BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16479_g2_i1 len=991 path=[5155:0-170 901:171-211 3572:212-990]

Length=991
                                                                      Score     E

ref|XP_009787085.1|  PREDICTED: serine/threonine-protein kinase-l...    375   1e-123   
ref|XP_009602383.1|  PREDICTED: serine/threonine-protein kinase-l...    372   2e-122   
ref|XP_006345390.1|  PREDICTED: serine/threonine-protein kinase-l...    368   9e-121   
ref|XP_004229679.1|  PREDICTED: serine/threonine-protein kinase-l...    367   3e-120   
ref|XP_010659216.1|  PREDICTED: serine/threonine-protein kinase-l...    362   1e-118   
ref|XP_002271281.1|  PREDICTED: serine/threonine-protein kinase-l...    361   4e-118   Vitis vinifera
ref|XP_011088115.1|  PREDICTED: serine/threonine-protein kinase-l...    362   6e-118   
ref|XP_008356751.1|  PREDICTED: serine/threonine-protein kinase-l...    353   8e-115   
ref|XP_008346948.1|  PREDICTED: serine/threonine-protein kinase-l...    351   5e-114   
ref|XP_009368073.1|  PREDICTED: serine/threonine-protein kinase-l...    351   1e-113   
ref|XP_007217936.1|  hypothetical protein PRUPE_ppa004965mg             348   7e-113   
gb|EYU27012.1|  hypothetical protein MIMGU_mgv1a025641mg                345   2e-112   
ref|XP_008231535.1|  PREDICTED: serine/threonine-protein kinase-l...    347   4e-112   
ref|XP_010067787.1|  PREDICTED: serine/threonine-protein kinase-l...    346   7e-112   
ref|XP_004303089.1|  PREDICTED: serine/threonine-protein kinase-l...    344   2e-111   
ref|XP_006438927.1|  hypothetical protein CICLE_v10031354mg             344   3e-111   
ref|XP_010694683.1|  PREDICTED: serine/threonine-protein kinase-l...    343   5e-111   
emb|CDP14372.1|  unnamed protein product                                343   1e-110   
emb|CAN82122.1|  hypothetical protein VITISV_009093                     362   3e-110   Vitis vinifera
ref|XP_007052432.1|  Serine/threonine-protein kinase protein            339   1e-109   
ref|XP_011091782.1|  PREDICTED: serine/threonine-protein kinase-l...    340   2e-109   
ref|XP_009354393.1|  PREDICTED: serine/threonine-protein kinase-l...    338   7e-109   
ref|XP_004149730.1|  PREDICTED: serine/threonine-protein kinase-l...    337   1e-108   
ref|XP_008354911.1|  PREDICTED: serine/threonine-protein kinase-l...    337   1e-108   
ref|XP_008461833.1|  PREDICTED: serine/threonine-protein kinase-l...    335   2e-108   
ref|XP_010279526.1|  PREDICTED: serine/threonine-protein kinase-l...    337   2e-108   
ref|XP_011025511.1|  PREDICTED: serine/threonine-protein kinase-l...    334   2e-107   
ref|XP_007131433.1|  hypothetical protein PHAVU_011G013100g             334   3e-107   
gb|KDP43611.1|  hypothetical protein JCGZ_16898                         334   3e-107   
ref|XP_010269712.1|  PREDICTED: serine/threonine-protein kinase-l...    334   4e-107   
ref|XP_002527952.1|  Protein kinase APK1B, chloroplast precursor,...    332   9e-107   Ricinus communis
ref|XP_006587692.1|  PREDICTED: serine/threonine-protein kinase-l...    332   1e-106   
gb|KHN11713.1|  Serine/threonine-protein kinase-like protein            332   2e-106   
ref|XP_006379076.1|  hypothetical protein POPTR_0009s06000g             331   3e-106   
ref|XP_011025513.1|  PREDICTED: serine/threonine-protein kinase-l...    331   3e-106   
ref|XP_011008277.1|  PREDICTED: serine/threonine-protein kinase-l...    327   2e-105   
ref|XP_010557823.1|  PREDICTED: serine/threonine-protein kinase-l...    327   2e-105   
ref|XP_010548808.1|  PREDICTED: serine/threonine-protein kinase-l...    327   3e-105   
ref|XP_006591991.1|  PREDICTED: serine/threonine-protein kinase-l...    328   5e-105   
emb|CBI28598.3|  unnamed protein product                                320   9e-105   
ref|XP_004516233.1|  PREDICTED: serine/threonine-protein kinase-l...    318   4e-101   
gb|KEH29540.1|  Serine/Threonine kinase family protein                  316   2e-100   
ref|XP_008375289.1|  PREDICTED: serine/threonine-protein kinase-l...    308   5e-99    
gb|KHN32393.1|  Serine/threonine-protein kinase-like protein            305   7e-98    
ref|XP_002298707.2|  hypothetical protein POPTR_0001s26810g             303   3e-96    Populus trichocarpa [western balsam poplar]
gb|EPS69242.1|  hypothetical protein M569_05525                         278   1e-87    
ref|XP_008778027.1|  PREDICTED: serine/threonine-protein kinase-l...    280   9e-86    
ref|XP_010926999.1|  PREDICTED: serine/threonine-protein kinase-l...    276   2e-84    
ref|XP_003568554.1|  PREDICTED: serine/threonine-protein kinase-l...    258   8e-77    
ref|NP_190767.1|  serine/threonine-protein kinase-like protein          251   1e-76    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006291374.1|  hypothetical protein CARUB_v10017513mg             250   2e-76    
ref|XP_002876113.1|  kinase family protein                              250   2e-76    
ref|XP_010503912.1|  PREDICTED: serine/threonine-protein kinase-l...    249   4e-76    
ref|XP_010426793.1|  PREDICTED: serine/threonine-protein kinase-l...    249   5e-76    
emb|CDX78052.1|  BnaA09g32470D                                          249   7e-76    
ref|XP_010515644.1|  PREDICTED: serine/threonine-protein kinase-l...    248   8e-76    
emb|CDX73669.1|  BnaC08g23340D                                          248   1e-75    
ref|XP_009115903.1|  PREDICTED: serine/threonine-protein kinase-l...    249   1e-75    
gb|KFK34450.1|  hypothetical protein AALP_AA5G147000                    247   2e-75    
ref|XP_006853039.1|  hypothetical protein AMTR_s00038p00022150          253   2e-75    
ref|XP_006403855.1|  hypothetical protein EUTSA_v10011161mg             247   4e-75    
gb|EYU42979.1|  hypothetical protein MIMGU_mgv1a017739mg                238   4e-72    
gb|ABR18424.1|  unknown                                                 243   4e-72    Picea sitchensis
gb|EMT32007.1|  Serine/threonine-protein kinase-like protein            242   5e-72    
ref|XP_009389632.1|  PREDICTED: serine/threonine-protein kinase-l...    243   7e-72    
ref|XP_010273041.1|  PREDICTED: serine/threonine-protein kinase-l...    236   5e-70    
gb|AFW81582.1|  putative protein kinase superfamily protein             239   6e-70    
ref|XP_009403351.1|  PREDICTED: serine/threonine-protein kinase-l...    238   6e-70    
gb|EEE63582.1|  hypothetical protein OsJ_18399                          235   3e-68    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010266446.1|  PREDICTED: serine/threonine-protein kinase-l...    233   2e-67    
ref|NP_001174402.1|  Os05g0387600                                       233   6e-67    
ref|XP_004962242.1|  PREDICTED: serine/threonine-protein kinase-l...    232   6e-67    
gb|EAY97886.1|  hypothetical protein OsI_19804                          232   8e-67    Oryza sativa Indica Group [Indian rice]
ref|XP_008649594.1|  PREDICTED: serine/threonine-protein kinase-l...    228   1e-65    
ref|XP_004299702.1|  PREDICTED: serine/threonine-protein kinase-l...    224   5e-65    
ref|XP_008338914.1|  PREDICTED: serine/threonine-protein kinase-l...    224   7e-65    
ref|XP_009373705.1|  PREDICTED: serine/threonine-protein kinase-l...    224   9e-65    
ref|XP_002439729.1|  hypothetical protein SORBIDRAFT_09g019110          225   3e-64    Sorghum bicolor [broomcorn]
ref|XP_007226245.1|  hypothetical protein PRUPE_ppa017880mg             219   1e-63    
emb|CBI19233.3|  unnamed protein product                                220   2e-63    
ref|XP_002285707.1|  PREDICTED: serine/threonine-protein kinase-l...    220   3e-63    Vitis vinifera
ref|XP_007136352.1|  hypothetical protein PHAVU_009G038000g             219   6e-63    
ref|XP_003523779.2|  PREDICTED: serine/threonine-protein kinase-l...    218   1e-62    
gb|KDP41453.1|  hypothetical protein JCGZ_15860                         218   3e-62    
ref|XP_010320196.1|  PREDICTED: serine/threonine-protein kinase-l...    217   3e-62    
ref|XP_006338093.1|  PREDICTED: serine/threonine-protein kinase-l...    216   4e-62    
ref|XP_009602564.1|  PREDICTED: serine/threonine-protein kinase-l...    216   6e-62    
ref|XP_003527876.1|  PREDICTED: serine/threonine-protein kinase-l...    215   1e-61    
emb|CAN75154.1|  hypothetical protein VITISV_035995                     219   1e-61    Vitis vinifera
ref|XP_009759754.1|  PREDICTED: serine/threonine-protein kinase-l...    215   1e-61    
ref|XP_003602947.1|  Wall-associated receptor kinase-like protein       214   1e-60    
ref|XP_010098661.1|  Serine/threonine-protein kinase-like protein       213   1e-60    
ref|XP_007018167.1|  Serine/threonine-protein kinase-like protein...    213   2e-60    
ref|XP_002993413.1|  hypothetical protein SELMODRAFT_44342              206   1e-59    
ref|XP_010060082.1|  PREDICTED: serine/threonine-protein kinase-l...    211   1e-59    
ref|XP_008444887.1|  PREDICTED: serine/threonine-protein kinase-l...    210   1e-59    
ref|XP_004152746.1|  PREDICTED: serine/threonine-protein kinase-l...    209   2e-59    
ref|XP_002514010.1|  protein with unknown function                      209   2e-59    Ricinus communis
ref|XP_004501618.1|  PREDICTED: serine/threonine-protein kinase-l...    209   9e-59    
ref|XP_006433873.1|  hypothetical protein CICLE_v10000878mg             208   9e-59    
ref|XP_006472515.1|  PREDICTED: serine/threonine-protein kinase-l...    208   1e-58    
ref|XP_011082721.1|  PREDICTED: serine/threonine-protein kinase-l...    206   4e-58    
gb|EPS60532.1|  hypothetical protein M569_14270                         201   5e-58    
ref|XP_011010390.1|  PREDICTED: serine/threonine-protein kinase-l...    204   4e-57    
ref|XP_002306551.2|  hypothetical protein POPTR_0005s17640g             203   6e-57    Populus trichocarpa [western balsam poplar]
ref|XP_010675502.1|  PREDICTED: serine/threonine-protein kinase-l...    202   1e-56    
ref|XP_008219383.1|  PREDICTED: serine/threonine-protein kinase-l...    202   2e-56    
ref|XP_006415662.1|  hypothetical protein EUTSA_v10007568mg             200   5e-56    
ref|XP_001763893.1|  predicted protein                                  196   8e-56    
ref|XP_003518250.1|  PREDICTED: serine/threonine-protein kinase-l...    197   1e-55    
ref|XP_010499365.1|  PREDICTED: serine/threonine-protein kinase-l...    199   2e-55    
ref|XP_010478211.1|  PREDICTED: serine/threonine-protein kinase-l...    198   3e-55    
ref|XP_006303715.1|  hypothetical protein CARUB_v10011837mg             198   4e-55    
emb|CDY35739.1|  BnaC03g58600D                                          196   1e-54    
gb|KFK44712.1|  hypothetical protein AALP_AA1G293100                    195   2e-54    
ref|XP_010460629.1|  PREDICTED: serine/threonine-protein kinase-l...    194   6e-54    
emb|CDX90148.1|  BnaA08g18360D                                          193   1e-53    
ref|XP_009109730.1|  PREDICTED: serine/threonine-protein kinase-l...    192   3e-53    
ref|XP_001762196.1|  predicted protein                                  189   4e-53    
ref|NP_174161.1|  serine/threonine-protein kinase-like protein          192   4e-53    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185106.1|  serine/threonine-protein kinase-like protein       191   8e-53    
ref|XP_002893526.1|  kinase family protein                              191   1e-52    
ref|XP_007141242.1|  hypothetical protein PHAVU_008G179300g             187   7e-52    
ref|XP_010530134.1|  PREDICTED: serine/threonine-protein kinase-l...    182   2e-49    
gb|KHN08253.1|  Serine/threonine-protein kinase-like protein            174   8e-48    
ref|XP_002529012.1|  Protein kinase APK1B, chloroplast precursor,...    170   1e-45    Ricinus communis
ref|XP_011014948.1|  PREDICTED: serine/threonine-protein kinase-l...    167   7e-45    
ref|XP_011047967.1|  PREDICTED: serine/threonine-protein kinase-l...    165   5e-44    
ref|XP_006389564.1|  hypothetical protein POPTR_0022s00890g             161   9e-43    
ref|XP_011092329.1|  PREDICTED: serine/threonine-protein kinase-l...    157   5e-41    
ref|XP_011028309.1|  PREDICTED: serine/threonine-protein kinase-l...    157   6e-41    
ref|XP_006385012.1|  hypothetical protein POPTR_0004s23060g             157   6e-41    
ref|XP_006372875.1|  epidermal differentiation family protein           163   7e-41    
ref|XP_011028310.1|  PREDICTED: serine/threonine-protein kinase-l...    157   7e-41    
gb|ACF80231.1|  unknown                                                 156   8e-41    Zea mays [maize]
ref|XP_011037092.1|  PREDICTED: serine/threonine-protein kinase-l...    162   1e-40    
ref|XP_009417009.1|  PREDICTED: putative receptor protein kinase ...    162   2e-40    
ref|XP_009607288.1|  PREDICTED: serine/threonine-protein kinase-l...    160   7e-40    
ref|XP_009593012.1|  PREDICTED: serine/threonine-protein kinase-l...    154   8e-40    
ref|XP_004230467.1|  PREDICTED: serine/threonine-protein kinase-l...    154   8e-40    
ref|XP_002264936.1|  PREDICTED: serine/threonine-protein kinase-l...    159   1e-39    Vitis vinifera
ref|XP_010522990.1|  PREDICTED: serine/threonine-protein kinase-l...    154   1e-39    
ref|XP_011088589.1|  PREDICTED: serine/threonine-protein kinase-l...    159   1e-39    
ref|XP_007041331.1|  Kinase APK1B, chloroplast, putative                154   1e-39    
ref|XP_004152097.1|  PREDICTED: serine/threonine-protein kinase-l...    159   1e-39    
ref|XP_009786187.1|  PREDICTED: serine/threonine-protein kinase-l...    154   1e-39    
ref|XP_010524151.1|  PREDICTED: serine/threonine-protein kinase-l...    159   1e-39    
ref|XP_008812970.1|  PREDICTED: serine/threonine-protein kinase-l...    153   1e-39    
ref|XP_006349428.1|  PREDICTED: serine/threonine-protein kinase-l...    154   2e-39    
ref|XP_008453980.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    159   2e-39    
ref|XP_010524149.1|  PREDICTED: serine/threonine-protein kinase-l...    159   2e-39    
ref|XP_002309807.2|  epidermal differentiation family protein           159   2e-39    Populus trichocarpa [western balsam poplar]
ref|XP_011012925.1|  PREDICTED: serine/threonine-protein kinase-l...    159   2e-39    
ref|XP_011026418.1|  PREDICTED: serine/threonine-protein kinase-l...    159   2e-39    
ref|XP_004250831.2|  PREDICTED: serine/threonine-protein kinase-l...    158   2e-39    
ref|XP_006859187.1|  hypothetical protein AMTR_s00070p00160180          152   3e-39    
ref|XP_008445995.1|  PREDICTED: serine/threonine-protein kinase-l...    152   3e-39    
ref|XP_008800064.1|  PREDICTED: putative receptor protein kinase ...    158   3e-39    
ref|XP_010930213.1|  PREDICTED: putative receptor protein kinase ...    158   4e-39    
gb|EYU26955.1|  hypothetical protein MIMGU_mgv1a007986mg                153   4e-39    
ref|XP_010275087.1|  PREDICTED: serine/threonine-protein kinase-l...    152   4e-39    
gb|KHN25294.1|  Serine/threonine-protein kinase-like protein ACR4       157   5e-39    
gb|EYU37937.1|  hypothetical protein MIMGU_mgv1a001147mg                157   6e-39    
ref|XP_003540697.2|  PREDICTED: serine/threonine-protein kinase-l...    157   7e-39    
ref|XP_009415049.1|  PREDICTED: putative receptor protein kinase ...    157   1e-38    
gb|KCW87886.1|  hypothetical protein EUGRSUZ_A00278                     154   1e-38    
gb|EPS72385.1|  hypothetical protein M569_02367                         156   1e-38    
ref|XP_006352076.1|  PREDICTED: serine/threonine-protein kinase-l...    156   1e-38    
ref|XP_010530555.1|  PREDICTED: serine/threonine-protein kinase-l...    151   1e-38    
ref|XP_008222558.1|  PREDICTED: serine/threonine-protein kinase-l...    156   1e-38    
gb|AAR96009.1|  crinkly4-like protein                                   156   1e-38    Musa acuminata [banana]
gb|KHN06205.1|  Serine/threonine-protein kinase-like protein ACR4       156   2e-38    
ref|XP_010064568.1|  PREDICTED: serine/threonine-protein kinase-l...    154   2e-38    
ref|XP_006650326.1|  PREDICTED: putative receptor protein kinase ...    156   2e-38    
ref|XP_009410126.1|  PREDICTED: serine/threonine-protein kinase-l...    150   2e-38    
ref|XP_004972946.1|  PREDICTED: putative receptor protein kinase ...    155   2e-38    
ref|XP_002441844.1|  hypothetical protein SORBIDRAFT_08g003290          155   2e-38    Sorghum bicolor [broomcorn]
emb|CDO97591.1|  unnamed protein product                                150   3e-38    
ref|XP_007131950.1|  hypothetical protein PHAVU_011G054300g             155   3e-38    
gb|KDP43834.1|  hypothetical protein JCGZ_20844                         155   3e-38    
ref|XP_008218769.1|  PREDICTED: serine/threonine-protein kinase-l...    150   3e-38    
ref|NP_001105395.1|  putative receptor protein kinase CRINKLY4 pr...    155   3e-38    Zea mays [maize]
gb|EMS46171.1|  hypothetical protein TRIUR3_24183                       149   3e-38    
gb|EEC75803.1|  hypothetical protein OsI_12742                          155   4e-38    Oryza sativa Indica Group [Indian rice]
ref|XP_009770850.1|  PREDICTED: serine/threonine-protein kinase-l...    155   4e-38    
ref|XP_007224380.1|  hypothetical protein PRUPE_ppa021630mg             149   5e-38    
ref|XP_009363637.1|  PREDICTED: serine/threonine-protein kinase-l...    155   5e-38    
ref|XP_008369139.1|  PREDICTED: serine/threonine-protein kinase-l...    155   5e-38    
ref|XP_007224894.1|  hypothetical protein PRUPE_ppa022122mg             154   5e-38    
gb|ABW81401.1|  receptor-like kinase CR4                                154   5e-38    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010268133.1|  PREDICTED: serine/threonine-protein kinase-l...    154   6e-38    
ref|NP_001050726.1|  Os03g0637800                                       154   6e-38    Oryza sativa Japonica Group [Japonica rice]
dbj|BAK05611.1|  predicted protein                                      154   6e-38    
ref|XP_008445994.1|  PREDICTED: serine/threonine-protein kinase-l...    149   6e-38    
emb|CDP10055.1|  unnamed protein product                                154   6e-38    
ref|XP_006852116.1|  hypothetical protein AMTR_s00049p00025350          154   7e-38    
ref|XP_002533445.1|  receptor protein kinase, putative                  154   7e-38    Ricinus communis
ref|XP_010268132.1|  PREDICTED: serine/threonine-protein kinase-l...    154   8e-38    
ref|XP_010030141.1|  PREDICTED: serine/threonine-protein kinase-l...    149   8e-38    
ref|XP_004979143.1|  PREDICTED: putative receptor protein kinase ...    154   9e-38    
ref|XP_004309815.1|  PREDICTED: serine/threonine-protein kinase-l...    153   2e-37    
ref|XP_009381900.1|  PREDICTED: serine/threonine-protein kinase-l...    148   2e-37    
ref|XP_004507428.1|  PREDICTED: serine/threonine-protein kinase-l...    153   2e-37    
ref|XP_010526052.1|  PREDICTED: serine/threonine-protein kinase-l...    152   3e-37    
ref|XP_003597519.1|  Serine/threonine protein kinase-like protein...    152   3e-37    
ref|XP_001754560.1|  predicted protein                                  152   4e-37    
gb|KDO47346.1|  hypothetical protein CISIN_1g002512mg                   152   4e-37    
ref|XP_006443034.1|  hypothetical protein CICLE_v10018759mg             152   4e-37    
gb|KGN51641.1|  hypothetical protein Csa_5G587120                       146   4e-37    
ref|XP_004135345.1|  PREDICTED: serine/threonine-protein kinase-l...    146   4e-37    
ref|XP_011092892.1|  PREDICTED: serine/threonine-protein kinase-l...    152   5e-37    
ref|XP_007033959.1|  Crinkly4                                           151   6e-37    
gb|KDP42413.1|  hypothetical protein JCGZ_00210                         146   8e-37    
ref|XP_003563239.1|  PREDICTED: putative receptor protein kinase ...    151   8e-37    
ref|XP_009355443.1|  PREDICTED: serine/threonine-protein kinase-l...    145   1e-36    
gb|EMS64811.1|  Putative receptor protein kinase CRINKLY4               150   1e-36    
gb|EMT10158.1|  Putative receptor protein kinase CRINKLY4               150   1e-36    
ref|XP_006494360.1|  PREDICTED: serine/threonine-protein kinase-l...    145   2e-36    
gb|KDO47796.1|  hypothetical protein CISIN_1g035572mg                   145   2e-36    
ref|XP_006431727.1|  hypothetical protein CICLE_v10003742mg             145   2e-36    
ref|XP_010672185.1|  PREDICTED: serine/threonine-protein kinase-l...    150   2e-36    
emb|CAI23709.1|  putative serine/threonine protein kinase               144   3e-36    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010939732.1|  PREDICTED: serine/threonine-protein kinase-l...    144   3e-36    
ref|XP_006402689.1|  hypothetical protein EUTSA_v10005780mg             149   3e-36    
emb|CAI23699.1|  putative serine/threonine protein kinase               144   3e-36    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007150432.1|  hypothetical protein PHAVU_005G153100g             149   4e-36    
ref|XP_010454598.1|  PREDICTED: serine/threonine-protein kinase-l...    144   4e-36    
ref|XP_002878271.1|  hypothetical protein ARALYDRAFT_486409             149   5e-36    
ref|NP_191501.1|  serine/threonine-protein kinase-like protein ACR4     149   5e-36    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512201.1|  PREDICTED: serine/threonine-protein kinase-l...    149   5e-36    
ref|XP_010469358.1|  PREDICTED: serine/threonine-protein kinase-l...    149   5e-36    
ref|XP_010413696.1|  PREDICTED: serine/threonine-protein kinase-l...    149   6e-36    
gb|KFK40245.1|  hypothetical protein AALP_AA3G349100                    149   6e-36    
ref|XP_003546987.1|  PREDICTED: serine/threonine-protein kinase-l...    148   6e-36    
ref|XP_010493432.1|  PREDICTED: serine/threonine-protein kinase-l...    143   7e-36    
ref|XP_008378888.1|  PREDICTED: serine/threonine-protein kinase-l...    143   7e-36    
emb|CDY66068.1|  BnaC08g48960D                                          147   7e-36    
gb|KHN33307.1|  Serine/threonine-protein kinase-like protein ACR4       148   7e-36    
emb|CDY06005.1|  BnaA09g37750D                                          147   8e-36    
ref|XP_002264141.1|  PREDICTED: serine/threonine-protein kinase-l...    143   1e-35    Vitis vinifera
gb|KHN30097.1|  Serine/threonine-protein kinase-like protein ACR4       147   1e-35    
ref|XP_003542059.1|  PREDICTED: serine/threonine-protein kinase-l...    147   1e-35    
ref|XP_009116601.1|  PREDICTED: serine/threonine-protein kinase-l...    147   1e-35    
gb|KEH30326.1|  receptor-like kinase                                    147   2e-35    
ref|XP_009345833.1|  PREDICTED: serine/threonine-protein kinase-l...    142   2e-35    
ref|XP_009355441.1|  PREDICTED: serine/threonine-protein kinase-l...    142   3e-35    
ref|XP_006288105.1|  hypothetical protein CARUB_v10001338mg             142   3e-35    
ref|XP_008813100.1|  PREDICTED: serine/threonine-protein kinase-l...    141   3e-35    
ref|XP_001770558.1|  predicted protein                                  140   4e-35    
ref|XP_006290261.1|  hypothetical protein CARUB_v10016669mg             145   7e-35    
ref|XP_009391628.1|  PREDICTED: serine/threonine-protein kinase-l...    140   1e-34    
ref|XP_010421116.1|  PREDICTED: serine/threonine-protein kinase-l...    140   1e-34    
ref|XP_007148545.1|  hypothetical protein PHAVU_006G217700g             140   1e-34    
ref|XP_009414223.1|  PREDICTED: serine/threonine-protein kinase-l...    140   1e-34    
ref|XP_008368202.1|  PREDICTED: serine/threonine-protein kinase-l...    139   2e-34    
ref|XP_006394586.1|  hypothetical protein EUTSA_v10004540mg             137   8e-34    
ref|XP_010906945.1|  PREDICTED: serine/threonine-protein kinase-l...    137   1e-33    
emb|CAI23695.1|  putative serine/threonine protein kinase               137   1e-33    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874113.1|  hypothetical protein ARALYDRAFT_489173             136   1e-33    
ref|NP_197708.1|  serine/threonine-protein kinase-like protein          136   2e-33    Arabidopsis thaliana [mouse-ear cress]
emb|CAI23711.1|  putative serine/threonine protein kinase               136   2e-33    Arabidopsis thaliana [mouse-ear cress]
emb|CAI23720.1|  putative serine/threonine protein kinase               136   2e-33    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010097520.1|  Serine/threonine-protein kinase-like protein       141   2e-33    
ref|XP_009136384.1|  PREDICTED: serine/threonine-protein kinase-l...    136   3e-33    
emb|CAI23749.1|  putative serine/threonine protein kinase               136   3e-33    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003565632.1|  PREDICTED: serine/threonine-protein kinase-l...    136   4e-33    
emb|CAI23727.1|  putative serine/threonine protein kinase               135   9e-33    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ97616.1|  predicted protein                                      135   1e-32    
emb|CAI23733.1|  putative serine/threonine protein kinase               134   1e-32    Arabidopsis thaliana [mouse-ear cress]
emb|CDY02212.1|  BnaA03g39550D                                          133   1e-32    
emb|CDY61912.1|  BnaC07g49720D                                          132   1e-31    
ref|XP_009417890.1|  PREDICTED: serine/threonine-protein kinase-l...    132   2e-31    
ref|XP_010034839.1|  PREDICTED: proline-rich receptor-like protei...    129   4e-31    
gb|ACN33630.1|  unknown                                                 127   1e-30    Zea mays [maize]
gb|AFW79591.1|  putative protein kinase superfamily protein             129   2e-30    
ref|XP_008655488.1|  PREDICTED: serine/threonine-protein kinase-l...    129   3e-30    
ref|XP_008655489.1|  PREDICTED: serine/threonine-protein kinase-l...    129   3e-30    
ref|XP_002982387.1|  hypothetical protein SELMODRAFT_25464              126   6e-30    
ref|NP_001237102.1|  putative receptor protein kinase PERK1             128   8e-30    
ref|XP_002966546.1|  hypothetical protein SELMODRAFT_25465              125   8e-30    
ref|XP_004235662.1|  PREDICTED: proline-rich receptor-like protei...    129   8e-30    
ref|XP_004235663.1|  PREDICTED: proline-rich receptor-like protei...    129   8e-30    
gb|KHN45639.1|  Proline-rich receptor-like protein kinase PERK1         127   9e-30    
gb|EYU22356.1|  hypothetical protein MIMGU_mgv1a001485mg                130   9e-30    
emb|CDO97062.1|  unnamed protein product                                127   1e-29    
gb|EYU42622.1|  hypothetical protein MIMGU_mgv1a0191422mg               124   1e-29    
ref|NP_001238464.1|  serine/threonine protein kinase                    126   1e-29    
gb|AFW77530.1|  putative prolin-rich extensin-like receptor prote...    127   2e-29    
gb|AGT16610.1|  hypothetical protein SHCRBa_063_F06_R_170               126   2e-29    
ref|XP_002455426.1|  hypothetical protein SORBIDRAFT_03g010610          126   2e-29    
gb|ACF86764.1|  unknown                                                 126   2e-29    
gb|KDO48900.1|  hypothetical protein CISIN_1g014904mg                   126   2e-29    
gb|KDO48899.1|  hypothetical protein CISIN_1g014904mg                   126   2e-29    
ref|XP_010939267.1|  PREDICTED: proline-rich receptor-like protei...    127   3e-29    
ref|XP_002439469.1|  hypothetical protein SORBIDRAFT_09g007240          126   3e-29    
gb|KHN45457.1|  Serine/threonine-protein kinase-like protein            125   3e-29    
ref|XP_010527207.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    127   3e-29    
ref|XP_001768504.1|  predicted protein                                  124   4e-29    
ref|XP_010680801.1|  PREDICTED: proline-rich receptor-like protei...    127   4e-29    
gb|EEE59556.1|  hypothetical protein OsJ_11840                          129   5e-29    
ref|XP_010034845.1|  PREDICTED: proline-rich receptor-like protei...    125   5e-29    
ref|XP_006343065.1|  PREDICTED: proline-rich receptor-like protei...    126   6e-29    
ref|XP_001751255.1|  predicted protein                                  123   7e-29    
ref|XP_008781703.1|  PREDICTED: proline-rich receptor-like protei...    126   7e-29    
ref|XP_006343064.1|  PREDICTED: proline-rich receptor-like protei...    126   7e-29    
ref|XP_010520632.1|  PREDICTED: proline-rich receptor-like protei...    126   7e-29    
dbj|BAD06582.1|  PERK1-like protein kinase                              122   8e-29    
dbj|BAK03828.1|  predicted protein                                      126   8e-29    
ref|XP_011092780.1|  PREDICTED: proline-rich receptor-like protei...    126   8e-29    
ref|XP_008651782.1|  PREDICTED: uncharacterized protein LOC100193...    126   8e-29    
ref|XP_011092781.1|  PREDICTED: proline-rich receptor-like protei...    126   8e-29    
ref|XP_009342720.1|  PREDICTED: putative serine/threonine-protein...    124   9e-29    
gb|KDP46243.1|  hypothetical protein JCGZ_10083                         125   9e-29    
gb|ACG28793.1|  receptor protein kinase PERK1                           126   1e-28    
ref|XP_010033869.1|  PREDICTED: proline-rich receptor-like protei...    122   1e-28    
ref|NP_001148076.1|  LOC100281684                                       126   1e-28    
ref|NP_001145767.1|  uncharacterized LOC100279274                       126   1e-28    
ref|XP_010254881.1|  PREDICTED: proline-rich receptor-like protei...    126   1e-28    
ref|XP_006586722.1|  PREDICTED: putative receptor protein kinase ...    126   1e-28    
ref|XP_011072361.1|  PREDICTED: proline-rich receptor-like protei...    124   1e-28    
ref|XP_006656979.1|  PREDICTED: proline-rich receptor-like protei...    124   1e-28    
gb|AAO72646.1|  putative receptor protein kinase                        124   1e-28    
ref|NP_001054941.1|  Os05g0218400                                       124   2e-28    
ref|XP_010479680.1|  PREDICTED: proline-rich receptor-like protei...    120   2e-28    
ref|XP_006833299.1|  hypothetical protein AMTR_s00109p00039350          124   2e-28    
ref|XP_010229848.1|  PREDICTED: proline-rich receptor-like protei...    124   2e-28    
ref|XP_010030670.1|  PREDICTED: proline-rich receptor-like protei...    125   2e-28    
ref|XP_010688473.1|  PREDICTED: probable receptor-like serine/thr...    123   2e-28    
ref|XP_007156929.1|  hypothetical protein PHAVU_002G029200g             125   2e-28    
gb|EEE65746.1|  hypothetical protein OsJ_21402                          127   2e-28    
ref|XP_002509476.1|  somatic embryogenesis receptor kinase, putative    124   2e-28    
ref|NP_190178.1|  protein kinase family protein                         119   2e-28    
ref|XP_009413938.1|  PREDICTED: proline-rich receptor-like protei...    124   3e-28    
gb|EMT01631.1|  Somatic embryogenesis receptor kinase 1                 120   3e-28    
ref|XP_010510296.1|  PREDICTED: PTI1-like tyrosine-protein kinase 2     122   3e-28    
ref|XP_010545704.1|  PREDICTED: proline-rich receptor-like protei...    124   3e-28    
ref|XP_008795084.1|  PREDICTED: proline-rich receptor-like protei...    124   3e-28    
gb|KHN20676.1|  Proline-rich receptor-like protein kinase PERK1         123   3e-28    
ref|XP_006385464.1|  hypothetical protein POPTR_0003s052201g            120   4e-28    
ref|XP_006388225.1|  hypothetical protein POPTR_0275s002101g            120   4e-28    
ref|XP_010033870.1|  PREDICTED: proline-rich receptor-like protei...    124   4e-28    
ref|XP_008783468.1|  PREDICTED: proline-rich receptor-like protei...    124   4e-28    
ref|XP_002315260.1|  hypothetical protein POPTR_0010s22010g             125   4e-28    
ref|XP_009408793.1|  PREDICTED: proline-rich receptor-like protei...    124   4e-28    
ref|XP_002975616.1|  hypothetical protein SELMODRAFT_103981             121   4e-28    
ref|XP_009380552.1|  PREDICTED: proline-rich receptor-like protei...    124   4e-28    
ref|XP_002973593.1|  hypothetical protein SELMODRAFT_99707              121   4e-28    
ref|XP_006654162.1|  PREDICTED: proline-rich receptor-like protei...    122   4e-28    
ref|XP_008361244.1|  PREDICTED: proline-rich receptor-like protei...    124   4e-28    
gb|EMS54404.1|  Proline-rich receptor-like protein kinase PERK8         123   5e-28    
ref|XP_006451164.1|  hypothetical protein CICLE_v10007670mg             124   5e-28    
gb|EEC78728.1|  hypothetical protein OsI_18915                          122   5e-28    
ref|XP_002514297.1|  ATP binding protein, putative                      124   5e-28    
emb|CBI32578.3|  unnamed protein product                                120   5e-28    
ref|XP_003603906.1|  Cysteine-rich receptor-like protein kinase         124   5e-28    
ref|XP_011088379.1|  PREDICTED: proline-rich receptor-like protei...    124   6e-28    
ref|XP_008790437.1|  PREDICTED: putative proline-rich receptor-li...    122   6e-28    
ref|XP_009611770.1|  PREDICTED: proline-rich receptor-like protei...    123   7e-28    
ref|NP_001042687.2|  Os01g0267800                                       122   7e-28    
ref|XP_010519128.1|  PREDICTED: receptor-like cytosolic serine/th...    122   7e-28    
ref|XP_006349643.1|  PREDICTED: proline-rich receptor-like protei...    122   7e-28    
ref|XP_010432054.1|  PREDICTED: putative leucine-rich repeat rece...    117   7e-28    
ref|XP_011088376.1|  PREDICTED: proline-rich receptor-like protei...    124   7e-28    
gb|KCW53716.1|  hypothetical protein EUGRSUZ_J02973                     122   7e-28    
ref|XP_004960636.1|  PREDICTED: proline-rich receptor-like protei...    124   7e-28    
gb|ACN40429.1|  unknown                                                 124   8e-28    
gb|EMS62683.1|  Proline-rich receptor-like protein kinase PERK1         122   8e-28    
gb|AAV25281.1|  putative protein kinase                                 122   8e-28    
dbj|BAB02941.1|  somatic embryogenesis receptor kinase-like protein     122   8e-28    
emb|CDY48706.1|  BnaCnng16830D                                          122   9e-28    
ref|XP_008338108.1|  PREDICTED: proline-rich receptor-like protei...    124   9e-28    
ref|XP_010103058.1|  Proline-rich receptor-like protein kinase PERK1    122   9e-28    
ref|XP_010113486.1|  Proline-rich receptor-like protein kinase PERK4    123   9e-28    
gb|AFW82073.1|  putative prolin-rich extensin-like receptor prote...    123   9e-28    
ref|XP_004516659.1|  PREDICTED: L-type lectin-domain containing r...    121   9e-28    
ref|XP_004167794.1|  PREDICTED: proline-rich receptor-like protei...    121   1e-27    
ref|XP_010925846.1|  PREDICTED: proline-rich receptor-like protei...    122   1e-27    
ref|XP_007024170.1|  Proline extensin-like receptor kinase 1            122   1e-27    
ref|XP_002465598.1|  hypothetical protein SORBIDRAFT_01g041850          122   1e-27    
ref|XP_009371633.1|  PREDICTED: proline-rich receptor-like protei...    124   1e-27    
ref|XP_006287879.1|  hypothetical protein CARUB_v10001106mg             121   1e-27    
ref|XP_004516072.1|  PREDICTED: L-type lectin-domain containing r...    121   1e-27    
ref|XP_011027082.1|  PREDICTED: probable receptor-like protein ki...    124   1e-27    
gb|ABR17823.1|  unknown                                                 120   1e-27    
ref|XP_011072360.1|  PREDICTED: proline-rich receptor-like protei...    122   1e-27    
emb|CBI17536.3|  unnamed protein product                                119   1e-27    
ref|XP_004512025.1|  PREDICTED: proline-rich receptor-like protei...    123   1e-27    
ref|XP_010488565.1|  PREDICTED: proline-rich receptor-like protei...    123   2e-27    
ref|XP_008337381.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    123   2e-27    
ref|XP_009612243.1|  PREDICTED: putative serine/threonine-protein...    120   2e-27    
ref|XP_008338107.1|  PREDICTED: proline-rich receptor-like protei...    123   2e-27    
ref|XP_010034842.1|  PREDICTED: proline-rich receptor-like protei...    122   2e-27    
ref|XP_004987095.1|  PREDICTED: LOW QUALITY PROTEIN: DNA (cytosin...    124   2e-27    
ref|XP_009419795.1|  PREDICTED: proline-rich receptor-like protei...    123   2e-27    
ref|XP_009105891.1|  PREDICTED: proline-rich receptor-like protei...    123   2e-27    
ref|XP_009769553.1|  PREDICTED: putative serine/threonine-protein...    120   2e-27    
gb|EYU37788.1|  hypothetical protein MIMGU_mgv1a003036mg                122   2e-27    
ref|XP_006645667.1|  PREDICTED: proline-rich receptor-like protei...    121   2e-27    
ref|XP_010026169.1|  PREDICTED: proline-rich receptor-like protei...    122   2e-27    
ref|XP_009764139.1|  PREDICTED: proline-rich receptor-like protei...    122   2e-27    
ref|XP_010068105.1|  PREDICTED: proline-rich receptor-like protei...    121   2e-27    
ref|XP_003568732.1|  PREDICTED: proline-rich receptor-like protei...    122   2e-27    
gb|KDP33677.1|  hypothetical protein JCGZ_07248                         123   2e-27    
ref|XP_010249724.1|  PREDICTED: proline-rich receptor-like protei...    122   2e-27    
ref|XP_008785658.1|  PREDICTED: proline-rich receptor-like protei...    122   2e-27    
ref|XP_010466870.1|  PREDICTED: proline-rich receptor-like protei...    122   2e-27    
gb|EYU21456.1|  hypothetical protein MIMGU_mgv1a004031mg                121   2e-27    
ref|XP_003528909.1|  PREDICTED: proline-rich receptor-like protei...    123   2e-27    
gb|EMT32300.1|  Putative serine/threonine-protein kinase                120   2e-27    
ref|XP_009374021.1|  PREDICTED: proline-rich receptor-like protei...    122   2e-27    
ref|XP_008241661.1|  PREDICTED: proline-rich receptor-like protei...    122   2e-27    
emb|CDO98035.1|  unnamed protein product                                121   2e-27    
ref|XP_006292697.1|  hypothetical protein CARUB_v10018943mg             123   2e-27    
ref|XP_006365092.1|  PREDICTED: putative proline-rich receptor-li...    120   2e-27    
ref|XP_009348850.1|  PREDICTED: probable LRR receptor-like serine...    123   2e-27    
ref|XP_010936290.1|  PREDICTED: proline-rich receptor-like protei...    122   2e-27    
ref|XP_001773277.1|  predicted protein                                  119   2e-27    
ref|XP_004288526.1|  PREDICTED: receptor-like cytosolic serine/th...    120   2e-27    
ref|XP_010033701.1|  PREDICTED: proline-rich receptor-like protei...    121   3e-27    
dbj|BAO45865.1|  serine/threonine-protein kinase                        123   3e-27    
ref|XP_006409147.1|  hypothetical protein EUTSA_v10022596mg             122   3e-27    
ref|XP_010943774.1|  PREDICTED: proline-rich receptor-like protei...    120   3e-27    
ref|XP_004156667.1|  PREDICTED: probable LRR receptor-like serine...    120   3e-27    
ref|XP_004161311.1|  PREDICTED: serine/threonine-protein kinase P...    120   3e-27    
gb|KCW53427.1|  hypothetical protein EUGRSUZ_J02672                     117   3e-27    
ref|XP_002883531.1|  hypothetical protein ARALYDRAFT_479967             122   3e-27    
gb|KEH34092.1|  lectin receptor kinase                                  122   3e-27    
ref|XP_010915808.1|  PREDICTED: LOW QUALITY PROTEIN: proline-rich...    122   3e-27    
ref|XP_010936289.1|  PREDICTED: proline-rich receptor-like protei...    122   3e-27    
ref|XP_010688207.1|  PREDICTED: proline-rich receptor-like protei...    122   3e-27    
ref|NP_001054375.1|  Os05g0100700                                       117   3e-27    
gb|EEE58632.1|  hypothetical protein OsJ_09997                          122   3e-27    
ref|XP_006292621.1|  hypothetical protein CARUB_v10018863mg             120   3e-27    
ref|XP_006366995.1|  PREDICTED: putative proline-rich receptor-li...    120   3e-27    
ref|XP_004137905.1|  PREDICTED: probable LRR receptor-like serine...    119   3e-27    
ref|XP_009757853.1|  PREDICTED: proline-rich receptor-like protei...    122   3e-27    
ref|XP_010513600.1|  PREDICTED: proline-rich receptor-like protei...    122   3e-27    
ref|XP_008463258.1|  PREDICTED: serine/threonine-protein kinase PBS1    120   3e-27    
gb|EMS48532.1|  Proline-rich receptor-like protein kinase PERK8         119   4e-27    
ref|XP_004512982.1|  PREDICTED: proline-rich receptor-like protei...    122   4e-27    
gb|KHG05454.1|  Proline-rich receptor-like protein kinase PERK4         120   4e-27    
dbj|BAJ96935.1|  predicted protein                                      122   4e-27    
ref|XP_010228924.1|  PREDICTED: proline-rich receptor-like protei...    121   4e-27    
ref|XP_002516042.1|  ATP binding protein, putative                      119   4e-27    
ref|XP_006425697.1|  hypothetical protein CICLE_v10025093mg             122   4e-27    
ref|XP_004492426.1|  PREDICTED: probable leucine-rich repeat rece...    119   4e-27    
ref|XP_004300986.1|  PREDICTED: proline-rich receptor-like protei...    122   4e-27    
ref|XP_007042215.1|  Roline-rich extensin-like receptor kinase 4        121   4e-27    
ref|XP_009344949.1|  PREDICTED: putative serine/threonine-protein...    122   4e-27    
ref|XP_006349462.1|  PREDICTED: probable LRR receptor-like serine...    119   4e-27    
gb|KHN38884.1|  Receptor-like cytosolic serine/threonine-protein ...    120   5e-27    
ref|XP_006304667.1|  hypothetical protein CARUB_v10011886mg             122   5e-27    
ref|XP_003534246.1|  PREDICTED: receptor-like cytosolic serine/th...    120   5e-27    
ref|XP_010327570.1|  PREDICTED: putative proline-rich receptor-li...    120   5e-27    
ref|XP_001774429.1|  predicted protein                                  119   5e-27    
ref|XP_006349463.1|  PREDICTED: probable LRR receptor-like serine...    119   5e-27    
ref|XP_006347034.1|  PREDICTED: L-type lectin-domain containing r...    122   5e-27    
ref|XP_010548616.1|  PREDICTED: receptor-like cytosolic serine/th...    119   5e-27    
ref|XP_004966984.1|  PREDICTED: proline-rich receptor-like protei...    120   5e-27    
ref|XP_006366364.1|  PREDICTED: probable leucine-rich repeat rece...    118   5e-27    
ref|XP_010030811.1|  PREDICTED: proline-rich receptor-like protei...    119   5e-27    
ref|XP_008242654.1|  PREDICTED: proline-rich receptor-like protei...    121   5e-27    
gb|KCW56393.1|  hypothetical protein EUGRSUZ_I02121                     119   6e-27    
ref|XP_002527233.1|  kinase, putative                                   121   6e-27    
ref|XP_006395237.1|  hypothetical protein EUTSA_v10003696mg             122   6e-27    
ref|XP_010501362.1|  PREDICTED: probable LRR receptor-like serine...    116   6e-27    
ref|XP_004492425.1|  PREDICTED: probable leucine-rich repeat rece...    119   6e-27    
ref|XP_003610091.1|  Receptor-like protein kinase                       119   6e-27    
ref|XP_010691326.1|  PREDICTED: proline-rich receptor-like protei...    120   6e-27    
ref|XP_010691327.1|  PREDICTED: proline-rich receptor-like protei...    120   6e-27    
ref|XP_006394019.1|  hypothetical protein EUTSA_v100041830mg            115   6e-27    
ref|XP_010040447.1|  PREDICTED: cysteine-rich receptor-like prote...    117   6e-27    
ref|XP_008785783.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    117   6e-27    
ref|XP_002873046.1|  hypothetical protein ARALYDRAFT_487008             119   6e-27    
ref|NP_001042469.1|  Os01g0227200                                       120   6e-27    
ref|XP_008442432.1|  PREDICTED: putative serine/threonine-protein...    119   7e-27    
emb|CAB88286.1|  serine/threonine-specific protein kinase-like pr...    119   7e-27    
ref|XP_008442433.1|  PREDICTED: putative serine/threonine-protein...    119   7e-27    
ref|XP_008354402.1|  PREDICTED: proline-rich receptor-like protei...    121   7e-27    
ref|XP_009371460.1|  PREDICTED: proline-rich receptor-like protei...    121   7e-27    
ref|XP_007020165.1|  CRINKLY4 related 4, putative                       121   7e-27    
ref|XP_010034744.1|  PREDICTED: proline-rich receptor-like protei...    119   8e-27    
ref|XP_007204236.1|  hypothetical protein PRUPE_ppa002532mg             121   8e-27    
ref|XP_009760994.1|  PREDICTED: putative proline-rich receptor-li...    119   8e-27    
ref|XP_010691096.1|  PREDICTED: PTI1-like tyrosine-protein kinase...    118   8e-27    
emb|CAT79815.1|  Rop-interacting receptor-like cytoplasmic kinase 1     119   8e-27    
ref|XP_002457091.1|  hypothetical protein SORBIDRAFT_03g001090          119   8e-27    
ref|NP_195849.1|  putative serine/threonine-protein kinase NAK          119   8e-27    
emb|CAB62024.1|  receptor-like protein kinase homolog                   122   8e-27    
ref|XP_008668339.1|  PREDICTED: uncharacterized protein LOC100382...    117   8e-27    
ref|XP_008659020.1|  PREDICTED: putative proline-rich receptor-li...    120   8e-27    
ref|XP_010500822.1|  PREDICTED: proline-rich receptor-like protei...    119   8e-27    
ref|XP_004516073.1|  PREDICTED: L-type lectin-domain containing r...    118   8e-27    
gb|KHF99092.1|  Proline-rich receptor-like protein kinase PERK15        120   9e-27    
ref|XP_002279197.1|  PREDICTED: proline-rich receptor-like protei...    120   9e-27    
ref|XP_009591550.1|  PREDICTED: L-type lectin-domain containing r...    121   9e-27    
gb|EMT15553.1|  Putative serine/threonine-protein kinase                119   9e-27    
ref|XP_002978742.1|  hypothetical protein SELMODRAFT_109609             120   9e-27    
ref|XP_009129365.1|  PREDICTED: probable receptor-like protein ki...    119   9e-27    
ref|XP_006403457.1|  hypothetical protein EUTSA_v10010443mg             118   9e-27    



>ref|XP_009787085.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Nicotiana sylvestris]
Length=462

 Score =   375 bits (962),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 188/271 (69%), Positives = 216/271 (80%), Gaps = 21/271 (8%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDRN NARLGDFGLALRC  +DFRLRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  168  VIHRDIKSANVLIDRNFNARLGDFGLALRCHLDDFRLRSTPPAGTMGYLDPCYVTPDNLS  227

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV YSPPSIVDWAIPLI+RGKL+A++DPRI PPKDPLV
Sbjct  228  TKTDVFSFGILLLEIISGRKAIDVVYSPPSIVDWAIPLIKRGKLLAVYDPRIPPPKDPLV  287

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT------  522
            RKQLA+VAAKCVR+CRERRP+MKE+VECL  LSK+VPLHSWNGF NPCLMVET       
Sbjct  288  RKQLAIVAAKCVRTCRERRPTMKEVVECLSGLSKLVPLHSWNGFTNPCLMVETVGRPVES  347

Query  523  ----VGLRKVGEEAQSFDAKFSKPLRNSRRVYSDLGSRSNLMELMAG----------GDD  660
                + LR+   +    DA+ + PLRNS+RVYSDLG RSNLM+LM+G          GD 
Sbjct  348  KTSQLNLRRKERDLDGGDARLATPLRNSQRVYSDLGFRSNLMDLMSGNDGQSEFRGDGDG  407

Query  661  FVPKSSS-QKGSSLRCKTGNLVGKGNHSPFL  750
              PK++S  +  S R  +G++VG+ N+   +
Sbjct  408  VEPKANSISRALSCRYVSGSVVGRRNNESLV  438



>ref|XP_009602383.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Nicotiana tomentosiformis]
Length=465

 Score =   372 bits (955),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 189/271 (70%), Positives = 213/271 (79%), Gaps = 21/271 (8%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDRN +ARLGDFGLALRC  +DFRLRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  171  VIHRDIKSANVLIDRNFHARLGDFGLALRCHLDDFRLRSTPPAGTMGYLDPCYVTPDNLS  230

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLI+RGKL+A++DPRI PPKDPLV
Sbjct  231  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIKRGKLLAVYDPRIPPPKDPLV  290

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT------  522
            RKQLA+VAAKCVRSCRERRP+MKE+VECL  LSK+ PLHSWNGF NPCLMVET       
Sbjct  291  RKQLAIVAAKCVRSCRERRPTMKEVVECLSGLSKLAPLHSWNGFTNPCLMVETVGRPVES  350

Query  523  ----VGLRKVGEEAQSFDAKFSKPLRNSRRVYSDLGSRSNLMELMAGGDDFV--------  666
                + LR    +    DA+ + PLRNS+RVYSDLG RSNLM+LMAG D           
Sbjct  351  KTSQLNLRIKERDLDGGDARLATPLRNSQRVYSDLGFRSNLMDLMAGNDGHSEFRGDADG  410

Query  667  --PKSSS-QKGSSLRCKTGNLVGKGNHSPFL  750
              PKS S  +  S R  +G++VG+ N+   +
Sbjct  411  VEPKSKSISRALSCRYVSGSVVGRRNNESLV  441



>ref|XP_006345390.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990-like 
[Solanum tuberosum]
Length=481

 Score =   368 bits (945),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 190/274 (69%), Positives = 214/274 (78%), Gaps = 24/274 (9%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDRN NARLGDFGLALRC  +DFRLRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  184  VIHRDIKSANVLIDRNFNARLGDFGLALRCHLDDFRLRSTPPAGTMGYLDPCYVTPDNLS  243

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLI+RGKL+A++DPRI PPKDP +
Sbjct  244  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIKRGKLLAVYDPRIPPPKDPGL  303

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT------  522
            RKQLAVVAAKCVR CRERRP+MKE+ ECL  LSK+VPLHSWNGF NPCLMVET       
Sbjct  304  RKQLAVVAAKCVRPCRERRPTMKEVAECLSGLSKLVPLHSWNGFTNPCLMVETVGRPVES  363

Query  523  ----VGLRKVGEEAQSF---DAKFSKPLRNSRRVYSDLGSRSNLMELMAG----------  651
                + LR  G + + +   DA+ + PLRNS RVYSDLG RSNLM+LMAG          
Sbjct  364  RTSQLNLRGKGSKQRDWDVGDARLATPLRNSPRVYSDLGLRSNLMDLMAGNEGQSEFRGE  423

Query  652  GDDFVPKSSS-QKGSSLRCKTGNLVGKGNHSPFL  750
            GD   PKS S  +  S R  +G++VG+ N+   +
Sbjct  424  GDGVEPKSKSISRALSCRYVSGSVVGRRNNESLV  457



>ref|XP_004229679.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Solanum lycopersicum]
Length=478

 Score =   367 bits (941),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 190/274 (69%), Positives = 213/274 (78%), Gaps = 24/274 (9%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDRN NARLGDFGLALRC  +DFRLRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  181  VIHRDIKSANVLIDRNFNARLGDFGLALRCHLDDFRLRSTPPAGTMGYLDPCYVTPDNLS  240

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLI+RGKL+A++DPRI PPKDP +
Sbjct  241  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIKRGKLLAVYDPRIPPPKDPSL  300

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT------  522
            RKQLAVVAAKCVR CRERRP+MKE+ ECL  LSK+VPLHSWNGF NPCLMVET       
Sbjct  301  RKQLAVVAAKCVRPCRERRPTMKEVAECLSGLSKLVPLHSWNGFTNPCLMVETVGRPVES  360

Query  523  ----VGLRKVGEEAQSF---DAKFSKPLRNSRRVYSDLGSRSNLMELMAG----------  651
                + LR  G + + +   DA  + PLRNS RVYSDLG RSNLM+LMAG          
Sbjct  361  RTSQLNLRGKGSKQRDWDGGDASLAMPLRNSPRVYSDLGLRSNLMDLMAGKEGQSEFRGE  420

Query  652  GDDFVPKSSS-QKGSSLRCKTGNLVGKGNHSPFL  750
            GD   PKS S  +  S R  +G++VG+ N+   +
Sbjct  421  GDGVEPKSKSISRALSCRYVSGSVVGRRNNESLV  454



>ref|XP_010659216.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
isoform X2 [Vitis vinifera]
Length=457

 Score =   362 bits (928),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 185/247 (75%), Positives = 202/247 (82%), Gaps = 12/247 (5%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDRN NARLGDFGLALRC  +D+RLRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  170  VIHRDIKSANVLIDRNFNARLGDFGLALRCHVDDYRLRSTPPAGTMGYLDPCYVTPDNLS  229

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV +SPPSIVDWAIPLIR+GKL+AI+DP I PPK+P V
Sbjct  230  TKTDVFSFGILLLEIISGRKAIDVGHSPPSIVDWAIPLIRKGKLLAIYDPTIAPPKEPFV  289

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT---VGL  531
            RKQLAV+AAKCVRSCRERRPSMKE+VE LG LSK+VPLH+WNGF NPCLMVET    V  
Sbjct  290  RKQLAVIAAKCVRSCRERRPSMKEVVEWLGGLSKLVPLHTWNGFNNPCLMVETMGCPVEA  349

Query  532  RKV----GEEAQSFDAKFSK-PLRNSRRVYSDLGSRSNLMELMAGGDDFVPKSSSQKGSS  696
             K+    G      DAKF + PLRNSRRVYSDLG R+NLM+LMAG D      S   GSS
Sbjct  350  SKMDGVEGGNMDGMDAKFGRTPLRNSRRVYSDLGFRNNLMDLMAGTDG----ESVNWGSS  405

Query  697  LRCKTGN  717
             R   G+
Sbjct  406  FRFDRGS  412



>ref|XP_002271281.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
isoform X1 [Vitis vinifera]
Length=472

 Score =   361 bits (927),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 188/258 (73%), Positives = 205/258 (79%), Gaps = 19/258 (7%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDRN NARLGDFGLALRC  +D+RLRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  170  VIHRDIKSANVLIDRNFNARLGDFGLALRCHVDDYRLRSTPPAGTMGYLDPCYVTPDNLS  229

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV +SPPSIVDWAIPLIR+GKL+AI+DP I PPK+P V
Sbjct  230  TKTDVFSFGILLLEIISGRKAIDVGHSPPSIVDWAIPLIRKGKLLAIYDPTIAPPKEPFV  289

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT---VGL  531
            RKQLAV+AAKCVRSCRERRPSMKE+VE LG LSK+VPLH+WNGF NPCLMVET    V  
Sbjct  290  RKQLAVIAAKCVRSCRERRPSMKEVVEWLGGLSKLVPLHTWNGFNNPCLMVETMGCPVEA  349

Query  532  RKV----GEEAQSFDAKFSK-PLRNSRRVYSDLGSRSNLMELMAGGD----------DFV  666
             K+    G      DAKF + PLRNSRRVYSDLG R+NLM+LMAG D           F 
Sbjct  350  SKMDGVEGGNMDGMDAKFGRTPLRNSRRVYSDLGFRNNLMDLMAGTDGESEFRGEAEGFG  409

Query  667  PKSSS-QKGSSLRCKTGN  717
            P S S   GSS R   G+
Sbjct  410  PMSKSVNWGSSFRFDRGS  427



>ref|XP_011088115.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Sesamum indicum]
Length=499

 Score =   362 bits (928),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 182/232 (78%), Positives = 193/232 (83%), Gaps = 14/232 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDRN NARLGDFGLALRC D D+RLRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  182  VIHRDIKSANVLIDRNFNARLGDFGLALRCVD-DYRLRSTPPAGTMGYLDPCYVTPDNLS  240

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAID+ +SPPSIVDWAIPLIRRGKL+AI+DPR+ PPKDP+V
Sbjct  241  TKTDVFSFGILLLEIISGRKAIDMGHSPPSIVDWAIPLIRRGKLLAIYDPRVVPPKDPMV  300

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT------  522
            RK LAVVAAKCVRSCRERRPSMKE+VECL ELSK+VP+HSWNG ANPCLMVET       
Sbjct  301  RKTLAVVAAKCVRSCRERRPSMKEVVECLSELSKLVPVHSWNGLANPCLMVETAGVPVQS  360

Query  523  ----VGLRKVGEEA---QSFDAKFSKPLRNSRRVYSDLGSRSNLMELMAGGD  657
                V     G E       DAK  KPLRN RRVYSDLG RSNLMELMA  D
Sbjct  361  RSSQVNSNGTGGENGILDDGDAKLGKPLRNPRRVYSDLGFRSNLMELMASPD  412



>ref|XP_008356751.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Malus domestica]
Length=498

 Score =   353 bits (907),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 182/266 (68%), Positives = 208/266 (78%), Gaps = 15/266 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALR-CQDNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            VIHRDIKSANVLIDR+ NARLGDFGLALR CQ +++RLRSTPPAGTMGYLDP Y+TPDNL
Sbjct  180  VIHRDIKSANVLIDRSYNARLGDFGLALRYCQFDEYRLRSTPPAGTMGYLDPCYVTPDNL  239

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            STKTDVFSFGILLLEIISGRKAIDV +SPPSIVDWAIPLI+RGKL+ ++DPRI PPKDP+
Sbjct  240  STKTDVFSFGILLLEIISGRKAIDVGHSPPSIVDWAIPLIKRGKLITVYDPRIVPPKDPV  299

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVET------  519
            VRKQLAV+AAKCVRSCRERRPSMKE+V  L  LSK+VPLHSWNGF NPC MVET      
Sbjct  300  VRKQLAVIAAKCVRSCRERRPSMKEVVVWLTGLSKLVPLHSWNGFNNPCTMVETMGRPVE  359

Query  520  ------TVGLRKVGEEA-QSFDAKFSK-PLRNSRRVYSDLGSRSNLMELMAGGDDFVPKS  675
                  T  L  VGEE  ++ +AK ++  LRNSRRVYSDLG  +NLMELMAG D      
Sbjct  360  SRNAHLTSKLEGVGEENLEALEAKLTRQALRNSRRVYSDLGFSTNLMELMAGTDGESEFH  419

Query  676  SSQKGSSLRCKTGNLVGKGNHSPFLG  753
             +  G     K+ NLV +   + ++G
Sbjct  420  GNADGDBSSSKSANLVSRFGSARYIG  445



>ref|XP_008346948.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Malus domestica]
Length=498

 Score =   351 bits (901),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 182/266 (68%), Positives = 207/266 (78%), Gaps = 15/266 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALR-CQDNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            VIHRDIKSANVLIDR+ NARLGDFGLALR CQ +++RLRSTPPAGTMGYLDP Y+TPDNL
Sbjct  180  VIHRDIKSANVLIDRSYNARLGDFGLALRYCQFDEYRLRSTPPAGTMGYLDPCYVTPDNL  239

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            STKTDVFSFGILLLEIISGRKAIDV +SPPSIVDWAIPLI+RGKL+ + DPRI PPKDP+
Sbjct  240  STKTDVFSFGILLLEIISGRKAIDVGHSPPSIVDWAIPLIKRGKLITVXDPRIVPPKDPV  299

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVET------  519
            VRKQLAV+AAKCVRSCRERRPSMKE+V  L  LSK+VPLHSWNGF NPC MVET      
Sbjct  300  VRKQLAVIAAKCVRSCRERRPSMKEVVVWLTGLSKLVPLHSWNGFNNPCTMVETMGRPVE  359

Query  520  ------TVGLRKVGEEA-QSFDAKFSK-PLRNSRRVYSDLGSRSNLMELMAGGDDFVPKS  675
                  T  L  VGEE  ++ +AK ++  LRNSRRVYSDLG  +NLMELMAG D      
Sbjct  360  SRNAHLTSKLEGVGEENLEALEAKLTRQALRNSRRVYSDLGFSTNLMELMAGTDGESEFH  419

Query  676  SSQKGSSLRCKTGNLVGKGNHSPFLG  753
             +  G     K+ NLV +   + ++G
Sbjct  420  GNADGDBSSSKSANLVSRFGSARYIG  445



>ref|XP_009368073.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Pyrus x bretschneideri]
Length=498

 Score =   351 bits (900),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 183/266 (69%), Positives = 208/266 (78%), Gaps = 15/266 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALR-CQDNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            VIHRDIKSANVLIDR+ NARLGDFGLALR CQ +++RLRSTPPAGTMGYLDP Y+TPDNL
Sbjct  180  VIHRDIKSANVLIDRSYNARLGDFGLALRYCQFDEYRLRSTPPAGTMGYLDPCYVTPDNL  239

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            STKTDVFSFGILLLEIISGRKAIDV +SPPSIVDWAIPLI+RGKL+ ++DPRI PPKDP+
Sbjct  240  STKTDVFSFGILLLEIISGRKAIDVGHSPPSIVDWAIPLIKRGKLITVYDPRIVPPKDPV  299

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT---VG  528
            VRKQLAV+AAKCVRSCRERRPSMKE+V  L  LSK+VPLHSWNGF NPC MVET    V 
Sbjct  300  VRKQLAVIAAKCVRSCRERRPSMKEVVVWLSGLSKLVPLHSWNGFNNPCTMVETMGRPVE  359

Query  529  LRK---------VGEEA-QSFDAKFSK-PLRNSRRVYSDLGSRSNLMELMAGGDDFVPKS  675
             R          VGEE  ++ +AK ++  LRNSRRVYSDLG  SNLMELMAG D      
Sbjct  360  SRNAHLISKPEGVGEENLEALEAKLTRQALRNSRRVYSDLGFSSNLMELMAGNDGESEFH  419

Query  676  SSQKGSSLRCKTGNLVGKGNHSPFLG  753
             +  G     K+ NLV +   + ++G
Sbjct  420  GNADGDDSNSKSANLVSRFGSARYIG  445



>ref|XP_007217936.1| hypothetical protein PRUPE_ppa004965mg [Prunus persica]
 gb|EMJ19135.1| hypothetical protein PRUPE_ppa004965mg [Prunus persica]
Length=483

 Score =   348 bits (893),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 180/254 (71%), Positives = 200/254 (79%), Gaps = 15/254 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALR-CQDNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            VIHRDIKSANVLIDR+ NARLGDFGLALR C  +D+RLRSTPPAGT+GYLDP Y+TPDNL
Sbjct  181  VIHRDIKSANVLIDRSYNARLGDFGLALRYCHFDDYRLRSTPPAGTIGYLDPCYVTPDNL  240

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            STKTDVFSFGILLLEI+SGRKAIDVAYSPP IVDWAIPLI+RGKL+ ++DPRI PPKDP+
Sbjct  241  STKTDVFSFGILLLEILSGRKAIDVAYSPPCIVDWAIPLIKRGKLITVYDPRIEPPKDPI  300

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT-----  522
            VRKQLAV+AAKCVRSCRERRPSMKE+V  L  LSK+VPLHSWNGF NPC MVET      
Sbjct  301  VRKQLAVIAAKCVRSCRERRPSMKEVVVWLTGLSKLVPLHSWNGFNNPCTMVETMGQPVE  360

Query  523  -------VGLRKVGEEA-QSFDAKFSK-PLRNSRRVYSDLGSRSNLMELMAGGDDFVPKS  675
                     L  VGEE  ++ DAK ++  LRNSRRVYSDLG  SNLMELMAG D      
Sbjct  361  SRNAHFRSKLEGVGEENLEALDAKLTRQALRNSRRVYSDLGFSSNLMELMAGTDGESEFR  420

Query  676  SSQKGSSLRCKTGN  717
             +  G     K+GN
Sbjct  421  GNADGDEPNLKSGN  434



>gb|EYU27012.1| hypothetical protein MIMGU_mgv1a025641mg, partial [Erythranthe 
guttata]
Length=452

 Score =   345 bits (886),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 182/258 (71%), Positives = 203/258 (79%), Gaps = 22/258 (9%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSAN+LIDRN NARLGDFGLALRC D D++LRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  197  VIHRDIKSANILIDRNFNARLGDFGLALRCVD-DYKLRSTPPAGTMGYLDPCYVTPDNLS  255

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAID+  SPPSIVDWAIPLIRRGKL++IFDPR+ PPKD  V
Sbjct  256  TKTDVFSFGILLLEIISGRKAIDMGNSPPSIVDWAIPLIRRGKLLSIFDPRVPPPKDATV  315

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETTVGLRKV  540
            RK LAVVAAKCVRSCRERR SMKE+VECL ELS++VPLHSWNG ANPC+MVE  VG   V
Sbjct  316  RKMLAVVAAKCVRSCRERRLSMKEVVECLSELSRLVPLHSWNGLANPCMMVE-NVGRPVV  374

Query  541  GEEAQS--------FDAKFSKPLRNSRRVYSDLGSRSNLMELMAG----------GDDFV  666
               ++S         DA+ ++ LR + RVYSDLG RSNLMELMA           GDD +
Sbjct  375  QSRSESKKTGNLDEGDARVTRALRKNGRVYSDLGFRSNLMELMASPDCESRFGGEGDDVL  434

Query  667  PK--SSSQKGSSLRCKTG  714
                 S +KGSSLR + G
Sbjct  435  ENKVESGKKGSSLRFEIG  452



>ref|XP_008231535.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Prunus mume]
Length=497

 Score =   347 bits (889),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 181/266 (68%), Positives = 204/266 (77%), Gaps = 15/266 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALR-CQDNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            VIHRDIKSANVLIDR+ NARLGDFGLALR C  +D+RLRSTPPAGT+GYLDP Y+TPDNL
Sbjct  178  VIHRDIKSANVLIDRSYNARLGDFGLALRYCHFDDYRLRSTPPAGTIGYLDPCYVTPDNL  237

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            STKTDVFSFGILLLEI+SGRKAIDVAYSPP IVDWAIPLI+RGKL+ ++DPRI PPKDP+
Sbjct  238  STKTDVFSFGILLLEILSGRKAIDVAYSPPCIVDWAIPLIKRGKLITVYDPRIEPPKDPI  297

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT-----  522
            VRKQLAV+AAKCVRSCRERRPSMKE+V  L  LSK+VPLHSWNGF NPC MVET      
Sbjct  298  VRKQLAVIAAKCVRSCRERRPSMKEVVVWLTGLSKLVPLHSWNGFNNPCTMVETMGQPVE  357

Query  523  -------VGLRKVGEEA-QSFDAKFSK-PLRNSRRVYSDLGSRSNLMELMAGGDDFVPKS  675
                     L  VGEE  ++ DAK ++  LRNSRRVYSDLG  SNLMELMAG D      
Sbjct  358  SRNAHLRSKLEGVGEENLEALDAKLTRQALRNSRRVYSDLGFSSNLMELMAGTDGESEFR  417

Query  676  SSQKGSSLRCKTGNLVGKGNHSPFLG  753
             +  G     K+ N V +     ++G
Sbjct  418  GNADGDEPNLKSRNRVSRFGSERYVG  443



>ref|XP_010067787.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Eucalyptus grandis]
Length=497

 Score =   346 bits (887),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 172/234 (74%), Positives = 194/234 (83%), Gaps = 14/234 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKSANVLIDRN NARLGDFGLALRC  NDFRL STPPAGT+GYLDP Y+TPDNLS
Sbjct  176  IIHRDIKSANVLIDRNFNARLGDFGLALRCHVNDFRLLSTPPAGTLGYLDPLYVTPDNLS  235

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV++SPPSIVDWAIPLI++GKL  ++DPR+ PPKDP+V
Sbjct  236  TKTDVFSFGILLLEIISGRKAIDVSHSPPSIVDWAIPLIKKGKLPCVYDPRMAPPKDPVV  295

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT---VGL  531
            RKQ+AV+AAKCVR CRERRP+MKEIV+ L  LSK+VPLHSWNGF NPCLMVET    V  
Sbjct  296  RKQIAVIAAKCVRPCRERRPAMKEIVDWLTGLSKLVPLHSWNGFNNPCLMVETMGRPVES  355

Query  532  RKVGEEAQ----------SFDAKFSKP-LRNSRRVYSDLGSRSNLMELMAGGDD  660
            R V   ++          + D KFSKP +RNSRRVYSDLG RS+LM+LMA   D
Sbjct  356  RNVQNNSRLDNTDTGYLDALDGKFSKPAMRNSRRVYSDLGFRSDLMDLMAANTD  409



>ref|XP_004303089.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990-like 
[Fragaria vesca subsp. vesca]
Length=492

 Score =   344 bits (883),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/234 (74%), Positives = 194/234 (83%), Gaps = 14/234 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDR+ NARLGDFGLALRC  +D++LRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  181  VIHRDIKSANVLIDRSYNARLGDFGLALRCHLDDYKLRSTPPAGTMGYLDPCYVTPDNLS  240

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV +SPPSIVDWAIPLI+RGKL+ ++DPRI PPKDP+V
Sbjct  241  TKTDVFSFGILLLEIISGRKAIDVGFSPPSIVDWAIPLIKRGKLITVYDPRIVPPKDPVV  300

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVET-------  519
            RKQLAV+AAKCVRSCRERRPSMKE+V  L  LSK+VPLHSWN F NPC MVET       
Sbjct  301  RKQLAVIAAKCVRSCRERRPSMKEVVVWLTGLSKLVPLHSWNNFNNPCTMVETMGQPVES  360

Query  520  ---TVGLRKVG---EEAQSFDAKFSK-PLRNSRRVYSDLGSRSNLMELMAGGDD  660
                + L+  G   E  +S +AK ++  +RNSRRVYSDLG  SNLMELMAG D+
Sbjct  361  RASQMNLKPHGFGEEHFESMEAKLARQAMRNSRRVYSDLGFSSNLMELMAGTDE  414



>ref|XP_006438927.1| hypothetical protein CICLE_v10031354mg [Citrus clementina]
 ref|XP_006482943.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990-like 
[Citrus sinensis]
 gb|ESR52167.1| hypothetical protein CICLE_v10031354mg [Citrus clementina]
 gb|KDO37042.1| hypothetical protein CISIN_1g011384mg [Citrus sinensis]
Length=487

 Score =   344 bits (882),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 173/256 (68%), Positives = 199/256 (78%), Gaps = 10/256 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKSANVLIDRN NARLGDFGLALRC  ++FR RSTPPAGT+GYLDP Y+TPDNLS
Sbjct  173  IIHRDIKSANVLIDRNFNARLGDFGLALRCGVDNFRFRSTPPAGTIGYLDPCYVTPDNLS  232

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIIS RKAID+ +SPPSIVDWA PLI++GK++++FDPRI PPKDP+V
Sbjct  233  TKTDVFSFGILLLEIISCRKAIDIGFSPPSIVDWAAPLIKKGKILSVFDPRIPPPKDPIV  292

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT---VGL  531
            RKQLAV+A +CVRSCRERRPSMKEIV+ L  LSK+VPLHSWNGF NPCLMVET    V +
Sbjct  293  RKQLAVIAVRCVRSCRERRPSMKEIVDWLTGLSKLVPLHSWNGFNNPCLMVETVGRPVEV  352

Query  532  RKV------GEEAQSFDAKFSK-PLRNSRRVYSDLGSRSNLMELMAGGDDFVPKSSSQKG  690
            RK       GE     D K S+  +++SRRVYSDLG RSNLMELMAG D+         G
Sbjct  353  RKTQEGGIAGENLDLLDGKLSRMSMKDSRRVYSDLGLRSNLMELMAGMDEEHEFRGEADG  412

Query  691  SSLRCKTGNLVGKGNH  738
                 K+   V   +H
Sbjct  413  VEPSIKSAKQVSSSSH  428



>ref|XP_010694683.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Beta vulgaris subsp. vulgaris]
Length=476

 Score =   343 bits (879),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 177/274 (65%), Positives = 206/274 (75%), Gaps = 25/274 (9%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVL+DRN NA+LGDFGLAL+C  +DFRLRSTPPAGT+GYLDP Y+TPDNLS
Sbjct  179  VIHRDIKSANVLLDRNFNAKLGDFGLALKCNVDDFRLRSTPPAGTIGYLDPCYVTPDNLS  238

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAID+ +SPPS+VDWAIPL+R+GKL+ I+DPRI PPKD +V
Sbjct  239  TKTDVFSFGILLLEIISGRKAIDIGHSPPSVVDWAIPLVRKGKLLGIYDPRIPPPKDHMV  298

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT---VGL  531
            RKQLAV+AAKCVRS RERRPSMKEIVE L  LSK+VPLHSWNG ANPCLMVE     VGL
Sbjct  299  RKQLAVIAAKCVRSNRERRPSMKEIVEALDRLSKLVPLHSWNGLANPCLMVENVGQPVGL  358

Query  532  RKVGEEAQSF-----------DAKFSKPLRNSRRVYSDLGSRSNLMELMA--------GG  654
               G  +  F           D  F+KPL+N RRVYSDLG R+NL++LMA        GG
Sbjct  359  AN-GHSSSRFRGLECGNLVDVDGTFAKPLKNPRRVYSDLGFRNNLLDLMAESELDSEFGG  417

Query  655  DDFVP--KSSSQKGSSLRCKTGNLVGKGNHSPFL  750
            +D +   + +     SLR ++     KG  S  +
Sbjct  418  EDVIEHKQHTPSHKPSLRIRSERYSEKGQTSSLV  451



>emb|CDP14372.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   343 bits (879),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 184/269 (68%), Positives = 212/269 (79%), Gaps = 16/269 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDRN NARLGDFGLALRC  +D+RLRSTPPAGTMGYLDPGY+TPDNLS
Sbjct  180  VIHRDIKSANVLIDRNFNARLGDFGLALRCHVDDYRLRSTPPAGTMGYLDPGYVTPDNLS  239

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV +SPPSIVDWAIPLIRRGKL++I+DPRI PP+DPLV
Sbjct  240  TKTDVFSFGILLLEIISGRKAIDVGHSPPSIVDWAIPLIRRGKLVSIYDPRIPPPRDPLV  299

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVET-------  519
            RKQLAVVAAKCVRSCRERRP+MKE+VECL  LSK+VPLHSWNG  NPCLMVET       
Sbjct  300  RKQLAVVAAKCVRSCRERRPTMKEVVECLSGLSKLVPLHSWNGLTNPCLMVETVGRPVES  359

Query  520  ---TVGLRKVGEEAQSFD----AKFSKPLRNSRRVYSDLGSRSNLMELMAG--GDDFVPK  672
                V +++ G+E  + D    A  ++ LRNSRRVYSDLG RSNLM+L+ G  G+   P+
Sbjct  360  RSNNVNVKEKGDEQGNLDGEDGASLARALRNSRRVYSDLGFRSNLMDLLNGIHGESEFPE  419

Query  673  SSSQKGSSLRCKTGNLVGKGNHSPFLGLK  759
             +S      + ++G    +     F+G K
Sbjct  420  DNSGIKPCEQPESGGFSCRFESEKFVGRK  448



>emb|CAN82122.1| hypothetical protein VITISV_009093 [Vitis vinifera]
Length=1697

 Score =   362 bits (930),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 179/227 (79%), Positives = 195/227 (86%), Gaps = 8/227 (4%)
 Frame = +1

Query  1     VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
             VIHRDIKSANVLIDRN NARLGDFGLALRC  +D+RLRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  1448  VIHRDIKSANVLIDRNFNARLGDFGLALRCHVDDYRLRSTPPAGTMGYLDPCYVTPDNLS  1507

Query  181   TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             TKTDVFSFGILLLEIISGRKAIDV +SPPSIVDWAIPLIR+GKL+AI+DP I PPK+P V
Sbjct  1508  TKTDVFSFGILLLEIISGRKAIDVGHSPPSIVDWAIPLIRKGKLLAIYDPTIAPPKEPFV  1567

Query  361   RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT---VGL  531
             RKQLAV+AAKCVRSCRERRPSMKE+VE LG LSK+VPLH+WNGF NPCLMVET    V  
Sbjct  1568  RKQLAVIAAKCVRSCRERRPSMKEVVEWLGGLSKLVPLHTWNGFNNPCLMVETMGCPVEA  1627

Query  532   RKV----GEEAQSFDAKFSK-PLRNSRRVYSDLGSRSNLMELMAGGD  657
              K+    G      DAKF + PLRNSRRVYSDLG R+NLM+LMAG D
Sbjct  1628  SKMDGVEGGNMDGMDAKFGRTPLRNSRRVYSDLGFRNNLMDLMAGTD  1674



>ref|XP_007052432.1| Serine/threonine-protein kinase protein [Theobroma cacao]
 gb|EOX96589.1| Serine/threonine-protein kinase protein [Theobroma cacao]
Length=478

 Score =   339 bits (870),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 170/245 (69%), Positives = 199/245 (81%), Gaps = 12/245 (5%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRD+KSANVLIDRN NARLGDFGLALRC  +D+RLRSTPPAGT+GYLDP Y+TPDNLS
Sbjct  172  IIHRDVKSANVLIDRNFNARLGDFGLALRCGVDDYRLRSTPPAGTIGYLDPCYVTPDNLS  231

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDVA+SPPSIVDWAIPL+++GK++A++DPRI PPKDP+V
Sbjct  232  TKTDVFSFGILLLEIISGRKAIDVAHSPPSIVDWAIPLVKKGKIVAVYDPRIAPPKDPIV  291

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETTVGLRKV  540
            RKQLAV+AAKCVRS RERRP+MKE+V  L  LSK+VPLHSWNGF+NPCLMVET     + 
Sbjct  292  RKQLAVIAAKCVRSYRERRPAMKEVVGWLTGLSKLVPLHSWNGFSNPCLMVETVGRPVEF  351

Query  541  GEEAQSFDAKFSK-PLRNSRRVYSDLGSRSNLMELMA--GGD---------DFVPKSSSQ  684
                ++ D  F +  +R+SRRVYSDLG  SNLMELM   G D         D V +  S+
Sbjct  352  RNPQENLDGNFGRQTMRDSRRVYSDLGFSSNLMELMGMTGVDGESEVWREADVVERPESK  411

Query  685  KGSSL  699
             GSS+
Sbjct  412  PGSSV  416



>ref|XP_011091782.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Sesamum indicum]
Length=492

 Score =   340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/225 (74%), Positives = 188/225 (84%), Gaps = 7/225 (3%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDRN NARLGDFGLALRC DND +LRSTPPAGTMGYLDP Y+TP+NLS
Sbjct  184  VIHRDIKSANVLIDRNFNARLGDFGLALRCVDND-KLRSTPPAGTMGYLDPCYVTPENLS  242

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEI+SGRKAID+A+SPPS+VDWAIPLIRRGK ++I+DPR+ PPKD  V
Sbjct  243  TKTDVFSFGILLLEIVSGRKAIDMAHSPPSVVDWAIPLIRRGKFLSIYDPRVVPPKDASV  302

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVET------T  522
            RK LA+VAAKCVRSCRERRPSMKE+VECL ELSK+VP++SWNG +NPCLMVE       +
Sbjct  303  RKTLALVAAKCVRSCRERRPSMKEVVECLSELSKLVPVYSWNGVSNPCLMVENVGRPVQS  362

Query  523  VGLRKVGEEAQSFDAKFSKPLRNSRRVYSDLGSRSNLMELMAGGD  657
              +R   +     DAK   PLR  RRVYSDLG R NLM+LM+  D
Sbjct  363  TSVRVNSKRMDPGDAKVGIPLRKPRRVYSDLGVRCNLMDLMSSLD  407



>ref|XP_009354393.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Pyrus x bretschneideri]
Length=500

 Score =   338 bits (867),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 182/274 (66%), Positives = 209/274 (76%), Gaps = 30/274 (11%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALR-CQDNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            VIHRDIKSANVLIDR+ NARLGDFGLALR C  +++RLRSTPPAGTMGYLDP Y+TPDNL
Sbjct  180  VIHRDIKSANVLIDRSYNARLGDFGLALRYCLFDEYRLRSTPPAGTMGYLDPCYVTPDNL  239

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            STKTDVFSFGILLLEIISGRKAIDV +SPPSIVDWAIPLI+RGKL+ ++DP+I PPKD +
Sbjct  240  STKTDVFSFGILLLEIISGRKAIDVGHSPPSIVDWAIPLIKRGKLITVYDPQIVPPKDLV  299

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVET------  519
            VRKQLAV+AAKCVRSCRERRP+MKE+V  L  LSK+VPLHSWNGF NPC MVET      
Sbjct  300  VRKQLAVIAAKCVRSCRERRPTMKEVVVWLTGLSKLVPLHSWNGFNNPCTMVETMGRPVE  359

Query  520  ------TVGLRKVGEEA-QSFDAKFS-KPLRNSRRVYSDLGSRSNLMELMAG--------  651
                  +  L  VGEE  ++ +AK + K LRNS+RVYSDLG  SNLMELMAG        
Sbjct  360  SRIVHLSSKLEGVGEENLEALEAKLTRKVLRNSQRVYSDLGFSSNLMELMAGTDGEPDFH  419

Query  652  ----GDDFVPKSSSQKGSSLRCKTGNLVGKGNHS  741
                GDD   KS++Q     R  +G  +G+ N S
Sbjct  420  GNADGDDRSSKSANQVS---RFGSGRYIGRINKS  450



>ref|XP_004149730.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990-like 
[Cucumis sativus]
 ref|XP_004163921.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990-like 
[Cucumis sativus]
 gb|KGN58564.1| hypothetical protein Csa_3G685690 [Cucumis sativus]
Length=456

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 189/230 (82%), Gaps = 14/230 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDRN NARLGDFGLA++   +D+RLRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  186  VIHRDIKSANVLIDRNYNARLGDFGLAIQGYADDYRLRSTPPAGTMGYLDPCYVTPDNLS  245

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV YSPPSIVDWA+PLI++GKLMAI+DPRI PPKDP+V
Sbjct  246  TKTDVFSFGILLLEIISGRKAIDVGYSPPSIVDWAVPLIKKGKLMAIYDPRIAPPKDPIV  305

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT------  522
            RKQLAV+AAKCVRSCRERRPSMK++V  L  LSK+VPLHSWNGF NPCLMVET       
Sbjct  306  RKQLAVIAAKCVRSCRERRPSMKDVVVWLTGLSKLVPLHSWNGFNNPCLMVETVGRPVEM  365

Query  523  ----VGLRKVGEEAQSFD---AKFS-KPLRNSRRVYSDLGSRSNLMELMA  648
                  LR    E    D   AK S + ++NSRRVYSDLG  +NLM+LMA
Sbjct  366  RNSQSNLRSPSVEDGDLDVGNAKMSRRDIKNSRRVYSDLGISNNLMDLMA  415



>ref|XP_008354911.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Malus domestica]
Length=500

 Score =   337 bits (865),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 175/266 (66%), Positives = 201/266 (76%), Gaps = 15/266 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALR-CQDNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            VIHRD KSANVLIDR+ NARLGDFGLALR C  +++RLRSTPPAGTMGYLDP Y+TPDNL
Sbjct  180  VIHRDXKSANVLIDRSXNARLGDFGLALRYCLFDEYRLRSTPPAGTMGYLDPCYVTPDNL  239

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            STKTDVFSFGILLLEI SGRKAIDV +SPPSIVDWAIPLI+RGKL+ ++DPRI PPKDP+
Sbjct  240  STKTDVFSFGILLLEIJSGRKAIDVGHSPPSIVDWAIPLIKRGKLITVYDPRIVPPKDPV  299

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVET------  519
            VRKQLAV+AAKCVRSCRERRP+MKE+V  L  LSK+VPLHSWNGF NPC MVET      
Sbjct  300  VRKQLAVIAAKCVRSCRERRPTMKEVVVWLTGLSKLVPLHSWNGFNNPCTMVETVGXPVE  359

Query  520  ------TVGLRKVGEEA-QSFDAKFS-KPLRNSRRVYSDLGSRSNLMELMAGGDDFVPKS  675
                  +     VGEE  ++ +AK + + LRNS+RVYSDLG  SNLMELMAG D      
Sbjct  360  SRNAHLSSKQEXVGEENLEALEAKLTRRVLRNSQRVYSDLGFSSNLMELMAGTDGEPDFH  419

Query  676  SSQKGSSLRCKTGNLVGKGNHSPFLG  753
                G     K+ N V +     ++G
Sbjct  420  GXADGDDRSSKSANWVSRFGSGRYIG  445



>ref|XP_008461833.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Cucumis melo]
Length=456

 Score =   335 bits (860),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 190/231 (82%), Gaps = 16/231 (7%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDRN NARLGDFGLA++   +D+RLRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  186  VIHRDIKSANVLIDRNYNARLGDFGLAIQGYADDYRLRSTPPAGTMGYLDPCYVTPDNLS  245

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV YSPPSIVDWA+PLI++GKLMAI+DPRI PPKDP+V
Sbjct  246  TKTDVFSFGILLLEIISGRKAIDVGYSPPSIVDWAVPLIKKGKLMAIYDPRIAPPKDPIV  305

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETTVGLRKV  540
            RKQLAV+AAKCVRSCRERRPSMK++V  L  LSK+VPLHSWNGF NPCLMVE TVG    
Sbjct  306  RKQLAVIAAKCVRSCRERRPSMKDVVVWLTGLSKLVPLHSWNGFNNPCLMVE-TVGRPVE  364

Query  541  GEEAQSF--------------DAKFS-KPLRNSRRVYSDLGSRSNLMELMA  648
                QS               DAK S + ++NSRRVYSDLG  +NLM+LMA
Sbjct  365  TRNLQSNLRCRSVEDGDLDVGDAKMSRRDIKNSRRVYSDLGISNNLMDLMA  415



>ref|XP_010279526.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Nelumbo nucifera]
Length=506

 Score =   337 bits (864),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 174/235 (74%), Positives = 193/235 (82%), Gaps = 20/235 (9%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDRN NARLGDFGLALRC  +DFRLRSTPPAGT+GYLDP Y+TPDNLS
Sbjct  185  VIHRDIKSANVLIDRNFNARLGDFGLALRCHVDDFRLRSTPPAGTIGYLDPCYVTPDNLS  244

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV YSPPSIVDWA+PLIR+GKL+A++DPRI PPKDP V
Sbjct  245  TKTDVFSFGILLLEIISGRKAIDVGYSPPSIVDWAVPLIRKGKLLAVYDPRIPPPKDPSV  304

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFA-NPCLMVETTVGLRK  537
             KQLAV+AAKCVRS +ERRP+MKEIVE L  LSK +PLHSWNGF+ NPC+MV+  VG R 
Sbjct  305  GKQLAVLAAKCVRSSKERRPTMKEIVEYLTVLSKTIPLHSWNGFSVNPCMMVD-AVG-RP  362

Query  538  VGEEAQSF---------------DAKFSKPLRNSRRVYSDL--GSRSNLMELMAG  651
            VG EA                  D K S+ LRNSRRVYSDL  GSR+NLM+L+AG
Sbjct  363  VGPEATHLSSRSRQQGGESGDVGDTKSSRQLRNSRRVYSDLGFGSRNNLMDLLAG  417



>ref|XP_011025511.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Populus euphratica]
Length=483

 Score =   334 bits (856),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 191/234 (82%), Gaps = 15/234 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQ-DNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            +IHRDIKSANVLIDRN NARLGDFGLALRC  D+D+RL+STPPAGT+GYLDP Y+TPDNL
Sbjct  171  IIHRDIKSANVLIDRNFNARLGDFGLALRCGVDDDYRLKSTPPAGTIGYLDPCYVTPDNL  230

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            STKTDVFSFGIL LEIISGRKAIDV +SPPSIVDWAIPLI++GKL AI+DPR  P KDP+
Sbjct  231  STKTDVFSFGILFLEIISGRKAIDVGHSPPSIVDWAIPLIKKGKLGAIYDPRTFPLKDPM  290

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT---VG  528
            +RKQLA++A+KCVRSCRERRP+MKE+V+ L  LSK+VPLHSWNGF NPC+MVET    V 
Sbjct  291  IRKQLALIASKCVRSCRERRPAMKEVVDWLTTLSKLVPLHSWNGFNNPCMMVETMGRPVE  350

Query  529  LRKV---------GEEA-QSFDAKFS-KPLRNSRRVYSDLGSRSNLMELMAGGD  657
            LR           GEE     D K   K + ++RRVYSDLG RSNLMELMAG D
Sbjct  351  LRNTRFGSRPQGDGEENLNEIDGKMGRKSMMDTRRVYSDLGFRSNLMELMAGTD  404



>ref|XP_007131433.1| hypothetical protein PHAVU_011G013100g [Phaseolus vulgaris]
 gb|ESW03427.1| hypothetical protein PHAVU_011G013100g [Phaseolus vulgaris]
Length=503

 Score =   334 bits (857),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 169/232 (73%), Positives = 192/232 (83%), Gaps = 12/232 (5%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDR+ NARLGDFGLALR   +D+RLRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  186  VIHRDIKSANVLIDRSYNARLGDFGLALRGHVDDYRLRSTPPAGTMGYLDPCYVTPDNLS  245

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAID+ YSPPSIVDWAIPLI++GKL+ ++DPRI PPKDP+V
Sbjct  246  TKTDVFSFGILLLEIISGRKAIDITYSPPSIVDWAIPLIKKGKLLGVYDPRIAPPKDPVV  305

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT---VGL  531
            RKQLAV+AAKCVRSCRERRPSMKE+V  L  L K+VPLHSWNGF NPC+MVET    V  
Sbjct  306  RKQLAVIAAKCVRSCRERRPSMKEVVTWLCGLCKLVPLHSWNGFNNPCMMVETVGRPVEA  365

Query  532  R------KVGEEAQ--SFDAKFSK-PLRNSRRVYSDLGSRSNLMELMAGGDD  660
            R      ++ EE    + DA+ SK  +R SRRVYSDLG  SNLM+LMA  ++
Sbjct  366  RNGQFSSRLVEEGNFDALDARLSKSAMRYSRRVYSDLGFSSNLMDLMATTEE  417



>gb|KDP43611.1| hypothetical protein JCGZ_16898 [Jatropha curcas]
Length=486

 Score =   334 bits (856),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 167/232 (72%), Positives = 191/232 (82%), Gaps = 15/232 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQ-DNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            +IHRDIKSANVLIDRN NARLGDFGLALRC  D+D+RL+STPPAGT+GYLDP Y+TPDNL
Sbjct  168  IIHRDIKSANVLIDRNFNARLGDFGLALRCGIDDDYRLKSTPPAGTIGYLDPCYVTPDNL  227

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            STKTDVFSFGILLLEIISGRKAIDV +SPPSIVDWAIPLI++GKL AI+DPRI P KD +
Sbjct  228  STKTDVFSFGILLLEIISGRKAIDVGHSPPSIVDWAIPLIKKGKLGAIYDPRIAPLKDHM  287

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVE-------  516
            +R+QLA+VAAKCVRSCRERRP+MKE+V+ L  LSK+VPLHSWNGF NPC+MVE       
Sbjct  288  IRRQLALVAAKCVRSCRERRPAMKEVVDWLTALSKLVPLHSWNGFNNPCMMVETMGRPVE  347

Query  517  ---TTVGLRKVGEEAQSFDAKFSK----PLRNSRRVYSDLGSRSNLMELMAG  651
               T  GLR  G   ++ D   SK     +++SRRVYS LG RSNLMELMAG
Sbjct  348  LRNTQFGLRPEGVAEENLDGIDSKLGAQSVKDSRRVYSGLGFRSNLMELMAG  399



>ref|XP_010269712.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Nelumbo nucifera]
Length=505

 Score =   334 bits (856),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 179/269 (67%), Positives = 203/269 (75%), Gaps = 26/269 (10%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDRN NARLGDFGLALRC  +DFRLRSTPPAGT+GYLDP Y+TPDNLS
Sbjct  185  VIHRDIKSANVLIDRNFNARLGDFGLALRCHVDDFRLRSTPPAGTIGYLDPCYVTPDNLS  244

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV +SPPSIVDWAIPLIR+GKL+ ++DPRI PPKDP V
Sbjct  245  TKTDVFSFGILLLEIISGRKAIDVGHSPPSIVDWAIPLIRKGKLLVVYDPRIPPPKDPSV  304

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFA-NPCLMVETT---VG  528
            RKQLAV+AAKCVRS +ERRPSMK+IVECL  LSK VPLHSWNGF+ NPCLMV+     VG
Sbjct  305  RKQLAVLAAKCVRSSKERRPSMKDIVECLTLLSKSVPLHSWNGFSVNPCLMVDIVGRPVG  364

Query  529  L----------RKVGEEAQSFDAKFSKPLRNSRRVYSDL--GSRSNLMELMA---GGDDF  663
                       ++VGE     D + ++ LRN RRVYSDL  G R+NLM+LMA   G   F
Sbjct  365  HENTHLNSRPRQQVGENGDVGDTRSARQLRNLRRVYSDLGFGPRNNLMDLMAVMEGESSF  424

Query  664  -------VPKSSSQKGSSLRCKTGNLVGK  729
                    P   + +G   R  +G  VG+
Sbjct  425  RGETCGAQPVPVAFQGCGYRVGSGRFVGR  453



>ref|XP_002527952.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF34441.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=486

 Score =   332 bits (852),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 168/232 (72%), Positives = 190/232 (82%), Gaps = 15/232 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQ-DNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            +IHRDIKSANVLIDRN NARLGDFGLALRC  D+D+RL+STPPAGT+GYLDP Y+TPDNL
Sbjct  168  IIHRDIKSANVLIDRNFNARLGDFGLALRCGIDDDYRLKSTPPAGTIGYLDPCYVTPDNL  227

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            STKTDVFSFGILLLEIISGRKAIDV +SPPSIVDWAIPL+++GKL AI+DPRI P KDP 
Sbjct  228  STKTDVFSFGILLLEIISGRKAIDVGHSPPSIVDWAIPLVKKGKLGAIYDPRIDPLKDPT  287

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVE-------  516
             RKQLA++A KCVRSCRERRP+MKE+   L  LSK+VPLHSWNGF NPC+MVE       
Sbjct  288  TRKQLALIATKCVRSCRERRPAMKEVANWLTTLSKLVPLHSWNGFNNPCMMVETMGRPVE  347

Query  517  ---TTVGLR--KVGEEA-QSFDAKFS-KPLRNSRRVYSDLGSRSNLMELMAG  651
               T  GLR   VGEE     D+K   + +++SRRVYSDLG RSNLMELMAG
Sbjct  348  LRNTQFGLRPEGVGEENLDGIDSKLGVQSVKDSRRVYSDLGFRSNLMELMAG  399



>ref|XP_006587692.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990-like, 
partial [Glycine max]
Length=480

 Score =   332 bits (850),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/238 (71%), Positives = 189/238 (79%), Gaps = 18/238 (8%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDR+ NARLGDFGLALR   +D+RLRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  179  VIHRDIKSANVLIDRSYNARLGDFGLALRGHVDDYRLRSTPPAGTMGYLDPCYVTPDNLS  238

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAID+ YSPPSIVDWAIPLI++GKL+A++DPRI PPKDP+V
Sbjct  239  TKTDVFSFGILLLEIISGRKAIDITYSPPSIVDWAIPLIKKGKLLAVYDPRIAPPKDPIV  298

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT------  522
            RKQLAV+AAKCVRSCRERRPSMKE+V  L  L K+VPLHSWNGF NPC+MVET       
Sbjct  299  RKQLAVIAAKCVRSCRERRPSMKEVVTWLCGLCKLVPLHSWNGFNNPCMMVETAGRPVEA  358

Query  523  --------VGLRKVGEEAQSFDA---KFSK-PLRNSRRVYSDLGSRSNLMELMAGGDD  660
                       R  G E   FDA   + SK  +R SRRVYSDLG   NLM+LMA  ++
Sbjct  359  AAARNNGQFSSRLEGVEEGKFDALDGRLSKSAMRYSRRVYSDLGFSRNLMDLMATTEE  416



>gb|KHN11713.1| Serine/threonine-protein kinase-like protein [Glycine soja]
Length=502

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/238 (71%), Positives = 189/238 (79%), Gaps = 18/238 (8%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDR+ NARLGDFGLALR   +D+RLRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  179  VIHRDIKSANVLIDRSYNARLGDFGLALRGHVDDYRLRSTPPAGTMGYLDPCYVTPDNLS  238

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAID+ YSPPSIVDWAIPLI++GKL+A++DPRI PPKDP+V
Sbjct  239  TKTDVFSFGILLLEIISGRKAIDITYSPPSIVDWAIPLIKKGKLLAVYDPRIAPPKDPIV  298

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT------  522
            RKQLAV+AAKCVRSCRERRPSMKE+V  L  L K+VPLHSWNGF NPC+MVET       
Sbjct  299  RKQLAVIAAKCVRSCRERRPSMKEVVTWLCGLCKLVPLHSWNGFNNPCMMVETAGCPVEA  358

Query  523  --------VGLRKVGEEAQSFDA---KFSK-PLRNSRRVYSDLGSRSNLMELMAGGDD  660
                       R  G E   FDA   + SK  +R SRRVYSDLG   NLM+LMA  ++
Sbjct  359  AAARNNGQFSSRLEGVEEGKFDALDGRLSKSAMRYSRRVYSDLGFSRNLMDLMATTEE  416



>ref|XP_006379076.1| hypothetical protein POPTR_0009s06000g [Populus trichocarpa]
 gb|ERP56873.1| hypothetical protein POPTR_0009s06000g [Populus trichocarpa]
Length=481

 Score =   331 bits (848),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 167/234 (71%), Positives = 190/234 (81%), Gaps = 15/234 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQ-DNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            +IHRDIKSANVLIDRN NARLGDFGLALRC  D+D+RL+STPPAGT+GYLDP Y+TPDNL
Sbjct  169  IIHRDIKSANVLIDRNFNARLGDFGLALRCGVDDDYRLKSTPPAGTIGYLDPCYVTPDNL  228

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            STKTDVFSFGIL LEIISGRKAIDV +SPPSIVDWAIPLI++GKL AI+DPR  P KDP+
Sbjct  229  STKTDVFSFGILFLEIISGRKAIDVGHSPPSIVDWAIPLIKKGKLAAIYDPRTFPLKDPM  288

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT---VG  528
            +RKQLA++A+KCVRSCRERRP+MKE+V+ L  LSK+VPLHSWNG  NPC+MVET    V 
Sbjct  289  IRKQLALIASKCVRSCRERRPAMKEVVDWLTTLSKLVPLHSWNGLNNPCMMVETMGRPVE  348

Query  529  LRKV---------GEEA-QSFDAKFS-KPLRNSRRVYSDLGSRSNLMELMAGGD  657
            LR           GEE     D K   K + ++RRVYSDLG RSNLMELMAG D
Sbjct  349  LRNTRFGSRPQGDGEENLNEIDGKMGRKSMMDTRRVYSDLGFRSNLMELMAGTD  402



>ref|XP_011025513.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Populus euphratica]
Length=483

 Score =   331 bits (848),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 167/234 (71%), Positives = 190/234 (81%), Gaps = 15/234 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQ-DNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            +IHRDIKSANVLIDRN NARLGDFGLALRC  D+D+RL+STPPAGT+GYLDP Y+TPDNL
Sbjct  171  IIHRDIKSANVLIDRNFNARLGDFGLALRCGVDDDYRLKSTPPAGTIGYLDPCYVTPDNL  230

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            STKTDVFSFGIL LEIISGRKAIDV +SP SIVDWAIPLI++GKL AI+DPR  P KDP+
Sbjct  231  STKTDVFSFGILFLEIISGRKAIDVGHSPSSIVDWAIPLIKKGKLGAIYDPRTFPLKDPM  290

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT---VG  528
            +RKQLA++A+KCVRSCRERRP+MKE+V+ L  LSK+VPLHSWNGF NPC+MVET    V 
Sbjct  291  IRKQLALIASKCVRSCRERRPAMKEVVDWLTTLSKLVPLHSWNGFNNPCMMVETMGRPVE  350

Query  529  LRKV---------GEEA-QSFDAKFS-KPLRNSRRVYSDLGSRSNLMELMAGGD  657
            LR           GEE     D K   K + ++RRVYSDLG RSNLMELMAG D
Sbjct  351  LRNTRFGSRPQGDGEENLNEIDGKMGRKSMMDTRRVYSDLGFRSNLMELMAGTD  404



>ref|XP_011008277.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Populus euphratica]
Length=413

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/234 (70%), Positives = 187/234 (80%), Gaps = 15/234 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQ-DNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            VIHRDIKSANVLIDRN NARLGDFGLA+RC  D+D+RL+STPPAGTMGYLDP Y+TPDNL
Sbjct  171  VIHRDIKSANVLIDRNFNARLGDFGLAVRCGVDDDYRLKSTPPAGTMGYLDPCYVTPDNL  230

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            STKTDVFSFGI LLEIISGRKAIDV +SP SIVDWAIPLI++GKL AI+DPR  P KDP+
Sbjct  231  STKTDVFSFGIFLLEIISGRKAIDVGHSPSSIVDWAIPLIKKGKLGAIYDPRTVPLKDPM  290

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVE-------  516
            +RKQLA++A+KCVRSCRERRP+MKE+V+ L  LSK+VPLHSWNGF NPC+MVE       
Sbjct  291  IRKQLALIASKCVRSCRERRPAMKEVVDWLAALSKLVPLHSWNGFNNPCMMVETMGRPAE  350

Query  517  ---TTVGLRKVGEEAQSFDAKFSKPLRNS----RRVYSDLGSRSNLMELMAGGD  657
               T  G R  G+  +  +  + K  R S    RRVYSDLG RSNLMELMA  D
Sbjct  351  QRNTQFGSRPQGDGEEILEETYGKMGRKSVMDTRRVYSDLGFRSNLMELMAWTD  404



>ref|XP_010557823.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Tarenaya hassleriana]
Length=430

 Score =   327 bits (838),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 188/224 (84%), Gaps = 9/224 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKSANVLIDRN NARLGDFGLALRC  +D+RLRSTPPAGT+GYLDP Y+TPDNLS
Sbjct  174  IIHRDIKSANVLIDRNYNARLGDFGLALRCSVDDYRLRSTPPAGTIGYLDPNYVTPDNLS  233

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAID+ +SPPSIVDWAIPL+++GK+++I+DPR  PPKDPLV
Sbjct  234  TKTDVFSFGILLLEIISGRKAIDIGHSPPSIVDWAIPLVKKGKILSIYDPRTAPPKDPLV  293

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT---VGL  531
            RKQLA +AAKCVRSCRERRPSMKE+V  L  LSK+VPLHSWN   NPCLMVET    V  
Sbjct  294  RKQLAAIAAKCVRSCRERRPSMKEMVNWLTGLSKLVPLHSWN-INNPCLMVETMGRPVEY  352

Query  532  RKVGEEAQ--SFDAK--FSKP-LRNSRRVYSDLGSRSNLMELMA  648
            R+  E +     D K  FS+  +R+SR+V SDLG RSNLMELMA
Sbjct  353  RRSQEGSHRGEHDPKGTFSRDVMRDSRKVCSDLGIRSNLMELMA  396



>ref|XP_010548808.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Tarenaya hassleriana]
Length=434

 Score =   327 bits (838),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 162/226 (72%), Positives = 189/226 (84%), Gaps = 11/226 (5%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKSANVLIDR+ NARLGDFGLALRC  +D+RLRSTPPAGT+GYLDP Y+TPDNLS
Sbjct  152  IIHRDIKSANVLIDRSFNARLGDFGLALRCGVDDYRLRSTPPAGTIGYLDPNYVTPDNLS  211

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAID+ +SPPSIVDWAIPL+++GK+++I+DPR  PPKDP+V
Sbjct  212  TKTDVFSFGILLLEIISGRKAIDIGHSPPSIVDWAIPLVKKGKILSIYDPRTVPPKDPVV  271

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT---VGL  531
             KQLA++AAKCVRSCRE+RPSMKEIV+ L  L K+VPLHSWN   NPC+MVET    V  
Sbjct  272  SKQLALIAAKCVRSCREKRPSMKEIVDWLTGLCKLVPLHSWN-INNPCMMVETMGRPVEY  330

Query  532  RKVGEEAQS------FDAKFSKP-LRNSRRVYSDLGSRSNLMELMA  648
            R+  E A         D KFS+  +R+SR+VYSDLG RSNLMELMA
Sbjct  331  RRSQERAHHRREDDDTDGKFSRNMMRDSRKVYSDLGIRSNLMELMA  376



>ref|XP_006591991.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990-like 
[Glycine max]
Length=505

 Score =   328 bits (842),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 168/240 (70%), Positives = 188/240 (78%), Gaps = 20/240 (8%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDR+ NARLGDFGLALR   +D+RLRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  180  VIHRDIKSANVLIDRSYNARLGDFGLALRGHVDDYRLRSTPPAGTMGYLDPCYVTPDNLS  239

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAID+ YSPPSIVDWAIPLI++GKL+A++DPRI PPKDP+V
Sbjct  240  TKTDVFSFGILLLEIISGRKAIDITYSPPSIVDWAIPLIKKGKLLAVYDPRIAPPKDPIV  299

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT------  522
            RKQLAV+AAKCVRSCRERRPSMKE+V  L  L K+VPLHSWNGF NPC+M E        
Sbjct  300  RKQLAVIAAKCVRSCRERRPSMKELVTWLCGLCKLVPLHSWNGFNNPCMMAEIAGRPVEA  359

Query  523  ----------VGLRKVGEEAQSFDA---KFSK-PLRNSRRVYSDLGSRSNLMELMAGGDD  660
                         R  G E   FDA   + SK  +R SRRVYSDLG  SNLM+LMA  ++
Sbjct  360  AAAAARNYGQFSSRLEGVEEGKFDALDGRLSKSAMRYSRRVYSDLGFSSNLMDLMATTEE  419



>emb|CBI28598.3| unnamed protein product [Vitis vinifera]
Length=279

 Score =   320 bits (820),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 153/186 (82%), Positives = 167/186 (90%), Gaps = 0/186 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDRN NARLGDFGLALRC  +D+RLRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  92   VIHRDIKSANVLIDRNFNARLGDFGLALRCHVDDYRLRSTPPAGTMGYLDPCYVTPDNLS  151

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV +SPPSIVDWAIPLIR+GKL+AI+DP I PPK+P V
Sbjct  152  TKTDVFSFGILLLEIISGRKAIDVGHSPPSIVDWAIPLIRKGKLLAIYDPTIAPPKEPFV  211

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETTVGLRKV  540
            RKQLAV+AAKCVRSCRERRPSMKE+VE LG LSK+VPLH+WNGF NPCLMVET      +
Sbjct  212  RKQLAVIAAKCVRSCRERRPSMKEVVEWLGGLSKLVPLHTWNGFNNPCLMVETMGCPDAI  271

Query  541  GEEAQS  558
             E A+S
Sbjct  272  EEFAES  277



>ref|XP_004516233.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990-like 
[Cicer arietinum]
Length=496

 Score =   318 bits (815),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 177/275 (64%), Positives = 196/275 (71%), Gaps = 32/275 (12%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLID+N NARLGDFGLALR  D   R+RSTPPAGTMGYLDP Y+TPDNLS
Sbjct  182  VIHRDIKSANVLIDQNFNARLGDFGLALRGHD---RIRSTPPAGTMGYLDPCYVTPDNLS  238

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK DVFSFGILLLEIISGRKAIDVAYSPPS+VDWAIPLI++GK+ A++DPRI P KD  V
Sbjct  239  TKIDVFSFGILLLEIISGRKAIDVAYSPPSVVDWAIPLIKKGKVFAVYDPRIAPIKDVFV  298

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVET-------  519
            RKQLA++AAKCVRSCRERRPSM E+V  L  L K+VPLHSWNGF NPC+MVET       
Sbjct  299  RKQLALIAAKCVRSCRERRPSMNEVVNWLCGLCKLVPLHSWNGFNNPCMMVETVGRPVEA  358

Query  520  ----TVGLRKVG--EEAQ--SFDAKFSK-PLRNSRRVYSDLGSRSNLMELMAG-------  651
                  G R  G  EE      DA+ SK  LR SRRVYSDLG  SNLM+LMA        
Sbjct  359  GNGRVFGSRFEGVVEEGNFDGLDARLSKSALRYSRRVYSDLGFSSNLMDLMASTAEEAEF  418

Query  652  --GDDFVPKSSSQKG----SSLRCKTGNLVGKGNH  738
                D V  SSS K     SS R  +G    +G +
Sbjct  419  QRDGDGVEHSSSSKSCEQVSSSRFGSGRYFTRGKN  453



>gb|KEH29540.1| Serine/Threonine kinase family protein [Medicago truncatula]
Length=478

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 171/268 (64%), Positives = 197/268 (74%), Gaps = 25/268 (9%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLID+N NARLGDFGLALR  D   R+RSTPPAGTMGYLDP Y+TPDNLS
Sbjct  171  VIHRDIKSANVLIDQNYNARLGDFGLALRGFD---RVRSTPPAGTMGYLDPCYVTPDNLS  227

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK DVFSFGILLLEIISGRKAIDVAYSPPS+VDWAIPLI++GK+ A++DPRI PPKD +V
Sbjct  228  TKIDVFSFGILLLEIISGRKAIDVAYSPPSVVDWAIPLIKKGKVFAVYDPRIPPPKDLVV  287

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETT------  522
            RKQLA++AAKCVRSCRERRPSM E+V  L  L K+VP HSWNGF NPC+MVET       
Sbjct  288  RKQLALIAAKCVRSCRERRPSMNEVVNWLSGLCKLVPNHSWNGFNNPCMMVETVGRPVEP  347

Query  523  ----VGLRKVGEEAQ--SFDAKFSK-PLRNSRRVYSDLGSRSNLMELMAGGD--DFV---  666
                V   +  E+      DA+ SK  LR SRRV+SDLG  SNLM+LMA  +  +FV   
Sbjct  348  RNGHVNSSRFVEDGNFDGLDARLSKSALRYSRRVHSDLGFSSNLMDLMATTEEAEFVRDG  407

Query  667  ----PKSSSQKGSSLRCKTGNLVGKGNH  738
                   S ++ SS R  +G    KG +
Sbjct  408  VVEHSSKSVEQVSSSRFGSGRYFAKGKN  435



>ref|XP_008375289.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Malus domestica]
Length=358

 Score =   308 bits (790),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 147/174 (84%), Positives = 161/174 (93%), Gaps = 1/174 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALR-CQDNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            VIHRDIKSANVLIDR+ NARLGDFGLALR CQ +++RLRSTPPAGTMGYLDP Y+TPDNL
Sbjct  180  VIHRDIKSANVLIDRSYNARLGDFGLALRYCQFDEYRLRSTPPAGTMGYLDPCYVTPDNL  239

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            STKTDVFSFGILLLEIISGRKAIDV +SPPSIVDWAIPLI+RGKL+ ++DPRI PPKDP+
Sbjct  240  STKTDVFSFGILLLEIISGRKAIDVGHSPPSIVDWAIPLIKRGKLITVYDPRIVPPKDPV  299

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVET  519
            VRKQLAV+AAKCVRSCRERRPSMKE+V  L  LSK+VPLHSWNGF NPC MVET
Sbjct  300  VRKQLAVIAAKCVRSCRERRPSMKEVVVWLTGLSKLVPLHSWNGFNNPCTMVET  353



>gb|KHN32393.1| Serine/threonine-protein kinase-like protein [Glycine soja]
Length=365

 Score =   305 bits (782),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 144/172 (84%), Positives = 159/172 (92%), Gaps = 0/172 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLIDR+ NARLGDFGLALR   +D+RLRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  180  VIHRDIKSANVLIDRSYNARLGDFGLALRGHVDDYRLRSTPPAGTMGYLDPCYVTPDNLS  239

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAID+ YSPPSIVDWAIPLI++GKL+A++DPRI PPKDP+V
Sbjct  240  TKTDVFSFGILLLEIISGRKAIDITYSPPSIVDWAIPLIKKGKLLAVYDPRIAPPKDPIV  299

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVE  516
            RKQLAV+AAKCVRSCRERRPSMKE+V  L  L K+VPLHSWNGF NPC+MVE
Sbjct  300  RKQLAVIAAKCVRSCRERRPSMKEVVTWLCGLCKLVPLHSWNGFNNPCMMVE  351



>ref|XP_002298707.2| hypothetical protein POPTR_0001s26810g, partial [Populus trichocarpa]
 gb|EEE83512.2| hypothetical protein POPTR_0001s26810g, partial [Populus trichocarpa]
Length=415

 Score =   303 bits (776),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/220 (70%), Positives = 175/220 (80%), Gaps = 26/220 (12%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQ-DNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            VIHRDIKSANVLIDRN NARLGDFGLAL C  D+D+RL+STPPAGT+GYLDP Y+TPDNL
Sbjct  171  VIHRDIKSANVLIDRNFNARLGDFGLALMCGVDDDYRLKSTPPAGTIGYLDPCYVTPDNL  230

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            STKTDVFSFGI LLEIISGRKAIDV +SP SIVDWAIPLI++GKL+AI+DPR  P KDP+
Sbjct  231  STKTDVFSFGIFLLEIISGRKAIDVGHSPSSIVDWAIPLIKKGKLVAIYDPRTVPLKDPM  290

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETTVGLRK  537
            +RKQLA++A+KCVRSCRERRPSMKE+V+ L  LSK+VPLHSWNGF NPC+MVET      
Sbjct  291  IRKQLALIASKCVRSCRERRPSMKEVVDWLAALSKLVPLHSWNGFNNPCMMVET------  344

Query  538  VGEEAQSFDAKFSKPLRNSRRVYSDLGSRSNLMELMAGGD  657
            +G  A+         LRN+           NLMELMA  D
Sbjct  345  MGRPAE---------LRNTH----------NLMELMAWTD  365



>gb|EPS69242.1| hypothetical protein M569_05525, partial [Genlisea aurea]
Length=325

 Score =   278 bits (711),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 154/177 (87%), Gaps = 0/177 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRD+KSAN+LID N +ARLGDFGLALR  D+D RL+ TPPAGT+GYLDP Y+TPDNLS
Sbjct  146  VIHRDVKSANILIDDNFSARLGDFGLALRRVDDDNRLKFTPPAGTIGYLDPCYVTPDNLS  205

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK DVFSFGILLLEI+SGRKAID+  SPPSIVDWA+PLIR+GKL+++FD ++ PP D  V
Sbjct  206  TKNDVFSFGILLLEILSGRKAIDMGNSPPSIVDWAVPLIRKGKLLSLFDHKLPPPVDAAV  265

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETTVGL  531
            RK LA+VAAKCVRS RE+RPSMKE+V+CL EL K++PLHSWNG  NPCLMV+T  G+
Sbjct  266  RKVLAMVAAKCVRSSREKRPSMKEVVQCLSELRKLLPLHSWNGLPNPCLMVDTVAGV  322



>ref|XP_008778027.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Phoenix dactylifera]
Length=528

 Score =   280 bits (715),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 146/255 (57%), Positives = 180/255 (71%), Gaps = 41/255 (16%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRL----RSTPPAGTMGYLDPGYITP  168
            VIHRD+KSANVLIDR  NARLGDFGLALR  D+   L    R+TPPAGT+GYLDP Y+TP
Sbjct  198  VIHRDVKSANVLIDRRFNARLGDFGLALR--DDSAALFSAARATPPAGTLGYLDPSYVTP  255

Query  169  DNLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK  348
            +NLSTKTDVFSFGILLLEI+SGRKAIDVA+SPPS+V+WA+PL+++GK++A++DPRI PPK
Sbjct  256  ENLSTKTDVFSFGILLLEIMSGRKAIDVAHSPPSVVEWAVPLLKKGKILALYDPRIAPPK  315

Query  349  DPLVRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFA--NPCLMVETT  522
            DP  R+QLA +AA CVRSC+E+RPSM+E+VE L  LSK VPL +WNG +  NPC +V+T 
Sbjct  316  DPAARRQLASLAASCVRSCKEKRPSMQEVVEQLKVLSKTVPLRAWNGLSVGNPCSVVDTE  375

Query  523  VGLRKVGEEAQSFD-------------------------------AKFSKPLRNSRRVYS  609
              L K+   + + D                                K S P RN+RRV+S
Sbjct  376  RTLLKLNPNSLNLDRNLSLVSRWAKDDEQAEEEEMPVGVKKLPSIVKESHPSRNARRVFS  435

Query  610  DLGSRS--NLMELMA  648
            D  +R   NLMELMA
Sbjct  436  DASTRGSRNLMELMA  450



>ref|XP_010926999.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Elaeis guineensis]
Length=539

 Score =   276 bits (707),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 146/256 (57%), Positives = 180/256 (70%), Gaps = 42/256 (16%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRL----RSTPPAGTMGYLDPGYITP  168
            VIHRD+KSANVLIDR  NARLGDFGLALR  D+   L    R+TPPAGT+GYLDP Y+TP
Sbjct  198  VIHRDVKSANVLIDRRFNARLGDFGLALR--DDSAALFSAARATPPAGTLGYLDPSYVTP  255

Query  169  DNLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK  348
            +NLSTKTDVFSFGILLLEI+SGRKAIDVA+SPPS+V+WA+PL+R+GK++A++DPRI PPK
Sbjct  256  ENLSTKTDVFSFGILLLEIMSGRKAIDVAHSPPSVVEWAVPLLRKGKILALYDPRIAPPK  315

Query  349  DPLVRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFA--NPCLMVETT  522
            DP  R+QLA VAA CVRSC+E+RP M+E+VE L  LSK VPL +WNG +  NPC +V+T 
Sbjct  316  DPAGRRQLASVAASCVRSCKEKRPPMQEVVEQLKVLSKTVPLRAWNGLSVGNPCSVVDTE  375

Query  523  VGLRKVGEEAQSFD--------------------------------AKFSKPLRNSRRVY  606
              + K+   + + D                                 K S+P RN+RRV+
Sbjct  376  RTILKLNPNSLNLDRNLSSVSRWAKDDEQDAEEEEMPAGVKKLPSIVKESRPSRNARRVF  435

Query  607  SDLGSRS--NLMELMA  648
            SD  +R   NLMELMA
Sbjct  436  SDASTRGTRNLMELMA  451



>ref|XP_003568554.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Brachypodium distachyon]
Length=591

 Score =   258 bits (658),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 138/255 (54%), Positives = 170/255 (67%), Gaps = 32/255 (13%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRD+KSANVL+D NL+A LGDFGLALR  +      +  PAGT+GYLDP Y+TP++LS
Sbjct  188  VIHRDVKSANVLLDANLDAHLGDFGLALRVPNAAGNAATQAPAGTLGYLDPAYVTPESLS  247

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEI+SGRKAIDV YSPPS+V+WA+PL+R+GK++A+FDPR+ PP+DP+ 
Sbjct  248  TKTDVFSFGILLLEIMSGRKAIDVQYSPPSVVEWAVPLLRKGKVVALFDPRVAPPRDPVT  307

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFA---NPCLM--VETTV  525
            R+ LA +AA CVRSCRERRPSM +IVE L  LSK V    WNG A   NPC +  V+ T+
Sbjct  308  RRDLAALAASCVRSCRERRPSMADIVERLIVLSKAVSAKVWNGMAVVGNPCAIVDVQKTI  367

Query  526  GLRKVGEEAQSFDA------------------------KFSKPLRNSRRVYSDLGSRS--  627
              R    E +S  A                        K  +PL N  RV+S+ G R   
Sbjct  368  SKRAAASERESTSALAFDDDEKESDAALEELVPLVGARKPPRPLNNG-RVFSEAGDRERR  426

Query  628  NLMELMAGGDDFVPK  672
            NL+ELMA  D    K
Sbjct  427  NLLELMARIDGVAGK  441



>ref|NP_190767.1| serine/threonine-protein kinase-like protein [Arabidopsis thaliana]
 sp|Q9SV05.1|CCR35_ARATH RecName: Full=Serine/threonine-protein kinase-like protein At3g51990; 
AltName: Full=CRINKLY 4-related kinase; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB41319.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAL24299.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AAM10106.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 gb|AEE78872.1| serine/threonine-protein kinase-like protein [Arabidopsis thaliana]
Length=362

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 143/178 (80%), Gaps = 2/178 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKSANVL+D+NLNA+LGDFGLA+RC  +D +++STPPAGTMGYLDP Y+T D LS
Sbjct  181  IIHRDIKSANVLMDKNLNAKLGDFGLAIRCNVDDQKVKSTPPAGTMGYLDPDYVTADRLS  240

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV YSP  IVDWAIP+I+RGK+  I+DPRI PP D  V
Sbjct  241  TKTDVFSFGILLLEIISGRKAIDVRYSPSFIVDWAIPMIKRGKIGGIYDPRIGPPIDVSV  300

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWN--GFANPCLMVETTVG  528
            R  L +VAAKCVR+CRE+RP M+E+V  L  L+K V    W+     NPC+MVET  G
Sbjct  301  RNHLGLVAAKCVRTCREKRPGMEEVVGWLTGLTKSVRSRRWDELSIGNPCMMVETVGG  358



>ref|XP_006291374.1| hypothetical protein CARUB_v10017513mg [Capsella rubella]
 gb|EOA24272.1| hypothetical protein CARUB_v10017513mg [Capsella rubella]
Length=358

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKSANVL+D+NLNA+LGDFGLA+RC  +D +++STPPAGTMGYLDP Y+T D LS
Sbjct  178  IIHRDIKSANVLMDKNLNAKLGDFGLAIRCNVDDQKVKSTPPAGTMGYLDPDYVTADRLS  237

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV YSP  IVDWAIP+I+RGK+  I+DPRI PP D  V
Sbjct  238  TKTDVFSFGILLLEIISGRKAIDVRYSPSFIVDWAIPMIKRGKIGGIYDPRIGPPVDVSV  297

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWN--GFANPCLMVETT  522
            R  L +VAAKCVR+CRE+RP M+E+V  L  L+K V    W+     NPC+MVET 
Sbjct  298  RNHLGLVAAKCVRTCREKRPGMEEVVGWLTGLTKSVKSRRWDELSIGNPCMMVETV  353



>ref|XP_002876113.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52372.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 143/176 (81%), Gaps = 2/176 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKSANVL+D+NLNA+LGDFGLA+RC  +D +++STPPAGTMGYLDP Y+T D LS
Sbjct  181  IIHRDIKSANVLMDKNLNAKLGDFGLAIRCNVDDQKVKSTPPAGTMGYLDPDYVTADRLS  240

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV YSP  IVDWAIP+I+RGK+  I+DPRI PP D  V
Sbjct  241  TKTDVFSFGILLLEIISGRKAIDVRYSPSFIVDWAIPMIKRGKIGGIYDPRIGPPIDVSV  300

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFA--NPCLMVETT  522
            R  L +VAAKCVR+CRE+RP M+E+V  L  L+K V    W+  +  NPC+MVET 
Sbjct  301  RNHLGLVAAKCVRTCREKRPGMEEVVGWLTGLTKSVRSRRWDDLSIGNPCMMVETV  356



>ref|XP_010503912.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
isoform X1 [Camelina sativa]
 ref|XP_010503913.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
isoform X2 [Camelina sativa]
 ref|XP_010503914.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
isoform X3 [Camelina sativa]
Length=359

 Score =   249 bits (636),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKSANVL+D++LNA+LGDFGLA+RC  ND +++STPPAGTMGYLDP Y+T D LS
Sbjct  179  IIHRDIKSANVLMDKSLNAKLGDFGLAIRCNVNDQKVKSTPPAGTMGYLDPDYVTADRLS  238

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            +KTDVFSFGILLLEIISGRKAIDV YSP  IVDWAIP+I+RGK+  I+DPRI PP D  V
Sbjct  239  SKTDVFSFGILLLEIISGRKAIDVRYSPSFIVDWAIPMIKRGKIGGIYDPRIGPPMDVSV  298

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWN--GFANPCLMVETT  522
            R  L +VAAKCVR+CRE+RP M+E+V  L  L+K V    W+     NPC+MVET 
Sbjct  299  RNHLGLVAAKCVRTCREKRPEMEEVVGWLTGLTKSVRSRRWDELSIGNPCMMVETV  354



>ref|XP_010426793.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Camelina sativa]
Length=354

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKSANVL+D++LNA+LGDFGLA+RC  ND +++STPPAGTMGYLDP Y+T D LS
Sbjct  174  IIHRDIKSANVLMDKSLNAKLGDFGLAIRCNVNDQKVKSTPPAGTMGYLDPDYVTADRLS  233

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            +KTDVFSFGILLLEIISGRKAIDV YSP  IVDWAIP+I+RGK+  I+DPRI PP D  V
Sbjct  234  SKTDVFSFGILLLEIISGRKAIDVRYSPSFIVDWAIPMIKRGKIGGIYDPRIGPPMDVSV  293

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWN--GFANPCLMVETT  522
            R  L +VAAKCVR+CRE+RP M+E+V  L  L+K V    W+     NPC+MVET 
Sbjct  294  RNHLGLVAAKCVRTCREKRPEMEEVVGWLTGLTKSVRSRRWDELSIGNPCMMVETV  349



>emb|CDX78052.1| BnaA09g32470D [Brassica napus]
Length=358

 Score =   249 bits (635),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKSANVL+D+NLNA+LGDFGLA+RC   D R++STPPAGTMGYLDP Y+T D LS
Sbjct  178  IIHRDIKSANVLMDKNLNAKLGDFGLAIRCNVEDQRVKSTPPAGTMGYLDPDYVTADRLS  237

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV YSP  IVDWAIP+I+RGK+  I+DP I PP D  V
Sbjct  238  TKTDVFSFGILLLEIISGRKAIDVRYSPSFIVDWAIPMIKRGKIGGIYDPMIGPPVDVSV  297

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWN--GFANPCLMVETT  522
            R  L +VAAKCVR+CRE+RP M+E+V  L  L++ V    W+  G  NPC+MVET 
Sbjct  298  RNHLGLVAAKCVRTCREKRPGMEEVVGWLTGLTQSVRSRRWDELGIGNPCMMVETV  353



>ref|XP_010515644.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Camelina sativa]
Length=357

 Score =   248 bits (634),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKSANVL+D++LNA+LGDFGLA+RC  ND +++STPPAGTMGYLDP Y+T D LS
Sbjct  177  IIHRDIKSANVLMDKSLNAKLGDFGLAIRCNVNDQKVKSTPPAGTMGYLDPDYVTADRLS  236

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            +KTDVFSFGILLLEIISGRKAIDV YSP  IVDWAIP+I+RGK+  I+DPRI PP D  V
Sbjct  237  SKTDVFSFGILLLEIISGRKAIDVRYSPSFIVDWAIPMIKRGKIGGIYDPRIGPPMDVSV  296

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWN--GFANPCLMVETT  522
            R  L +VAAKCVR+CRE+RP M+E+V  L  L+K V    W+     NPC+MVET 
Sbjct  297  RNHLGLVAAKCVRTCREKRPEMEEVVGWLTGLTKSVRSRRWDELSIGNPCMMVETV  352



>emb|CDX73669.1| BnaC08g23340D [Brassica napus]
Length=358

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKSANVL+D+NLNA+LGDFGLA+RC   D +++STPPAGTMGYLDP Y+T D LS
Sbjct  178  IIHRDIKSANVLMDKNLNAKLGDFGLAIRCNVEDQKVKSTPPAGTMGYLDPDYVTADRLS  237

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV YSP  IVDWAIP+I+RGK+  I+DP I PP D  V
Sbjct  238  TKTDVFSFGILLLEIISGRKAIDVRYSPSFIVDWAIPMIKRGKIGGIYDPMIGPPVDVSV  297

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWN--GFANPCLMVETT  522
            R  L +VAAKCVR+CRE+RP M+E+V  L  L++ V    W+  G  NPC+MVET 
Sbjct  298  RNHLGLVAAKCVRTCREKRPGMEEVVGWLTGLTQSVRSRRWDELGIGNPCMMVETV  353



>ref|XP_009115903.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Brassica rapa]
Length=387

 Score =   249 bits (635),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKSANVL+D+NLNA+LGDFGLA+RC   D R++STPPAGTMGYLDP Y+T D LS
Sbjct  207  IIHRDIKSANVLMDKNLNAKLGDFGLAIRCNVEDQRVKSTPPAGTMGYLDPDYVTADRLS  266

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV YSP  IVDWAIP+I+RGK+  I+DP I PP D  V
Sbjct  267  TKTDVFSFGILLLEIISGRKAIDVRYSPSFIVDWAIPMIKRGKIGGIYDPMIGPPVDVSV  326

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWN--GFANPCLMVETT  522
            R  L +VAAKCVR+CRE+RP M+E+V  L  L++ V    W+  G  NPC+MVET 
Sbjct  327  RNHLGLVAAKCVRTCREKRPGMEEVVGWLTGLTQSVRSRRWDELGIGNPCMMVETV  382



>gb|KFK34450.1| hypothetical protein AALP_AA5G147000 [Arabis alpina]
Length=348

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 141/176 (80%), Gaps = 2/176 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            ++HRDIKSANVL+D+NLNA+LGDFGLA+RC  +D +++STPPAGTMGYLDP Y+T D LS
Sbjct  168  IMHRDIKSANVLMDKNLNAKLGDFGLAIRCNADDQKMKSTPPAGTMGYLDPDYVTADRLS  227

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV YSP  IVDWAIP+I+RGK+  I+DPRI  P D  V
Sbjct  228  TKTDVFSFGILLLEIISGRKAIDVRYSPSFIVDWAIPMIKRGKIAGIYDPRIGTPLDVSV  287

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWN--GFANPCLMVETT  522
            R  L +VAAKCVR+C E+RP M+E+V  L  L+K +    W+  G  NPC+MVET 
Sbjct  288  RNHLGLVAAKCVRTCTEKRPGMEEVVGWLTGLTKSLRSRRWDDLGIGNPCMMVETV  343



>ref|XP_006853039.1| hypothetical protein AMTR_s00038p00022150 [Amborella trichopoda]
 gb|ERN14506.1| hypothetical protein AMTR_s00038p00022150 [Amborella trichopoda]
Length=560

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 143/179 (80%), Gaps = 7/179 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRD+KS+NVLID N NARLGDFGLALR    D RL+STPPAGT+GYLDPGY+TP+NLS
Sbjct  165  VIHRDVKSSNVLIDSNWNARLGDFGLALRGHVEDIRLKSTPPAGTIGYLDPGYLTPENLS  224

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK DVFSFGILLLEIISGR AIDV +SPPSIVDWAIPLIR+GKL++++DPRI P  D   
Sbjct  225  TKNDVFSFGILLLEIISGRNAIDVNHSPPSIVDWAIPLIRKGKLISLYDPRIGPLPDLSA  284

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGF-------ANPCLMVE  516
            RKQ A++AA+CVRSCRERRPSM+E+VE L  +SK +P   W          ANPC  V+
Sbjct  285  RKQFALIAARCVRSCRERRPSMREVVEGLKLVSKSIPFPVWTNIRRIGLPNANPCSSVD  343



>ref|XP_006403855.1| hypothetical protein EUTSA_v10011161mg [Eutrema salsugineum]
 gb|ESQ45308.1| hypothetical protein EUTSA_v10011161mg [Eutrema salsugineum]
Length=361

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 140/176 (80%), Gaps = 2/176 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKSANVL+D+NLNA+LGDFGLA+RC  ND +++STPPAGTMGYLDP Y+T D LS
Sbjct  181  IIHRDIKSANVLMDKNLNAKLGDFGLAIRCNANDQKVKSTPPAGTMGYLDPDYVTADRLS  240

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV YSP  IVDWAIP+I+RGK+  I+DP I  P D  V
Sbjct  241  TKTDVFSFGILLLEIISGRKAIDVRYSPSFIVDWAIPMIKRGKIGGIYDPMIGAPVDVSV  300

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGF--ANPCLMVETT  522
            R  L +VAAKCVR+CRE+RP M+E+V  L  L+K V    W+     NPC+MVET 
Sbjct  301  RNHLGLVAAKCVRTCREKRPGMEEVVGWLTGLTKSVRSRRWDDLVIGNPCMMVETV  356



>gb|EYU42979.1| hypothetical protein MIMGU_mgv1a017739mg [Erythranthe guttata]
Length=340

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 133/151 (88%), Gaps = 2/151 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSANVLID N +A+LGDFGLALRC D D +LRSTPPAGTMGYLDP Y+TPDNLS
Sbjct  188  VIHRDIKSANVLIDSNFDAKLGDFGLALRCVD-DHKLRSTPPAGTMGYLDPCYLTPDNLS  246

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEIISGRKAIDV YSPPS++DWAIPLIRRGK ++I+DPR+ PPKD  V
Sbjct  247  TKTDVFSFGILLLEIISGRKAIDVFYSPPSMLDWAIPLIRRGKFLSIYDPRVVPPKDGSV  306

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGE  453
            RK LAVVAAKCVR+ RERRP +  ++  LGE
Sbjct  307  RKMLAVVAAKCVRTSRERRP-VGLVMGILGE  336



>gb|ABR18424.1| unknown [Picea sitchensis]
Length=511

 Score =   243 bits (621),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 135/164 (82%), Gaps = 0/164 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID N NARLGDFGLALR    D +L STPPAGT+GYLDPGYITP NLS
Sbjct  161  VIHRDIKSSNVLIDANWNARLGDFGLALRGHVEDIKLNSTPPAGTIGYLDPGYITPGNLS  220

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK DVFSFGILLLEIISGR AIDV YSPPSIVDWA+PLIR+ K++ ++DPR+ PPK+   
Sbjct  221  TKNDVFSFGILLLEIISGRNAIDVQYSPPSIVDWAMPLIRQNKILELYDPRLSPPKNLNT  280

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGF  492
             K +A++AA+CVRS  ERRPSM E+VE L ++S+ +PL  W+G 
Sbjct  281  IKHMALIAARCVRSTEERRPSMNEVVEGLKQVSRSIPLPIWDGL  324



>gb|EMT32007.1| Serine/threonine-protein kinase-like protein [Aegilops tauschii]
Length=457

 Score =   242 bits (617),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 165/243 (68%), Gaps = 35/243 (14%)
 Frame = +1

Query  22   SANVLIDRNLNARLGDFGLALRC--QDNDFRLRSTP-PAGTMGYLDPGYITPDNLSTKTD  192
            SANVL+D +L+A LGDFGLALR   +D      +TP PAGT+GYLDP Y+TP++LSTKTD
Sbjct  12   SANVLLDAHLDAHLGDFGLALRVPKRDGGPGNAATPAPAGTLGYLDPAYVTPESLSTKTD  71

Query  193  VFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLVRKQL  372
            VFSFGILLLEI+SGRKAIDV YSPPS+V+WA+PL+R+GK++A+FDPR+ PP+DP+ R+ L
Sbjct  72   VFSFGILLLEIMSGRKAIDVQYSPPSVVEWAVPLLRKGKVVALFDPRVAPPRDPVTRRDL  131

Query  373  AVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFA---NPCLM--VETTVGLRK  537
            A +AA CVRSCRERRPSM +IVE L  +SK V    WNG A   NPC +  V+ T+  R 
Sbjct  132  ASLAASCVRSCRERRPSMADIVERLAVISKAVSAKVWNGMAVVGNPCAIVDVQKTISKRA  191

Query  538  VGEEAQSFDA------------------------KFSKPLRNSRRVYSDL--GSRSNLME  639
               E +S  A                        K  +PL+N  +V+S+   G R NL+E
Sbjct  192  AASEKESTSALAFDDDEKEADATLEELVPLVGAKKPPRPLKNG-KVFSEAGDGERRNLLE  250

Query  640  LMA  648
            LMA
Sbjct  251  LMA  253



>ref|XP_009389632.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Musa acuminata subsp. malaccensis]
Length=532

 Score =   243 bits (621),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 149/193 (77%), Gaps = 9/193 (5%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRL-------RSTPPAGTMGYLDPGY  159
            VIHRD+KSANVLID++ NARL DFGLALR  D+D          RSTPPAGT+GYLDP Y
Sbjct  212  VIHRDVKSANVLIDQDSNARLADFGLALRDDDDDAAGGKFPSSARSTPPAGTLGYLDPSY  271

Query  160  ITPDNLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIH  339
            +TP++LSTKTDVFSFGILLLEI+SGRKAIDVA+SPPS+V+WA+PL+R+GK+  +FDPRI 
Sbjct  272  VTPESLSTKTDVFSFGILLLEIMSGRKAIDVAHSPPSVVEWAVPLLRKGKVSTLFDPRIP  331

Query  340  PPKDPLVRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFA--NPCLMV  513
            PPK+PL RKQLA VAA CVRS +E RPSM E+V  L  L K VP  +WNG +  NPC +V
Sbjct  332  PPKNPLARKQLASVAASCVRSLKEMRPSMDEVVGQLKVLRKTVPFRAWNGLSVGNPCSVV  391

Query  514  ETTVGLRKVGEEA  552
            +    L K+   +
Sbjct  392  DVERTLTKLNSSS  404



>ref|XP_010273041.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990, 
partial [Nelumbo nucifera]
Length=463

 Score =   236 bits (603),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 131/164 (80%), Gaps = 0/164 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVL+D N NARLGDFGLALR    D ++R TPPAGT+GYLDPGY+ P+NLS
Sbjct  181  VIHRDIKSSNVLVDGNWNARLGDFGLALRGHVEDVKIRCTPPAGTLGYLDPGYVLPENLS  240

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEIISGR AIDV YSPPS+V WA+PLI++ +   +FDPRI PP DP V
Sbjct  241  AKSDVFSFGILLLEIISGRNAIDVNYSPPSVVHWALPLIKQFEFALLFDPRIGPPGDPSV  300

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGF  492
             +QLAV+AA+CV S  E+RPSM E+VECL  +SK VP   WN  
Sbjct  301  MRQLAVLAARCVGSTAEKRPSMAEVVECLQTVSKKVPSAVWNNL  344



>gb|AFW81582.1| putative protein kinase superfamily protein [Zea mays]
Length=588

 Score =   239 bits (611),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 140/175 (80%), Gaps = 4/175 (2%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRD+KSANVL+D NL ARLGDFGLALR       + +  PAGT+GYLDP Y+TP++LS
Sbjct  182  VIHRDVKSANVLLDANLGARLGDFGLALRVP-KAAGVATPAPAGTLGYLDPAYVTPESLS  240

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEI+SGRKAIDV +SPP +V+WA+PL+R+GK+ ++FDPR+ PP+DPL 
Sbjct  241  TKTDVFSFGILLLEIMSGRKAIDVQHSPPFVVEWAVPLLRKGKVASLFDPRVAPPRDPLT  300

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFA---NPCLMVE  516
            RK LA +AA CVRSCRERRPSM +IV+ L  LSK V    WNG A   NPC +V+
Sbjct  301  RKDLAALAASCVRSCRERRPSMADIVQRLVVLSKAVSAKVWNGLAVVGNPCAVVD  355



>ref|XP_009403351.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Musa acuminata subsp. malaccensis]
Length=533

 Score =   238 bits (607),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 138/257 (54%), Positives = 175/257 (68%), Gaps = 39/257 (15%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRL---RSTPPAGTMGYLDPGYITPD  171
            VIHRD+KSAN+L+D + NARLGDFGLALR  D D +    RSTPPAGT+GYLDP Y+TP+
Sbjct  209  VIHRDVKSANILLDHSFNARLGDFGLALR-DDEDTKFPSARSTPPAGTLGYLDPSYVTPE  267

Query  172  NLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKD  351
            NLSTKTDVFSFGILLLEI+SGRKAIDVA+SPPS+V+WA+PL+R+GK+  +FDPRI PPKD
Sbjct  268  NLSTKTDVFSFGILLLEIMSGRKAIDVAHSPPSVVEWAVPLLRKGKVSTLFDPRIGPPKD  327

Query  352  PLVRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFA--NPCLMVETTV  525
            P+ R+QLA +AA CVRS +E RPSM+E+VE L  LSK V   +WNG +  NPC +V+   
Sbjct  328  PVARRQLAALAASCVRSYKEMRPSMEEVVEQLNVLSKTVLSRAWNGLSVGNPCSVVDVER  387

Query  526  GLRKVGE------EAQSFDAKFSK---PL-----------------------RNSRRV-Y  606
             L K+         + + D++F +   PL                       RN+RRV  
Sbjct  388  PLTKLNSTSIDRGRSPASDSRFHREDEPLDKDRDMAVNVKKPPLIIKETRSSRNARRVLL  447

Query  607  SDLGSRSNLMELMAGGD  657
             D    +NL++LMA  D
Sbjct  448  EDTRGSTNLLDLMAQPD  464



>gb|EEE63582.1| hypothetical protein OsJ_18399 [Oryza sativa Japonica Group]
Length=604

 Score =   235 bits (600),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 141/181 (78%), Gaps = 9/181 (5%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRC------QDNDFRLRSTPPAGTMGYLDPGYI  162
            VIHRD+KSANVL+D NL+ARLGDFGLALR               +  PAGT+GYLDP Y+
Sbjct  124  VIHRDVKSANVLLDANLDARLGDFGLALRVPKRLPGDAAANAAATPAPAGTLGYLDPAYV  183

Query  163  TPDNLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHP  342
            TP++LSTKTDVFSFGILLLEI+SGRKAIDV +SPPS+V+WA+PL+R+GK+ ++FDPR+ P
Sbjct  184  TPESLSTKTDVFSFGILLLEIMSGRKAIDVQHSPPSVVEWAVPLLRKGKVASLFDPRVAP  243

Query  343  PKDPLVRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFA---NPCLMV  513
            P+DP+ R+ LA +AA CVRSCRERRPSM +IV+ L  LSK V    WNG A   NPC +V
Sbjct  244  PRDPVTRRDLAALAASCVRSCRERRPSMADIVDRLVVLSKAVSGKMWNGLAVVGNPCAVV  303

Query  514  E  516
            +
Sbjct  304  D  304



>ref|XP_010266446.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Nelumbo nucifera]
Length=576

 Score =   233 bits (593),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVL+D + NARLGD+GLALR    D R+R TPPAGT+GYLDPGY+ P+NLS
Sbjct  183  VIHRDIKSSNVLVDGHWNARLGDYGLALRGHVEDVRIRCTPPAGTLGYLDPGYVAPENLS  242

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFSFGILLLEIISGR AIDV YSPPS+VDWA+PLI++ +   +FDPRI PP DP V
Sbjct  243  TKSDVFSFGILLLEIISGRNAIDVNYSPPSVVDWALPLIKQFEFTPLFDPRIGPPGDPSV  302

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWN  486
             +QLAV+AA+CV    E+RPSM E+V+ L  +SK VP   WN
Sbjct  303  MRQLAVLAARCVGKTAEKRPSMVEVVDSLRTISKKVPSAVWN  344



>ref|NP_001174402.1| Os05g0387600 [Oryza sativa Japonica Group]
 gb|AAV31339.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG97159.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH93130.1| Os05g0387600 [Oryza sativa Japonica Group]
Length=679

 Score =   233 bits (595),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 141/181 (78%), Gaps = 9/181 (5%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRC------QDNDFRLRSTPPAGTMGYLDPGYI  162
            VIHRD+KSANVL+D NL+ARLGDFGLALR               +  PAGT+GYLDP Y+
Sbjct  199  VIHRDVKSANVLLDANLDARLGDFGLALRVPKRLPGDAAANAAATPAPAGTLGYLDPAYV  258

Query  163  TPDNLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHP  342
            TP++LSTKTDVFSFGILLLEI+SGRKAIDV +SPPS+V+WA+PL+R+GK+ ++FDPR+ P
Sbjct  259  TPESLSTKTDVFSFGILLLEIMSGRKAIDVQHSPPSVVEWAVPLLRKGKVASLFDPRVAP  318

Query  343  PKDPLVRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFA---NPCLMV  513
            P+DP+ R+ LA +AA CVRSCRERRPSM +IV+ L  LSK V    WNG A   NPC +V
Sbjct  319  PRDPVTRRDLAALAASCVRSCRERRPSMADIVDRLVVLSKAVSGKMWNGLAVVGNPCAVV  378

Query  514  E  516
            +
Sbjct  379  D  379



>ref|XP_004962242.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990-like 
[Setaria italica]
Length=611

 Score =   232 bits (592),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 136/263 (52%), Positives = 169/263 (64%), Gaps = 48/263 (18%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRC----QDNDFRLRSTPPAGTMGYLDPGYITP  168
            VIHRD+KSANVL+D NL+ARLGDFGLALR       N     +  PAGT+GYLDP Y+TP
Sbjct  178  VIHRDVKSANVLLDANLDARLGDFGLALRVPRATGANAAAAATPAPAGTLGYLDPAYVTP  237

Query  169  DNLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK  348
            ++LSTKTDVFSFGILLLEI+SGRKAIDV +SPPS+V+WA+PL+R+G++ ++FDPR+ PP+
Sbjct  238  ESLSTKTDVFSFGILLLEIMSGRKAIDVQHSPPSVVEWAVPLLRKGRVSSLFDPRVAPPR  297

Query  349  DPLVRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFA-------NPCL  507
            DP+ RK LA +AA CVRSCRERRPSM +IVE L  LSK V    WNG A       NPC 
Sbjct  298  DPVARKDLAALAASCVRSCRERRPSMADIVERLVVLSKAVSAKVWNGLADGLAVVGNPCA  357

Query  508  MV--------------------ETTVGLRKVGEEAQSFDA--------------KFSKPL  585
            +V                    E+T  L    +E +  DA              K  +PL
Sbjct  358  VVDVQRTISKRAAASSRAESERESTSALAFDDDEKEEADADALEEDQVPLVGARKSPRPL  417

Query  586  RNSRRVYSDLGSRS--NLMELMA  648
            +N   V S+ G+R   NL+ELMA
Sbjct  418  KNG-IVLSEAGARERRNLLELMA  439



>gb|EAY97886.1| hypothetical protein OsI_19804 [Oryza sativa Indica Group]
Length=610

 Score =   232 bits (591),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/182 (63%), Positives = 141/182 (77%), Gaps = 9/182 (5%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRC------QDNDFRLRSTPPAGTMGYLDPGYI  162
            VIHRD+KSANVL+D NL+ARLGDFGLALR               +  PAGT+GYLDP Y+
Sbjct  199  VIHRDVKSANVLLDANLDARLGDFGLALRVPKRLPGDAAANAAATPAPAGTLGYLDPAYV  258

Query  163  TPDNLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHP  342
            TP++LSTKTDVFSFGILLLEI+SGRKAIDV +SPPS+V+WA+PL+R+GK+ ++FDPR+ P
Sbjct  259  TPESLSTKTDVFSFGILLLEIMSGRKAIDVQHSPPSVVEWAVPLLRKGKVASLFDPRVAP  318

Query  343  PKDPLVRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFA---NPCLMV  513
            P+DP+ R+ LA +AA CVRSCRERRPSM +IV+ L  LSK V    WNG A   NPC +V
Sbjct  319  PRDPVTRRDLAALAASCVRSCRERRPSMADIVDRLVVLSKAVSGKMWNGLAVVGNPCAVV  378

Query  514  ET  519
            + 
Sbjct  379  DV  380



>ref|XP_008649594.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Zea mays]
 gb|AFW77840.1| putative protein kinase superfamily protein [Zea mays]
Length=609

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 169/264 (64%), Gaps = 49/264 (19%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRC-------QDNDFRLRSTPPAGTMGYLDPGY  159
            VIHRD+KSANVL+D NL ARLGDFGLALR                + PPAGT+GYLDP Y
Sbjct  180  VIHRDVKSANVLLDANLGARLGDFGLALRVPKATAGANAAAAAAPTPPPAGTLGYLDPAY  239

Query  160  ITPDNLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIH  339
            +TP++LSTKTDVFSFGILLLEI+SGRKAIDV +SPPS+V+WA+PL+R+GK+ ++FDPR+ 
Sbjct  240  VTPESLSTKTDVFSFGILLLEIMSGRKAIDVQHSPPSVVEWAVPLLRKGKVASLFDPRVA  299

Query  340  PPKDPLVRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFA-------N  498
            PP+DP+ RK LA +AA CVRSCRERRPSM +IV+ L  LSK V    WNG A       N
Sbjct  300  PPRDPVTRKDLAALAASCVRSCRERRPSMADIVQRLVLLSKAVSAKVWNGLADGLAVVGN  359

Query  499  PCLMVETTVGLRKVG--------------------EEAQSFDAKF------------SKP  582
            PC +V+    + K G                    +E +  DA+              +P
Sbjct  360  PCAVVDVQKTISKRGAASRRAESERESTSALVFDDDEKEDVDAEALEEDQVPSNKSPPRP  419

Query  583  LRNSRRVYSDLGSRS--NLMELMA  648
            L+N   V+S+ G+R   NL++LMA
Sbjct  420  LKNG-IVFSEAGARERRNLLDLMA  442



>ref|XP_004299702.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390-like 
[Fragaria vesca subsp. vesca]
Length=477

 Score =   224 bits (570),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 139/200 (70%), Gaps = 11/200 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID +  ARLGD GLALR    D R+R TPPAGT+GYLDPGY+ P +L+
Sbjct  175  VIHRDIKSSNVLIDGDWKARLGDLGLALRGHVEDVRVRCTPPAGTLGYLDPGYLAPGDLT  234

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEI+SGR AIDV YSPPS++DWA+PLI+ G+  A+ D RI PP DP V
Sbjct  235  AKSDVFSFGILLLEIVSGRNAIDVNYSPPSVIDWALPLIKHGEYAALCDQRIGPPADPAV  294

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETTVGLRKV  540
             +QLAV+AA+CVRS  E+RPSM E+VECL  +SK V    W G              R  
Sbjct  295  IRQLAVLAARCVRSTAEKRPSMAEVVECLKGVSKRVHAPIWYGLTR-----------RVE  343

Query  541  GEEAQSFDAKFSKPLRNSRR  600
             EE ++   +  +  R SRR
Sbjct  344  REEKENDTEEVVRSTRGSRR  363



>ref|XP_008338914.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390 
[Malus domestica]
Length=512

 Score =   224 bits (572),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID++ NARLGD GLALR    D R++ TPPAGT+GYLDPGY+ P +LS
Sbjct  181  VIHRDIKSSNVLIDKDGNARLGDLGLALRGHVEDVRVKCTPPAGTLGYLDPGYLAPGDLS  240

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFSFGILLLEI+SGR AIDV YSPPS+VDWA+P+I+RG    I DPRI PP DP V
Sbjct  241  TKSDVFSFGILLLEILSGRNAIDVNYSPPSVVDWAMPIIKRGDFAGILDPRIGPPSDPAV  300

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++AV+AAKCVRS  ERRP+M E+VECL
Sbjct  301  IRRVAVLAAKCVRSSVERRPTMAEVVECL  329



>ref|XP_009373705.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390 
[Pyrus x bretschneideri]
Length=512

 Score =   224 bits (571),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID++ NARLGD GLALR    D R++ TPPAGT+GYLDPGY+ P +LS
Sbjct  181  VIHRDIKSSNVLIDKDWNARLGDLGLALRGHVEDVRVKCTPPAGTLGYLDPGYLAPGDLS  240

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFSFGILLLEI+SGR AIDV YSPPS+VDWA+P+I+RG    I DPRI PP DP V
Sbjct  241  TKSDVFSFGILLLEILSGRNAIDVNYSPPSVVDWAMPIIKRGDFAGILDPRIGPPLDPAV  300

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++AV+AAKCVRS  ERRP+M E+V+CL
Sbjct  301  IRRVAVLAAKCVRSSAERRPTMAEVVQCL  329



>ref|XP_002439729.1| hypothetical protein SORBIDRAFT_09g019110 [Sorghum bicolor]
 gb|EES18159.1| hypothetical protein SORBIDRAFT_09g019110 [Sorghum bicolor]
Length=609

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 129/264 (49%), Positives = 163/264 (62%), Gaps = 49/264 (19%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGT-----MGYLDPGYIT  165
            VIHRD+KSANVL+D NL+ARLGDFGLALR    +    +           +GYLDP Y+T
Sbjct  187  VIHRDVKSANVLLDANLDARLGDFGLALRVPKPNAAGAAAAATTPAPAGTLGYLDPAYVT  246

Query  166  PDNLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPP  345
            P++LSTKTDVFSFGILLLEIISGR+AIDV +SPPS+V+WA+PL+R+GK+ ++FDPR+  P
Sbjct  247  PESLSTKTDVFSFGILLLEIISGRRAIDVQHSPPSVVEWAVPLLRKGKVASLFDPRVAAP  306

Query  346  KDPLVRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFA-------NPC  504
            +DP  RK LA +AA CVRSCRERRPSM +IV+ L  LSK V    WNG A       NPC
Sbjct  307  RDPATRKDLAALAASCVRSCRERRPSMADIVQRLVVLSKAVSAKVWNGLADGLAVVGNPC  366

Query  505  LMV--------------------ETTVGLRKVGEEAQSFDA--------------KFSKP  582
             +V                    E+T  L    +E +  DA              K  +P
Sbjct  367  AVVDVHKTISKRAAASNRAESERESTSALAFDDDEKEEADAVALEEDQVPLVGAKKSPRP  426

Query  583  LRNSRRVYSDLGSRS--NLMELMA  648
            L+N   V S+ G+R   NL++LMA
Sbjct  427  LKNG-IVLSEAGARERRNLLDLMA  449



>ref|XP_007226245.1| hypothetical protein PRUPE_ppa017880mg [Prunus persica]
 gb|EMJ27444.1| hypothetical protein PRUPE_ppa017880mg [Prunus persica]
Length=457

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 124/154 (81%), Gaps = 0/154 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID++ NARLGD GLALR    D R++ TPPAGT+GYLDPGY+ P +LS
Sbjct  180  VIHRDIKSSNVLIDKDWNARLGDLGLALRGHVEDVRIKCTPPAGTLGYLDPGYLAPGDLS  239

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEI+SGR AIDV YSPPS+VDWA+P+I+RG    I D RI PP DP V
Sbjct  240  AKSDVFSFGILLLEILSGRNAIDVNYSPPSVVDWAVPIIKRGDFAGICDQRIGPPADPAV  299

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSK  462
             + +AV+AAKCVRS  E+RP+M E+VECL  + K
Sbjct  300  IRHVAVLAAKCVRSTAEKRPTMAEVVECLKVMIK  333



>emb|CBI19233.3| unnamed protein product [Vitis vinifera]
Length=478

 Score =   220 bits (560),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVL+D   NARLGDFGLALR    D R+R TPPAGT+GYLDPGY+ P +LS
Sbjct  164  VIHRDIKSSNVLLDGKWNARLGDFGLALRGHVEDVRVRCTPPAGTLGYLDPGYLAPGDLS  223

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFSFGILLLE+ISGR AIDV YSPPS+VDWA+PLI+     AI DPRI  P+DP V
Sbjct  224  TKSDVFSFGILLLEMISGRNAIDVNYSPPSVVDWAVPLIKHTNFSAICDPRIGEPEDPRV  283

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVV  468
             +QLAV+AA+CVRS  E+RP+  E+V+CL  + K+V
Sbjct  284  IRQLAVLAARCVRSTAEKRPAATEVVDCLRNVRKMV  319



>ref|XP_002285707.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390 
[Vitis vinifera]
Length=508

 Score =   220 bits (560),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVL+D   NARLGDFGLALR    D R+R TPPAGT+GYLDPGY+ P +LS
Sbjct  179  VIHRDIKSSNVLLDGKWNARLGDFGLALRGHVEDVRVRCTPPAGTLGYLDPGYLAPGDLS  238

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFSFGILLLE+ISGR AIDV YSPPS+VDWA+PLI+     AI DPRI  P+DP V
Sbjct  239  TKSDVFSFGILLLEMISGRNAIDVNYSPPSVVDWAVPLIKHTNFSAICDPRIGEPEDPRV  298

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVV  468
             +QLAV+AA+CVRS  E+RP+  E+V+CL  + K+V
Sbjct  299  IRQLAVLAARCVRSTAEKRPAATEVVDCLRNVRKMV  334



>ref|XP_007136352.1| hypothetical protein PHAVU_009G038000g [Phaseolus vulgaris]
 gb|ESW08346.1| hypothetical protein PHAVU_009G038000g [Phaseolus vulgaris]
Length=523

 Score =   219 bits (559),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRD+KS+NVLID   NARLGDFGLALR    D R++ TPPAGT+GYLDP Y+ P++LS
Sbjct  177  VIHRDVKSSNVLIDEKWNARLGDFGLALRGHVEDVRVKCTPPAGTLGYLDPCYLAPEDLS  236

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEIISGR AIDV YSPPS+VDWA+PLI+ G    I D RI PP DP V
Sbjct  237  AKSDVFSFGILLLEIISGRNAIDVNYSPPSVVDWAVPLIKLGDFARICDRRIGPPTDPAV  296

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVV  468
             +QLAV AA+CVRS  E+RPSM E+VECL  + K V
Sbjct  297  VRQLAVQAARCVRSTAEKRPSMAEVVECLNLVRKRV  332



>ref|XP_003523779.2| PREDICTED: serine/threonine-protein kinase-like protein At1g28390-like 
[Glycine max]
Length=496

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 132/178 (74%), Gaps = 5/178 (3%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRD+KS+NVLID+  NARLGDFGLALR    D R++ TPPAGT+GYLDP Y+ P++LS
Sbjct  191  VIHRDVKSSNVLIDQEWNARLGDFGLALRGHVEDVRVKCTPPAGTLGYLDPCYLAPEDLS  250

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEIISGR AIDV +SPPS+VDWA+PLI+ G    I D RI PP DP V
Sbjct  251  AKSDVFSFGILLLEIISGRNAIDVNFSPPSVVDWAVPLIKIGDFAGICDRRIGPPPDPAV  310

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVV---PLHSWNGFANPCLMVETTV  525
             +QLAV+AA+CVRS  E+RPSM E+VECL    K +   P+  WN        VE+ +
Sbjct  311  VRQLAVLAARCVRSTAEKRPSMAEVVECLNLARKRIRASPI--WNSLRRRVARVESAL  366



>gb|KDP41453.1| hypothetical protein JCGZ_15860 [Jatropha curcas]
Length=510

 Score =   218 bits (554),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID N  AR+GDFGLALR    D R++ TPPAGT+GYLDPGY+ P +LS
Sbjct  188  VIHRDIKSSNVLIDDNWKARIGDFGLALRGHVEDVRVKCTPPAGTLGYLDPGYLAPGDLS  247

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFSFGILLLEIISGR AIDV YSPPSIVDWA+PLI+RG  + I D RI  P DP V
Sbjct  248  TKSDVFSFGILLLEIISGRNAIDVNYSPPSIVDWAVPLIKRGDFLPICDHRIGTPVDPGV  307

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVV--PLHSWN  486
             K LA++AA+CVRS  E+RP M+E+VE L  ++K V  PL  WN
Sbjct  308  IKNLAILAARCVRSTAEKRPGMEELVEGLKVVNKRVHAPL-IWN  350



>ref|XP_010320196.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Solanum lycopersicum]
Length=496

 Score =   217 bits (553),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 143/212 (67%), Gaps = 14/212 (7%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID N +ARLGDFGL+LR    D  ++STPPAGT+GYLDP Y+ P +LS
Sbjct  172  VIHRDIKSSNILIDGNFSARLGDFGLSLRGNVEDVVVKSTPPAGTLGYLDPAYLAPSDLS  231

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFS+GILLLEIISGR AIDV YSPPS+VDWA+PLI+ G+   I+DPR+  P+D   
Sbjct  232  TKSDVFSYGILLLEIISGRNAIDVNYSPPSVVDWAVPLIKSGEYSEIYDPRLTSPEDDGA  291

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETTVGLRKV  540
             +QLA+VAA+CVR    +RP+M E+VE L ++ K +    WN               R+V
Sbjct  292  LRQLAIVAARCVRKTAAKRPAMAEVVEWLKQVYKRMSSPIWNNIG------------RRV  339

Query  541  GEEAQSFDAKFSKPLRNSRRVY--SDLGSRSN  630
            G   +S      +PL  S  +   S +GSR N
Sbjct  340  GRVRESTRVVKYEPLDESMEIVKISRMGSRRN  371



>ref|XP_006338093.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390-like 
[Solanum tuberosum]
Length=487

 Score =   216 bits (551),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 142/212 (67%), Gaps = 14/212 (7%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID N +ARLGDFGL+LR    D  ++STPPAGT+GYLDP Y+ P +LS
Sbjct  171  VIHRDIKSSNILIDGNFSARLGDFGLSLRGHVEDVVVKSTPPAGTLGYLDPAYLAPSDLS  230

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFSFGILLLEIISGR AIDV YSPPS+VDWA+PLI+ G+   I+DPR+  P+D   
Sbjct  231  TKSDVFSFGILLLEIISGRNAIDVNYSPPSVVDWAVPLIKSGEYTDIYDPRLTSPEDDGA  290

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETTVGLRKV  540
             +QLAVVAA+CVR    +RP+M E+VE L  + K +    WN               R+V
Sbjct  291  LRQLAVVAARCVRKTAAKRPAMAEVVEWLKLVYKRMSSPIWNNIG------------RRV  338

Query  541  GEEAQSFDAKFSKPLRNSRRVY--SDLGSRSN  630
            G   +S      +PL  S  +   S +GSR N
Sbjct  339  GRVRESTRVVKYEPLDESMEIVKISRMGSRRN  370



>ref|XP_009602564.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Nicotiana tomentosiformis]
Length=497

 Score =   216 bits (551),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 143/212 (67%), Gaps = 14/212 (7%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID N +ARLGDFGL+LR    D  ++STPPAGT+GYLDP Y+ P +LS
Sbjct  175  VIHRDIKSSNILIDGNFSARLGDFGLSLRGHVEDVIVKSTPPAGTLGYLDPAYLAPGDLS  234

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFSFGILLLEIISGR AIDV YSPPS+VDWA+PLI+ G+   I DPRI  P+D  V
Sbjct  235  TKSDVFSFGILLLEIISGRNAIDVNYSPPSVVDWAVPLIKSGEYAEICDPRIGSPEDEGV  294

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETTVGLRKV  540
             +QLAVVAA+CVR    +RP+M E+VE L  + K +    WN               R+V
Sbjct  295  LRQLAVVAARCVRKTAAKRPAMAEVVEWLKLVHKRMSSPIWNNIG------------RRV  342

Query  541  GEEAQSFDAKFSKPLRNSRRVY--SDLGSRSN  630
            G   +S      +PL +S  +   S +GSR N
Sbjct  343  GRVRESTRVVKYEPLDDSMEIVKISRVGSRRN  374



>ref|XP_003527876.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390-like 
[Glycine max]
Length=479

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 131/178 (74%), Gaps = 5/178 (3%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRD+KS+NVLID   NARLGDFGLALR    D R++ TPPAGT+GYLDP Y+ P++LS
Sbjct  178  VIHRDVKSSNVLIDEEWNARLGDFGLALRGHVEDVRVKCTPPAGTLGYLDPCYLAPEDLS  237

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEIISGR AIDV +SPPS+VDWA+PLI+ G    I D RI P  DP V
Sbjct  238  AKSDVFSFGILLLEIISGRNAIDVNFSPPSVVDWAVPLIKLGDFAGICDRRIGPQPDPAV  297

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLG---ELSKVVPLHSWNGFANPCLMVETTV  525
             +QLAV+AA+CVRS  E+RPSM E+VECL    + ++  P+  WN        VE+ +
Sbjct  298  LRQLAVLAARCVRSTAEKRPSMAEVVECLNLARKRNRASPI--WNNLRRRVASVESAL  353



>emb|CAN75154.1| hypothetical protein VITISV_035995 [Vitis vinifera]
Length=686

 Score =   219 bits (558),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVL+D   NARLGDFGLALR    D R+R TPPAGT+GYLDPGY+ P +LS
Sbjct  375  VIHRDIKSSNVLLDGKWNARLGDFGLALRGHVEDVRVRCTPPAGTLGYLDPGYLAPGDLS  434

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFSFGILLLE+ISGR AIDV YSPPS+VDWA+PLI+     AI DPRI  P+DP V
Sbjct  435  TKSDVFSFGILLLEMISGRNAIDVNYSPPSVVDWAVPLIKHTNFSAICDPRIGEPEDPRV  494

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVV  468
             +QLAV+AA+CVRS  E+RP+  E+V+CL  + K+V
Sbjct  495  IRQLAVLAARCVRSTAEKRPAATEVVDCLRNVRKMV  530



>ref|XP_009759754.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Nicotiana sylvestris]
Length=490

 Score =   215 bits (548),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 143/212 (67%), Gaps = 14/212 (7%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID N +ARLGDFGL+LR    D  ++STPPAGT+GYLDP Y+ P +LS
Sbjct  171  VIHRDIKSSNILIDGNFSARLGDFGLSLRGHVEDVIVKSTPPAGTLGYLDPAYLAPGDLS  230

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFSFGILLLEIISGR AIDV YSPPS+VDWA+PLI+ G+   I DPRI  P+D  V
Sbjct  231  TKSDVFSFGILLLEIISGRNAIDVNYSPPSVVDWAVPLIKSGEYAEICDPRIGWPEDDGV  290

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETTVGLRKV  540
             +QLAVVAA+CVR    +RP+M E+VE L  + K +    WN               R+V
Sbjct  291  LRQLAVVAARCVRKTAAKRPAMAEVVEWLKMVHKRMSSPIWNNIG------------RRV  338

Query  541  GEEAQSFDAKFSKPLRNSRRVY--SDLGSRSN  630
            G   +S      +PL +S  +   S +GSR N
Sbjct  339  GRVRESTRVVKYEPLDDSMEIVKISRVGSRRN  370



>ref|XP_003602947.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
 gb|AES73198.1| tyrosine kinase family protein [Medicago truncatula]
Length=528

 Score =   214 bits (544),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID++  ARLGDFGLALR    D R++ TPPAGT+GYLDP Y+ P++LS
Sbjct  191  VIHRDIKSSNVLIDQDFKARLGDFGLALRGHVEDVRVKCTPPAGTLGYLDPCYLAPEDLS  250

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEIISGR AIDV YSPPS+VDWA+PLIR+G  + I D RI  P D ++
Sbjct  251  AKSDVFSFGILLLEIISGRNAIDVNYSPPSVVDWAVPLIRKGDFVGICDRRIGAPSDLVM  310

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +Q+AV+AA+CVRS  E+RP M E+VECL
Sbjct  311  LRQIAVIAARCVRSTAEKRPGMVEVVECL  339



>ref|XP_010098661.1| Serine/threonine-protein kinase-like protein [Morus notabilis]
 gb|EXB75564.1| Serine/threonine-protein kinase-like protein [Morus notabilis]
Length=490

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID + NARLGDFGLALR    D R++ TPPAGT+GYLDPGY+ P +LS
Sbjct  178  VIHRDIKSSNVLIDEDGNARLGDFGLALRGHVEDVRVKCTPPAGTLGYLDPGYLAPGDLS  237

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEIISGR AIDV YSPPSIVDWA P+I+RG    I D RI PP D  V
Sbjct  238  AKSDVFSFGILLLEIISGRNAIDVNYSPPSIVDWAGPIIKRGDYADICDSRIGPPPDRAV  297

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSK  462
             + LAV+AA+CVRS  E+RP+M E+VE L  +SK
Sbjct  298  ARHLAVLAARCVRSTLEKRPTMGEVVESLKLISK  331



>ref|XP_007018167.1| Serine/threonine-protein kinase-like protein, putative [Theobroma 
cacao]
 gb|EOY15392.1| Serine/threonine-protein kinase-like protein, putative [Theobroma 
cacao]
Length=503

 Score =   213 bits (541),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID + NARLGDFGLALR    D R++ TPPAGT+GYLDPGY+ P ++S
Sbjct  175  VIHRDIKSSNVLIDESWNARLGDFGLALRGHVEDVRVKCTPPAGTLGYLDPGYLAPSDVS  234

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFS+GILLLEIISGR AID+ YSPPS+VDWA+PLI+ G   AI D R+ PP D  V
Sbjct  235  TKSDVFSYGILLLEIISGRHAIDLNYSPPSVVDWAVPLIKGGDFSAICDCRVGPPVDKEV  294

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVV  468
             + LAV+AA+CVRS  E+RP M ++VECL  + K V
Sbjct  295  VQNLAVLAARCVRSTAEKRPGMADVVECLKVVRKRV  330



>ref|XP_002993413.1| hypothetical protein SELMODRAFT_44342, partial [Selaginella moellendorffii]
 gb|EFJ05506.1| hypothetical protein SELMODRAFT_44342, partial [Selaginella moellendorffii]
Length=325

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 124/164 (76%), Gaps = 0/164 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID + NARL DFGLALR +  D    STPPAGTMGYLDPGY++P +LS
Sbjct  162  VIHRDIKSSNVLIDADWNARLADFGLALRGRIEDVIRLSTPPAGTMGYLDPGYVSPGHLS  221

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLEI+SGR AIDV Y PP+IVDWA+PLI++GK  AI DP+   P +   
Sbjct  222  TKTDVFSFGILLLEIMSGRNAIDVQYYPPNIVDWALPLIKQGKGAAICDPKSKHPTNAEA  281

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGF  492
              ++A VAA+CVR    RRP+M E+V+ L E+SK + +  WN  
Sbjct  282  LNEMAGVAARCVRLSSSRRPTMAEVVKELREISKRIQMPIWNSI  325



>ref|XP_010060082.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390 
[Eucalyptus grandis]
 gb|KCW66610.1| hypothetical protein EUGRSUZ_F00404 [Eucalyptus grandis]
Length=538

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID   NARLGDFGLALR    D R R TPPAGT+GYLDPGY+ P +LS
Sbjct  205  VIHRDIKSSNVLIDGGSNARLGDFGLALRGHVEDVRARCTPPAGTLGYLDPGYLLPSDLS  264

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEI+SGR AIDV +SPPSIVDWA+PLIRR    AI+D RI PP DP  
Sbjct  265  AKSDVFSFGILLLEIVSGRNAIDVNFSPPSIVDWAVPLIRRRAFDAIWDDRIDPPADPAA  324

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSK  462
             + +A +AA+CV+    RRP M E+VE L E S+
Sbjct  325  VRSVAALAARCVKGSARRRPEMAEVVEVLREASR  358



>ref|XP_008444887.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Cucumis melo]
Length=488

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/154 (66%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID N NARLGDFGLALR    D R+R TPPAGT+GYLDPGY+ P +LS
Sbjct  186  VIHRDIKSSNVLIDGNFNARLGDFGLALRGHVEDVRVRCTPPAGTLGYLDPGYLAPADLS  245

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEI+SGR AIDV +SPPS+VDWA+P+I       + DPRI  P DP V
Sbjct  246  VKSDVFSFGILLLEILSGRNAIDVHHSPPSVVDWALPMINHSNFDGLCDPRIGSPTDPAV  305

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSK  462
             + L V+AAKCVRS  ++RP M E+VECL    K
Sbjct  306  TRCLGVLAAKCVRSPVQKRPDMAEVVECLKAAKK  339



>ref|XP_004152746.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390-like 
[Cucumis sativus]
 ref|XP_004170458.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390-like 
[Cucumis sativus]
 gb|KGN62732.1| hypothetical protein Csa_2G369830 [Cucumis sativus]
Length=493

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 123/167 (74%), Gaps = 5/167 (3%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID N NARLGDFGLALR    D R+R TPPAGT+GYLDPGY+ P +LS
Sbjct  183  VIHRDIKSSNVLIDGNFNARLGDFGLALRGHVEDVRVRCTPPAGTLGYLDPGYLAPADLS  242

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEI+SGR AIDV +SPPS+VDWA+P+I+      + DPRI  P DP V
Sbjct  243  VKSDVFSFGILLLEILSGRNAIDVHHSPPSVVDWALPMIKHSNFDGLCDPRIGSPTDPAV  302

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSK---VVPLHSWNGF  492
             + LAV+AA CVR   ++RP M E+VECL    K   V P+  WN  
Sbjct  303  IRCLAVLAANCVRVAVQKRPDMAEVVECLKAAKKKLHVPPI--WNNL  347



>ref|XP_002514010.1| protein with unknown function [Ricinus communis]
 gb|EEF48593.1| protein with unknown function [Ricinus communis]
Length=498

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 126/164 (77%), Gaps = 3/164 (2%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRD+KS+NVLID    ARLGDFGLALR    D R++ TPPAGT+GYLDPGY+ P +LS
Sbjct  171  VIHRDVKSSNVLIDDKWRARLGDFGLALRGHVEDVRVKCTPPAGTLGYLDPGYLAPADLS  230

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFSFGILLLEIISGR AIDV YSPPSIV+WA+PLI+RG    I D RI  P DP +
Sbjct  231  TKSDVFSFGILLLEIISGRNAIDVNYSPPSIVEWALPLIKRGDYSIICDHRIGSPVDPGI  290

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVV--PLHSWN  486
             K LAV+AA+CVRS  E+RP M E+VE L  +SK V  PL  WN
Sbjct  291  IKILAVLAARCVRSTAEKRPGMAEVVEGLKFVSKRVHAPL-LWN  333



>ref|XP_004501618.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390-like 
[Cicer arietinum]
Length=537

 Score =   209 bits (531),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 100/149 (67%), Positives = 118/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLIDR+  AR+GDFGLALR    D R++ TPPAGT+GYLDP Y+ P +LS
Sbjct  192  VIHRDIKSSNVLIDRDWKARVGDFGLALRGHVEDVRVKCTPPAGTLGYLDPCYLAPGDLS  251

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEIISGR AIDV YSPPS+VDWA+PLIRRG    + D RI  P D  V
Sbjct  252  AKSDVFSFGILLLEIISGRNAIDVNYSPPSVVDWAVPLIRRGDFAGLCDRRIGTPLDQTV  311

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             + LAV+AA+CVRS  E+RP M E+VEC+
Sbjct  312  LRLLAVLAARCVRSTAEKRPGMVEVVECI  340



>ref|XP_006433873.1| hypothetical protein CICLE_v10000878mg [Citrus clementina]
 gb|ESR47113.1| hypothetical protein CICLE_v10000878mg [Citrus clementina]
Length=518

 Score =   208 bits (530),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 132/190 (69%), Gaps = 1/190 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRD+KS+N+LID N NARL DFGLALR    D +++ TPPAGT+GYLDP Y+ P +LS
Sbjct  181  VIHRDVKSSNILIDENHNARLSDFGLALRGHVEDVKIKCTPPAGTLGYLDPRYLAPADLS  240

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFSFGILLLEIISGR AID+ YSPPS+VDWA+P+I+ G    I D RI PP DP V
Sbjct  241  TKSDVFSFGILLLEIISGRNAIDLNYSPPSVVDWAVPMIKHGDFGGICDRRIGPPPDPSV  300

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSK-VVPLHSWNGFANPCLMVETTVGLRK  537
             +QLAV+AA+CVRS  E+RP + E+VE L  + K V     W+         E +   + 
Sbjct  301  IRQLAVLAARCVRSSVEKRPEISEVVEYLKVVRKRVQSPRIWSNIQRRVRCAEKSSAQQV  360

Query  538  VGEEAQSFDA  567
            V  + Q  DA
Sbjct  361  VEMKRQVLDA  370



>ref|XP_006472515.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390-like 
[Citrus sinensis]
Length=518

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 132/190 (69%), Gaps = 1/190 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRD+KS+N+LID N NARL DFGLALR    D +++ TPPAGT+GYLDP Y+ P +LS
Sbjct  181  VIHRDVKSSNILIDENHNARLSDFGLALRGHVEDVKIKCTPPAGTLGYLDPRYLAPADLS  240

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFSFGILLLEIISGR AID+ YSPPS+VDWA+P+I+ G    I D RI PP DP V
Sbjct  241  TKSDVFSFGILLLEIISGRNAIDLNYSPPSVVDWAVPMIKHGDFGGICDRRIGPPPDPSV  300

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSK-VVPLHSWNGFANPCLMVETTVGLRK  537
             +QLAV+AA+CVRS  E+RP + E+VE L  + K V     W+         E +   + 
Sbjct  301  IRQLAVLAARCVRSSVEKRPEISEVVEYLKVVRKRVQSPRIWSNIQRRVRCAEKSSAQQV  360

Query  538  VGEEAQSFDA  567
            V  + Q  DA
Sbjct  361  VEMKRQVLDA  370



>ref|XP_011082721.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Sesamum indicum]
Length=488

 Score =   206 bits (524),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKS+N+LID   N+R+ DFGLALR    D +++STPPAGT+GYLDPGY+ P +LS
Sbjct  175  IIHRDIKSSNILIDSKFNSRISDFGLALRGHVEDVKVKSTPPAGTLGYLDPGYLAPGDLS  234

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFSFGIL+LEIISGR AIDV YSPPS+V+WA+P+I+ G +  I DPRI PP+D   
Sbjct  235  TKSDVFSFGILMLEIISGRNAIDVNYSPPSVVEWAVPVIKSGNIAGICDPRIGPPEDSEA  294

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHS  480
             + +AV+AA+CVRS   +RP M E++E L  + K +   S
Sbjct  295  LRLMAVLAARCVRSTSAKRPGMAEVLESLKGVYKRMKTQS  334



>gb|EPS60532.1| hypothetical protein M569_14270, partial [Genlisea aurea]
Length=324

 Score =   201 bits (512),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 118/151 (78%), Gaps = 2/151 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID   ++R+GDFGLALR    DFRL+STPPAGTMGY+DPGY++P+++S
Sbjct  173  VIHRDIKSSNVLIDSKFDSRIGDFGLALRGNSEDFRLKSTPPAGTMGYIDPGYLSPEDIS  232

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPP--KDP  354
            TK+DVFSFGILLLEIISGR AID+ YSP S+V+WA+P I+ G    I+D RI PP  K+ 
Sbjct  233  TKSDVFSFGILLLEIISGRNAIDLNYSPASVVEWAVPQIKSGNAAGIYDRRIAPPVKKEE  292

Query  355  LVRKQLAVVAAKCVRSCRERRPSMKEIVECL  447
                 +A +AA+CVRS  E+RP M+E   CL
Sbjct  293  DALGSMAALAARCVRSPAEKRPGMEEAARCL  323



>ref|XP_011010390.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390 
[Populus euphratica]
Length=506

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 120/154 (78%), Gaps = 0/154 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID    ARLGDFGLALR    D  ++ TPPAGT+GYLDP Y+ P +LS
Sbjct  185  VIHRDIKSSNVLIDEYGKARLGDFGLALRGHVEDVHVKCTPPAGTLGYLDPAYLAPGDLS  244

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEIISGR AIDV YSPPS+VDWA+PLI++G L AI D R+    DP+V
Sbjct  245  AKSDVFSFGILLLEIISGRNAIDVNYSPPSVVDWAVPLIKKGDLGAICDSRVASMPDPVV  304

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSK  462
             + L+V+AA+CVRS  E+RP M E+VE L  +S+
Sbjct  305  IRNLSVLAARCVRSTAEKRPGMAEVVEGLKLVSR  338



>ref|XP_002306551.2| hypothetical protein POPTR_0005s17640g [Populus trichocarpa]
 gb|EEE93547.2| hypothetical protein POPTR_0005s17640g [Populus trichocarpa]
Length=507

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID    ARLGDFGLALR    D  ++ TPPAGT+GYLDP Y+ P +LS
Sbjct  185  VIHRDIKSSNVLIDEYWKARLGDFGLALRGHVEDVHVKCTPPAGTLGYLDPAYLAPGDLS  244

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEIISGR AIDV YSPPS+VDWA+PLI++G L AI D R+    DP+V
Sbjct  245  AKSDVFSFGILLLEIISGRNAIDVNYSPPSVVDWAVPLIKKGDLGAICDNRVASMPDPVV  304

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             + L+V+AA+CVRS  E+RP M E+VE L
Sbjct  305  IRNLSVLAARCVRSTAEKRPGMAEVVEGL  333



>ref|XP_010675502.1| PREDICTED: serine/threonine-protein kinase-like protein At3g51990 
[Beta vulgaris subsp. vulgaris]
Length=490

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/239 (49%), Positives = 154/239 (64%), Gaps = 9/239 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            V+HRDIKS+NVL+D   NARL DFGLA++    D R+ STPPAGT+GYLDP Y+ P +LS
Sbjct  167  VMHRDIKSSNVLLDERENARLSDFGLAIKAHVKDVRVMSTPPAGTLGYLDPCYLAPGDLS  226

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DVFSFGILLLE++SGRKAIDV YSPP++VDWA+PLI+ G   AI D RI    D  V
Sbjct  227  TKSDVFSFGILLLELVSGRKAIDVDYSPPALVDWALPLIKSGVYEAIIDRRIKCFVDRTV  286

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETTVGLRKV  540
             K+LA++AA+CVRS  E+RP + EI ECL ++ + V +  +  + N    V   VG  + 
Sbjct  287  VKELALLAARCVRSTAEKRPPVNEIAECLKKVYRKVKMQGFPVWGNLRRRVR-HVGRSQP  345

Query  541  GEEAQSFD---AKFSKPLRNSRRVYSDLGSR-SNL----MELMAGGDDFVPKSSSQKGS  693
             +E    D   ++ S P   SR+  SD   + SN+     E+  GGD  V   S   GS
Sbjct  346  LDEFDGSDWEESRVSAPKYGSRKSLSDRNRKVSNVDGDEGEMTRGGDRTVRLRSKSIGS  404



>ref|XP_008219383.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390 
[Prunus mume]
Length=502

 Score =   202 bits (513),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 114/144 (79%), Gaps = 0/144 (0%)
 Frame = +1

Query  16   IKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLSTKTDV  195
            ++ +NVLID++ NARLGD GLALR    D R++ TPPAGT+GYLDPGY+ P +LS K+DV
Sbjct  177  LRRSNVLIDKDWNARLGDLGLALRGHVEDVRIKCTPPAGTLGYLDPGYLAPGDLSAKSDV  236

Query  196  FSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLVRKQLA  375
            FSFGILLLEI+SGR AIDV YSPPS+VDWA+P+I+ G    I D RI PP DP V   +A
Sbjct  237  FSFGILLLEILSGRNAIDVNYSPPSVVDWAVPIIKSGDFAGICDQRIGPPADPAVISHVA  296

Query  376  VVAAKCVRSCRERRPSMKEIVECL  447
            V+AAKCVRS  E+RP+M E+VECL
Sbjct  297  VLAAKCVRSKAEKRPTMTEVVECL  320



>ref|XP_006415662.1| hypothetical protein EUTSA_v10007568mg [Eutrema salsugineum]
 gb|ESQ34015.1| hypothetical protein EUTSA_v10007568mg [Eutrema salsugineum]
Length=464

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 129/166 (78%), Gaps = 7/166 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NARL DFGLAL     D RL+STPPAGT+GYLDP Y+ P +L+
Sbjct  181  VIHRDIKSSNILIDGEGNARLADFGLALIGNVEDERLKSTPPAGTLGYLDPSYLAPADLT  240

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRI-HPPKDPL  357
             K+DVFSFGILLLEIISGR AID+++SPP IVDWA+PLI+RG+  AI D RI + PK  +
Sbjct  241  AKSDVFSFGILLLEIISGRDAIDLSFSPPCIVDWAVPLIKRGESAAICDFRIRNRPKSAV  300

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLG---ELSKVVPLHSWN  486
            +R+ LAV+AA+CVRS  E+RP M E+VECL    ++S+  P+  WN
Sbjct  301  IRR-LAVMAARCVRSTAEKRPDMSEVVECLSSVRKMSQACPV--WN  343



>ref|XP_001763893.1| predicted protein [Physcomitrella patens]
 gb|EDQ71297.1| predicted protein [Physcomitrella patens]
Length=327

 Score =   196 bits (497),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKS+NVLID +  ARLGDFGLALR    D    STPPAGTMGYLDP Y TP +LS
Sbjct  174  IIHRDIKSSNVLIDESWKARLGDFGLALRGNIEDMLKTSTPPAGTMGYLDPEYETPSDLS  233

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLE+ISGR AID+AY PP I +WA+PLI++GK+  + D +++ P +   
Sbjct  234  TKTDVFSFGILLLEMISGRNAIDLAYEPPCIHEWALPLIKQGKIDELLDKKLNAPGNMKP  293

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSK  462
             KQL  VA KCVRS R RRPSM ++VE L  + K
Sbjct  294  LKQLINVAVKCVRSSRTRRPSMSDVVEDLKGIQK  327



>ref|XP_003518250.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390-like 
[Glycine max]
Length=428

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 120/154 (78%), Gaps = 3/154 (2%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID   NARLGDFGLA+R    D R+   PPAGT+GYLDP Y+ P +LS
Sbjct  173  VIHRDIKSSNVLIDEKWNARLGDFGLAVRGHVADSRV---PPAGTLGYLDPCYLAPGDLS  229

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            +K+DVFSFG+LLLEI SGR A+DV +SPPS++DWA+PL+RRG+   I DPRI  P D   
Sbjct  230  SKSDVFSFGVLLLEIASGRHALDVRHSPPSVLDWAVPLVRRGEFKEICDPRIGAPPDMAA  289

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSK  462
             +++AV+AA+CVRS  ERRPSM E++ECL  + K
Sbjct  290  FRRMAVLAARCVRSTPERRPSMVEVLECLTAVRK  323



>ref|XP_010499365.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390 
[Camelina sativa]
Length=480

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 130/166 (78%), Gaps = 7/166 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NARL DFGLAL    +D RL+ TPPAGT+GYLDP Y+ P +L+
Sbjct  183  VIHRDIKSSNILIDGDGNARLADFGLALIGNVDDERLKCTPPAGTLGYLDPSYLVPADLT  242

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRI-HPPKDPL  357
             KTDVFSFGILLLE+ISGR+AID++YSP  IVDWA+PLI+RG+  A+ DP+I + P   +
Sbjct  243  AKTDVFSFGILLLEMISGREAIDLSYSPSCIVDWAVPLIKRGEFAAVCDPKIKNRPYSAV  302

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLG---ELSKVVPLHSWN  486
            +RK LAV+AA+CVRS  ++RP M E+VECL    +LS+  P  SWN
Sbjct  303  IRK-LAVLAARCVRSTAKKRPDMLEVVECLKTVRKLSQASP--SWN  345



>ref|XP_010478211.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390 
[Camelina sativa]
Length=471

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 126/165 (76%), Gaps = 5/165 (3%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NARL DFGLAL    +D RL+ TPPAGT+GYLDP Y+ P +L+
Sbjct  177  VIHRDIKSSNILIDGEGNARLADFGLALIGNVDDERLKCTPPAGTLGYLDPSYLAPADLT  236

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             KTDVFSFGILLLE+ISGR+AIDV+YSP  IVDWA+PLI+RG+  A+ DP+I       V
Sbjct  237  AKTDVFSFGILLLEMISGREAIDVSYSPSCIVDWAVPLIKRGEFGAVCDPKIKNRPYAAV  296

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLG---ELSKVVPLHSWN  486
             ++LAV+AA+CVRS  ++RP M E+VECL    +LS+  P  +WN
Sbjct  297  IRKLAVMAARCVRSTAKKRPDMLEVVECLKTVRKLSQASP--AWN  339



>ref|XP_006303715.1| hypothetical protein CARUB_v10011837mg [Capsella rubella]
 gb|EOA36613.1| hypothetical protein CARUB_v10011837mg [Capsella rubella]
Length=481

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 129/166 (78%), Gaps = 7/166 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID + NARL DFGLAL    +D RL+ TPPAGT+GYLDP Y+ P +L+
Sbjct  179  VIHRDIKSSNVLIDGDGNARLADFGLALIGNVDDERLKCTPPAGTLGYLDPSYLAPADLT  238

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRI-HPPKDPL  357
             KTDVFSFGILLLE+ISGR+AID+ YSP  IVDWA+PLI+RG+  A+ DP+I + P   +
Sbjct  239  AKTDVFSFGILLLEMISGREAIDLNYSPSCIVDWAVPLIKRGEFAAVCDPKIKNRPYSAV  298

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLG---ELSKVVPLHSWN  486
            +RK LA++AA+CVRS  ++RP M E+VECL    +LSK  P  +WN
Sbjct  299  IRK-LAIMAARCVRSTAKKRPDMLEVVECLKTVRKLSKASP--AWN  341



>emb|CDY35739.1| BnaC03g58600D [Brassica napus]
Length=464

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NARL DFGLAL    +D RL++TPPAGTMGYLDP Y+ P +L+
Sbjct  169  VIHRDIKSSNILIDGEGNARLADFGLALIGNVDDERLKATPPAGTMGYLDPSYLAPADLT  228

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILL EI+SGR AID+ YSPP +VDWA+PL++RG+  AI D RI       V
Sbjct  229  AKSDVFSFGILLFEIVSGRDAIDLNYSPPCVVDWAVPLVKRGEYGAICDSRIRNRPSCAV  288

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKV  465
             ++L V+AA+CVRS  E+RP M E+VECL  + K+
Sbjct  289  IRRLVVMAARCVRSTAEKRPDMSEVVECLKTVRKM  323



>gb|KFK44712.1| hypothetical protein AALP_AA1G293100 [Arabis alpina]
Length=429

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 123/163 (75%), Gaps = 3/163 (2%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQ-DNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            +IHRDIKS+NVLID + NARL DFGLAL    + D  LRSTPPAGT+GYLDP Y+ P++L
Sbjct  158  IIHRDIKSSNVLIDGDGNARLADFGLALIGNVEKDEHLRSTPPAGTLGYLDPSYLAPEDL  217

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            + KTDVFSFGILLLE+ISGR+AID+ +SP  IVDWA+PLI+RG   AI D +I      +
Sbjct  218  TAKTDVFSFGILLLEMISGREAIDLNFSPSCIVDWAVPLIKRGDYTAICDSKIENRPRSV  277

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWN  486
            V + LAV+AA+CVRS  ++RP M E+VECL  + K+ P   WN
Sbjct  278  VIRILAVMAARCVRSTAKKRPDMVEVVECLKTVRKLYPF--WN  318



>ref|XP_010460629.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390 
[Camelina sativa]
Length=472

 Score =   194 bits (494),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 125/165 (76%), Gaps = 5/165 (3%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NARL DFGLAL     D RL+ TPPAGT+GYLDP Y+ P +L+
Sbjct  175  VIHRDIKSSNILIDGDGNARLADFGLALIGNVGDERLKCTPPAGTLGYLDPSYLAPADLT  234

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             KTDVFSFGILLLE+ISGR+AID++YSP  IVDWA+ LI+RG+  A+ DP+I       V
Sbjct  235  AKTDVFSFGILLLEMISGREAIDLSYSPSCIVDWAVSLIKRGEFAAVCDPKIKNRPYSAV  294

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLG---ELSKVVPLHSWN  486
             ++LAV+AA+CVRS  ++RP M E+VECL    +LS+  P  +WN
Sbjct  295  IRELAVMAARCVRSTAKKRPDMLEVVECLKTVRKLSQASP--AWN  337



>emb|CDX90148.1| BnaA08g18360D [Brassica napus]
Length=461

 Score =   193 bits (491),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NAR+ DFGLAL    ND RL++TPPAGTMGYLDP Y+ P +L+
Sbjct  169  VIHRDIKSSNILIDGDGNARIADFGLALIGNVNDERLKATPPAGTMGYLDPSYLAPADLT  228

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILL EI+SGR AID+ YSPP IVDWA+PL++RG+  AI D ++       V
Sbjct  229  AKSDVFSFGILLFEIVSGRDAIDLNYSPPCIVDWAVPLVKRGEYGAICDLKMRNRPSSAV  288

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKV  465
             + L V+AA+CVRS  E+RP M E+VECL  + K+
Sbjct  289  IRGLVVMAARCVRSTAEKRPDMLEVVECLKTVRKM  323



>ref|XP_009109730.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390 
[Brassica rapa]
Length=461

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 118/155 (76%), Gaps = 0/155 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NARL DFGLAL    +D RL++TPPAGTMGYLDP Y+ P +L+
Sbjct  169  VIHRDIKSSNILIDGDGNARLADFGLALIGNVDDERLKATPPAGTMGYLDPSYLAPADLT  228

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILL EI+SGR AID+ YSPP IVDWA+PL++RG+  AI D ++       V
Sbjct  229  AKSDVFSFGILLFEIVSGRDAIDLKYSPPCIVDWAVPLVKRGEYGAICDLKMRNRPSSAV  288

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKV  465
             + L V+AA+CVRS  E+RP M E+VECL  + K+
Sbjct  289  IRGLVVMAARCVRSTAEKRPDMLEVVECLKTVRKM  323



>ref|XP_001762196.1| predicted protein [Physcomitrella patens]
 gb|EDQ72988.1| predicted protein [Physcomitrella patens]
Length=327

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 114/154 (74%), Gaps = 0/154 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKS+NVLID    ARLGDFGLALR    D    STPPAGTMGYLDP Y TP +LS
Sbjct  174  IIHRDIKSSNVLIDETWKARLGDFGLALRGNIEDMLKSSTPPAGTMGYLDPEYETPSDLS  233

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFSFGILLLE+ISGR AID+AY PP I +WAIPLI++G++  + D ++  P +   
Sbjct  234  TKTDVFSFGILLLEMISGRNAIDLAYEPPCIHEWAIPLIKQGRMDELLDRKLDLPGNIKP  293

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSK  462
             KQL  +A KCVRS R RRPSM  +V+ L E+ K
Sbjct  294  LKQLINLALKCVRSSRLRRPSMLCVVDDLKEIQK  327



>ref|NP_174161.1| serine/threonine-protein kinase-like protein [Arabidopsis thaliana]
 sp|Q9SGN7.1|CCR12_ARATH RecName: Full=Serine/threonine-protein kinase-like protein At1g28390; 
AltName: Full=CRINKLY 4-related kinase [Arabidopsis 
thaliana]
 gb|AAF16755.1|AC010155_8 F3M18.17 [Arabidopsis thaliana]
 gb|AAL91624.1| At1g28390/F3M18_17 [Arabidopsis thaliana]
 gb|AEE30966.1| serine/threonine-protein kinase-like protein [Arabidopsis thaliana]
Length=470

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 122/162 (75%), Gaps = 2/162 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS NVLID + NARL DFGLAL    +D RL+ TPPAGT+GYLDP Y+ P +L+
Sbjct  182  VIHRDIKSCNVLIDGDGNARLADFGLALIGNVDDERLKYTPPAGTLGYLDPSYLAPADLT  241

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEIISGR+AID+ YSP  IVDWA+PLI+RG   AI D +I       V
Sbjct  242  AKSDVFSFGILLLEIISGREAIDLNYSPSCIVDWAVPLIKRGDYDAICDLKIKNRPYYAV  301

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWN  486
             ++LAV+AA+CVRS  ++RP M E+VECL  + ++ P  +WN
Sbjct  302  IRKLAVMAARCVRSTAKKRPDMLEVVECLKTVRQLSP--AWN  341



>ref|NP_001185106.1| serine/threonine-protein kinase-like protein [Arabidopsis thaliana]
 gb|AEE30967.1| serine/threonine-protein kinase-like protein [Arabidopsis thaliana]
Length=474

 Score =   191 bits (486),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 122/162 (75%), Gaps = 2/162 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS NVLID + NARL DFGLAL    +D RL+ TPPAGT+GYLDP Y+ P +L+
Sbjct  182  VIHRDIKSCNVLIDGDGNARLADFGLALIGNVDDERLKYTPPAGTLGYLDPSYLAPADLT  241

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEIISGR+AID+ YSP  IVDWA+PLI+RG   AI D +I       V
Sbjct  242  AKSDVFSFGILLLEIISGREAIDLNYSPSCIVDWAVPLIKRGDYDAICDLKIKNRPYYAV  301

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWN  486
             ++LAV+AA+CVRS  ++RP M E+VECL  + ++ P  +WN
Sbjct  302  IRKLAVMAARCVRSTAKKRPDMLEVVECLKTVRQLSP--AWN  341



>ref|XP_002893526.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69785.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=465

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 126/166 (76%), Gaps = 7/166 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS N+LID N NARL DFGLAL    +D RL+ TPPAGT+GYLDP Y+ P +L+
Sbjct  177  VIHRDIKSCNILIDGNGNARLADFGLALIGNVDDERLKCTPPAGTLGYLDPSYLAPADLT  236

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRI-HPPKDPL  357
             K+DVFSFGILLLEIISGR+AID+ YSP  IVDWA+PLI+RG+  AI D +I + P   +
Sbjct  237  AKSDVFSFGILLLEIISGREAIDLNYSPSCIVDWAVPLIKRGEFAAICDLKIKNRPYSAV  296

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLG---ELSKVVPLHSWN  486
            +RK L ++AA+CVRS  ++RP M E+VECL    +LS+  P  +WN
Sbjct  297  IRK-LVMMAARCVRSTAKKRPDMLEVVECLKTVRKLSQASP--AWN  339



>ref|XP_007141242.1| hypothetical protein PHAVU_008G179300g [Phaseolus vulgaris]
 gb|ESW13236.1| hypothetical protein PHAVU_008G179300g [Phaseolus vulgaris]
Length=415

 Score =   187 bits (476),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 93/149 (62%), Positives = 113/149 (76%), Gaps = 3/149 (2%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+NVLID    ARLGDFGLA R    D R+   PPAGT+GYLDP Y+ P +LS
Sbjct  166  VIHRDIKSSNVLIDEKWKARLGDFGLAFRGHVADSRV---PPAGTLGYLDPCYLAPGDLS  222

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEI SGR AIDV +SPPS++DWA+PL+ RG+   I DPRI  P D   
Sbjct  223  PKSDVFSFGILLLEIASGRHAIDVRHSPPSLLDWAMPLVCRGEFREICDPRIGAPPDMAA  282

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++ V+AA+CVRS  ERRP++ E+VECL
Sbjct  283  FRRMMVLAARCVRSTAERRPTIAEVVECL  311



>ref|XP_010530134.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390 
[Tarenaya hassleriana]
Length=465

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 124/175 (71%), Gaps = 4/175 (2%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRD+KS+NVLID   NARLGDFGLAL  +  D R++ TPPAGT+GYLDP Y+ P +L+
Sbjct  186  VIHRDVKSSNVLIDGGGNARLGDFGLALSPRSEDERVKRTPPAGTIGYLDPSYLAPADLT  245

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEIISGR AID+ YSP S+VDWA+PL++RG   A+ DP I  P  P  
Sbjct  246  VKSDVFSFGILLLEIISGRNAIDLNYSPSSVVDWALPLMKRGDYAAVCDPIIAFPPPPPA  305

Query  361  R-KQLAVVAAKCVRSCRERRPSMKEIVECLGELSKV--VPLHSWNGFANPCLMVE  516
              + + V+AA+CVRS  E+RP M E VECL ++ ++  VP   WN        VE
Sbjct  306  AVRAVCVLAARCVRSTVEKRPEMSEAVECLKQVRRLSHVP-RVWNNLRQRVRRVE  359



>gb|KHN08253.1| Serine/threonine-protein kinase-like protein [Glycine soja]
Length=302

 Score =   174 bits (441),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 100/129 (78%), Gaps = 0/129 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRD+KS+NVLID+  NARLGDFGLALR    D R++ TPPAGT+GYLDP Y+ P++LS
Sbjct  43   VIHRDVKSSNVLIDQEWNARLGDFGLALRGHVEDVRVKCTPPAGTLGYLDPCYLAPEDLS  102

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFGILLLEIISGR AIDV +SPPS+VDWA+PLI+ G    I D RI P  DP  
Sbjct  103  AKSDVFSFGILLLEIISGRNAIDVNFSPPSVVDWAVPLIKLGDFAGICDRRIGPQPDPAR  162

Query  361  RKQLAVVAA  387
            R+   V +A
Sbjct  163  RRVARVESA  171



>ref|XP_002529012.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF33382.1| Protein kinase APK1B, chloroplast precursor, putative [Ricinus 
communis]
Length=367

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 125/200 (63%), Gaps = 16/200 (8%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLAL-RCQDNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            VIHRDIKSANVL D N NA+L D+GLA+ R   +    +++ PAGT+GY+DP Y  P  L
Sbjct  149  VIHRDIKSANVLFDSNWNAKLADYGLAVSRVDSSTSSHQASQPAGTIGYMDPSYTIPSKL  208

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIH--PPKD  351
            STK DVFS+G++LLEIISGRKAIDV  SP S+V+WA+PLI +  LM I D RI   PP  
Sbjct  209  STKNDVFSYGVVLLEIISGRKAIDVNRSPTSVVEWAVPLILKEGLMEICDTRIGLPPPFI  268

Query  352  PLVRKQLAVVAAKCVRSCRERRPSMKEIV-------ECLGELSKVVPLHSWNGFANPCLM  510
                + L  VAA+CV S  E RPS+ +IV        CL E  +V P  SW G      +
Sbjct  269  EGTIRHLLYVAARCVSSNEENRPSIGDIVMAMGMNNSCLVERVRVAPTSSWIG------L  322

Query  511  VETTVGLRKVGEEAQSFDAK  570
            + + + +R+  + A+ F  +
Sbjct  323  IRSLMAIRRQRKLARKFHVQ  342



>ref|XP_011014948.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Populus euphratica]
Length=357

 Score =   167 bits (424),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 121/192 (63%), Gaps = 3/192 (2%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSAN+L D N  A+L DFGL++  +D+     +T PAGT+GYLDP Y TP  LS
Sbjct  143  VIHRDIKSANILFDINWKAKLADFGLSVLQEDSSSHDHATQPAGTLGYLDPSYTTPSKLS  202

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK-DPL  357
            TK DVFS+G++LLEIIS +K IDV+ SP SIV+WA+PLI   +LM I D RI  P     
Sbjct  203  TKIDVFSYGVVLLEIISCQKVIDVSRSPSSIVEWAVPLIEEQRLMEICDTRIALPTFMEG  262

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGE--LSKVVPLHSWNGFANPCLMVETTVGL  531
              K L  VAA+CV    E RPS+ EIV+ + +  L + V + SW  F    ++      L
Sbjct  263  TIKHLLYVAARCVSCKEENRPSITEIVKGMDKNCLVERVQMPSWTSFMRSVILTRRPREL  322

Query  532  RKVGEEAQSFDA  567
             +  ++A+  DA
Sbjct  323  AEQWQQAKCEDA  334



>ref|XP_011047967.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Populus euphratica]
Length=357

 Score =   165 bits (418),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 120/192 (63%), Gaps = 3/192 (2%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSAN+L D N  A+L DFGL++  +D+     +T PAGT+GYLDP Y TP  LS
Sbjct  143  VIHRDIKSANILFDINWKAKLADFGLSVLQEDSSSHDHATQPAGTLGYLDPSYTTPSKLS  202

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK-DPL  357
            TK DVFS+G++LLEIIS +K IDV+ SP SIV+WA+PLI   +LM I D RI  P     
Sbjct  203  TKIDVFSYGVVLLEIISCQKVIDVSRSPSSIVEWAVPLIEEQRLMEICDTRIALPTFMEG  262

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECLGE--LSKVVPLHSWNGFANPCLMVETTVGL  531
              K L  VAA+CV    E RPS+ EIV+ + +  L + V + SW       ++      L
Sbjct  263  TIKHLLYVAARCVSCKEENRPSITEIVKGMDKNCLVERVQMPSWTSLMRSVILTRRPREL  322

Query  532  RKVGEEAQSFDA  567
             +  ++A+  DA
Sbjct  323  AEQWQQAKCEDA  334



>ref|XP_006389564.1| hypothetical protein POPTR_0022s00890g, partial [Populus trichocarpa]
 gb|ERP48478.1| hypothetical protein POPTR_0022s00890g, partial [Populus trichocarpa]
Length=334

 Score =   161 bits (408),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 121/189 (64%), Gaps = 8/189 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSAN+L D N  A+L DFGL++   D+     +T PAGT+GYLDP Y TP  LS
Sbjct  147  VIHRDIKSANILFDINWKAKLADFGLSVLLADSSSHDHATQPAGTIGYLDPSYTTPSKLS  206

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK-DPL  357
            TK DVFS+G++LLEIIS +K ID++ SP SIV+WA+PLI   +LM I D RI  P     
Sbjct  207  TKIDVFSYGVVLLEIISCQKVIDISRSPSSIVEWAVPLIEEQRLMEICDTRIALPTFMEG  266

Query  358  VRKQLAVVAAKCVRSCRER-RPSMKEIVECLGE--LSKVVPLHSWNGFANPCLMVETTVG  528
              K L  VAA+CV SCRE  RPS+ EIV+ + +  L + V + SW       ++   T  
Sbjct  267  TIKHLLYVAARCV-SCREENRPSITEIVKGMDKNCLVERVQMPSWTSLMRSVIL---TRR  322

Query  529  LRKVGEEAQ  555
             R++ E+ Q
Sbjct  323  PRELAEQWQ  331



>ref|XP_011092329.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Sesamum indicum]
Length=344

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/152 (53%), Positives = 107/152 (70%), Gaps = 11/152 (7%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            ++HRDIKSANVL+D+N  A++ DFGLA+R  + +       PAGT+GYLDPGY TP  LS
Sbjct  138  IVHRDIKSANVLVDKNWKAKVADFGLAIREDELNV------PAGTIGYLDPGYTTPCKLS  191

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFS+G+LLLE+IS RK IDV  SP SIV+WA+PLI++G++M + D R+  P+    
Sbjct  192  TKTDVFSYGVLLLELISSRKVIDVVESPASIVEWAVPLIQKGRMMEVVDKRVVLPQ--YT  249

Query  361  R---KQLAVVAAKCVRSCRERRPSMKEIVECL  447
            R   KQL  +AA+C+      RP M +I+  L
Sbjct  250  RRSIKQLLRMAARCLSPTEALRPCMPQILAIL  281



>ref|XP_011028309.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Populus euphratica]
Length=360

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 119/199 (60%), Gaps = 6/199 (3%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLA-LRCQDNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            VIHRDIKSANVL D N  A+L DFGLA LR   +      T PAGT+GYLDP Y TP  L
Sbjct  147  VIHRDIKSANVLFDLNWKAKLADFGLAVLRVDSSSSPDHETQPAGTIGYLDPCYTTPSKL  206

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK-DP  354
            STK DVFS+G++LLEI+S +KAIDV+  P SIVDWA+PLI + +LM I D RI  P    
Sbjct  207  STKNDVFSYGVVLLEIVSCQKAIDVSRRPASIVDWAVPLIEKQRLMEICDARIALPTFME  266

Query  355  LVRKQLAVVAAKCVRSCRERRPSMKEIVECLGE--LSKVVPLHSWNGFANPCLMVETTVG  528
               K L  VA++CV    E RPS+ EIV  + +  L   V + SW       +++     
Sbjct  267  GTIKHLLYVASRCVSCKEENRPSISEIVMGMDKNCLVGRVKIPSWTSLMRSVMLMRRPRK  326

Query  529  LRKVGEEAQ--SFDAKFSK  579
              K  +E +  +  +K SK
Sbjct  327  FLKQWQEEKCDNLHSKISK  345



>ref|XP_006385012.1| hypothetical protein POPTR_0004s23060g [Populus trichocarpa]
 gb|ERP62809.1| hypothetical protein POPTR_0004s23060g [Populus trichocarpa]
Length=364

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 108/167 (65%), Gaps = 9/167 (5%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLA-LRCQDNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            VIHRDIKSANVL D N  A+L DFGLA LR   +    + T PAGT+GYLDP Y TP  L
Sbjct  147  VIHRDIKSANVLFDLNWKAKLADFGLAVLRVDSSSSPDQETQPAGTIGYLDPCYTTPSKL  206

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK-DP  354
            STK DVFS+G++LLEI+S +KAIDV+  P SIVDWA+PLI + +LM + D RI  P    
Sbjct  207  STKNDVFSYGVVLLEIVSCQKAIDVSRLPASIVDWAVPLIEKQRLMEVCDSRIALPTFME  266

Query  355  LVRKQLAVVAAKCVRSCRERRPSMKEIV-----ECLGELSKVVPLHS  480
               K L  VA++CV    E RPS+ EIV      CL E  K   LHS
Sbjct  267  GTIKHLLYVASRCVSCKEENRPSISEIVMGMDKNCLEE--KCDDLHS  311



>ref|XP_006372875.1| epidermal differentiation family protein [Populus trichocarpa]
 gb|ERP50672.1| epidermal differentiation family protein [Populus trichocarpa]
Length=922

 Score =   163 bits (412),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    N     +  PAGT+GYLDP Y     L+
Sbjct  649  VIHRDIKSSNILIDEEHNARVSDFGLSLLGPANSSSPLAELPAGTLGYLDPEYYRLHYLT  708

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + AI DP + PP DP  
Sbjct  709  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIKAGDISAILDPVLKPPSDPEA  768

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  769  LKRIANVACKCVRMRGKERPSMDKVTTAL  797



>ref|XP_011028310.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Populus euphratica]
Length=360

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 94/199 (47%), Positives = 119/199 (60%), Gaps = 6/199 (3%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLA-LRCQDNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            VIHRDIKSANVL D N  A+L DFGLA LR   +      T PAGT+GYLDP Y TP  L
Sbjct  147  VIHRDIKSANVLFDLNWKAKLADFGLAVLRVDSSSSPDHETQPAGTIGYLDPCYTTPSKL  206

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK-DP  354
            STK DVFS+G++LLEI+S +KAIDV+  P SIVDWA+PLI + +LM I D RI  P    
Sbjct  207  STKNDVFSYGVVLLEIVSCQKAIDVSRRPASIVDWAVPLIEKQRLMEICDARIALPTFME  266

Query  355  LVRKQLAVVAAKCVRSCRERRPSMKEIVECLGE--LSKVVPLHSWNGFANPCLMVETTVG  528
               K L  VA++CV    E RPS+ EIV  + +  L   V + SW       +++     
Sbjct  267  GTIKHLLYVASRCVSCKEESRPSISEIVMGMDKNCLVGRVKIPSWTSLMRSVMLMRRPRK  326

Query  529  LRKVGEEAQ--SFDAKFSK  579
              K  +E +  +  +K SK
Sbjct  327  FLKQWQEEKCDNLHSKISK  345



>gb|ACF80231.1| unknown [Zea mays]
Length=319

 Score =   156 bits (394),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NAR+ DFGL++    +     S  PAGT+GYLDP Y     L+
Sbjct  48   VIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLT  107

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG++LLEI+SGRKAID+ +   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  108  TKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDIFAILDPVLSPPSDLEA  167

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  168  LKKIASVACKCVRMRGKDRPSMDKVTTAL  196



>ref|XP_011037092.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Populus euphratica]
Length=922

 Score =   162 bits (410),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    N     +  PAGT+GYLDP Y     L+
Sbjct  649  VIHRDIKSSNILIDEEHNARVSDFGLSLLGPANSSSPLAELPAGTLGYLDPEYYRLHYLT  708

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + AI DP + PP DP  
Sbjct  709  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIKAGDIPAILDPVLKPPSDPEA  768

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  769  LKRIANVACKCVRMRGKERPSMDKVTTAL  797



>ref|XP_009417009.1| PREDICTED: putative receptor protein kinase CRINKLY4 [Musa acuminata 
subsp. malaccensis]
Length=897

 Score =   162 bits (409),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     S PPAGT+GYLDP Y     L+
Sbjct  628  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLSEPPAGTLGYLDPEYYRLHYLT  687

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ +   +IV+WA+PLI+ G + AI DP + PP +P  
Sbjct  688  TKSDVYSFGVLLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDVSAILDPALKPPAEPEA  747

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A  A KCVR   + RPSM ++   L
Sbjct  748  LKKIAATACKCVRMRGKDRPSMDKVTTAL  776



>ref|XP_009607288.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Nicotiana tomentosiformis]
Length=893

 Score =   160 bits (404),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    N     +  PAGT+GYLDP Y     L+
Sbjct  619  VIHRDIKSSNILIDEEHNARVADFGLSLLGPANSSSPLAELPAGTLGYLDPEYYRLHYLT  678

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  679  TKSDVYSFGVLLLEILSGRKAIDMQYDEGNIVEWAVPLIKAGDIQAILDPVLKPPSDVEA  738

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A +A+KCVR   + RPSM ++   L
Sbjct  739  LRRIATIASKCVRMRGKERPSMDKVTTAL  767



>ref|XP_009593012.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Nicotiana tomentosiformis]
Length=372

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 107/159 (67%), Gaps = 13/159 (8%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALR----CQDND-----FRLRS-TPPAGTMGYLD  150
            ++HRDIKS NVL D N NA+L D GLALR    C+D+D      R  S T PAGT+GYLD
Sbjct  140  IVHRDIKSTNVLFDSNWNAKLADLGLALRLKTDCEDDDPYSPSHRSNSVTRPAGTIGYLD  199

Query  151  PGYITPDNLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDP  330
            P Y  P  LSTK D+FSFG+LLLEI+S RK IDV+ SP SIVDWAI LI+ G+ + I D 
Sbjct  200  PSYTKPSKLSTKNDIFSFGVLLLEIMSSRKVIDVSKSPVSIVDWAIILIKEGRDLEICDK  259

Query  331  RIHPP--KDPLVRKQLAVVAAKCVRSCRERRPSMKEIVE  441
            R+H P   +  ++  L  +A +CV   +  RPS++EIV+
Sbjct  260  RMHVPWYMEATIKNMLR-IATRCVSPKKITRPSIQEIVK  297



>ref|XP_004230467.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Solanum lycopersicum]
Length=366

 Score =   154 bits (390),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 104/157 (66%), Gaps = 12/157 (8%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDND---------FRLRSTPPAGTMGYLDP  153
            ++HRDIKSAN+L D N NA+L D GLALR +++D              T PAGT+GYLDP
Sbjct  144  IVHRDIKSANILFDSNWNAKLADLGLALRMKNDDQDESPSYSYSYNSVTRPAGTIGYLDP  203

Query  154  GYITPDNLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPR  333
             Y  P  LSTK DVFSFG+LL EI+S RKAIDV+ SP SIVDWA  LI+ G+ + I D R
Sbjct  204  DYTKPSKLSTKNDVFSFGVLLFEIMSSRKAIDVSKSPVSIVDWATKLIKEGQSLEICDKR  263

Query  334  IHPP--KDPLVRKQLAVVAAKCVRSCRERRPSMKEIV  438
            +H P   +  ++  L+ +A +CV   +  RP+++EIV
Sbjct  264  MHVPWYMEATIKNMLS-IATRCVSPKKITRPTIEEIV  299



>ref|XP_002264936.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Vitis vinifera]
Length=926

 Score =   159 bits (403),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     + PPAGT GYLDP Y     L+
Sbjct  653  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSGSPLAEPPAGTFGYLDPEYYRLHYLT  712

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ +   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  713  TKSDVYSFGVLLLEILSGRKAIDMQFDEGNIVEWAVPLIKSGDISAILDPVLKPPSDLEA  772

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  773  LKRIATVAYKCVRMRGKERPSMDKVTTAL  801



>ref|XP_010522990.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Tarenaya hassleriana]
Length=355

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 102/146 (70%), Gaps = 4/146 (3%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRD+KS NVL D + +A+L DFGLA+     D  ++++PPAGT+GY+DP Y +P+NL+
Sbjct  156  VIHRDVKSENVLFDSSWDAKLADFGLAVSTHLADSAIQASPPAGTIGYIDPSYTSPENLT  215

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTD+FS+G+ +LEI++ RKAID++ SP SIVDWAIPLI  G +  I      PP     
Sbjct  216  TKTDIFSYGVAVLEIVTCRKAIDLSRSPASIVDWAIPLINDGNVREISGGEYPPPSI---  272

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIV  438
             ++L   AA+CV +  E RPS  EIV
Sbjct  273  -ERLIRTAARCVSATAESRPSAGEIV  297



>ref|XP_011088589.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Sesamum indicum]
Length=909

 Score =   159 bits (403),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    N     +  PAGT+GYLDP Y     L+
Sbjct  636  VIHRDIKSSNILIDEEHNARVADFGLSLLGPANSSSPLAELPAGTLGYLDPEYYRLHYLT  695

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G L AI DP + PP D   
Sbjct  696  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIKAGDLEAILDPALKPPPDLEA  755

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A +A+KCVR   + RPSM ++   L
Sbjct  756  LKRIANIASKCVRMRGKERPSMDKVTTAL  784



>ref|XP_007041331.1| Kinase APK1B, chloroplast, putative [Theobroma cacao]
 gb|EOX97162.1| Kinase APK1B, chloroplast, putative [Theobroma cacao]
Length=366

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 5/148 (3%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSAN+L D +  A+L DFGLA+   D+    ++T PAGT+GYLDP Y  PD LS
Sbjct  149  VIHRDIKSANILFDSSWTAKLADFGLAVLPDDS--LSQATQPAGTLGYLDPSYTAPDKLS  206

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK--DP  354
            TK DVFS G++ LEIISGRK IDV+ +P SIV+WAIPL+ + +L  I DPR+  P   + 
Sbjct  207  TKNDVFSLGVVFLEIISGRKVIDVSKAPASIVEWAIPLVEKQRLTGICDPRVPFPTYMEG  266

Query  355  LVRKQLAVVAAKCVRSCRERRPSMKEIV  438
            ++R+ L+ V ++C+     RRPS+ EIV
Sbjct  267  VIRRILS-VTSRCLSENEARRPSIGEIV  293



>ref|XP_004152097.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Cucumis sativus]
 ref|XP_004156935.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Cucumis sativus]
 gb|KGN53088.1| hypothetical protein Csa_4G015780 [Cucumis sativus]
Length=921

 Score =   159 bits (403),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  648  VIHRDIKSSNILIDEEHNARVADFGLSLLGPTDSSSPLAELPAGTLGYLDPEYYRLHYLT  707

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLIR G + AI DP + PP D   
Sbjct  708  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIRSGDISAILDPILKPPSDAEA  767

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  768  LKRIANVACKCVRMRAKERPSMDKVTTAL  796



>ref|XP_009786187.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Nicotiana sylvestris]
Length=382

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 106/158 (67%), Gaps = 13/158 (8%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALR----CQDND-----FRLRS-TPPAGTMGYLD  150
            ++HRDIKS NVL D N NA+L D GLALR    C+D+D      R  S T PAGT+GYLD
Sbjct  151  IVHRDIKSTNVLFDSNWNAKLADLGLALRMKNDCEDDDPCSPSHRSNSVTRPAGTIGYLD  210

Query  151  PGYITPDNLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDP  330
            P Y  P  LSTK D+FSFG+LLLEI+S RK IDV+ SP SIVDWA  LI+ G+ + I D 
Sbjct  211  PSYTKPSKLSTKNDIFSFGVLLLEIMSSRKVIDVSKSPVSIVDWATTLIKEGRDLEICDK  270

Query  331  RIHPP--KDPLVRKQLAVVAAKCVRSCRERRPSMKEIV  438
            R+H P   +  ++  L  +A +CV + +  RPS++EIV
Sbjct  271  RMHVPWYMEGTIKNMLR-IATRCVSTKKITRPSIQEIV  307



>ref|XP_010524151.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
isoform X2 [Tarenaya hassleriana]
Length=892

 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 112/176 (64%), Gaps = 2/176 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  637  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  696

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  697  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIKAGDISAILDPALKPPSDTEA  756

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETTVG  528
             K++A VA KCVR     RPSM+++   L     +V L     +  P L  E  +G
Sbjct  757  LKRIARVACKCVRMRGRERPSMEKVTTALER--ALVELMGSPCYEQPILPTEVVLG  810



>ref|XP_008812970.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390 
[Phoenix dactylifera]
Length=348

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 106/158 (67%), Gaps = 6/158 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            V HRD+K +N+L+D N  ARL DF LA+R         +    GT+GYLDP Y+ P +LS
Sbjct  155  VAHRDVKPSNLLLDANGRARLADFSLAIRLPPPQALPPA----GTIGYLDPSYLRPTDLS  210

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK--DP  354
            T TDV+SFG++LLEI++GR+AIDV YSPPS+ DWA PL+  G+   ++DPR  P +  + 
Sbjct  211  TATDVYSFGVVLLEILTGRRAIDVEYSPPSLEDWAAPLVLAGRFAELWDPRARPAEGLEE  270

Query  355  LVRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVV  468
               + +AV+A +C+    E RPSM+E++ECL E  + V
Sbjct  271  EAARDVAVLATRCIAPAPEERPSMEEVLECLREAERRV  308



>ref|XP_006349428.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170-like 
[Solanum tuberosum]
Length=369

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 105/156 (67%), Gaps = 12/156 (8%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRS--------TPPAGTMGYLDPG  156
            ++HRDIKSAN+L D N NA+L D GLALR + ND +  S        T PAGT+GYLDP 
Sbjct  149  IVHRDIKSANILFDSNWNAKLADLGLALRMK-NDHQDESPSHSSNSVTRPAGTIGYLDPD  207

Query  157  YITPDNLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRI  336
            Y  P  LSTK DVFSFG+LL EI+S RKAIDV+ SP SIVDWA  LI+ G+ + I D R+
Sbjct  208  YTKPSKLSTKNDVFSFGVLLFEIMSSRKAIDVSKSPVSIVDWATKLIKEGQSLEICDKRM  267

Query  337  HPP--KDPLVRKQLAVVAAKCVRSCRERRPSMKEIV  438
            H P   +  ++  L+ +A +CV   +  RP+++EIV
Sbjct  268  HVPWYMESTIKNMLS-IATRCVSPKKITRPTIEEIV  302



>ref|XP_008453980.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase-like 
protein ACR4 [Cucumis melo]
Length=921

 Score =   159 bits (402),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  648  VIHRDIKSSNILIDEEHNARVADFGLSLLGPTDSSSPLAELPAGTLGYLDPEYYRLHYLT  707

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLIR G + AI DP + PP D   
Sbjct  708  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIRSGDISAILDPILKPPSDTEA  767

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  768  LKRIANVACKCVRMRAKERPSMDKVTTAL  796



>ref|XP_010524149.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010524150.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
isoform X1 [Tarenaya hassleriana]
Length=900

 Score =   159 bits (401),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/176 (48%), Positives = 112/176 (64%), Gaps = 2/176 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  645  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  704

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  705  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIKAGDISAILDPALKPPSDTEA  764

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSWNGFANPCLMVETTVG  528
             K++A VA KCVR     RPSM+++   L     +V L     +  P L  E  +G
Sbjct  765  LKRIARVACKCVRMRGRERPSMEKVTTALER--ALVELMGSPCYEQPILPTEVVLG  818



>ref|XP_002309807.2| epidermal differentiation family protein [Populus trichocarpa]
 gb|EEE90257.2| epidermal differentiation family protein [Populus trichocarpa]
Length=906

 Score =   159 bits (401),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  633  VIHRDIKSSNILIDEEHNARVSDFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  692

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+S RKAID+ Y   +IV+WA+PLI+ G + AI DP + PP DP  
Sbjct  693  TKSDVYSFGVLLLEILSSRKAIDMQYEEGNIVEWAVPLIKAGDISAILDPALKPPSDPEA  752

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  753  LKRIANVACKCVRMRGKERPSMDKVTTAL  781



>ref|XP_011012925.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Populus euphratica]
Length=922

 Score =   159 bits (401),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  649  VIHRDIKSSNILIDEEHNARVSDFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  708

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+S RKAID+ Y   +IV+WA+PLI+ G + AI DP + PP DP  
Sbjct  709  TKSDVYSFGVLLLEILSSRKAIDMQYEEGNIVEWAVPLIKAGDISAILDPALKPPSDPEA  768

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  769  LKRIANVACKCVRMRGKERPSMDKVTTAL  797



>ref|XP_011026418.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Populus euphratica]
Length=922

 Score =   159 bits (401),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  649  VIHRDIKSSNILIDEEHNARVSDFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  708

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+S RKAID+ Y   +IV+WA+PLI+ G + AI DP + PP DP  
Sbjct  709  TKSDVYSFGVLLLEILSSRKAIDMQYEEGNIVEWAVPLIKAGDISAILDPALKPPSDPEA  768

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  769  LKRIANVACKCVRMRGKERPSMDKVTTAL  797



>ref|XP_004250831.2| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Solanum lycopersicum]
Length=895

 Score =   158 bits (400),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    N     +  PAGT+GYLDP Y     L+
Sbjct  626  VIHRDIKSSNILIDEEHNARVADFGLSLLGPANSSSPLAELPAGTLGYLDPEYYRLHYLT  685

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  686  TKSDVYSFGVLLLEILSGRKAIDMQYDEGNIVEWAVPLIKAGDIEAILDPVLKPPSDAEA  745

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A +A+KCVR   + RPSM ++   L
Sbjct  746  LRRIANIASKCVRMRGKERPSMDKVTTAL  774



>ref|XP_006859187.1| hypothetical protein AMTR_s00070p00160180 [Amborella trichopoda]
 gb|ERN20654.1| hypothetical protein AMTR_s00070p00160180 [Amborella trichopoda]
Length=338

 Score =   152 bits (384),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 103/156 (66%), Gaps = 10/156 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSAN+L+D    ARL DFGLA+R   +     +  PAGT+GYLDP Y  P  LS
Sbjct  144  VIHRDIKSANILLDDRHRARLADFGLAVRGPGS-----TAAPAGTIGYLDPSYTAPSKLS  198

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDV+SFG++LLE++SGR+A+DV + PP + +WA  L+  G++  ++D R+ PP   + 
Sbjct  199  TKTDVYSFGVVLLELLSGRQAVDVDHEPPMVAEWATLLVDEGRVAEVWDRRLGPPAAAV-  257

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVV  468
               L  VA +CV    ERRP MKE+V    EL  VV
Sbjct  258  -WALMAVAVRCVDKAEERRPCMKEVVR---ELKGVV  289



>ref|XP_008445995.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
isoform X2 [Cucumis melo]
Length=346

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALR-CQDNDFRLRSTPPAGTMGYLDPGYITPDNL  177
            VIHRDIK+ N+L D N + +L DFGLA+  C     R+ S  PAGT+GYLDP Y T   L
Sbjct  141  VIHRDIKAENILFDSNWDLKLADFGLAVSTCGGKSSRIISRKPAGTIGYLDPSYTTASKL  200

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            STK+DVFSFG+++LE+ISGRKA+D++ SP SIV+WA PLI + K   I+D R+  PK   
Sbjct  201  STKSDVFSFGVVVLEVISGRKAMDISKSPASIVEWARPLIEQNKFEGIYDERMALPKWAE  260

Query  358  VR-KQLAVVAAKCVRSCRERRPSMKEIVECL  447
             R +++  +A +CV + +  RPSM EIVE +
Sbjct  261  RRLRKVVELAGRCVCAEQGMRPSMGEIVEAM  291



>ref|XP_008800064.1| PREDICTED: putative receptor protein kinase CRINKLY4 [Phoenix 
dactylifera]
Length=904

 Score =   158 bits (400),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L   D+     S  PAGT+GYLDP Y     L+
Sbjct  632  VIHRDIKSSNILIDEEHNARVADFGLSLFAPDDSSAPLSELPAGTLGYLDPEYYRLHYLT  691

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G +  + DP + PP D   
Sbjct  692  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIKAGDISTLLDPVLKPPADLEA  751

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A +A KCVR   + RPSM ++   L
Sbjct  752  LKKIASIACKCVRMRGKDRPSMDKVTTSL  780



>ref|XP_010930213.1| PREDICTED: putative receptor protein kinase CRINKLY4 [Elaeis 
guineensis]
Length=904

 Score =   158 bits (399),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L   D+     S  PAGT+GYLDP Y     L+
Sbjct  632  VIHRDIKSSNILIDEENNARVADFGLSLFAPDDSSAPLSELPAGTLGYLDPEYYRLHYLT  691

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + A+ DP +  P D   
Sbjct  692  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIKAGDITAVLDPVLKTPADLEA  751

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A +A KCVR   + RPSM ++   L
Sbjct  752  LKKIAAIACKCVRMRGKDRPSMDKVTTSL  780



>gb|EYU26955.1| hypothetical protein MIMGU_mgv1a007986mg [Erythranthe guttata]
Length=388

 Score =   153 bits (386),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 107/156 (69%), Gaps = 8/156 (5%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTP----PAGTMGYLDPGYITP  168
            V+HRDIKSAN+L+D N NA+L DFGLA R  ++   +        PAGT+GY+DP Y TP
Sbjct  156  VVHRDIKSANILLDDNWNAKLADFGLATRLHNSTSSIDDVANYKIPAGTIGYIDPSYTTP  215

Query  169  DNLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK  348
              LSTK DVFS+G++LLE+ISGR+AID+  SP SI+DWA+PLI RG+   I D +I  P+
Sbjct  216  SELSTKVDVFSYGVVLLELISGRRAIDMDESPASIIDWALPLIERGRAADICDGKIDWPR  275

Query  349  DPLVR---KQLAVVAAKCVRSCRERRPSMKEIVECL  447
            + LV    ++L  VAA+C+   +  RP M EIV  L
Sbjct  276  N-LVGGRIEELLQVAARCLSVEQNNRPPMDEIVGIL  310



>ref|XP_010275087.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Nelumbo nucifera]
Length=355

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 84/158 (53%), Positives = 108/158 (68%), Gaps = 8/158 (5%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQD-NDFRLRSTPPAGTMGYLDPGYITPDNL  177
            VIHRDIKSAN+L D N NA+L DFGLA+R  D N      + PAGT+GYLDP Y TP  L
Sbjct  139  VIHRDIKSANILFDSNWNAKLADFGLAVRLGDVNQPVPPPSQPAGTIGYLDPCYTTPGKL  198

Query  178  STKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK--D  351
            STKTDVFS+G++LLEIIS R+AIDV + P SIVDWA+ L  + +++ + D R+  P   +
Sbjct  199  STKTDVFSYGVVLLEIISCRRAIDVEWEPASIVDWALRLTNQDRMIEVCDSRVALPSYME  258

Query  352  PLVRKQLAVVAAKCVRSCRERRPSMKEIV----ECLGE  453
              VR  L+ +AA+CV S  + RP+M+EI      CL E
Sbjct  259  TTVRCMLS-LAARCVSSKEDFRPAMREIATELKTCLAE  295



>gb|KHN25294.1| Serine/threonine-protein kinase-like protein ACR4 [Glycine soja]
Length=876

 Score =   157 bits (398),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  602  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSGSPLAELPAGTLGYLDPEYYRLHYLT  661

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  662  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIKSGDITAILDPVLKPPPDLEA  721

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  722  LKRIANVACKCVRMRGKERPSMDKVTTAL  750



>gb|EYU37937.1| hypothetical protein MIMGU_mgv1a001147mg [Erythranthe guttata]
Length=877

 Score =   157 bits (397),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    N     +  PAGT+GYLDP Y     L+
Sbjct  601  VIHRDIKSSNILIDEEHNARVADFGLSLLGPANSSSPLAELPAGTLGYLDPEYYRLHYLT  660

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G++ AI DP + PP D   
Sbjct  661  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIKGGEIDAILDPFLKPPSDLEA  720

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
              ++A +A KCVR   + RPSM ++   L
Sbjct  721  LTRIANIACKCVRMRGKERPSMDKVTTAL  749



>ref|XP_003540697.2| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Glycine max]
Length=946

 Score =   157 bits (397),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  672  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSGSPLAELPAGTLGYLDPEYYRLHYLT  731

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  732  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIKSGDITAILDPVLKPPPDLEA  791

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  792  LKRIANVACKCVRMRGKERPSMDKVTTAL  820



>ref|XP_009415049.1| PREDICTED: putative receptor protein kinase CRINKLY4 [Musa acuminata 
subsp. malaccensis]
Length=894

 Score =   157 bits (396),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     S PPAGT+GYLDP Y     L+
Sbjct  625  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLSEPPAGTLGYLDPEYYRLHYLT  684

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ +   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  685  TKSDVYSFGVLLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDISAILDPVLKPPADLEA  744

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A +A+KCVR   + R SM ++   L
Sbjct  745  LKKIAAMASKCVRMRGKDRLSMDKVTTTL  773



>gb|KCW87886.1| hypothetical protein EUGRSUZ_A00278 [Eucalyptus grandis]
Length=543

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  273  VIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSGSPLAELPAGTLGYLDPEYYRLHYLT  332

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G +  I DP + PP D   
Sbjct  333  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIKTGDISNILDPDLKPPSDLEA  392

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A +A KCVR   + RPSM  +   L
Sbjct  393  LKRIANIACKCVRMRGKDRPSMDRVTTAL  421



>gb|EPS72385.1| hypothetical protein M569_02367 [Genlisea aurea]
Length=888

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    N     +  PAGT+GYLDP Y     L+
Sbjct  608  VIHRDIKSSNILIDEEHNARVSDFGLSLLGPANSSSPLAELPAGTLGYLDPEYYRLHYLT  667

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PL++ G + AI DP + PP +   
Sbjct  668  TKSDVYSFGVLLLEILSGRKAIDLQYEEGNIVEWAVPLVKSGDVEAILDPNLKPPAELEA  727

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  728  VKRIANVAIKCVRMRGKERPSMDKVTTAL  756



>ref|XP_006352076.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Solanum tuberosum]
Length=895

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    N     +  PAGT+GYLDP Y     L+
Sbjct  626  VIHRDIKSSNILIDEEHNARVADFGLSLLGPANSSSPLAELPAGTLGYLDPEYYRLHYLT  685

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G++ AI DP +  P D   
Sbjct  686  TKSDVYSFGVLLLEILSGRKAIDMQYDEGNIVEWAVPLIKAGEIEAILDPVLKSPSDAEA  745

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A +A+KCVR   + RPSM ++   L
Sbjct  746  LRRIANIASKCVRMRGKERPSMDKVTTAL  774



>ref|XP_010530555.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010530563.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
isoform X2 [Tarenaya hassleriana]
Length=356

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 97/145 (67%), Gaps = 0/145 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRD+KS NVL D N NA+L DFGLA+  Q  D  +++ PPAGT+GY+DP Y +P+ LS
Sbjct  153  VIHRDVKSENVLFDSNWNAKLADFGLAVSTQRVDSAIQTNPPAGTIGYIDPSYTSPEKLS  212

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDVFS+G++LLEI+S RKAIDV  SP SIVDWAI  I  GK+  I      P      
Sbjct  213  TKTDVFSYGVVLLEIMSCRKAIDVTRSPASIVDWAISSIEEGKIGEITGVGSAPSCISAA  272

Query  361  RKQLAVVAAKCVRSCRERRPSMKEI  435
             +++  +A +CV    E RPS  EI
Sbjct  273  IERILRMAVRCVSPPTESRPSAGEI  297



>ref|XP_008222558.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Prunus mume]
Length=890

 Score =   156 bits (394),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  618  VIHRDIKSSNILIDEEHNARVSDFGLSLLGPADSGSPLAELPAGTLGYLDPEYYRLHYLT  677

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G++ AI DP + PP D   
Sbjct  678  TKSDVYSFGVLLLEILSGRKAIDMQYEDGNIVEWAVPLIKSGEINAILDPVLKPPPDLEA  737

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  738  LKRIANVACKCVRMRGKERPSMDKVTTAL  766



>gb|AAR96009.1| crinkly4-like protein [Musa acuminata]
Length=894

 Score =   156 bits (394),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     S PPAGT+GYLDP Y     L+
Sbjct  625  VIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSSSPLSEPPAGTLGYLDPEYYRLHYLT  684

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ +   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  685  TKSDVYSFGVLLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDISAILDPVLKPPADLEA  744

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A +A+KCVR   + R SM ++   L
Sbjct  745  LKKIAAMASKCVRMRGKDRLSMDKVTTTL  773



>gb|KHN06205.1| Serine/threonine-protein kinase-like protein ACR4 [Glycine soja]
Length=916

 Score =   156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  645  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSGSPLAELPAGTLGYLDPEYYRLHYLT  704

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  705  TKSDVYSFGVLLLEILSGRKAIDMQYEECNIVEWAVPLIKSGDITAISDPVLKPPPDLEA  764

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  765  LKRIANVACKCVRMRGKERPSMDKVTTAL  793



>ref|XP_010064568.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4, 
partial [Eucalyptus grandis]
Length=583

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  313  VIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSGSPLAELPAGTLGYLDPEYYRLHYLT  372

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G +  I DP + PP D   
Sbjct  373  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIKTGDISNILDPDLKPPSDLEA  432

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A +A KCVR   + RPSM  +   L
Sbjct  433  LKRIANIACKCVRMRGKDRPSMDRVTTAL  461



>ref|XP_006650326.1| PREDICTED: putative receptor protein kinase CRINKLY4-like [Oryza 
brachyantha]
Length=900

 Score =   156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NAR+ DFGL++    +     S  PAGT+GYLDP Y     L+
Sbjct  628  VIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLT  687

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG++LLEI+SGRKAID+ +   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  688  TKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDISAILDPVLSPPSDLEA  747

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  748  LKKIAAVACKCVRMRAKDRPSMDKVTTAL  776



>ref|XP_009410126.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390 
[Musa acuminata subsp. malaccensis]
Length=350

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 104/155 (67%), Gaps = 8/155 (5%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQ----DNDFRLRSTPPAGTMGYLDPGYITP  168
            V+HRD+K AN+L+D     RL DFGLA+R      D D  L   PPAGTMGYLDPGY+ P
Sbjct  163  VVHRDVKPANLLLDAKGRTRLADFGLAIRLPLPGGDEDRSL--PPPAGTMGYLDPGYVRP  220

Query  169  DNLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPP-  345
             + ST+TDV+SFG+LLLE++SGR+AIDV YSPPS+VDWA PL+  G+   ++DPR  P  
Sbjct  221  VDASTRTDVYSFGVLLLEVLSGREAIDVEYSPPSLVDWATPLLEEGRFEELWDPRAAPED  280

Query  346  -KDPLVRKQLAVVAAKCVRSCRERRPSMKEIVECL  447
              +    + +A VA +C+      RPSM E+V  L
Sbjct  281  RSEEEAARAVAEVAGRCLAPAAGDRPSMAEVVTVL  315



>ref|XP_004972946.1| PREDICTED: putative receptor protein kinase CRINKLY4-like [Setaria 
italica]
Length=907

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NAR+ DFGL++    +     S  PAGT+GYLDP Y     L+
Sbjct  636  VIHRDIKSSNILIDEDHNARVADFGLSIMGPADSGTPLSELPAGTLGYLDPEYYRLHYLT  695

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+ LLEI+SGRKAID+ +   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  696  TKSDVYSFGVFLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDIFAILDPVLSPPSDLEA  755

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  756  LKKIASVACKCVRMRGKDRPSMDKVTTAL  784



>ref|XP_002441844.1| hypothetical protein SORBIDRAFT_08g003290 [Sorghum bicolor]
 gb|EES15682.1| hypothetical protein SORBIDRAFT_08g003290 [Sorghum bicolor]
Length=903

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NAR+ DFGL++    +     S  PAGT+GYLDP Y     L+
Sbjct  632  VIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLT  691

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG++LLEI+SGRKAID+ +   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  692  TKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDIFAILDPALSPPSDLEA  751

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  752  LKKIASVACKCVRMRGKDRPSMDKVTTAL  780



>emb|CDO97591.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   150 bits (379),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 103/154 (67%), Gaps = 6/154 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTP---PAGTMGYLDPGYITPD  171
            ++HRDIKSAN+L D + NARL D GLA+R   +    +      PAGT+GYLDP Y  P 
Sbjct  148  IVHRDIKSANILFDSDWNARLADLGLAIRMNHDSLNWQIDSLNRPAGTIGYLDPAYTVPS  207

Query  172  NLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK-  348
             LSTK DVFSFG+LLLEIIS RK +DV+ SP SIV+WAIPLI++ +++ I D R+   + 
Sbjct  208  KLSTKIDVFSFGVLLLEIISARKVMDVSRSPSSIVEWAIPLIQKDQIVEISDGRVPISRF  267

Query  349  -DPLVRKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             D L+R  L+ +A +C+      RPSM EIV  L
Sbjct  268  TDGLIRNMLS-IARRCINFGETDRPSMGEIVSEL  300



>ref|XP_007131950.1| hypothetical protein PHAVU_011G054300g [Phaseolus vulgaris]
 gb|ESW03944.1| hypothetical protein PHAVU_011G054300g [Phaseolus vulgaris]
Length=919

 Score =   155 bits (392),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 102/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  646  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSGSPLAELPAGTLGYLDPEYYRLHYLT  705

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  706  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIKSGDITAILDPVLKPPPDLEA  765

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A V  KCVR   + RPSM ++   L
Sbjct  766  LKRIANVGCKCVRMRGKERPSMDKVTTAL  794



>gb|KDP43834.1| hypothetical protein JCGZ_20844 [Jatropha curcas]
Length=819

 Score =   155 bits (391),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 102/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  546  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSGSPLAELPAGTLGYLDPEYYRLHYLT  605

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+   + AI DP + PP D   
Sbjct  606  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIKSADISAILDPLLKPPPDIEA  665

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  666  LKRIANVACKCVRMKGKERPSMDKVTTAL  694



>ref|XP_008218769.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Prunus mume]
Length=354

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 101/157 (64%), Gaps = 7/157 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRD+KSAN+L D + NA+L DFGLA+  + +     S P AGT+GYLDP Y TP  LS
Sbjct  141  VIHRDVKSANILFDSDWNAKLADFGLAVLLRVDSPSHPSQPAAGTIGYLDPCYTTPSKLS  200

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK--DP  354
            TK DVFSFGI+LLEIIS RK ID+  SP SIVDWAIPLI+  ++  I D R+  P     
Sbjct  201  TKNDVFSFGIVLLEIISSRKVIDIYKSPASIVDWAIPLIKEQRIEQICDARLGLPTYMSS  260

Query  355  LVRKQLAVVAAKCVRSCRERRPSM----KEIVECLGE  453
             +R  L  VAA CV S    RP+M    KEI  C  E
Sbjct  261  TIRHMLN-VAASCVSSDVACRPTMMDVVKEIENCFIE  296



>ref|NP_001105395.1| putative receptor protein kinase CRINKLY4 precursor [Zea mays]
 ref|XP_008662321.1| PREDICTED: putative receptor protein kinase CRINKLY4 isoform 
X1 [Zea mays]
 sp|O24585.1|CRI4_MAIZE RecName: Full=Putative receptor protein kinase CRINKLY4; Flags: 
Precursor [Zea mays]
 gb|AAB09771.1| CRINKLY4 precursor [Zea mays]
 gb|AFW56055.1| crinkly4 [Zea mays]
Length=901

 Score =   155 bits (392),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NAR+ DFGL++    +     S  PAGT+GYLDP Y     L+
Sbjct  630  VIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLT  689

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG++LLEI+SGRKAID+ +   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  690  TKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDIFAILDPVLSPPSDLEA  749

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  750  LKKIASVACKCVRMRGKDRPSMDKVTTAL  778



>gb|EMS46171.1| hypothetical protein TRIUR3_24183 [Triticum urartu]
Length=350

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 107/172 (62%), Gaps = 32/172 (19%)
 Frame = +1

Query  226  ISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLVRKQLAVVAAKCVRSC  405
            +SGRKAIDV YSPPS+V+WA+PL+R+GK++A+FDPR+ PP+DP+ R+ LA +AA CVRSC
Sbjct  1    MSGRKAIDVQYSPPSVVEWAVPLLRKGKVVALFDPRVAPPRDPVTRRDLASLAASCVRSC  60

Query  406  RERRPSMKEIVECLGELSKVVPLHSWNGFA---NPCLM--VETTVGLRKVGEEAQSFDA-  567
            RERRPSM +IVE L  +SK V    WNG A   NPC +  V+ T+  R    E +S  A 
Sbjct  61   RERRPSMADIVERLAVISKAVSAKVWNGMAVVGNPCAIVDVQKTISKRAAASEKESTSAL  120

Query  568  -----------------------KFSKPLRNSRRVYSDL--GSRSNLMELMA  648
                                   K  +PL+N  +V+S+   G R NL+ELMA
Sbjct  121  AFDDDDKEADATLEELVPLVGAKKPPRPLKNG-KVFSEAGDGERRNLLELMA  171



>gb|EEC75803.1| hypothetical protein OsI_12742 [Oryza sativa Indica Group]
Length=858

 Score =   155 bits (391),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NAR+ DFGL++    +     S  PAGT+GYLDP Y     L+
Sbjct  586  VIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLT  645

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG++LLEI+SGRKAID+ +   +IV+WA+PLI+ G + A+ DP + PP D   
Sbjct  646  TKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDISALLDPVLSPPSDLEA  705

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  706  LKKIAAVACKCVRMRAKDRPSMDKVTTAL  734



>ref|XP_009770850.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Nicotiana sylvestris]
Length=893

 Score =   155 bits (391),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    N     +  PAGT+GYLDP Y     L+
Sbjct  619  VIHRDIKSSNILIDEEHNARVADFGLSLLGPANSSSPLAELPAGTLGYLDPEYYRLHYLT  678

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + AI DP +  P D   
Sbjct  679  TKSDVYSFGVLLLEILSGRKAIDMQYDEGNIVEWAVPLIKAGDIQAILDPVLKLPSDVEA  738

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A +A+KCVR   + RPSM ++   L
Sbjct  739  LRRIANIASKCVRMRGKERPSMDKVTTAL  767



>ref|XP_007224380.1| hypothetical protein PRUPE_ppa021630mg [Prunus persica]
 gb|EMJ25579.1| hypothetical protein PRUPE_ppa021630mg [Prunus persica]
Length=352

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 101/157 (64%), Gaps = 7/157 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRD+KSAN+L D + NA+L DFGLA+  + +     S P AGT+GYLDP Y TP  LS
Sbjct  139  VIHRDVKSANILFDSDWNAKLADFGLAVLLRVDSPSHPSEPAAGTIGYLDPCYTTPSKLS  198

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK--DP  354
            TK DVFSFG++LLEIIS RK ID+  SP SIVDWAIPLI+  ++  I D R+  P     
Sbjct  199  TKNDVFSFGVVLLEIISSRKVIDIYKSPASIVDWAIPLIKEQRIEQICDARLGLPTYMSS  258

Query  355  LVRKQLAVVAAKCVRSCRERRPSM----KEIVECLGE  453
             +R  L  VAA CV S    RP+M    KEI  C  E
Sbjct  259  TIRHMLN-VAASCVSSDVACRPTMMDVVKEIENCFIE  294



>ref|XP_009363637.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Pyrus x bretschneideri]
Length=912

 Score =   155 bits (391),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 102/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  639  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSGSPLAELPAGTLGYLDPEYYRLHYLT  698

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+W +PLI+ G + AI DP + PP D   
Sbjct  699  TKSDVYSFGVLLLEILSGRKAIDMQYEDGNIVEWGVPLIKSGDISAILDPVLKPPPDLEA  758

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  759  LKRIANVACKCVRMRGKERPSMDKVTTAL  787



>ref|XP_008369139.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Malus domestica]
Length=912

 Score =   155 bits (391),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 102/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  639  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSGSPLAELPAGTLGYLDPEYYRLHYLT  698

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G +  I DP + PP D   
Sbjct  699  TKSDVYSFGVLLLEILSGRKAIDMQYEDGNIVEWAVPLIKSGDISTILDPVLKPPPDLEA  758

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  759  LKRIANVACKCVRMRGKERPSMDKVTTAL  787



>ref|XP_007224894.1| hypothetical protein PRUPE_ppa022122mg [Prunus persica]
 gb|EMJ26093.1| hypothetical protein PRUPE_ppa022122mg [Prunus persica]
Length=914

 Score =   154 bits (390),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  642  VIHRDIKSSNILIDEEHNARVSDFGLSLLGPADSGSPLAELPAGTLGYLDPEYYRLHYLT  701

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G++  I DP + PP D   
Sbjct  702  TKSDVYSFGVLLLEILSGRKAIDMQYEYGNIVEWAVPLIKSGEINGILDPVLKPPPDLEA  761

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  762  LKRIANVACKCVRMRGKERPSMDKVTTAL  790



>gb|ABW81401.1| receptor-like kinase CR4 [Hordeum vulgare subsp. vulgare]
Length=897

 Score =   154 bits (390),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 102/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NAR+ DFGL++    +     S  PAGT+GYLDP Y     L+
Sbjct  625  VIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPLSELPAGTLGYLDPEYYRLHYLT  684

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG++LLEI+SGRKAID+     +IV+WA PLI+ G +  I DP + PP DP  
Sbjct  685  TKSDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAPLIKAGDISGILDPALSPPSDPEA  744

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  745  LKKIAAVACKCVRMRGKDRPSMDKVTTSL  773



>ref|XP_010268133.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
isoform X2 [Nelumbo nucifera]
Length=905

 Score =   154 bits (390),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  632  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  691

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ +   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  692  TKSDVYSFGVLLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDISAILDPVLKPPDDLEA  751

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A VA+KCVR   + RPSM ++   L
Sbjct  752  LRRIANVASKCVRMRGKERPSMDKVTTAL  780



>ref|NP_001050726.1| Os03g0637800 [Oryza sativa Japonica Group]
 dbj|BAB68389.1| CR4 [Oryza sativa]
 gb|AAR01745.1| putative TNFR-like receptor kinase [Oryza sativa Japonica Group]
 gb|ABF97796.1| Receptor protein kinase CRINKLY4 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12640.1| Os03g0637800 [Oryza sativa Japonica Group]
Length=901

 Score =   154 bits (390),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NAR+ DFGL++    +     S  PAGT+GYLDP Y     L+
Sbjct  629  VIHRDIKSSNILIDEDHNARVADFGLSILGPADSGTPLSELPAGTLGYLDPEYYRLHYLT  688

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG++LLEI+SGRKAID+ +   +IV+WA+PLI+ G + A+ DP + PP D   
Sbjct  689  TKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDISALLDPVLSPPSDLEA  748

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  749  LKKIAAVACKCVRMRAKDRPSMDKVTTAL  777



>dbj|BAK05611.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=897

 Score =   154 bits (390),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 102/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NAR+ DFGL++    +     S  PAGT+GYLDP Y     L+
Sbjct  625  VIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPLSELPAGTLGYLDPEYYRLHYLT  684

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG++LLEI+SGRKAID+     +IV+WA PLI+ G +  I DP + PP DP  
Sbjct  685  TKSDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAPLIKAGDISGILDPALSPPSDPEA  744

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  745  LKKIAAVACKCVRMRGKDRPSMDKVTTSL  773



>ref|XP_008445994.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
isoform X1 [Cucumis melo]
Length=347

 Score =   149 bits (375),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 106/152 (70%), Gaps = 3/152 (2%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLAL-RCQDNDFRLRST-PPAGTMGYLDPGYITPDN  174
            VIHRDIK+ N+L D N + +L DFGLA+  C     R+ S+  PAGT+GYLDP Y T   
Sbjct  141  VIHRDIKAENILFDSNWDLKLADFGLAVSTCGGKSSRIISSRKPAGTIGYLDPSYTTASK  200

Query  175  LSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDP  354
            LSTK+DVFSFG+++LE+ISGRKA+D++ SP SIV+WA PLI + K   I+D R+  PK  
Sbjct  201  LSTKSDVFSFGVVVLEVISGRKAMDISKSPASIVEWARPLIEQNKFEGIYDERMALPKWA  260

Query  355  LVR-KQLAVVAAKCVRSCRERRPSMKEIVECL  447
              R +++  +A +CV + +  RPSM EIVE +
Sbjct  261  ERRLRKVVELAGRCVCAEQGMRPSMGEIVEAM  292



>emb|CDP10055.1| unnamed protein product [Coffea canephora]
Length=920

 Score =   154 bits (390),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    N     +  PAGT+GYLDP Y     L+
Sbjct  647  VIHRDIKSSNILIDEEHNARVADFGLSLLGPANSSSPLAELPAGTLGYLDPEYYRLHYLT  706

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   ++V+WA+PLI+ G + AI DP +  P D   
Sbjct  707  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNVVEWAVPLIKAGDIQAILDPILKQPSDLEA  766

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A +A+KCVR   + RPSM ++   L
Sbjct  767  LRRIANIASKCVRMRGKERPSMDKVTTAL  795



>ref|XP_006852116.1| hypothetical protein AMTR_s00049p00025350 [Amborella trichopoda]
 gb|ERN13583.1| hypothetical protein AMTR_s00049p00025350 [Amborella trichopoda]
Length=947

 Score =   154 bits (390),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     S  PAGT+GYLDP Y     L+
Sbjct  682  VIHRDIKSSNILIDEEFNARVADFGLSLLGPADSNSPLSELPAGTLGYLDPEYYRLHYLT  741

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLE+ISGRKAID+ +   +IV+WA+PLI+ G L AI DP + PP +   
Sbjct  742  TKSDVYSFGVLLLELISGRKAIDMKFEDGNIVEWAVPLIKAGNLNAILDPNLRPPVEMEA  801

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A +A++CVR     RPSM+++   L
Sbjct  802  MRRIANIASRCVRMRGRERPSMEKVTTGL  830



>ref|XP_002533445.1| receptor protein kinase, putative [Ricinus communis]
 gb|EEF28941.1| receptor protein kinase, putative [Ricinus communis]
Length=920

 Score =   154 bits (389),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 102/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  647  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  706

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG++LLEI+SGRKAID+ Y   +IV+WA+PLI+ G + AI DP +  P D   
Sbjct  707  TKSDVYSFGVMLLEILSGRKAIDMQYEEGNIVEWAVPLIKSGDISAILDPVLKKPSDLEA  766

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  767  LKRIANVACKCVRMKGKERPSMDKVTTAL  795



>ref|XP_010268132.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
isoform X1 [Nelumbo nucifera]
Length=1061

 Score =   154 bits (390),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  788  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  847

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ +   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  848  TKSDVYSFGVLLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDISAILDPVLKPPDDLEA  907

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A VA+KCVR   + RPSM ++   L
Sbjct  908  LRRIANVASKCVRMRGKERPSMDKVTTAL  936



>ref|XP_010030141.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Eucalyptus grandis]
 gb|KCW57104.1| hypothetical protein EUGRSUZ_I02751 [Eucalyptus grandis]
Length=350

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 105/159 (66%), Gaps = 8/159 (5%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            ++HRDIKSAN+L D   NA+L DFGLA+   D+D RL S  PAGT+GYLDP Y  P  LS
Sbjct  149  IVHRDIKSANILFDSEWNAKLADFGLAV--MDSDDRLDS--PAGTIGYLDPNYTCPSKLS  204

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K DVFSFG++LLEI+SGRKA+DV+    SIVDWAI L+   + M I DPRI  P     
Sbjct  205  RKNDVFSFGVVLLEIMSGRKAMDVSKQTASIVDWAISLLEGQRAMDICDPRISLPSAVPF  264

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLH  477
            R  +  +A +CV +    RPS+ EIV    E+ +V+P H
Sbjct  265  R-HMVHLAGRCVAADEGSRPSVSEIVM---EMERVLPHH  299



>ref|XP_004979143.1| PREDICTED: putative receptor protein kinase CRINKLY4-like isoform 
X1 [Setaria italica]
 ref|XP_004979144.1| PREDICTED: putative receptor protein kinase CRINKLY4-like isoform 
X2 [Setaria italica]
Length=909

 Score =   154 bits (389),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 104/149 (70%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NAR+ DFGL++    +     S  PAGT+GYLDP Y     L+
Sbjct  638  VIHRDIKSSNILIDEDHNARVADFGLSILGPPDSGTPLSELPAGTLGYLDPEYYRLHYLT  697

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG++LLEI+SGRKAID+ +   +IV+WA+PLI+ G + +I DP + PP D   
Sbjct  698  TKSDVYSFGVVLLEILSGRKAIDMQFEEGNIVEWAVPLIKAGDIFSILDPVLSPPSDLEA  757

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  758  LKKIASVACKCVRMRGKDRPSMDKVTTAL  786



>ref|XP_004309815.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Fragaria vesca subsp. vesca]
Length=914

 Score =   153 bits (387),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 104/150 (69%), Gaps = 1/150 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  644  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  703

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPP-SIVDWAIPLIRRGKLMAIFDPRIHPPKDPL  357
            TK+DV+SFG+LLLEI+SGRKAID+ Y    +IV+WA+PLI+ G ++AI DP + PP D  
Sbjct  704  TKSDVYSFGVLLLEILSGRKAIDMQYEESGNIVEWAVPLIKAGDIIAILDPVLKPPPDVE  763

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIVECL  447
              K++A VA KCVR   + RPSM ++   L
Sbjct  764  ALKRIANVACKCVRMRGKERPSMDKVTTAL  793



>ref|XP_009381900.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390 
[Musa acuminata subsp. malaccensis]
Length=357

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 101/153 (66%), Gaps = 4/153 (3%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRST--PPAGTMGYLDPGYITPDN  174
            V HRD+K AN+L+D     RL DFGLA+     D    +    PAGTMGYLDP Y+ P++
Sbjct  162  VAHRDVKPANLLLDAKGRPRLADFGLAVGLSSRDGHEAAVLPQPAGTMGYLDPAYVHPED  221

Query  175  LSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPP--K  348
            +ST TDV+SFG++LLE++SGR+AIDV YSPPS+VDWA  L+  G+   I+DPR  P   +
Sbjct  222  VSTSTDVYSFGVVLLEVLSGREAIDVEYSPPSLVDWARRLLEEGRYEEIWDPRAAPEGRR  281

Query  349  DPLVRKQLAVVAAKCVRSCRERRPSMKEIVECL  447
            +    + +A VA +C+ +    RPSM E+V  L
Sbjct  282  EKEAARAMADVAGRCLVAAARERPSMAEVVAEL  314



>ref|XP_004507428.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Cicer arietinum]
Length=910

 Score =   153 bits (386),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 103/151 (68%), Gaps = 2/151 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  632  VIHRDIKSSNILIDEEHNARVSDFGLSLLGPADSTTPLAELPAGTLGYLDPEYYRLHYLT  691

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSP--PSIVDWAIPLIRRGKLMAIFDPRIHPPKDP  354
            TK+DV+SFG+LLLEIISGRKAID+ Y     +IV+W++PLI+ G + AI DP + PP D 
Sbjct  692  TKSDVYSFGVLLLEIISGRKAIDMKYEEGINNIVEWSVPLIKSGDIAAILDPTLEPPHDV  751

Query  355  LVRKQLAVVAAKCVRSCRERRPSMKEIVECL  447
               K++A VA KCVR   + RPSM ++   L
Sbjct  752  EALKRIANVACKCVRMRGKNRPSMDKVTTSL  782



>ref|XP_010526052.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Tarenaya hassleriana]
 ref|XP_010526059.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Tarenaya hassleriana]
Length=898

 Score =   152 bits (385),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  639  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSAPLAELPAGTLGYLDPEYYRLHYLT  698

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + AI DP + PP D   
Sbjct  699  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIKAGDIAAILDPVLKPPPDMES  758

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A  A KCVR     RPSM ++   L
Sbjct  759  LRRIASAAYKCVRMRGRDRPSMDKVTTAL  787



>ref|XP_003597519.1| Serine/threonine protein kinase-like protein ACR4 [Medicago truncatula]
 gb|AES67770.1| receptor-like kinase [Medicago truncatula]
Length=921

 Score =   152 bits (385),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 102/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  647  VIHRDIKSSNILIDEEHNARVSDFGLSLLGPTDSSSPLAELPAGTLGYLDPEYYRLHYLT  706

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV W++PLI+ G + +I DP + PP D   
Sbjct  707  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVQWSVPLIKSGDIASILDPCLKPPSDIEA  766

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A VA KCVR   + RPSM ++   L
Sbjct  767  LRRIANVACKCVRMRGKDRPSMDKVTTSL  795



>ref|XP_001754560.1| predicted protein [Physcomitrella patens]
 gb|EDQ80530.1| predicted protein [Physcomitrella patens]
Length=893

 Score =   152 bits (384),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 105/149 (70%), Gaps = 1/149 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKSAN+L+D   NAR+ DFGL+L    +  R  S  PAGT+GYLDP Y     L+
Sbjct  626  VIHRDIKSANILLDGGYNARVADFGLSLLGPSDSSRPLSELPAGTLGYLDPEYYRLHYLT  685

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LL+EI++G+ AID  Y   ++V+WA+PLI++G++M+I DPR+  P DP  
Sbjct  686  TKSDVYSFGVLLIEILTGKMAID-EYEDENLVEWAVPLIKKGEIMSILDPRLQHPADPEG  744

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
              ++A VAA+CVR   + RPSM  +   L
Sbjct  745  LLRIARVAARCVRMRGKDRPSMDRVTTSL  773



>gb|KDO47346.1| hypothetical protein CISIN_1g002512mg [Citrus sinensis]
Length=914

 Score =   152 bits (384),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 102/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  641  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  700

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ +   +IV+WA+PLI+ G + AI DP +  P D   
Sbjct  701  TKSDVYSFGVLLLEILSGRKAIDMQFEEGNIVEWAVPLIKSGDITAILDPVLKLPSDLDA  760

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  761  LKRIANVACKCVRMRGKERPSMDKVTTAL  789



>ref|XP_006443034.1| hypothetical protein CICLE_v10018759mg [Citrus clementina]
 ref|XP_006478696.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Citrus sinensis]
 gb|ESR56274.1| hypothetical protein CICLE_v10018759mg [Citrus clementina]
Length=914

 Score =   152 bits (384),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 102/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  641  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  700

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ +   +IV+WA+PLI+ G + AI DP +  P D   
Sbjct  701  TKSDVYSFGVLLLEILSGRKAIDMQFEEGNIVEWAVPLIKSGDITAILDPVLKLPSDLDA  760

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  761  LKRIANVACKCVRMRGKERPSMDKVTTAL  789



>gb|KGN51641.1| hypothetical protein Csa_5G587120 [Cucumis sativus]
Length=334

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/153 (50%), Positives = 104/153 (68%), Gaps = 4/153 (3%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLR---STPPAGTMGYLDPGYITPD  171
            VIHRDIK+ N+L D N + +L DFGLA+  + +    R   S  PAGT+GYLDP Y T  
Sbjct  141  VIHRDIKAENILFDSNWDLKLADFGLAVSDEGDGKSTRIIGSRKPAGTIGYLDPSYTTAS  200

Query  172  NLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKD  351
             LSTK+DVFSFG+++LE+ISGRKA+D++ SP SIV+WA PLI + K   I+D R+  PK 
Sbjct  201  KLSTKSDVFSFGVVVLEVISGRKAMDISKSPASIVEWARPLIEQNKFQGIYDERMTLPKW  260

Query  352  PLVR-KQLAVVAAKCVRSCRERRPSMKEIVECL  447
               R +++  +A +CV +    RPSM EIVE +
Sbjct  261  AERRLRKVVELAGRCVCAEPGMRPSMAEIVEAM  293



>ref|XP_004135345.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390-like 
[Cucumis sativus]
 ref|XP_004161927.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390-like 
[Cucumis sativus]
Length=333

 Score =   146 bits (369),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 104/152 (68%), Gaps = 3/152 (2%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDN--DFRLRSTPPAGTMGYLDPGYITPDN  174
            VIHRDIK+ N+L D N + +L DFGLA+  + +    R+    PAGT+GYLDP Y T   
Sbjct  141  VIHRDIKAENILFDSNWDLKLADFGLAVSDEGDGKSTRIIGRKPAGTIGYLDPSYTTASK  200

Query  175  LSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDP  354
            LSTK+DVFSFG+++LE+ISGRKA+D++ SP SIV+WA PLI + K   I+D R+  PK  
Sbjct  201  LSTKSDVFSFGVVVLEVISGRKAMDISKSPASIVEWARPLIEQNKFQGIYDERMTLPKWA  260

Query  355  LVR-KQLAVVAAKCVRSCRERRPSMKEIVECL  447
              R +++  +A +CV +    RPSM EIVE +
Sbjct  261  ERRLRKVVELAGRCVCAEPGMRPSMAEIVEAM  292



>ref|XP_011092892.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Sesamum indicum]
 ref|XP_011092893.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Sesamum indicum]
 ref|XP_011092894.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Sesamum indicum]
Length=908

 Score =   152 bits (383),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 102/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    N     +  PAGT+GYLDP Y     L+
Sbjct  635  VIHRDIKSSNILIDEEHNARVADFGLSLLGPVNSSSPLAELPAGTLGYLDPEYYRLHYLT  694

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+     +IV+WA+PLI+ G + AI DP +  P D   
Sbjct  695  TKSDVYSFGVLLLEILSGRKAIDMQCEEGNIVEWAVPLIKAGDIEAILDPALKHPSDLEA  754

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A +A+KCVR   + RPSM ++   L
Sbjct  755  LKRIANIASKCVRMRGKERPSMDKVTTAL  783



>ref|XP_007033959.1| Crinkly4 [Theobroma cacao]
 gb|EOY04885.1| Crinkly4 [Theobroma cacao]
Length=876

 Score =   151 bits (382),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 102/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  603  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSCPLAELPAGTLGYLDPEYYRLHYLT  662

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + A+ DP +  P D   
Sbjct  663  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVEWAVPLIKSGDISAVLDPLLKRPADLEA  722

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A VA KCVR   + RPSM ++   L
Sbjct  723  LRKIANVACKCVRMRGKERPSMDKVTTAL  751



>gb|KDP42413.1| hypothetical protein JCGZ_00210 [Jatropha curcas]
Length=352

 Score =   146 bits (368),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 116/204 (57%), Gaps = 16/204 (8%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKSANVL D N NA+L D+GLA+     D     + PAGT+GY+DP Y  P  LS
Sbjct  140  IIHRDIKSANVLFDSNFNAKLADYGLAVSSTRVD---PPSQPAGTIGYMDPCYTIPSKLS  196

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGK---LMAIFDPRIHPPKD  351
             K DV+S+G++LLE+IS R+AIDV  +P SIV+WAIPLI   K   L  I DPRI  P  
Sbjct  197  PKNDVYSYGVVLLELISSRRAIDVNRTPASIVEWAIPLIETQKNTILEEICDPRIGLPPI  256

Query  352  PL--VRKQLAVVAAKCVRSCRERRPSMKEIVE------CLGELSKVVPLH--SWNGFANP  501
             L  + K L  V A+CV    E RPSM +IV        L +  KVV  H  SW+     
Sbjct  257  FLEGIIKHLLYVGARCVSYKEENRPSMADIVTGIDSGFGLVDRVKVVSSHLPSWSSVIRS  316

Query  502  CLMVETTVGLRKVGEEAQSFDAKF  573
             ++      L K G+ +     KF
Sbjct  317  FIVTRRQKKLGKKGDYSDISKGKF  340



>ref|XP_003563239.1| PREDICTED: putative receptor protein kinase CRINKLY4 [Brachypodium 
distachyon]
Length=898

 Score =   151 bits (381),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NAR+ DFGL++    +     S  PAGT+GYLDP Y     L+
Sbjct  626  VIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPLSELPAGTLGYLDPEYYRLHYLT  685

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG++LLE++SGRKAID+     +IV+WA+PLI+ G + +I DP + PP D   
Sbjct  686  TKSDVYSFGVVLLEMLSGRKAIDMQCEEGNIVEWAVPLIKAGDISSILDPALSPPSDLEA  745

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  746  LKKIAAVACKCVRMRGKDRPSMDKVTTSL  774



>ref|XP_009355443.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Pyrus x bretschneideri]
Length=344

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 100/147 (68%), Gaps = 3/147 (2%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIH DIKSAN+L D + NA+L DFGLA+   D+  ++ S P AGT+GYLDP Y TP  LS
Sbjct  127  VIHSDIKSANILFDSDWNAKLADFGLAVLF-DSPSQV-SPPAAGTIGYLDPCYTTPSKLS  184

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKD-PL  357
            TK DVFSFG++LLEIIS RK IDV+ SP SIVDWA+ LI   ++  I D RI  P D   
Sbjct  185  TKNDVFSFGVVLLEIISCRKVIDVSESPASIVDWAVALIEEKRIDEICDARIGLPMDISS  244

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIV  438
              + +  VAA CV S  E RP ++EIV
Sbjct  245  TIRHILYVAASCVSSKLENRPMIREIV  271



>gb|EMS64811.1| Putative receptor protein kinase CRINKLY4 [Triticum urartu]
Length=949

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NAR+ DFGL++    +     S  PAGT+GYLDP Y     L+
Sbjct  677  VIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPLSELPAGTLGYLDPEYYRLHYLT  736

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG++LLEI+SGRKAID+     +IV+WA PLI+ G +  I DP + PP D   
Sbjct  737  TKSDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAPLIKAGDISGILDPALSPPSDLEA  796

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  797  LKKIAAVACKCVRMRGKDRPSMDKVTTSL  825



>gb|EMT10158.1| Putative receptor protein kinase CRINKLY4 [Aegilops tauschii]
Length=949

 Score =   150 bits (380),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID + NAR+ DFGL++    +     S  PAGT+GYLDP Y     L+
Sbjct  677  VIHRDIKSSNILIDEDHNARVADFGLSIMGPVDSGTPLSELPAGTLGYLDPEYYRLHYLT  736

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG++LLEI+SGRKAID+     +IV+WA PLI+ G +  I DP + PP D   
Sbjct  737  TKSDVYSFGVVLLEILSGRKAIDMQLEEGNIVEWAAPLIKAGDISGILDPALSPPSDLEA  796

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++A VA KCVR   + RPSM ++   L
Sbjct  797  LKKIAAVACKCVRMRGKDRPSMDKVTTSL  825



>ref|XP_006494360.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170-like 
[Citrus sinensis]
Length=378

 Score =   145 bits (367),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 96/147 (65%), Gaps = 4/147 (3%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKS N+L D   +A+L DFGLA+   D    ++   PAGT+GYLDPGY  P  LS
Sbjct  163  IIHRDIKSTNILFDSKWDAKLADFGLAVSESDESSMVQ---PAGTIGYLDPGYTNPSKLS  219

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK-DPL  357
             K DVFS+G++LLEIIS RK ID A  P SI+DWA+PLI+  KL  + D R+  P     
Sbjct  220  KKVDVFSYGVVLLEIISCRKPIDAARDPASIIDWALPLIKEEKLRQVCDSRVGLPTFMEG  279

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIV  438
              KQ+  VAA+CV S  E RP + EI+
Sbjct  280  AIKQMLHVAARCVSSEEENRPGIGEIL  306



>gb|KDO47796.1| hypothetical protein CISIN_1g035572mg [Citrus sinensis]
Length=379

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 96/147 (65%), Gaps = 4/147 (3%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKS N+L D   +A+L DFGLA+   D    ++   PAGT+GYLDPGY  P  LS
Sbjct  163  IIHRDIKSTNILFDSKWDAKLADFGLAVSESDESSMVQ---PAGTIGYLDPGYTNPSKLS  219

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK-DPL  357
             K DVFS+G++LLEIIS RK ID A  P SI+DWA+PLI+  KL  + D R+  P     
Sbjct  220  KKVDVFSYGVVLLEIISCRKPIDAARDPASIIDWALPLIKEEKLRQVCDSRVGLPTFMEG  279

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIV  438
              KQ+  VAA+CV S  E RP + EI+
Sbjct  280  AIKQMLHVAARCVSSEEENRPGIGEIL  306



>ref|XP_006431727.1| hypothetical protein CICLE_v10003742mg [Citrus clementina]
 gb|ESR44967.1| hypothetical protein CICLE_v10003742mg [Citrus clementina]
Length=379

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 96/147 (65%), Gaps = 4/147 (3%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKS N+L D   +A+L DFGLA+   D    ++   PAGT+GYLDPGY  P  LS
Sbjct  163  IIHRDIKSTNILFDSKWDAKLADFGLAVSESDESSMVQ---PAGTIGYLDPGYTNPSKLS  219

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPK-DPL  357
             K DVFS+G++LLEIIS RK ID A  P SI+DWA+PLI+  KL  + D R+  P     
Sbjct  220  KKVDVFSYGVVLLEIISCRKPIDAARDPASIIDWAMPLIKEEKLRQVCDSRVGLPTFMEG  279

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIV  438
              KQ+  VAA+CV S  E RP + EI+
Sbjct  280  AIKQMLHVAARCVSSEEENRPGIGEIL  306



>ref|XP_010672185.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Beta vulgaris subsp. vulgaris]
Length=920

 Score =   150 bits (378),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/149 (49%), Positives = 103/149 (69%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  648  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  707

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI++GRKAID+ +   +IV+WA+PL++ G + A+ DP + PP +   
Sbjct  708  TKSDVYSFGVLLLEILTGRKAIDMQFEEGNIVEWAVPLLKTGDITAVLDPLLKPPPEIEA  767

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A VA KCVR   + RPSM ++   L
Sbjct  768  LRRIANVACKCVRMRGKDRPSMDKVTTAL  796



>emb|CAI23709.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 emb|CAI23741.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
Length=345

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 106/162 (65%), Gaps = 6/162 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS N+L D N  A+L DFGLA+     D ++R  P AGT+GYLDP Y  P+NLS
Sbjct  154  VIHRDIKSENILFDSNWEAKLADFGLAVEF-GGDKKIRPAP-AGTIGYLDPCYTLPENLS  211

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             KTDV+S+G++LLEI+S RKAIDV+ SP SIVDWA+PLI+ G++  I            +
Sbjct  212  MKTDVYSYGVVLLEIVSCRKAIDVSRSPASIVDWAVPLIKEGRIGEICGGGGGSGVFRGM  271

Query  361  RKQLAVVAAKCVRSCRERRPSM----KEIVECLGELSKVVPL  474
             ++L  +AA+CV S  E RP       EIV CL E  K +PL
Sbjct  272  SQRLLRMAARCVSSDVESRPCFGEITAEIVACLAEPLKSLPL  313



>ref|XP_010939732.1| PREDICTED: serine/threonine-protein kinase-like protein At1g28390 
[Elaeis guineensis]
Length=343

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 101/153 (66%), Gaps = 6/153 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            V HRD+K +N+L+D N  ARL DF LA+R         +    GT+GY+DP Y+ P +LS
Sbjct  160  VAHRDVKPSNLLLDANGRARLADFSLAVRLPPPQALPPA----GTIGYIDPSYLRPTDLS  215

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPP--KDP  354
            T TDV+SFG++LLEI++GR+AIDV YSPPS+ DWA PL+  G+   ++DPR  P   ++ 
Sbjct  216  TATDVYSFGVVLLEILTGRRAIDVEYSPPSLEDWAAPLVGAGRFPELWDPRGRPAEGREE  275

Query  355  LVRKQLAVVAAKCVRSCRERRPSMKEIVECLGE  453
               + +AV+A +C+    E RPSM E+ E L E
Sbjct  276  EAARDVAVLATRCLAPVAEERPSMAEVAELLRE  308



>ref|XP_006402689.1| hypothetical protein EUTSA_v10005780mg [Eutrema salsugineum]
 gb|ESQ44142.1| hypothetical protein EUTSA_v10005780mg [Eutrema salsugineum]
Length=895

 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  636  VIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSGSPLAELPAGTLGYLDPEYYRLHYLT  695

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + AI DP +  P +   
Sbjct  696  TKSDVYSFGVLLLEILSGRKAIDMHYEEGNIVEWAVPLIKAGDITAILDPVLKQPSEIEA  755

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++  VA KCVR   + RPSM ++   L
Sbjct  756  LRRIVSVACKCVRMRGKDRPSMDKVTTAL  784



>emb|CAI23699.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 emb|CAI23701.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 emb|CAI23705.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 emb|CAI23707.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 emb|CAI23725.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 emb|CAI23729.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 emb|CAI23751.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
 emb|CAI23747.1| putative serine/threonine protein kinase [Arabidopsis thaliana]
Length=345

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 106/162 (65%), Gaps = 6/162 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS N+L D N  A+L DFGLA+     D ++R  P AGT+GYLDP Y  P+NLS
Sbjct  154  VIHRDIKSENILFDSNWEAKLADFGLAVEF-GGDKKIRPAP-AGTIGYLDPCYTLPENLS  211

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             KTDV+S+G++LLEI+S RKAIDV+ SP SIVDWA+PLI+ G++  I            +
Sbjct  212  MKTDVYSYGVVLLEIVSCRKAIDVSRSPASIVDWAVPLIKEGRIGEICGGGGGSGVFRGM  271

Query  361  RKQLAVVAAKCVRSCRERRPSM----KEIVECLGELSKVVPL  474
             ++L  +AA+CV S  E RP       EIV CL E  K +PL
Sbjct  272  SQRLLRMAARCVSSDVESRPCFGEITAEIVACLAEPLKSLPL  313



>ref|XP_007150432.1| hypothetical protein PHAVU_005G153100g [Phaseolus vulgaris]
 gb|ESW22426.1| hypothetical protein PHAVU_005G153100g [Phaseolus vulgaris]
Length=906

 Score =   149 bits (376),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  637  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  696

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV WA+PLI+ G + +I DP + PP D   
Sbjct  697  TKSDVYSFGVLLLEILSGRKAIDMQYEEGNIVQWAVPLIKSGDIASILDPVLKPPNDIDA  756

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A VA K VR   + RPSM ++   L
Sbjct  757  LRRIANVACKSVRMRGKDRPSMDKVTTVL  785



>ref|XP_010454598.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Camelina sativa]
Length=338

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 112/167 (67%), Gaps = 10/167 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS N+L   +  A+L DFGLA+  +++D ++R  P AGT+GYLDP Y +P+NLS
Sbjct  149  VIHRDIKSENILFGSSWEAKLADFGLAVDLKNDD-KMRPAP-AGTIGYLDPCYTSPENLS  206

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TKTDV+S+G++LLEI+S RKAIDV+ SP SIVDWA+PLI  G++  I        +   V
Sbjct  207  TKTDVYSYGVVLLEIVSCRKAIDVSRSPSSIVDWAVPLINGGRIGEICGGGSDVFRGMNV  266

Query  361  RKQLAVVAAKCVRSCRERRPSM----KEIVECLGELSKVVPLHSWNG  489
            R  L  +AA+CV +  E RP +     EIV C+ E  K +PL  W G
Sbjct  267  R--LLRMAARCVSADVETRPCLGEITAEIVACMAEPLKSLPL--WIG  309



>ref|XP_002878271.1| hypothetical protein ARALYDRAFT_486409 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54530.1| hypothetical protein ARALYDRAFT_486409 [Arabidopsis lyrata subsp. 
lyrata]
Length=894

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  637  VIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSGSPLAELPAGTLGYLDPEYYRLHYLT  696

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + A+ DP +  P +   
Sbjct  697  TKSDVYSFGVLLLEILSGRKAIDMHYEEGNIVEWAVPLIKAGDINALLDPVLKHPSEIEA  756

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++  VA KCVR   + RPSM ++   L
Sbjct  757  LKRIVSVACKCVRMRGKDRPSMDKVTTSL  785



>ref|NP_191501.1| serine/threonine-protein kinase-like protein ACR4 [Arabidopsis 
thaliana]
 sp|Q9LX29.1|ACR4_ARATH RecName: Full=Serine/threonine-protein kinase-like protein ACR4; 
AltName: Full=Protein CRINKLY 4; Short=AtCR4; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAB91612.1| putative protein [Arabidopsis thaliana]
 dbj|BAB91132.1| putative receptor protein kinase ACR4 [Arabidopsis thaliana]
 gb|AEE79920.1| serine/threonine-protein kinase-like protein ACR4 [Arabidopsis 
thaliana]
Length=895

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  637  VIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSGSPLAELPAGTLGYLDPEYYRLHYLT  696

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + A+ DP +  P +   
Sbjct  697  TKSDVYSFGVLLLEILSGRKAIDMHYEEGNIVEWAVPLIKAGDINALLDPVLKHPSEIEA  756

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++  VA KCVR   + RPSM ++   L
Sbjct  757  LKRIVSVACKCVRMRGKDRPSMDKVTTAL  785



>ref|XP_010512201.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Camelina sativa]
Length=895

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  637  VIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSGSPLAELPAGTLGYLDPEYYRLHYLT  696

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + A+ DP +  P +   
Sbjct  697  TKSDVYSFGVLLLEILSGRKAIDMHYEEGNIVEWAVPLIKAGDINALLDPVLKHPSEIEA  756

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++  VA KCVR   + RPSM ++   L
Sbjct  757  LKRIVSVACKCVRMRGKDRPSMDKVTTAL  785



>ref|XP_010469358.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Camelina sativa]
Length=897

 Score =   149 bits (375),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  639  VIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSGSPLAELPAGTLGYLDPEYYRLHYLT  698

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + A+ DP +  P +   
Sbjct  699  TKSDVYSFGVLLLEILSGRKAIDMHYEEGNIVEWAVPLIKAGDINALLDPVLKHPSEIEA  758

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++  VA KCVR   + RPSM ++   L
Sbjct  759  LKRIVSVACKCVRMRGKDRPSMDKVTTAL  787



>ref|XP_010413696.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Camelina sativa]
Length=895

 Score =   149 bits (375),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  638  VIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSGSPLAELPAGTLGYLDPEYYRLHYLT  697

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + A+ DP +  P +   
Sbjct  698  TKSDVYSFGVLLLEILSGRKAIDMHYEEGNIVEWAVPLIKAGDINALLDPVLKHPSEIEA  757

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++  VA KCVR   + RPSM ++   L
Sbjct  758  LKRIVSVACKCVRMRGKDRPSMDKVTTAL  786



>gb|KFK40245.1| hypothetical protein AALP_AA3G349100 [Arabis alpina]
Length=893

 Score =   149 bits (375),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 100/149 (67%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  635  VIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSGSPLAELPAGTLGYLDPEYYRLHYLT  694

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G +  I DP +  P +   
Sbjct  695  TKSDVYSFGVLLLEILSGRKAIDMHYEEGNIVEWAVPLIKAGDITGILDPVLKQPSEIEA  754

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++  VA KCVR   + RPSM ++   L
Sbjct  755  LKRIVSVACKCVRMRGKDRPSMDKVTTSL  783



>ref|XP_003546987.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like, 
partial [Glycine max]
Length=857

 Score =   148 bits (374),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  587  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  646

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ +   +IV WA+PLI+ G + AI DP + PP D   
Sbjct  647  TKSDVYSFGVLLLEILSGRKAIDMQFEEGNIVQWAVPLIKSGDIAAILDPTLKPPPDLDA  706

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A VA K VR   + RPSM ++   L
Sbjct  707  LRRIANVACKSVRMRGKDRPSMDKVTTVL  735



>ref|XP_010493432.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Camelina sativa]
Length=353

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 81/164 (49%), Positives = 108/164 (66%), Gaps = 8/164 (5%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS N+L   +  A+L DFGLA+  ++ D ++R  P AGT+GYLDP Y +P+NLS
Sbjct  160  VIHRDIKSENILFGSSWEAKLADFGLAVDLEEGD-KMRPAP-AGTIGYLDPCYTSPENLS  217

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL-  357
            TKTDV+S+G++LLEI S RKAIDV+ SP SIVDWA+PLI  G+++ I         D   
Sbjct  218  TKTDVYSYGVVLLEIFSCRKAIDVSRSPSSIVDWAVPLIDGGRIVEICGRGEGGGSDVFR  277

Query  358  -VRKQLAVVAAKCVRSCRERRPSM----KEIVECLGELSKVVPL  474
             +  +L  +AA+CV    E RP +     EIV C+ E  K +PL
Sbjct  278  GMNVRLLRIAARCVSGDVESRPCLGEITAEIVACMAEPLKSLPL  321



>ref|XP_008378888.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Malus domestica]
Length=352

 Score =   143 bits (361),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS N+L D + NA+L DFGLA+   D+  ++ S P AGT+GYLDP Y TP  LS
Sbjct  135  VIHRDIKSENILFDSDWNAKLADFGLAVLF-DSPSQV-SPPAAGTIGYLDPCYTTPSKLS  192

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKD-PL  357
            TK DVFSFG++LLEIIS RK IDV+ SP SIVDWA+ LI   ++  I D RI  P D   
Sbjct  193  TKNDVFSFGVVLLEIISCRKVIDVSKSPASIVDWAVALIEEERIDEICDARIGLPMDMSS  252

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIV  438
              + +  VAA CV S  E RP++  IV
Sbjct  253  TIRHILYVAASCVSSNVENRPTIGGIV  279



>emb|CDY66068.1| BnaC08g48960D [Brassica napus]
Length=730

 Score =   147 bits (372),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  476  VIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSGSPLAELPAGTLGYLDPEYYRLHYLT  535

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + +I DP +  P +   
Sbjct  536  TKSDVYSFGVLLLEILSGRKAIDMHYEEGNIVEWAVPLIKAGDITSILDPVLKQPTEVEA  595

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++  VA KCVR   + RPSM ++   L
Sbjct  596  LRRIVSVACKCVRMRGKDRPSMDKVTTSL  624



>gb|KHN33307.1| Serine/threonine-protein kinase-like protein ACR4 [Glycine soja]
Length=873

 Score =   148 bits (374),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  603  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  662

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ +   +IV WA+PLI+ G + AI DP + PP D   
Sbjct  663  TKSDVYSFGVLLLEILSGRKAIDMQFEEGNIVQWAVPLIKSGDIAAILDPTLKPPPDLDA  722

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A VA K VR   + RPSM ++   L
Sbjct  723  LRRIANVACKSVRMRGKDRPSMDKVTTVL  751



>emb|CDY06005.1| BnaA09g37750D [Brassica napus]
Length=730

 Score =   147 bits (371),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  476  VIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSGSPLAELPAGTLGYLDPEYYRLHYLT  535

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + +I DP +  P +   
Sbjct  536  TKSDVYSFGVLLLEILSGRKAIDMHYEEGNIVEWAVPLIKAGDITSILDPVLKQPTEIEA  595

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++  VA KCVR   + RPSM ++   L
Sbjct  596  LRRIVSVACKCVRMRGKDRPSMDKVTTSL  624



>ref|XP_002264141.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Vitis vinifera]
Length=361

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/151 (50%), Positives = 102/151 (68%), Gaps = 6/151 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRS---TPPAGTMGYLDPGYITPD  171
            V+HRDIKSAN+L D   NA+L DFGLA+R  +N    R    + PAGT+GYLDP Y TP 
Sbjct  141  VVHRDIKSANILFDSEWNAKLADFGLAVRKNENIDHSRVDSLSQPAGTIGYLDPCYTTPS  200

Query  172  NLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPP--  345
             LSTK DVFSFG++LLE+IS  K ID++ +   IV+WAIPLI++ ++  + D R   P  
Sbjct  201  KLSTKNDVFSFGVVLLEVISTSKVIDLSRTRTHIVEWAIPLIKKDRIKEVCDSRTELPMC  260

Query  346  KDPLVRKQLAVVAAKCVRSCRERRPSMKEIV  438
             +  +R  L  VAA+CV S  + RPSM++I+
Sbjct  261  MEGTIRHILR-VAARCVSSREDLRPSMQQII  290



>gb|KHN30097.1| Serine/threonine-protein kinase-like protein ACR4 [Glycine soja]
Length=871

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  605  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  664

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ +   +IV WA+PLI+ G + AI DP + PP D   
Sbjct  665  TKSDVYSFGVLLLEILSGRKAIDMQFEEGNIVQWAVPLIKSGDIAAILDPVLKPPPDLDA  724

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A VA K VR   + RPSM ++   L
Sbjct  725  LRRIANVACKSVRMRGKDRPSMDKVTTVL  753



>ref|XP_003542059.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4-like 
[Glycine max]
Length=900

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  634  VIHRDIKSSNILIDEEHNARVADFGLSLLGPADSSSPLAELPAGTLGYLDPEYYRLHYLT  693

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ +   +IV WA+PLI+ G + AI DP + PP D   
Sbjct  694  TKSDVYSFGVLLLEILSGRKAIDMQFEEGNIVQWAVPLIKSGDIAAILDPVLKPPPDLDA  753

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++A VA K VR   + RPSM ++   L
Sbjct  754  LRRIANVACKSVRMRGKDRPSMDKVTTVL  782



>ref|XP_009116601.1| PREDICTED: serine/threonine-protein kinase-like protein ACR4 
[Brassica rapa]
Length=904

 Score =   147 bits (372),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 101/149 (68%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  634  VIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSGSPLAELPAGTLGYLDPEYYRLHYLT  693

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+PLI+ G + +I DP +  P +   
Sbjct  694  TKSDVYSFGVLLLEILSGRKAIDMHYEEGNIVEWAVPLIKAGDITSILDPVLKQPTEIEA  753

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             +++  VA KCVR   + RPSM ++   L
Sbjct  754  LRRIVSVACKCVRMRGKDRPSMDKVTTSL  782



>gb|KEH30326.1| receptor-like kinase [Medicago truncatula]
Length=914

 Score =   147 bits (372),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 102/151 (68%), Gaps = 2/151 (1%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  642  VIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSSSPLAELPAGTLGYLDPEYYRLHYLT  701

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPP--SIVDWAIPLIRRGKLMAIFDPRIHPPKDP  354
            TK+DV+SFG+LLLEI+SGRKAID+       +IV+WA+PLI+ G + AI DP + PP D 
Sbjct  702  TKSDVYSFGVLLLEILSGRKAIDMMQYEEGNNIVEWAVPLIKSGDISAILDPILKPPHDL  761

Query  355  LVRKQLAVVAAKCVRSCRERRPSMKEIVECL  447
               K++A VA KCVR   + RPSM ++   L
Sbjct  762  EALKKIANVACKCVRMRGKDRPSMDKVTTAL  792



>ref|XP_009345833.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Pyrus x bretschneideri]
 ref|XP_009345846.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Pyrus x bretschneideri]
Length=351

 Score =   142 bits (358),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 97/150 (65%), Gaps = 9/150 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRL---RSTPPAGTMGYLDPGYITPD  171
            VIHRDIKS N+L D + NA+L DFGLA+      F L    S P AGT+GYLDP Y TP 
Sbjct  136  VIHRDIKSENILFDSDWNAKLADFGLAVL-----FDLPSQVSQPAAGTIGYLDPCYTTPS  190

Query  172  NLSTKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRI-HPPK  348
             LSTK+D+FSFG++LLEIIS RK IDV  SP SIVDWA+ LI   ++  I D RI  P  
Sbjct  191  KLSTKSDMFSFGVVLLEIISCRKVIDVYKSPASIVDWAVALIEEERIDEICDARIGFPVY  250

Query  349  DPLVRKQLAVVAAKCVRSCRERRPSMKEIV  438
                 + +  VAA CV S  E RP++ EIV
Sbjct  251  MSSTIRHILYVAASCVSSNVENRPTIGEIV  280



>ref|XP_009355441.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Pyrus x bretschneideri]
Length=349

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 99/147 (67%), Gaps = 3/147 (2%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS N+L D + NA+L D GLA+   D+  ++ S P AGT+GY+DP Y TP  LS
Sbjct  135  VIHRDIKSENILFDSDWNAKLADLGLAVLF-DSPSQV-SPPAAGTIGYMDPCYTTPSKLS  192

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKD-PL  357
            TK DVFSFG++LLEIIS RK IDV+ SP SIVDWA+ LI   ++  I D RI  P D   
Sbjct  193  TKNDVFSFGVVLLEIISCRKVIDVSKSPASIVDWAVALIEEERIDEICDARIGLPMDMSS  252

Query  358  VRKQLAVVAAKCVRSCRERRPSMKEIV  438
              + +  VAA CV S  + RP++ EIV
Sbjct  253  TIRHILYVAASCVSSNVDNRPTIGEIV  279



>ref|XP_006288105.1| hypothetical protein CARUB_v10001338mg [Capsella rubella]
 gb|EOA21003.1| hypothetical protein CARUB_v10001338mg [Capsella rubella]
Length=344

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 105/164 (64%), Gaps = 10/164 (6%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS N+L   N  A+L DFGLA+       R     PAGT+GYLDP Y +P+NLS
Sbjct  153  VIHRDIKSENILFGSNWEAKLADFGLAVDMAGEKAR---PAPAGTIGYLDPCYTSPENLS  209

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPL-  357
            TKTDV+S+G++LLEI+S RKAIDV+ SP S+VDWA+PLI+ G++  +         D   
Sbjct  210  TKTDVYSYGVVLLEIVSCRKAIDVSRSPSSVVDWAVPLIKEGRIGEVCGGGG-GGSDVFR  268

Query  358  -VRKQLAVVAAKCVRSCRERRPSMK----EIVECLGELSKVVPL  474
             +  +L  +AA+CV S  E RP  +    EIV C+ E  K +PL
Sbjct  269  GMNLRLLRMAARCVSSDVESRPCFREITAEIVACMAEPLKSLPL  312



>ref|XP_008813100.1| PREDICTED: serine/threonine-protein kinase-like protein At5g23170 
[Phoenix dactylifera]
Length=352

 Score =   141 bits (356),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 106/163 (65%), Gaps = 7/163 (4%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            +IHRDIKSAN+LIDRN NARL DF LA+R  D+     ST PAGT+GYLDP Y     L 
Sbjct  136  IIHRDIKSANILIDRNWNARLADFSLAVR-DDSSQSPVSTVPAGTIGYLDPCYTESGQLG  194

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
             K+DVFSFG++LLE+IS RK +D+   P SI+ WA+P+I   ++  + D R+  P D ++
Sbjct  195  PKSDVFSFGVVLLELISSRKVMDMDGDPSSIIAWAVPMIGSRRVAEVCDRRVALP-DGML  253

Query  361  R--KQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSW  483
            R   ++  +A +CV    ERRP M E+V   GEL +VV    W
Sbjct  254  RPIDRMLSIAVRCVSENVERRPLMGEVV---GELQRVVEGIWW  293



>ref|XP_001770558.1| predicted protein [Physcomitrella patens]
 gb|EDQ64727.1| predicted protein [Physcomitrella patens]
Length=325

 Score =   140 bits (354),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 110/180 (61%), Gaps = 19/180 (11%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDND-----FRLRSTPPAGT----------  135
            +IH +I+S NV ID++ NARLGDFGLA   Q+++       L S P   T          
Sbjct  146  IIHCNIRSNNVFIDKDWNARLGDFGLARYVQESEPPLKPRNLSSIPEVDTEEGASQFFTS  205

Query  136  --MGYLDPGYITPDNLSTKTDVFSFGILLLEIISGRKAI--DVAYSPPSIVDWAIPLIRR  303
              +  +D      +++STKTDVFSFG+LLLEI+SGR A+  D  ++P S++ WA+P I+ 
Sbjct  206  LMVSNVDLERENLNHISTKTDVFSFGMLLLEIMSGRSAVSMDSDFTPFSLLHWALPFIKH  265

Query  304  GKLMAIFDPRIHPPKDPLVRKQLAVVAAKCVRSCRERRPSMKEIVECLGELSKVVPLHSW  483
            G  +AI D R+ PP+   V KQL  +AA+CVR+   RRPSM EIV  L  + K++PL  W
Sbjct  266  GNAIAICDTRLKPPQVTAVVKQLGTIAARCVRASGSRRPSMDEIVHGLANVCKLLPLPMW  325



>ref|XP_006290261.1| hypothetical protein CARUB_v10016669mg [Capsella rubella]
 gb|EOA23159.1| hypothetical protein CARUB_v10016669mg [Capsella rubella]
Length=896

 Score =   145 bits (367),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 100/149 (67%), Gaps = 0/149 (0%)
 Frame = +1

Query  1    VIHRDIKSANVLIDRNLNARLGDFGLALRCQDNDFRLRSTPPAGTMGYLDPGYITPDNLS  180
            VIHRDIKS+N+LID   NAR+ DFGL+L    +     +  PAGT+GYLDP Y     L+
Sbjct  638  VIHRDIKSSNILIDEEHNARVADFGLSLLGPVDSGSPLAELPAGTLGYLDPEYYRLHYLT  697

Query  181  TKTDVFSFGILLLEIISGRKAIDVAYSPPSIVDWAIPLIRRGKLMAIFDPRIHPPKDPLV  360
            TK+DV+SFG+LLLEI+SGRKAID+ Y   +IV+WA+ LI+ G + A+ DP +  P +   
Sbjct  698  TKSDVYSFGVLLLEILSGRKAIDMHYEEGNIVEWAVSLIKAGDINALLDPVLKHPSEIEA  757

Query  361  RKQLAVVAAKCVRSCRERRPSMKEIVECL  447
             K++  VA KCVR   + RPSM ++   L
Sbjct  758  LKRIVSVACKCVRMRGKDRPSMDKVTTAL  786



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2193756387154