BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16473_g1_i1 len=586 path=[886:0-362 144:363-585]

Length=586
                                                                      Score     E

ref|XP_006429592.1|  hypothetical protein CICLE_v10013263mg           53.9    9e-07   
ref|XP_007033520.1|  Uncharacterized protein isoform 3                49.7    3e-05   
ref|XP_007033518.1|  Uncharacterized protein isoform 1                49.7    4e-05   
ref|XP_007033519.1|  Uncharacterized protein isoform 2                49.3    5e-05   



>ref|XP_006429592.1| hypothetical protein CICLE_v10013263mg [Citrus clementina]
 gb|ESR42832.1| hypothetical protein CICLE_v10013263mg [Citrus clementina]
 gb|KDO64110.1| hypothetical protein CISIN_1g035097mg [Citrus sinensis]
Length=73

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -1

Query  307  DDPFLACCCCPCMMVSSLFSVFQRCLMFVCYPFLSCLG  194
            DDPFL CCCCPC MVSS+F+  +RC+   CYP L C G
Sbjct  20   DDPFLRCCCCPCFMVSSIFTGIRRCIFVACYPLLRCFG  57



>ref|XP_007033520.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
 gb|EOY04446.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
Length=62

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  307  DDPFLACCCCPCMMVSSLFSVFQRCLMFVCYPFLSCLG  194
            DDPFL CCCCPC ++SS+F    RC+   CYP L C G
Sbjct  8    DDPFLRCCCCPCFIMSSIFRGLGRCIFVACYPVLHCFG  45



>ref|XP_007033518.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY04444.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=71

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  307  DDPFLACCCCPCMMVSSLFSVFQRCLMFVCYPFLSCLG  194
            DDPFL CCCCPC ++SS+F    RC+   CYP L C G
Sbjct  18   DDPFLRCCCCPCFIMSSIFRGLGRCIFVACYPVLHCFG  55



>ref|XP_007033519.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY04445.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=72

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -1

Query  307  DDPFLACCCCPCMMVSSLFSVFQRCLMFVCYPFLSCLG  194
            DDPFL CCCCPC ++SS+F    RC+   CYP L C G
Sbjct  18   DDPFLRCCCCPCFIMSSIFRGLGRCIFVACYPVLHCFG  55



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 679482509436