELLDE+VNV K   L+      +      K         
Sbjct  188   SHGSQGFSNNMLNSQYLKAAQELLDEIVNVRKQTSLEKQPSFRDVGLDGSKDSDGKSTTQ  247

Query  741   cggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVA  920
                      G S+A   ++ EL+  +RQ+   KK KLLSM+DEV++RYRQY HQMQ++V+
Sbjct  248   SVQISSGPNGSSAA--NSSCELSPTERQNFLDKKTKLLSMLDEVDKRYRQYCHQMQIVVS  305

Query  921   SFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGSRLKFIDH  1100
             SF+  +G G+A  YT LAL TIS+ FRCL  AI+ QI+ T ++LGE+EG+   RL+++D 
Sbjct  306   SFDMVSGCGAAEPYTALALRTISRHFRCLHDAISGQIQVTQRNLGEQEGI--PRLRYVDQ  363

Query  1101  HLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGL  1280
              L QQ+ALQ LG+M+  AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+KIMLA+QTGL
Sbjct  364   QLRQQKALQQLGVMR-QAWRPQRGLPETSVSILRAWLFEHFLHPYPKDSEKIMLARQTGL  422

Query  1281  TRSQVSNWFINARV  1322
             T++QV+NWFINARV
Sbjct  423   TKNQVANWFINARV  436



>gb|ACD39463.1| BEL30 protein [Solanum etuberosum]
Length=645

 Score =   269 bits (688),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 190/264 (72%), Gaps = 9/264 (3%)
 Frame = +3

Query  549   GASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMP  728
             G +S   T  I+  I  SKYLKAAQ LLDEVV+V K++K   +++   K+  +   +S  
Sbjct  187   GYNSPYGTSSIARTIPSSKYLKAAQYLLDEVVSVRKAIKEQNSKKELTKDSRESDVDSKN  246

Query  729   PFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQ  908
                    +  ++  ES   K   +EL+  ++Q++Q K  KLLSM+DE+++RYRQY+HQMQ
Sbjct  247   ISSDTPANGGSNPHES---KNNQSELSATEKQEVQNKLTKLLSMLDEIDRRYRQYYHQMQ  303

Query  909   VIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGS---  1079
             ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI  QI+A+ +SLGE++    S   
Sbjct  304   IVVSSFDVVAGDGAAKPYTALALQTISRHFRCLRDAICDQIRASRRSLGEQDASENSKAI  363

Query  1080  ---RLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
                RL+F+D H+ QQRALQ LGMMQ  AWRPQRGLPE +VSVLRAWLFEHFLHPYPKDSD
Sbjct  364   GISRLRFVDQHIRQQRALQQLGMMQQQAWRPQRGLPESSVSVLRAWLFEHFLHPYPKDSD  423

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             KIMLA+QTGLTRSQVSNWFINARV
Sbjct  424   KIMLARQTGLTRSQVSNWFINARV  447



>gb|EMT16587.1| BEL1-like homeodomain protein 6 [Aegilops tauschii]
Length=712

 Score =   271 bits (692),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 147/285 (52%), Positives = 190/285 (67%), Gaps = 12/285 (4%)
 Frame = +3

Query  483   SLPMESPVGLLSARPGAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSL  662
             S P  SP   L A      D +G  +  +    S  I  SKYLKAAQELLDE+V+V KS+
Sbjct  270   SYPYWSPKPDLLATQSYQGDENGMKN--MQSEASRAIRNSKYLKAAQELLDEIVSVWKSI  327

Query  663   KLDaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKK  842
             K +A ++     K   K               ++  ES+A   A  E++ A++Q+LQ K 
Sbjct  328   KQNAQKDKVEAGKMDGKDADE---VLKSEGVSSNPQESTA--NAEPEISAAEKQELQNKM  382

Query  843   AKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIA  1022
             AKLL+M+DEV+++Y+ Y HQMQ++V+SF+  AG G+A+ YT +AL TIS+ FRCLK AI 
Sbjct  383   AKLLAMLDEVDRKYKHYFHQMQIVVSSFDMIAGSGAAKPYTAVALQTISRHFRCLKDAIN  442

Query  1023  SQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERA  1187
              Q+    K LGEE+   G     +RL++ID  L QQRA Q  GM+Q NAWRPQRGLPE +
Sbjct  443   DQVNVIRKKLGEEDNSSGREGKLTRLRYIDQQLRQQRAFQQYGMLQQNAWRPQRGLPENS  502

Query  1188  VSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             VS+LRAWLFEHFLHPYPKDS+K+MLA+QTGLTRSQ+SNWFINARV
Sbjct  503   VSILRAWLFEHFLHPYPKDSEKLMLARQTGLTRSQISNWFINARV  547



>ref|XP_008796599.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X1 [Phoenix 
dactylifera]
Length=670

 Score =   270 bits (690),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/245 (55%), Positives = 179/245 (73%), Gaps = 7/245 (3%)
 Frame = +3

Query  603   KYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSA  782
             +YLK A++LLDEVV+V K+LK +  +  +        +               +  ES+ 
Sbjct  225   RYLKVARQLLDEVVSVRKALKQETDKTQSLDNSGGTAECKDSDEVSKCDGMSLNPQESNV  284

Query  783   QKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSY  962
             Q  +  EL+ ++RQ LQ K  +LL+M+DEV++RY+QY++QMQ++V+SF+  AG  +A+ Y
Sbjct  285   Q--SPTELSPSERQGLQNKMTELLAMLDEVDRRYKQYYYQMQIVVSSFDVVAGCEAAKPY  342

Query  963   THLALNTISKQFRCLKVAIASQIKATSKSLGEEE-----GVRGSRLKFIDHHLPQQRALQ  1127
             T LAL TIS+QFR L+ AI  QI+AT KSLGE++     GV  SRLK+ID  L QQRA+Q
Sbjct  343   TALALQTISRQFRRLRDAINGQIRATRKSLGEQDNSSSKGVGISRLKYIDQQLRQQRAMQ  402

Query  1128  HLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWF  1307
             HLGM+Q NAWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+MLA+QTGLT+SQ+SNWF
Sbjct  403   HLGMVQHNAWRPQRGLPETSVSILRAWLFEHFLHPYPKDSEKLMLARQTGLTKSQISNWF  462

Query  1308  INARV  1322
             INARV
Sbjct  463   INARV  467



>emb|CDY02261.1| BnaA03g39060D [Brassica napus]
Length=449

 Score =   264 bits (674),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 140/264 (53%), Positives = 180/264 (68%), Gaps = 28/264 (11%)
 Frame = +3

Query  549   GASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMP  728
             G SS   T  +SGF   SKYL+AAQELLDE VNV+K+LK                     
Sbjct  92    GISSQIETQVVSGF-HNSKYLEAAQELLDEAVNVKKALK---------------------  129

Query  729   PFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQ  908
              F   G        ++  +     +L  A+RQ+LQ K +KLLS++DEV++RY+QY+HQMQ
Sbjct  130   QFQPEGDKTEEDKEKNLQESITNPDLPQAERQELQNKLSKLLSILDEVDRRYKQYYHQMQ  189

Query  909   VIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLG-EEEGVRG---  1076
             ++V+SF+  AG  +A+ YT LAL TIS+ FRCL+ AI+ QI    +SLG E +G+ G   
Sbjct  190   IVVSSFDVIAGSEAAKPYTALALQTISRHFRCLRDAISGQILVIRRSLGGEHDGLDGRGV  249

Query  1077  --SRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSD  1250
               SRL+ +D  + QQRALQ LG++QP+AWRPQRGLP+ +V +LRAWLFEHFLHPYPKDSD
Sbjct  250   GISRLRNVDQKVRQQRALQRLGVVQPHAWRPQRGLPDSSVLILRAWLFEHFLHPYPKDSD  309

Query  1251  KIMLAKQTGLTRSQVSNWFINARV  1322
             KIMLA+QTGL+R QVSNWFINARV
Sbjct  310   KIMLARQTGLSRGQVSNWFINARV  333



>ref|XP_004289652.1| PREDICTED: BEL1-like homeodomain protein 6-like [Fragaria vesca 
subsp. vesca]
Length=670

 Score =   269 bits (688),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 156/279 (56%), Positives = 198/279 (71%), Gaps = 18/279 (6%)
 Frame = +3

Query  525   PGAAHDNS-GASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankek  701
             PG   D+S G  S      I+  I  SKYLKAAQ+LLDEVVNV+K+LK     +   ++ 
Sbjct  185   PGGNADSSKGDLSPYGMSSIARNIPNSKYLKAAQQLLDEVVNVQKALK-----QHDREKN  239

Query  702   akmkkeSMPPFgg--cggdpptsggESSAQKTAAA----ELTTAQRQDLQMKKAKLLSMV  863
                 + +M  F             GESS  + +A+    EL+ A++Q+LQ K  KLLSM+
Sbjct  240   ESANEHTMKSFKEGDDRSKNELESGESSNPQESASNSPFELSHAEKQELQNKLTKLLSML  299

Query  864   DEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATS  1043
             DEV++RY+QY+HQMQ++V+SF+  AG G+A+ YT +AL TIS+ FRCL+ AI  QI+AT 
Sbjct  300   DEVDRRYKQYYHQMQIVVSSFDVIAGSGAAKPYTAVALQTISRHFRCLRDAITGQIRATQ  359

Query  1044  KSLGEE------EGVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRA  1205
             KSLGE+      +GV  +RL+++D  L QQRALQ LGMMQ +AWRPQRGLPE +VS+LRA
Sbjct  360   KSLGEQGTSGSIKGVGITRLRYVDQQLRQQRALQQLGMMQQHAWRPQRGLPESSVSILRA  419

Query  1206  WLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             WLFEHFLHPYPKDSDKIMLA+QTGLTRSQVSNWFINARV
Sbjct  420   WLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARV  458



>gb|KEH36201.1| BEL1-related homeotic protein [Medicago truncatula]
Length=517

 Score =   265 bits (677),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 178/251 (71%), Gaps = 5/251 (2%)
 Frame = +3

Query  570   THGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcgg  749
             + G S     ++YLKA QELLDE+VNV K   ++  E   N      K            
Sbjct  156   SQGFSNIFLNTQYLKAIQELLDEIVNVRKQRGMEKQETIRNIGLDNPKDSDGKSISQSMQ  215

Query  750   dpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFE  929
                    + ++    + E+++A+RQ+L  KK KLLSM+DEV++RYRQY H+MQ++V+S +
Sbjct  216   ITSGGPNDPNS--NPSCEISSAERQNLLDKKTKLLSMLDEVDKRYRQYCHRMQIVVSSLD  273

Query  930   QAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGSRLKFIDHHLP  1109
               AG G+A  YT LAL TIS+QFRCL+ AI++Q++   ++LGE+EG+   RL+++D  L 
Sbjct  274   MVAGGGAAEPYTTLALRTISRQFRCLRDAISNQVQVIQRNLGEQEGI--PRLRYVDQQLR  331

Query  1110  QQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRS  1289
             QQ+ALQHLG+M+  AWRPQRGLPE +VS+LRAWLFEHFL+PYPKDS+KIMLA+QTGLTR+
Sbjct  332   QQKALQHLGVMR-QAWRPQRGLPENSVSILRAWLFEHFLNPYPKDSEKIMLARQTGLTRN  390

Query  1290  QVSNWFINARV  1322
             QV+NWFINARV
Sbjct  391   QVANWFINARV  401



>gb|EEE51686.1| hypothetical protein OsJ_33045 [Oryza sativa Japonica Group]
Length=641

 Score =   268 bits (685),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 158/253 (62%), Positives = 184/253 (73%), Gaps = 10/253 (4%)
 Frame = +3

Query  588   FITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsg  767
              +  SKYLKAAQELLDEVV+V K +  D  + AA  +     K+     G  GG     G
Sbjct  146   MVMSSKYLKAAQELLDEVVSVSKGV--DDVKAAAAAKSPASVKKKEDSEGVSGGGTEDGG  203

Query  768   gESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVE-QRYRQYHHQMQVIVASFEQAAGV  944
             G  S       E++TA+RQ+LQMKK KL++M+DEV     RQYH QMQV+VASFE  AG 
Sbjct  204   GAKSGGAPPQPEMSTAERQELQMKKGKLINMLDEVSGAAVRQYHQQMQVVVASFEAVAGG  263

Query  945   GSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-------SRLKFIDHH  1103
             GSAR+YT LAL TIS+QFRCL+ AIA Q++A S++LGE     G       SRL++IDH 
Sbjct  264   GSARTYTALALRTISRQFRCLRDAIAGQVRAASRALGEAVDADGGCGRTVGSRLRYIDHQ  323

Query  1104  LPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLT  1283
             L QQRALQ LGMMQ +AWRPQRGLPER+VS+LRAWLFEHFLHPYPKDSDKIMLAKQTGLT
Sbjct  324   LRQQRALQQLGMMQSSAWRPQRGLPERSVSILRAWLFEHFLHPYPKDSDKIMLAKQTGLT  383

Query  1284  RSQVSNWFINARV  1322
             RSQVSNWFINARV
Sbjct  384   RSQVSNWFINARV  396



>gb|KHN12676.1| BEL1-like homeodomain protein 7 [Glycine soja]
Length=611

 Score =   267 bits (683),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/254 (54%), Positives = 178/254 (70%), Gaps = 8/254 (3%)
 Frame = +3

Query  570   THGISGF---ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFgg  740
             +HG  GF   +  S+YLKAAQELLDE+VNV K   L+      +      K         
Sbjct  188   SHGSQGFSNNMLNSQYLKAAQELLDEIVNVRKQTSLEKQPSFRDVGLDGSKDSDGKSTTQ  247

Query  741   cggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVA  920
                      G S+A   ++ EL+  +RQ+   KK KLLSM+DEV++RYRQY HQMQ++V+
Sbjct  248   SVQISSGPNGSSAA--NSSCELSPTERQNFLDKKTKLLSMLDEVDKRYRQYCHQMQIVVS  305

Query  921   SFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGSRLKFIDH  1100
             SF+  +G G+A  YT LAL TIS+ FRCL  AI+ QI+ T ++LGE+EG+   RL+++D 
Sbjct  306   SFDMVSGCGAAEPYTALALRTISRHFRCLHDAISGQIQVTQRNLGEQEGI--PRLRYVDQ  363

Query  1101  HLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGL  1280
              + QQ+ALQ LG+M+  AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+KIMLA+QTGL
Sbjct  364   QVRQQKALQQLGVMR-QAWRPQRGLPETSVSILRAWLFEHFLHPYPKDSEKIMLARQTGL  422

Query  1281  TRSQVSNWFINARV  1322
             T++QV+NWFINARV
Sbjct  423   TKNQVANWFINARV  436



>ref|XP_008236952.1| PREDICTED: BEL1-like homeodomain protein 7 [Prunus mume]
Length=679

 Score =   268 bits (686),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 158/281 (56%), Positives = 198/281 (70%), Gaps = 19/281 (7%)
 Frame = +3

Query  510   LLSARPGAAHDNS-GASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeea  686
             L S  PG   D+S G  S      I+  I  +KYLKAAQ+LLDEVVNV+K+LK    E+ 
Sbjct  186   LQSGFPGGNPDSSKGDLSPYGMSSIARAIPNNKYLKAAQQLLDEVVNVQKALKQHDREKN  245

Query  687   ankekakmkkeSMPPFggcggdpptsggESSAQKTAA---AELTTAQRQDLQMKKAKLLS  857
              +  + +              +   SG  S+ Q TA+    EL+ A++Q+LQ K  KLLS
Sbjct  246   QSTHEHRDDGS---------KNELESGVSSNPQDTASNSQCELSHAEKQELQSKLTKLLS  296

Query  858   MVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKA  1037
             M+DEV++RY+ Y+HQMQ++V+SF+  AG G+A+ YT +AL TIS+ FRCL+ AI  QI+A
Sbjct  297   MLDEVDRRYKHYYHQMQIVVSSFDVIAGCGAAKPYTAVALQTISRHFRCLRDAITGQIRA  356

Query  1038  TSKSLGEE------EGVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVL  1199
             T KSLGEE      +GV  SRL+++D  L QQRALQ LGMMQ +AWRPQRGLPE +VS+L
Sbjct  357   TRKSLGEEGASGSIKGVGISRLRYVDQQLRQQRALQQLGMMQQHAWRPQRGLPESSVSIL  416

Query  1200  RAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             RAWLFEHFLHPYPKDSDKIMLA+QTGLTRSQVSNWFINARV
Sbjct  417   RAWLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARV  457



>emb|CAN62866.1| hypothetical protein VITISV_015924 [Vitis vinifera]
Length=691

 Score =   269 bits (687),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 161/282 (57%), Positives = 200/282 (71%), Gaps = 12/282 (4%)
 Frame = +3

Query  501   PVGLLSARPGAAHDN-SGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKL-Da  674
             P G+L    GA  D+  G  SS     I+  I  SKYLKAAQ+LLDEVVNV K+LK  D+
Sbjct  190   PPGVL----GANQDSIKGDPSSYGMSSIARTIPHSKYLKAAQQLLDEVVNVRKALKQPDS  245

Query  675   aeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLL  854
              +     E  K  KE+        G  P +         +++EL+ A+RQDLQ K  KLL
Sbjct  246   EKNQNIHELWKGSKEADVGLKNGTGMTPAASNPQEPVSNSSSELSPAERQDLQNKLTKLL  305

Query  855   SMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIK  1034
             +M+DEV++RY+QY+HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI  QI+
Sbjct  306   AMLDEVDRRYKQYYHQMQIVVSSFDVIAGSGAAKPYTALALQTISRHFRCLRDAITGQIR  365

Query  1035  ATSKSLGEEE------GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSV  1196
             AT +SLGE++      GV  SRL+++D  L QQRALQ LGMMQ +AWRPQRGLPE +VS+
Sbjct  366   ATRRSLGEQDTSGNGKGVGISRLRYVDQQLRQQRALQQLGMMQQHAWRPQRGLPESSVSI  425

Query  1197  LRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             LRAWLFEHFLHPYPKDSDKIMLA+QTGLTRSQVSNWFINARV
Sbjct  426   LRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARV  467



>emb|CDO97015.1| unnamed protein product [Coffea canephora]
Length=668

 Score =   268 bits (685),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 147/276 (53%), Positives = 192/276 (70%), Gaps = 8/276 (3%)
 Frame = +3

Query  516   SARPGAAHDNSGASSSSITH-GISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaan  692
             S  PG+  D + A  S      I+  +  SKYLKAAQ+LLDEVVNV K+LK +   +   
Sbjct  196   SGFPGSNSDTARADVSPYGMPSIARAVPNSKYLKAAQQLLDEVVNVRKALK-EHNPKKGA  254

Query  693   kekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEV  872
              + +K                 +S     +   +A+EL+ A++QDLQ K +KLL+M+DEV
Sbjct  255   MKDSKESHGDPKNGESDYPICGSSTNVQESSSNSASELSAAEKQDLQSKMSKLLAMMDEV  314

Query  873   EQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSL  1052
             ++RY+QY+HQMQ++V+SF+  AG  +AR YT LAL TIS+ FRCL+ AI  Q++ T +SL
Sbjct  315   DKRYKQYYHQMQIVVSSFDVIAGSEAARPYTALALQTISRHFRCLRDAINVQVQVTRRSL  374

Query  1053  GEEEG------VRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLF  1214
             GE++       +  SRL+++D  + QQRALQ LGMMQ +AWRPQRGLPE +V+VLRAWLF
Sbjct  375   GEQDASTSSKAIGISRLRYVDQQIKQQRALQQLGMMQQHAWRPQRGLPESSVTVLRAWLF  434

Query  1215  EHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             EHFLHPYPKDSDKIMLA+QTGLTRSQVSNWFINARV
Sbjct  435   EHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARV  470



>gb|KEH36200.1| BEL1-related homeotic protein [Medicago truncatula]
Length=587

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 131/251 (52%), Positives = 178/251 (71%), Gaps = 5/251 (2%)
 Frame = +3

Query  570   THGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcgg  749
             + G S     ++YLKA QELLDE+VNV K   ++  E   N      K            
Sbjct  156   SQGFSNIFLNTQYLKAIQELLDEIVNVRKQRGMEKQETIRNIGLDNPKDSDGKSISQSMQ  215

Query  750   dpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFE  929
                    + ++    + E+++A+RQ+L  KK KLLSM+DEV++RYRQY H+MQ++V+S +
Sbjct  216   ITSGGPNDPNS--NPSCEISSAERQNLLDKKTKLLSMLDEVDKRYRQYCHRMQIVVSSLD  273

Query  930   QAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGSRLKFIDHHLP  1109
               AG G+A  YT LAL TIS+QFRCL+ AI++Q++   ++LGE+EG+   RL+++D  L 
Sbjct  274   MVAGGGAAEPYTTLALRTISRQFRCLRDAISNQVQVIQRNLGEQEGI--PRLRYVDQQLR  331

Query  1110  QQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRS  1289
             QQ+ALQHLG+M+  AWRPQRGLPE +VS+LRAWLFEHFL+PYPKDS+KIMLA+QTGLTR+
Sbjct  332   QQKALQHLGVMRQ-AWRPQRGLPENSVSILRAWLFEHFLNPYPKDSEKIMLARQTGLTRN  390

Query  1290  QVSNWFINARV  1322
             QV+NWFINARV
Sbjct  391   QVANWFINARV  401



>ref|XP_003576293.1| PREDICTED: BEL1-like homeodomain protein 1 [Brachypodium distachyon]
 ref|XP_010237922.1| PREDICTED: BEL1-like homeodomain protein 1 [Brachypodium distachyon]
 ref|XP_010237923.1| PREDICTED: BEL1-like homeodomain protein 1 [Brachypodium distachyon]
Length=671

 Score =   268 bits (684),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 154/256 (60%), Positives = 183/256 (71%), Gaps = 24/256 (9%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             +  SKYL+AAQELLDEVV+V K   +D  +         +KK+                G
Sbjct  175   VMSSKYLRAAQELLDEVVSVSKQGGIDDVDGKQEAAAKSVKKKEE------------EEG  222

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
                A   +A E++TA+RQ+LQMKK KL++M+DEVEQRYRQYH QM+ + +SFE  AG G+
Sbjct  223   GEDAAGKSAPEMSTAERQELQMKKGKLVNMLDEVEQRYRQYHGQMRSVSSSFESLAGAGA  282

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGE-----------EEGVRGSRLKFID  1097
             AR+YT LAL TIS+QFRCL+ AIA QI+A S++LGE                GSRL++ID
Sbjct  283   ARTYTSLALRTISRQFRCLRDAIAGQIRAASRALGEDLGDLSGGGGGRGSGVGSRLRYID  342

Query  1098  HHLPQQRALQHLGMMQ-PNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQT  1274
             H L QQRALQ LGMMQ  +AWRPQRGLPER+VSVLRAWLFEHFLHPYPKDSDKIMLAKQT
Sbjct  343   HQLRQQRALQQLGMMQGSSAWRPQRGLPERSVSVLRAWLFEHFLHPYPKDSDKIMLAKQT  402

Query  1275  GLTRSQVSNWFINARV  1322
             GLTRSQVSNWFINARV
Sbjct  403   GLTRSQVSNWFINARV  418



>ref|XP_003631586.1| PREDICTED: BEL1-like homeodomain protein 3 [Vitis vinifera]
 ref|XP_010647690.1| PREDICTED: BEL1-like homeodomain protein 3 [Vitis vinifera]
Length=691

 Score =   268 bits (684),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 161/284 (57%), Positives = 201/284 (71%), Gaps = 16/284 (6%)
 Frame = +3

Query  501   PVGLLSARPGAAHDNSGASSSSITHGISGF---ITGSKYLKAAQELLDEVVNVEKSLKL-  668
             P G+L    GA  D+     SS  +G+S     I  SKYLKAAQ+LLDEVVNV K+LK  
Sbjct  190   PPGVL----GANQDSIKVDPSS--YGMSSIARTIPHSKYLKAAQQLLDEVVNVRKALKQP  243

Query  669   DaaeeaankekakmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAK  848
             D+ +     E  K  KE+        G  P +         +++EL+ A+RQDLQ K  K
Sbjct  244   DSEKNQNIHELWKGSKEADVGLKNGTGMTPAASNPQEPVSNSSSELSPAERQDLQNKLTK  303

Query  849   LLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQ  1028
             LL+M+DEV++RY+QY+HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI  Q
Sbjct  304   LLAMLDEVDRRYKQYYHQMQIVVSSFDVIAGSGAAKPYTALALQTISRHFRCLRDAITGQ  363

Query  1029  IKATSKSLGEEE------GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAV  1190
             I+AT +SLGE++      GV  SRL+++D  L QQRALQ LGMMQ +AWRPQRGLPE +V
Sbjct  364   IRATRRSLGEQDTSGNGKGVGISRLRYVDQQLRQQRALQQLGMMQQHAWRPQRGLPESSV  423

Query  1191  SVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             S+LRAWLFEHFLHPYPKDSDKIMLA+QTGLTRSQVSNWFINARV
Sbjct  424   SILRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQVSNWFINARV  467



>ref|XP_007135942.1| hypothetical protein PHAVU_009G004800g [Phaseolus vulgaris]
 gb|ESW07936.1| hypothetical protein PHAVU_009G004800g [Phaseolus vulgaris]
Length=645

 Score =   266 bits (681),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 141/260 (54%), Positives = 181/260 (70%), Gaps = 11/260 (4%)
 Frame = +3

Query  573   HGISG---FITGSKYLKAAQELLDEVVNVEKSLKL-DaaeeaankekakmkkeSMPPFgg  740
             HGIS     +  SKYLKA Q+LLDEVV++ +++K  +      ++   K  KE       
Sbjct  162   HGISSAGRTVPSSKYLKAVQQLLDEVVDIRQAIKRPETRSYGTHENSTKNSKEGDEHLLN  221

Query  741   cggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVA  920
                         ++   ++ EL+  ++QDLQ K AKLLSM+DEV+ RY+QY+ +MQ +V+
Sbjct  222   ERSSVNVVPNSQASASNSSCELSHTEKQDLQRKLAKLLSMLDEVDSRYKQYYQKMQNVVS  281

Query  921   SFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE------GVRGSR  1082
             SF+  AG G+A+ YT LAL TIS  FRCL+ AI+ QI+AT K LGE +      GV  +R
Sbjct  282   SFDVVAGCGAAKPYTALALQTISCHFRCLRDAISGQIRATRKRLGEHDASGSNKGVGMAR  341

Query  1083  LKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIML  1262
             LK++DH + QQRA+Q LGMMQ +AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K ML
Sbjct  342   LKYVDHQVRQQRAIQQLGMMQ-HAWRPQRGLPESSVSILRAWLFEHFLHPYPKDSEKTML  400

Query  1263  AKQTGLTRSQVSNWFINARV  1322
             AKQTGLTRSQVSNWFINARV
Sbjct  401   AKQTGLTRSQVSNWFINARV  420



>ref|XP_009396357.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=632

 Score =   266 bits (679),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 134/249 (54%), Positives = 173/249 (69%), Gaps = 7/249 (3%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  SKYL+ AQELLDEVVNV  +LK     + +    +     +     G       +  
Sbjct  183   IPNSKYLRIAQELLDEVVNVGSALK--QRADKSQSHPSADGALTCKDGSGESKSEGMASN  240

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
                A    + EL+ ++RQDLQ K +KLL M+DEV++RY+QY+HQMQ+IV+ F+  AG G+
Sbjct  241   PQEATVNYSNELSPSERQDLQNKVSKLLGMLDEVDRRYKQYYHQMQIIVSCFDAIAGCGA  300

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQ  1115
             A+ YT LAL TIS+ FRCL+ AI+ QI+A  K+LGE +   G     SRL++ID  L QQ
Sbjct  301   AKPYTALALQTISRHFRCLRDAISGQIQAIRKNLGEPDNTSGKGGGLSRLRYIDQQLRQQ  360

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA+Q  GMMQ + WRPQRGLPE +V +LRAWLFEHFL+PYPKDS+K+MLA+QTGL+RSQV
Sbjct  361   RAMQQFGMMQQHTWRPQRGLPESSVLILRAWLFEHFLNPYPKDSEKLMLARQTGLSRSQV  420

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  421   SNWFINARV  429



>ref|XP_008644604.1| PREDICTED: BEL1-like homeodomain protein 7 [Zea mays]
 gb|AFW67987.1| putative POX domain/homeobox DNA-binding domain family protein 
[Zea mays]
Length=639

 Score =   266 bits (680),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 135/249 (54%), Positives = 177/249 (71%), Gaps = 10/249 (4%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  SKYLKAAQELLDE+V+V KS+K    +  +   K+  K+      G           
Sbjct  195   IRNSKYLKAAQELLDEIVSVWKSVKQKTDKGPSEAGKSDGKETDG---GTKSEGVSFDPQ  251

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ES A    AAEL+TA++Q+LQ K  KL++M+DEV+++Y+ Y+H+MQ++++SF+  AG G+
Sbjct  252   ESGA--NTAAELSTAEKQELQNKMVKLMAMLDEVDRKYKHYYHRMQLVMSSFDMVAGSGA  309

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRGS-----RLKFIDHHLPQQ  1115
             A+ YT +AL TIS+ FRCLK AI  QI    K LGE++   G      RL++ID  + QQ
Sbjct  310   AKPYTAVALQTISRHFRCLKDAINDQISVIRKKLGEDDDASGKEGKLIRLRYIDQQIRQQ  369

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA Q  GM+Q NAWRPQRGLPE +VS+LRAWLFEHFLHPYPKDS+K+ML++QTGLTRSQ+
Sbjct  370   RAFQQYGMLQQNAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSEKLMLSRQTGLTRSQI  429

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  430   SNWFINARV  438



>ref|XP_002465808.1| hypothetical protein SORBIDRAFT_01g046170 [Sorghum bicolor]
 gb|EER92806.1| hypothetical protein SORBIDRAFT_01g046170 [Sorghum bicolor]
Length=590

 Score =   265 bits (676),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 135/263 (51%), Positives = 188/263 (71%), Gaps = 14/263 (5%)
 Frame = +3

Query  552   ASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPP  731
             AS+++  +  S +I  SKYLKAA+ELLDEVVNV  ++K   A++    + +  + +    
Sbjct  136   ASAAASRNAQSIYIQNSKYLKAARELLDEVVNVRDAIKRKGADKNQQGKDSGGEGKD---  192

Query  732   FggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQV  911
                   +      +     ++AAELT ++RQDLQ K + L++++D+V+++YR YHHQMQ+
Sbjct  193   -----AETSDDKADEHEGNSSAAELTPSERQDLQNKVSALMALLDQVDRKYRHYHHQMQI  247

Query  912   IVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE----GVRGS  1079
             +++SF+  AG G+AR YT LAL TIS+ FR L+ A+ +Q+++  +SLGE++    G   S
Sbjct  248   VMSSFDAVAGAGAARPYTALALQTISRHFRSLRDAVGAQVQSLRRSLGEKDTSAHGGGLS  307

Query  1080  RLKFIDHHLPQQRALQHLGMMQP--NAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDK  1253
             RL++ID  L QQRA+Q  GMMQ   +AWRPQRGLPE AVSVLRAWLFEHFLHPYPKDS+K
Sbjct  308   RLRYIDQQLRQQRAMQQFGMMQQPQHAWRPQRGLPESAVSVLRAWLFEHFLHPYPKDSEK  367

Query  1254  IMLAKQTGLTRSQVSNWFINARV  1322
             +MLA+QTGL+R QVSNWFINARV
Sbjct  368   LMLARQTGLSRGQVSNWFINARV  390



>ref|XP_010028619.1| PREDICTED: BEL1-like homeodomain protein 7 [Eucalyptus grandis]
 ref|XP_010028620.1| PREDICTED: BEL1-like homeodomain protein 7 [Eucalyptus grandis]
 ref|XP_010028621.1| PREDICTED: BEL1-like homeodomain protein 7 [Eucalyptus grandis]
 gb|KCW55381.1| hypothetical protein EUGRSUZ_I01293 [Eucalyptus grandis]
Length=669

 Score =   266 bits (681),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 152/272 (56%), Positives = 198/272 (73%), Gaps = 18/272 (7%)
 Frame = +3

Query  528   GAAHD-NSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankeka  704
             GA  D N+G  S +    +S  ++ S+YL+AAQ+LLDEVVNV K+LK         +  +
Sbjct  190   GANQDLNTGNFSVNGMSNMSRMLSNSRYLRAAQQLLDEVVNVRKALK---------QSDS  240

Query  705   kmkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRY  884
             +  K+S         D  ++  ES     +A +L+ A+RQ+LQ K AKL SM+DEV++RY
Sbjct  241   EKIKKSEEGDEDSKKDVVSNPQESDG--NSAGDLSQAERQELQSKLAKLSSMLDEVDRRY  298

Query  885   RQYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE  1064
             +QY++QMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI++QI+AT KSLGE++
Sbjct  299   KQYYYQMQIVVSSFDVIAGPGAAKPYTALALQTISRHFRCLRDAISTQIQATRKSLGEQD  358

Query  1065  ------GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFL  1226
                   GV   RL+F+D  L QQRALQ LGMMQ +AWRPQRGLPE +VS+LRAWLFEHFL
Sbjct  359   ASGSSKGVGIPRLRFLDQQLRQQRALQQLGMMQQHAWRPQRGLPESSVSILRAWLFEHFL  418

Query  1227  HPYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             HPYPKDSDKI+LA+QTGLTRSQVSNWFINARV
Sbjct  419   HPYPKDSDKILLARQTGLTRSQVSNWFINARV  450



>ref|XP_007042091.1| BEL1-like homeodomain protein 6 isoform 1 [Theobroma cacao]
 ref|XP_007042092.1| BEL1-like homeodomain protein 6 isoform 1 [Theobroma cacao]
 gb|EOX97922.1| BEL1-like homeodomain protein 6 isoform 1 [Theobroma cacao]
 gb|EOX97923.1| BEL1-like homeodomain protein 6 isoform 1 [Theobroma cacao]
Length=680

 Score =   267 bits (682),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 185/271 (68%), Gaps = 11/271 (4%)
 Frame = +3

Query  528   GAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekak  707
             G    N G  S+     I+  I  SKYLKAAQ+LLDEVVNV K+LK    E+  + +   
Sbjct  192   GNQDSNKGDMSAYGMSSIARTIPNSKYLKAAQQLLDEVVNVRKALKQPDGEKNQSSQDRM  251

Query  708   mkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYR  887
                          G       +      +  EL+ A+RQ+LQ K  KL SM+DEV++RY+
Sbjct  252   KSSTD-----DDRGSKNVPSNQQECSNNSPNELSHAERQELQSKLTKLSSMLDEVDRRYK  306

Query  888   QYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE-  1064
             QY+HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL+ AI  QI+ T K+LGE++ 
Sbjct  307   QYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLRDAINGQIRVTRKNLGEQDT  366

Query  1065  -----GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLH  1229
                  GV  SRL+++D  L QQRALQ LGMMQ +AWRPQRGLPE +VS+LRAWLFEHFLH
Sbjct  367   SENSKGVGISRLRYVDQQLRQQRALQQLGMMQQHAWRPQRGLPESSVSILRAWLFEHFLH  426

Query  1230  PYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PYPKDSDKIMLA+QTGLTRSQVSNWFINARV
Sbjct  427   PYPKDSDKIMLARQTGLTRSQVSNWFINARV  457



>ref|XP_009396355.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396356.1| PREDICTED: BEL1-like homeodomain protein 7 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=665

 Score =   266 bits (680),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 134/249 (54%), Positives = 173/249 (69%), Gaps = 7/249 (3%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  SKYL+ AQELLDEVVNV  +LK     + +    +     +     G       +  
Sbjct  216   IPNSKYLRIAQELLDEVVNVGSALK--QRADKSQSHPSADGALTCKDGSGESKSEGMASN  273

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
                A    + EL+ ++RQDLQ K +KLL M+DEV++RY+QY+HQMQ+IV+ F+  AG G+
Sbjct  274   PQEATVNYSNELSPSERQDLQNKVSKLLGMLDEVDRRYKQYYHQMQIIVSCFDAIAGCGA  333

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG-----SRLKFIDHHLPQQ  1115
             A+ YT LAL TIS+ FRCL+ AI+ QI+A  K+LGE +   G     SRL++ID  L QQ
Sbjct  334   AKPYTALALQTISRHFRCLRDAISGQIQAIRKNLGEPDNTSGKGGGLSRLRYIDQQLRQQ  393

Query  1116  RALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQV  1295
             RA+Q  GMMQ + WRPQRGLPE +V +LRAWLFEHFL+PYPKDS+K+MLA+QTGL+RSQV
Sbjct  394   RAMQQFGMMQQHTWRPQRGLPESSVLILRAWLFEHFLNPYPKDSEKLMLARQTGLSRSQV  453

Query  1296  SNWFINARV  1322
             SNWFINARV
Sbjct  454   SNWFINARV  462



>ref|XP_004173415.1| PREDICTED: BEL1-like homeodomain protein 6-like [Cucumis sativus]
Length=681

 Score =   266 bits (680),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 148/259 (57%), Positives = 190/259 (73%), Gaps = 11/259 (4%)
 Frame = +3

Query  579   ISGFITGSKYLKAAQELLDEVVNVEKSLKL--DaaeeaankekakmkkeSMPPFggcggd  752
             I+  +  SKYLKAAQ+LLDEVVNV K+LK   +   +++++ + +  K            
Sbjct  203   IARTMPNSKYLKAAQQLLDEVVNVRKALKRPNNDRNQSSHEHETRSAKNGDTGTKNDSSM  262

Query  753   pptsggESSAQKTAA---AELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVAS  923
                SG  S+ Q+T +    EL+ A++QDLQ K  KLL M+DEV++RY QY+HQMQ++V+S
Sbjct  263   LTASGTSSNPQETGSNSTCELSHAEKQDLQNKLTKLLYMLDEVDRRYNQYYHQMQIVVSS  322

Query  924   FEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE------GVRGSRL  1085
             F+  AG G+++ YT LAL TIS+ FRCL+ AIA Q++AT KSLGE E      GV  +RL
Sbjct  323   FDVIAGCGASKPYTALALQTISRHFRCLRDAIAGQVRATRKSLGEHENSGSDKGVGITRL  382

Query  1086  KFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLA  1265
             +++D  L QQRALQ LGM+Q +AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDSDKIMLA
Sbjct  383   RYVDQQLRQQRALQQLGMIQQHAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSDKIMLA  442

Query  1266  KQTGLTRSQVSNWFINARV  1322
             +QTGLTRSQVSNWFINARV
Sbjct  443   RQTGLTRSQVSNWFINARV  461



>ref|XP_006581113.1| PREDICTED: BEL1-like homeodomain protein 6-like [Glycine max]
Length=556

 Score =   263 bits (672),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 138/247 (56%), Positives = 170/247 (69%), Gaps = 8/247 (3%)
 Frame = +3

Query  603   KYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsggESSA  782
             KYLKA Q LLDEVV++ K++K       +  E +K                      S A
Sbjct  212   KYLKAVQLLLDEVVDIRKAIKRPVVRSYSTHENSKKNSNEDDEQLENDRPSANGVPNSQA  271

Query  783   QKT-AAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGSARS  959
               +  + EL+ A++QDL  K  KLLSM+DEV+ RY+QY+ QMQ++V+SF+  AG G+A+ 
Sbjct  272   STSKTSCELSHAEKQDLHHKLTKLLSMLDEVDNRYKQYYQQMQIVVSSFDVVAGCGAAKP  331

Query  960   YTHLALNTISKQFRCLKVAIASQIKATSKSLGEE------EGVRGSRLKFIDHHLPQQRA  1121
             YT LAL TIS  FRCL+ AI  QI AT K+LGE+      +GV  +RLK++D  + QQR 
Sbjct  332   YTALALQTISCHFRCLRDAITGQISATQKNLGEQNASGSNKGVGMTRLKYMDQQIRQQRV  391

Query  1122  LQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSN  1301
             LQ LGMMQ +AWRPQRGLPE +V +LRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSN
Sbjct  392   LQQLGMMQ-HAWRPQRGLPESSVVILRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQVSN  450

Query  1302  WFINARV  1322
             WFINARV
Sbjct  451   WFINARV  457



>ref|XP_008460982.1| PREDICTED: BEL1-like homeodomain protein 7 [Cucumis melo]
 ref|XP_008460983.1| PREDICTED: BEL1-like homeodomain protein 7 [Cucumis melo]
 ref|XP_008460984.1| PREDICTED: BEL1-like homeodomain protein 7 [Cucumis melo]
 ref|XP_008460985.1| PREDICTED: BEL1-like homeodomain protein 7 [Cucumis melo]
Length=675

 Score =   266 bits (679),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 149/259 (58%), Positives = 189/259 (73%), Gaps = 11/259 (4%)
 Frame = +3

Query  579   ISGFITGSKYLKAAQELLDEVVNVEKSLKL--DaaeeaankekakmkkeSMPPFggcggd  752
             I+  +  SKYLKAAQ+LLDEVVNV K+LK   +   +++ + + K  K            
Sbjct  197   IARTMPNSKYLKAAQQLLDEVVNVRKALKRPNNERNQSSPEHETKSAKNGDAGTKNDSSM  256

Query  753   pptsggESSAQKT---AAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVAS  923
                SG  S+ Q+T   +  EL+ A++QDLQ K  KLL M+DEV++RY QY+HQMQ++V+S
Sbjct  257   LTASGTSSNPQETGSNSTCELSHAEKQDLQNKLTKLLYMLDEVDRRYNQYYHQMQIVVSS  316

Query  924   FEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE------GVRGSRL  1085
             F+  AG G+++ YT LAL TIS+ FRCL+ AIA Q++AT KSLGE E      GV  +RL
Sbjct  317   FDVIAGCGASKPYTALALQTISRHFRCLRDAIAGQVRATRKSLGEHENSGSDKGVGITRL  376

Query  1086  KFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLA  1265
             +++D  L QQRALQ LGM+Q +AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDSDKIMLA
Sbjct  377   RYVDQQLRQQRALQQLGMIQQHAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSDKIMLA  436

Query  1266  KQTGLTRSQVSNWFINARV  1322
             +QTGLTRSQVSNWFINARV
Sbjct  437   RQTGLTRSQVSNWFINARV  455



>ref|XP_010275538.1| PREDICTED: BEL1-like homeodomain protein 6 [Nelumbo nucifera]
 ref|XP_010275539.1| PREDICTED: BEL1-like homeodomain protein 6 [Nelumbo nucifera]
 ref|XP_010275540.1| PREDICTED: BEL1-like homeodomain protein 6 [Nelumbo nucifera]
Length=738

 Score =   267 bits (683),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 147/256 (57%), Positives = 182/256 (71%), Gaps = 6/256 (2%)
 Frame = +3

Query  573   HGISGF---ITGSKYLKAAQELLDEVVNVEKSLKL-DaaeeaankekakmkkeSMPPFgg  740
             +G+SG    I  SKYLKAAQ+LLDEVVNV   LK  D+ ++     K           G 
Sbjct  260   YGMSGLPSTIPNSKYLKAAQQLLDEVVNVRSVLKQSDSNKQQNLGLKGSKDTYEEQKGGT  319

Query  741   cggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVA  920
                             T +AE++ A+RQDLQ K  KLL+M+DEV++RY+QYHHQMQ++V+
Sbjct  320   SLPSTDGMPSNPQESSTNSAEISPAERQDLQNKMTKLLAMLDEVDRRYKQYHHQMQIVVS  379

Query  921   SFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE--GVRGSRLKFI  1094
             SF+  AG G+A+ YT LAL TIS+ FRCL+ AI+ QI A   SLGE++  GV  SRL+++
Sbjct  380   SFDVIAGSGAAKPYTALALQTISRHFRCLRDAISGQIHAIRTSLGEQDSKGVGISRLRYV  439

Query  1095  DHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQT  1274
             D  L QQRALQ  GMMQ +AWRPQRGLPE +VS+LRAWLFEHFLHPYPKD++KIMLA+QT
Sbjct  440   DQQLRQQRALQQFGMMQQHAWRPQRGLPESSVSILRAWLFEHFLHPYPKDAEKIMLARQT  499

Query  1275  GLTRSQVSNWFINARV  1322
             GLTRSQVSNWFINARV
Sbjct  500   GLTRSQVSNWFINARV  515



>ref|XP_004150064.1| PREDICTED: BEL1-like homeodomain protein 6-like [Cucumis sativus]
 gb|KGN61831.1| hypothetical protein Csa_2G249860 [Cucumis sativus]
Length=681

 Score =   266 bits (680),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 148/259 (57%), Positives = 190/259 (73%), Gaps = 11/259 (4%)
 Frame = +3

Query  579   ISGFITGSKYLKAAQELLDEVVNVEKSLKL--DaaeeaankekakmkkeSMPPFggcggd  752
             I+  +  SKYLKAAQ+LLDEVVNV K+LK   +   +++++ + +  K            
Sbjct  203   IARTMPNSKYLKAAQQLLDEVVNVRKALKRPNNDRNQSSHEHETRSAKNGDTGTKNDSSM  262

Query  753   pptsggESSAQKTAA---AELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVAS  923
                SG  S+ Q+T +    EL+ A++QDLQ K  KLL M+DEV++RY QY+HQMQ++V+S
Sbjct  263   LTASGTSSNPQETGSNSTCELSHAEKQDLQNKLTKLLYMLDEVDRRYNQYYHQMQIVVSS  322

Query  924   FEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE------GVRGSRL  1085
             F+  AG G+++ YT LAL TIS+ FRCL+ AIA Q++AT KSLGE E      GV  +RL
Sbjct  323   FDVIAGCGASKPYTALALQTISRHFRCLRDAIAGQVRATRKSLGEHENSGSDKGVGITRL  382

Query  1086  KFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLA  1265
             +++D  L QQRALQ LGM+Q +AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDSDKIMLA
Sbjct  383   RYVDQQLRQQRALQQLGMIQQHAWRPQRGLPENSVSILRAWLFEHFLHPYPKDSDKIMLA  442

Query  1266  KQTGLTRSQVSNWFINARV  1322
             +QTGLTRSQVSNWFINARV
Sbjct  443   RQTGLTRSQVSNWFINARV  461



>ref|XP_002512955.1| bel1 homeotic protein, putative [Ricinus communis]
 gb|EEF49458.1| bel1 homeotic protein, putative [Ricinus communis]
Length=677

 Score =   266 bits (679),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 194/271 (72%), Gaps = 10/271 (4%)
 Frame = +3

Query  528   GAAHDNSGASSSSITHGISGFITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekak  707
             G    N GA S      ++  I  SKYLKAAQ+LLDEVV+V K+LK    ++  N+ + +
Sbjct  188   GNQDSNKGALSPYGITSVARTIPSSKYLKAAQQLLDEVVSVRKALK--QPDKEKNQNRDE  245

Query  708   mkkeSMPPFggcggdpptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYR  887
                 S     G   D  ++  ES+    +  EL+  +RQ+LQ K  KLLSM+DEV++RY+
Sbjct  246   HGMNSSNEGDGKSKDGSSNPQEST--NNSPNELSHGERQELQNKLTKLLSMLDEVDRRYK  303

Query  888   QYHHQMQVIVASFEQAAGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEE-  1064
             QY+HQMQ++V+SF+  AG G+A+ YT LAL TIS+ FRCL  AI+ QI+AT KSLGE+E 
Sbjct  304   QYYHQMQIVVSSFDVIAGCGAAKPYTALALQTISRHFRCLLDAISGQIRATRKSLGEQET  363

Query  1065  -----GVRGSRLKFIDHHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLH  1229
                  GV  +RL+++D  L QQRALQ LGMMQ +AWRPQRGLPE +VS+LRAWLFEHFLH
Sbjct  364   SENGKGVGITRLRYVDQQLRQQRALQQLGMMQQHAWRPQRGLPESSVSILRAWLFEHFLH  423

Query  1230  PYPKDSDKIMLAKQTGLTRSQVSNWFINARV  1322
             PYPKDSDKIMLA+QTGLTRSQVSNWFINARV
Sbjct  424   PYPKDSDKIMLARQTGLTRSQVSNWFINARV  454



>ref|XP_009138307.1| PREDICTED: BEL1-like homeodomain protein 6 [Brassica rapa]
 ref|XP_009138308.1| PREDICTED: BEL1-like homeodomain protein 6 [Brassica rapa]
 ref|XP_009138309.1| PREDICTED: BEL1-like homeodomain protein 6 [Brassica rapa]
Length=528

 Score =   261 bits (668),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 140/255 (55%), Positives = 171/255 (67%), Gaps = 37/255 (15%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKL-----DaaeeaankekakmkkeSMPPFggcggdp  755
             I  SKYLKAAQELLDE VNV+KSLK      D  +E   +     +  +M P        
Sbjct  141   IPNSKYLKAAQELLDEAVNVKKSLKQFQPEGDKNKENPQETDKNPQDSNMNP--------  192

Query  756   ptsggESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQA  935
                           AE++ ++RQ+L  K  KLLSM+DEV++RY+QY+ QMQ++V+SF+  
Sbjct  193   -------------PAEISQSERQELHNKLTKLLSMLDEVDRRYKQYYQQMQIVVSSFDVI  239

Query  936   AGVGSARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEGVRG------SRLKFID  1097
             AG G+A+ YT LAL TIS+ FR L+ AI+ QI  T K LGE++G  G      SRLK++D
Sbjct  240   AGYGAAKPYTALALQTISRHFRSLRDAISGQIVVTRKCLGEQDGSDGKGVGTISRLKYVD  299

Query  1098  HHLPQQRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTG  1277
              HL QQR     G MQP AWRPQRGLPE +V VLRAWLFEHFLHPYPKDSDKIMLA+QTG
Sbjct  300   QHLRQQR-----GFMQPQAWRPQRGLPENSVLVLRAWLFEHFLHPYPKDSDKIMLARQTG  354

Query  1278  LTRSQVSNWFINARV  1322
             L+R QVSNWFINARV
Sbjct  355   LSRGQVSNWFINARV  369



>gb|KHG17019.1| BEL1-like homeodomain protein 6 [Gossypium arboreum]
Length=626

 Score =   263 bits (673),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 146/250 (58%), Positives = 186/250 (74%), Gaps = 10/250 (4%)
 Frame = +3

Query  591   ITGSKYLKAAQELLDEVVNVEKSLKLDaaeeaankekakmkkeSMPPFggcggdpptsgg  770
             I  SKYLKAAQ+LLDEVVNV+K+LK    +   N+   + + +S     G   + P +  
Sbjct  164   IPNSKYLKAAQQLLDEVVNVQKALK--QPDGEKNRNSLENRVKSSKEDDGGSKNVPANQQ  221

Query  771   ESSAQKTAAAELTTAQRQDLQMKKAKLLSMVDEVEQRYRQYHHQMQVIVASFEQAAGVGS  950
             ESS    +  EL+ A+RQ+LQ K  KLLSM+DEV++RY+QY+HQMQ++V+SF+  AG G+
Sbjct  222   ESSI--NSPKELSHAERQELQSKLTKLLSMLDEVDRRYKQYYHQMQIVVSSFDALAGCGA  279

Query  951   ARSYTHLALNTISKQFRCLKVAIASQIKATSKSLGEEEG------VRGSRLKFIDHHLPQ  1112
             ++ YT LAL TIS+ FRCL+ AI  Q++AT  SLGE +       +R +RL+++D  L Q
Sbjct  280   SKPYTALALQTISRHFRCLRDAINGQVQATRTSLGELDASENSKELRITRLRYVDQQLRQ  339

Query  1113  QRALQHLGMMQPNAWRPQRGLPERAVSVLRAWLFEHFLHPYPKDSDKIMLAKQTGLTRSQ  1292
             QRALQ  GMMQ +AWRPQRGLPE +VS+LRAWLFEHFLHPYPKDSDKIMLA+QTGLTRSQ
Sbjct  340   QRALQQFGMMQQHAWRPQRGLPESSVSILRAWLFEHFLHPYPKDSDKIMLARQTGLTRSQ  399

Query  1293  VSNWFINARV  1322
             VSNWFINARV
Sbjct  400   VSNWFINARV  409



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3440634590592