BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16468_g1_i1 len=284 path=[279:0-283]

Length=284
                                                                      Score     E

gb|AAG10403.1|AF233284_1  mannose-binding lectin                        107   3e-27   Convolvulus arvensis
gb|AAC49564.1|  lectin                                                  100   4e-24   Calystegia sepium
pdb|1OUW|A  Chain A, Crystal Structure Of Calystegia Sepium Agglu...    100   4e-24   
dbj|BAA14024.1|  ipomoelin                                            98.2    2e-23   Ipomoea batatas [batate]
pdb|3R50|A  Chain A, Structure Analysis Of A Wound-Inducible Lect...  98.2    3e-23   
gb|EEC68267.1|  hypothetical protein OsI_36302                        90.1    2e-18   Oryza sativa Indica Group [Indian rice]
gb|ABA93998.1|  NB-ARC domain containing protein, expressed           88.6    9e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004168675.1|  PREDICTED: pentatricopeptide repeat-containi...  87.8    1e-17   
gb|EEE52195.1|  hypothetical protein OsJ_34074                        87.4    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004152769.1|  PREDICTED: pentatricopeptide repeat-containi...  86.3    5e-17   
ref|XP_006663483.1|  PREDICTED: probable disease resistance RPP8-...  84.3    2e-16   
gb|EMT18893.1|  Disease resistance protein RPM1                       83.2    4e-16   
gb|KGN62634.1|  hypothetical protein Csa_2G362470                     82.8    4e-16   
ref|XP_008444758.1|  PREDICTED: LOW QUALITY PROTEIN: myrosinase-b...  82.4    5e-16   
gb|ACF87628.1|  unknown                                               77.8    6e-16   Zea mays [maize]
gb|EEC68269.1|  hypothetical protein OsI_36304                        82.8    7e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_004298563.1|  PREDICTED: myrosinase-binding protein-like A...  80.5    1e-15   
ref|NP_001106057.1|  PL3K2                                            77.8    1e-15   Zea mays [maize]
gb|EEE52196.1|  hypothetical protein OsJ_34075                        82.4    1e-15   Oryza sativa Japonica Group [Japonica rice]
gb|ABA94002.1|  Jacalin-like lectin domain containing protein, ex...  82.0    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066367.1|  Os12g0198700                                     79.3    1e-15   Oryza sativa Japonica Group [Japonica rice]
gb|ACG29554.1|  hypothetical protein                                  77.4    1e-15   Zea mays [maize]
ref|XP_006663484.1|  PREDICTED: putative disease resistance RPP13...  81.6    2e-15   
gb|AAA87042.1|  putative 32.7 kDa jasmonate-induced protein           78.2    3e-15   Hordeum vulgare [barley]
gb|EAY82651.1|  hypothetical protein OsI_37872                        77.8    4e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001066495.1|  Os12g0247700                                     77.8    4e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EEC69076.1|  hypothetical protein OsI_37951                        77.4    4e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_008677998.1|  PREDICTED: mannose/glucose-specific lectin-l...  79.7    6e-15   
ref|XP_008677990.1|  PREDICTED: mannose/glucose-specific lectin-l...  79.7    6e-15   
ref|XP_008677986.1|  PREDICTED: mannose/glucose-specific lectin-l...  79.7    6e-15   
ref|XP_008677991.1|  PREDICTED: mannose/glucose-specific lectin-l...  79.7    6e-15   
ref|XP_008677994.1|  PREDICTED: mannose/glucose-specific lectin-l...  79.7    6e-15   
ref|XP_010273654.1|  PREDICTED: mannose/glucose-specific lectin-like  75.5    7e-15   
ref|XP_008677996.1|  PREDICTED: mannose/glucose-specific lectin-l...  79.7    7e-15   
ref|XP_008677992.1|  PREDICTED: mannose/glucose-specific lectin-l...  79.7    7e-15   
gb|EMT23136.1|  hypothetical protein F775_18655                       74.7    1e-14   
gb|EMS66150.1|  hypothetical protein TRIUR3_12251                     76.6    1e-14   
ref|XP_006647196.1|  PREDICTED: disease resistance protein RPM1-l...  77.8    4e-14   
ref|XP_006647195.1|  PREDICTED: disease resistance protein RPM1-l...  77.8    4e-14   
gb|EMT07650.1|  Horcolin                                              75.1    4e-14   
gb|EMT11070.1|  hypothetical protein F775_02114                       75.1    5e-14   
gb|AFW60405.1|  putative protein kinase superfamily protein           77.0    5e-14   
ref|XP_002440163.1|  hypothetical protein SORBIDRAFT_09g027055        73.9    6e-14   Sorghum bicolor [broomcorn]
gb|AAA87041.1|  putative 32.6 kDa jasmonate-induced protein           73.9    9e-14   Hordeum vulgare [barley]
ref|XP_004982894.1|  PREDICTED: salt stress-induced protein-like      72.0    2e-13   
ref|XP_004980504.1|  PREDICTED: protein GOS9-like                     71.2    2e-13   
ref|XP_006662244.1|  PREDICTED: uncharacterized protein LOC102708001  73.2    3e-13   
gb|EEE60695.1|  hypothetical protein OsJ_14181                        70.1    3e-13   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009589464.1|  PREDICTED: agglutinin-like                       73.2    4e-13   
ref|XP_009763450.1|  PREDICTED: putative late blight resistance p...  75.1    4e-13   
ref|XP_009772163.1|  PREDICTED: putative late blight resistance p...  74.7    4e-13   
ref|XP_009772162.1|  PREDICTED: putative late blight resistance p...  74.7    4e-13   
ref|XP_009772161.1|  PREDICTED: putative late blight resistance p...  74.7    4e-13   
ref|XP_009763421.1|  PREDICTED: putative late blight resistance p...  74.7    4e-13   
emb|CDM80625.1|  unnamed protein product                              72.4    5e-13   
sp|Q5U9T2.1|LECH_HORVU  RecName: Full=Horcolin; AltName: Full=Agg...  70.5    5e-13   Hordeum vulgare [barley]
gb|EMS55842.1|  hypothetical protein TRIUR3_32339                     72.0    5e-13   
gb|EMT24046.1|  hypothetical protein F775_25349                       72.0    5e-13   
gb|AAR20919.1|  jasmonate-induced protein                             72.0    6e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004297619.1|  PREDICTED: agglutinin-like                       72.0    6e-13   
gb|ABS82785.1|  jasmonate-induced protein                             71.6    6e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009769147.1|  PREDICTED: putative late blight resistance p...  73.9    8e-13   
ref|XP_004291831.1|  PREDICTED: uncharacterized protein LOC101310192  73.6    8e-13   
ref|XP_002449838.1|  hypothetical protein SORBIDRAFT_05g024220        70.9    1e-12   Sorghum bicolor [broomcorn]
ref|XP_009614996.1|  PREDICTED: putative late blight resistance p...  73.6    1e-12   
ref|XP_009614994.1|  PREDICTED: putative late blight resistance p...  73.6    1e-12   
ref|XP_009614993.1|  PREDICTED: putative late blight resistance p...  73.6    1e-12   
ref|XP_009614991.1|  PREDICTED: putative late blight resistance p...  73.6    1e-12   
ref|XP_003573652.1|  PREDICTED: horcolin-like                         68.6    1e-12   
ref|NP_001052399.1|  Os04g0295400                                     69.7    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008804538.1|  PREDICTED: uncharacterized protein LOC103717797  72.4    2e-12   
gb|EAY93469.1|  hypothetical protein OsI_15270                        68.9    2e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_009784520.1|  PREDICTED: uncharacterized protein LOC104232941  72.8    2e-12   
ref|XP_009768641.1|  PREDICTED: putative late blight resistance p...  72.8    2e-12   
gb|EAZ01021.1|  hypothetical protein OsI_23055                        72.4    2e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_009768640.1|  PREDICTED: putative late blight resistance p...  72.8    2e-12   
ref|XP_009768636.1|  PREDICTED: putative late blight resistance p...  72.8    2e-12   
ref|XP_009768586.1|  PREDICTED: jacalin-related lectin 3-like         69.7    2e-12   
gb|EAY80990.1|  hypothetical protein OsI_36172                        72.4    3e-12   Oryza sativa Indica Group [Indian rice]
ref|XP_006663456.1|  PREDICTED: disease resistance protein RPM1-like  72.0    4e-12   
ref|XP_008244775.1|  PREDICTED: LOW QUALITY PROTEIN: agglutinin-like  70.1    4e-12   
ref|XP_010230396.1|  PREDICTED: jacalin-related lectin 3-like         68.6    5e-12   
gb|EEC72970.1|  hypothetical protein OsI_06866                        71.6    5e-12   Oryza sativa Indica Group [Indian rice]
dbj|BAD23250.1|  putative LZ-NBS-LRR class RGA                        71.6    5e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009795366.1|  PREDICTED: putative late blight resistance p...  71.6    5e-12   
emb|CDP17400.1|  unnamed protein product                              69.3    7e-12   
gb|EEE52450.1|  hypothetical protein OsJ_34606                        69.7    7e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009338132.1|  PREDICTED: uncharacterized protein LOC103930...  70.9    8e-12   
ref|XP_006853911.1|  hypothetical protein AMTR_s00036p00183970        67.0    8e-12   
ref|XP_010232946.1|  PREDICTED: uncharacterized protein LOC104583002  68.2    9e-12   
ref|NP_001148739.1|  LOC100282355                                     67.8    1e-11   Zea mays [maize]
ref|NP_001148448.1|  jasmonate-induced protein                        67.4    1e-11   Zea mays [maize]
ref|XP_008677993.1|  PREDICTED: mannose/glucose-specific lectin-l...  70.5    1e-11   
ref|XP_008654965.1|  PREDICTED: LOC100282355 isoform X4               67.4    1e-11   
ref|XP_006662272.1|  PREDICTED: uncharacterized protein LOC102701759  68.2    1e-11   
ref|XP_004964114.1|  PREDICTED: mannose/glucose-specific lectin-like  66.2    1e-11   
ref|XP_006343016.1|  PREDICTED: agglutinin-like                       67.4    1e-11   
ref|XP_004235622.1|  PREDICTED: jacalin-related lectin 19             67.4    1e-11   
ref|XP_008677995.1|  PREDICTED: mannose/glucose-specific lectin-l...  70.1    1e-11   
ref|XP_010232948.1|  PREDICTED: jacalin-related lectin 19-like        67.8    1e-11   
ref|XP_009608039.1|  PREDICTED: putative late blight resistance p...  70.5    1e-11   
ref|XP_009608038.1|  PREDICTED: putative late blight resistance p...  70.5    1e-11   
ref|XP_009608035.1|  PREDICTED: putative late blight resistance p...  70.5    1e-11   
gb|EMT07330.1|  Disease resistance protein RPM1                       70.5    1e-11   
ref|XP_004960703.1|  PREDICTED: agglutinin-like                       68.6    1e-11   
gb|EMS51533.1|  hypothetical protein TRIUR3_05238                     68.2    1e-11   
ref|XP_002440568.1|  hypothetical protein SORBIDRAFT_09g003330        66.2    1e-11   Sorghum bicolor [broomcorn]
gb|EAY96520.1|  hypothetical protein OsI_18424                        66.6    2e-11   Oryza sativa Indica Group [Indian rice]
gb|EMS58273.1|  hypothetical protein TRIUR3_17900                     67.8    2e-11   
ref|NP_001054618.1|  Os05g0143600                                     66.2    2e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009622525.1|  PREDICTED: agglutinin-like isoform X2            69.3    2e-11   
gb|AHW81907.1|  mannose-binding lectin                                66.2    2e-11   
ref|XP_009622524.1|  PREDICTED: mannose/glucose-specific lectin-l...  69.3    2e-11   
ref|XP_008348486.1|  PREDICTED: agglutinin alpha chain-like           66.6    2e-11   
dbj|BAK00987.1|  predicted protein                                    67.4    2e-11   
gb|ABA94728.1|  Jacalin-like lectin domain containing protein         69.3    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002439182.1|  hypothetical protein SORBIDRAFT_09g001880        67.4    3e-11   Sorghum bicolor [broomcorn]
gb|EEE68468.1|  hypothetical protein OsJ_26865                        68.6    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009588771.1|  PREDICTED: agglutinin-like                       67.8    3e-11   
gb|EAZ25557.1|  hypothetical protein OsJ_09383                        65.5    3e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010935305.1|  PREDICTED: jacalin-related lectin 3-like         68.6    3e-11   
ref|XP_006301377.1|  hypothetical protein CARUB_v10021789mg           65.9    3e-11   
ref|XP_002450764.1|  hypothetical protein SORBIDRAFT_05g017250        69.3    3e-11   Sorghum bicolor [broomcorn]
ref|XP_004960459.1|  PREDICTED: salt stress-induced protein-like      65.5    3e-11   
gb|AAL10685.1|  mannose-binding lectin                                65.9    4e-11   Morus nigra
ref|XP_004979671.1|  PREDICTED: mannose/glucose-specific lectin-l...  68.9    4e-11   
ref|XP_004979669.1|  PREDICTED: mannose/glucose-specific lectin-l...  68.9    4e-11   
ref|XP_007215056.1|  hypothetical protein PRUPE_ppa012210mg           65.5    4e-11   
ref|NP_001140746.1|  hypothetical protein                             68.6    4e-11   Zea mays [maize]
ref|XP_004979670.1|  PREDICTED: mannose/glucose-specific lectin-l...  68.6    4e-11   
gb|AAM46813.1|  hessian fly response gene 1 protein                   67.4    5e-11   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006372713.1|  hypothetical protein POPTR_0017s043602g          65.5    5e-11   
ref|XP_002440040.1|  hypothetical protein SORBIDRAFT_09g024950        68.2    5e-11   Sorghum bicolor [broomcorn]
ref|XP_006853909.1|  hypothetical protein AMTR_s00036p00182710        65.5    5e-11   
emb|CAD40628.2|  OSJNBa0016N04.16                                     67.8    5e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008244753.1|  PREDICTED: agglutinin-like                       65.5    5e-11   
ref|XP_004961574.1|  PREDICTED: mannose/glucose-specific lectin-like  68.2    6e-11   
ref|XP_003615697.1|  Myrosinase-binding protein-like protein          68.2    6e-11   
ref|XP_006390600.1|  hypothetical protein EUTSA_v10019210mg           65.1    6e-11   
ref|XP_010092355.1|  hypothetical protein L484_023733                 65.1    7e-11   
ref|XP_004984089.1|  PREDICTED: protein GOS9-like                     64.7    7e-11   
gb|KDO84683.1|  hypothetical protein CISIN_1g007083mg                 67.8    7e-11   
ref|NP_001052560.1|  Os04g0369100                                     68.2    7e-11   Oryza sativa Japonica Group [Japonica rice]
pdb|1XXQ|A  Chain A, Structure Of A Mannose-Specific Jacalin-Rela...  64.7    7e-11   
ref|XP_008806712.1|  PREDICTED: agglutinin-like isoform X2            65.1    8e-11   
ref|XP_008806706.1|  PREDICTED: agglutinin-like isoform X1            65.1    8e-11   
gb|EEE60834.1|  hypothetical protein OsJ_14451                        67.8    9e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011030089.1|  PREDICTED: jacalin-related lectin 19             64.7    9e-11   
ref|XP_009400545.1|  PREDICTED: agglutinin alpha chain                64.7    9e-11   
ref|XP_006654724.1|  PREDICTED: agglutinin-like                       64.7    9e-11   
tpg|DAA60181.1|  TPA: hypothetical protein ZEAMMB73_326702            65.9    9e-11   
gb|KDO84682.1|  hypothetical protein CISIN_1g007083mg                 67.4    1e-10   
ref|XP_008654961.1|  PREDICTED: LOC100282355 isoform X1               64.7    1e-10   
gb|EAY90359.1|  hypothetical protein OsI_11939                        64.3    1e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_004974871.1|  PREDICTED: mannose/glucose-specific lectin-like  64.7    1e-10   
ref|XP_008654963.1|  PREDICTED: LOC100282355 isoform X3               64.7    1e-10   
gb|KDP38344.1|  hypothetical protein JCGZ_04269                       67.0    1e-10   
ref|XP_009391787.1|  PREDICTED: agglutinin-like                       65.1    1e-10   
ref|XP_008654962.1|  PREDICTED: LOC100282355 isoform X2               64.7    1e-10   
ref|NP_177447.1|  Mannose-binding lectin superfamily protein          64.3    1e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006654618.1|  PREDICTED: myrosinase-binding protein-like A...  67.0    1e-10   
ref|XP_003577374.2|  PREDICTED: mannose/glucose-specific lectin-l...  67.0    1e-10   
ref|XP_008651439.1|  PREDICTED: jasmonate-induced protein isoform X1  65.5    1e-10   
ref|XP_010459648.1|  PREDICTED: jacalin-related lectin 3 isoform X1   67.0    1e-10   
gb|AFW81812.1|  putative protein kinase superfamily protein           66.6    1e-10   
gb|ABF96452.1|  Jacalin-like lectin domain containing protein, ex...  64.3    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001141303.1|  uncharacterized protein LOC100273394             65.5    1e-10   Zea mays [maize]
ref|XP_002300741.2|  hypothetical protein POPTR_0002s03180g           67.0    1e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006651478.1|  PREDICTED: horcolin-like                         63.9    1e-10   
ref|XP_002515891.1|  hypothetical protein RCOM_1485780                66.6    1e-10   Ricinus communis
ref|XP_010477194.1|  PREDICTED: jacalin-related lectin 3-like iso...  67.0    2e-10   
gb|KHG26998.1|  Agglutinin                                            67.0    2e-10   
ref|XP_010237569.1|  PREDICTED: mannose/glucose-specific lectin-l...  67.0    2e-10   
ref|XP_006838705.1|  hypothetical protein AMTR_s00002p00249920        67.0    2e-10   
gb|EMS53468.1|  hypothetical protein TRIUR3_21407                     63.5    2e-10   
ref|XP_004298564.1|  PREDICTED: uncharacterized protein LOC101299670  67.0    2e-10   
ref|XP_004986922.1|  PREDICTED: horcolin-like                         63.5    2e-10   
ref|XP_010471351.1|  PREDICTED: jacalin-related lectin 19             63.9    2e-10   
ref|XP_010690084.1|  PREDICTED: jacalin-related lectin 19             63.9    2e-10   
ref|NP_001050311.2|  Os03g0399800                                     64.3    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AAK55472.1|AC084295_5  putative salt-induced protein               63.9    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010477195.1|  PREDICTED: jacalin-related lectin 3-like iso...  66.6    2e-10   
ref|XP_006473571.1|  PREDICTED: pentatricopeptide repeat-containi...  66.6    2e-10   
ref|XP_006435072.1|  hypothetical protein CICLE_v10000604mg           66.6    2e-10   
ref|XP_009599288.1|  PREDICTED: jacalin-related lectin 3 isoform X1   66.6    2e-10   
ref|XP_009599289.1|  PREDICTED: jacalin-related lectin 3 isoform X2   66.6    2e-10   
ref|XP_007216928.1|  hypothetical protein PRUPE_ppa016643mg           65.5    2e-10   
ref|XP_008656248.1|  PREDICTED: putative receptor-like protein ki...  66.2    2e-10   
gb|EAY98637.1|  hypothetical protein OsI_20561                        66.6    2e-10   Oryza sativa Indica Group [Indian rice]
ref|NP_001055995.1|  Os05g0508400                                     66.6    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006473572.1|  PREDICTED: pentatricopeptide repeat-containi...  67.0    2e-10   
ref|XP_010236764.1|  PREDICTED: jacalin-related lectin 19-like        63.5    2e-10   
gb|EEE64302.1|  hypothetical protein OsJ_19139                        66.6    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009763456.1|  PREDICTED: putative late blight resistance p...  67.0    2e-10   
ref|XP_008466548.1|  PREDICTED: agglutinin-like                       65.9    2e-10   
gb|KHN46147.1|  Agglutinin                                            66.2    2e-10   
ref|XP_010664949.1|  PREDICTED: pentatricopeptide repeat-containi...  66.6    3e-10   
ref|XP_009763443.1|  PREDICTED: putative late blight resistance p...  66.6    3e-10   
gb|ABA94732.1|  Jacalin-like lectin domain containing protein, ex...  66.2    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006372325.1|  Mannose/glucose-specific lectin family protein   65.9    3e-10   
ref|XP_010088386.1|  hypothetical protein L484_008121                 63.5    3e-10   
ref|NP_001044410.1|  Os01g0775500                                     65.1    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002510452.1|  pentatricopeptide repeat-containing protein,...  66.6    3e-10   Ricinus communis
ref|XP_011081586.1|  PREDICTED: jacalin-related lectin 19-like        64.7    3e-10   
ref|XP_010533565.1|  PREDICTED: jacalin-related lectin 3 isoform X1   65.9    3e-10   
ref|XP_002318228.2|  hypothetical protein POPTR_0012s13320g           63.5    3e-10   Populus trichocarpa [western balsam poplar]
ref|XP_009367509.1|  PREDICTED: agglutinin alpha chain                63.2    3e-10   
ref|NP_001068257.2|  Os11g0607900                                     62.4    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010533571.1|  PREDICTED: jacalin-related lectin 3 isoform X2   65.9    3e-10   
ref|XP_009398855.1|  PREDICTED: protein GOS9-like                     62.8    3e-10   
ref|XP_007222058.1|  hypothetical protein PRUPE_ppa003185mg           65.9    3e-10   
ref|XP_010092351.1|  hypothetical protein L484_023729                 63.2    3e-10   
ref|NP_001104964.1|  beta-glucosidase aggregating factor precursor    64.7    3e-10   Zea mays [maize]
ref|XP_008348484.1|  PREDICTED: agglutinin-like isoform X2            63.2    3e-10   
ref|XP_008221341.1|  PREDICTED: uncharacterized protein LOC103321320  65.9    3e-10   
ref|XP_008348483.1|  PREDICTED: agglutinin-like isoform X1            63.2    3e-10   
gb|ABJ97445.1|  beta-glucosidase aggregating factor 1                 64.3    3e-10   Zea mays [maize]
emb|CAE76026.1|  B1292H11.12                                          63.2    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002467725.1|  hypothetical protein SORBIDRAFT_01g033090        62.8    4e-10   Sorghum bicolor [broomcorn]
ref|XP_006853910.1|  hypothetical protein AMTR_s00036p00183430        63.2    4e-10   
ref|XP_002888904.1|  predicted protein                                63.2    4e-10   
gb|AAQ07258.1|  jacalin-like lectin                                   62.8    4e-10   Ananas comosus
ref|XP_006306414.1|  hypothetical protein CARUB_v10012347mg           66.2    4e-10   
gb|KCW56701.1|  hypothetical protein EUGRSUZ_I02393                   65.5    4e-10   
gb|AAZ73669.1|  At1g19715-like protein                                62.8    4e-10   Arabidopsis lyrata [lyrate rockcress]
gb|KDO58671.1|  hypothetical protein CISIN_1g037526mg                 63.2    4e-10   
ref|XP_011001797.1|  PREDICTED: mannose/glucose-specific lectin-l...  65.5    4e-10   
ref|XP_002461768.1|  hypothetical protein SORBIDRAFT_02g007760        64.7    4e-10   Sorghum bicolor [broomcorn]
ref|XP_009760249.1|  PREDICTED: agglutinin-like                       64.7    4e-10   
ref|XP_006426466.1|  hypothetical protein CICLE_v10026553mg           63.2    4e-10   
ref|XP_011001798.1|  PREDICTED: mannose/glucose-specific lectin-l...  65.1    4e-10   
ref|XP_009770862.1|  PREDICTED: putative late blight resistance p...  66.2    4e-10   
gb|EMS65495.1|  hypothetical protein TRIUR3_18396                     65.1    4e-10   
gb|ADE77248.1|  unknown                                               62.8    4e-10   
ref|XP_010498396.1|  PREDICTED: pentatricopeptide repeat-containi...  65.9    5e-10   
ref|XP_009771019.1|  PREDICTED: jacalin-related lectin 3 isoform X1   65.5    5e-10   
ref|XP_009771020.1|  PREDICTED: jacalin-related lectin 3 isoform X2   65.5    5e-10   
dbj|BAJ88436.1|  predicted protein                                    65.5    5e-10   
ref|XP_009622527.1|  PREDICTED: agglutinin-like isoform X4            65.1    5e-10   
ref|XP_010267066.1|  PREDICTED: jacalin-related lectin 19             62.8    5e-10   
ref|XP_011015046.1|  PREDICTED: mannose/glucose-specific lectin-l...  65.1    5e-10   
ref|XP_010029744.1|  PREDICTED: jacalin-related lectin 4-like         65.9    5e-10   
dbj|BAJ85606.1|  predicted protein                                    65.5    5e-10   
ref|XP_006362248.1|  PREDICTED: myrosinase-binding protein-like A...  65.5    5e-10   
ref|XP_009127966.1|  PREDICTED: agglutinin                            62.4    5e-10   
ref|XP_011001796.1|  PREDICTED: mannose/glucose-specific lectin-l...  65.1    5e-10   
ref|XP_009622528.1|  PREDICTED: agglutinin-like isoform X5            65.1    6e-10   
ref|XP_011028924.1|  PREDICTED: uncharacterized protein LOC105128...  65.9    6e-10   
gb|EMT07336.1|  hypothetical protein F775_29709                       64.3    6e-10   
gb|AAZ73661.1|  At1g19715                                             62.4    6e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006362247.1|  PREDICTED: myrosinase-binding protein-like A...  65.5    6e-10   
ref|XP_008391447.1|  PREDICTED: uncharacterized protein LOC103453663  64.3    6e-10   
gb|ABA94721.1|  Jacalin-like lectin domain containing protein         65.1    6e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EEE55471.1|  hypothetical protein OsJ_03649                        65.5    6e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009622526.1|  PREDICTED: agglutinin-like isoform X3            65.1    6e-10   
ref|XP_010537548.1|  PREDICTED: LOW QUALITY PROTEIN: jacalin-rela...  62.4    6e-10   
gb|EEC71570.1|  hypothetical protein OsI_03937                        65.5    7e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010060992.1|  PREDICTED: jacalin-related lectin 3              65.1    7e-10   
gb|KCW69704.1|  hypothetical protein EUGRSUZ_F03098                   62.8    7e-10   
ref|XP_004960702.1|  PREDICTED: mannose/glucose-specific lectin-like  63.5    7e-10   
ref|XP_004249154.1|  PREDICTED: jacalin-related lectin 3 isoform X2   65.1    7e-10   
ref|XP_011074623.1|  PREDICTED: jacalin-related lectin 3              65.1    7e-10   
ref|XP_010312054.1|  PREDICTED: jacalin-related lectin 3 isoform X1   65.1    7e-10   
gb|AAZ73652.1|  At1g19715                                             62.0    7e-10   Arabidopsis thaliana [mouse-ear cress]
emb|CDO97947.1|  unnamed protein product                              63.2    8e-10   
ref|XP_010100192.1|  hypothetical protein L484_015337                 62.0    8e-10   
ref|XP_011028923.1|  PREDICTED: jacalin-related lectin 3-like iso...  65.1    8e-10   
ref|XP_006644795.1|  PREDICTED: mannose/glucose-specific lectin-like  64.7    8e-10   
gb|AFW74546.1|  hypothetical protein ZEAMMB73_667809                  62.0    8e-10   
ref|XP_011015045.1|  PREDICTED: mannose/glucose-specific lectin-l...  64.7    8e-10   
gb|AAZ73664.1|  At1g19715                                             62.0    8e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008648490.1|  PREDICTED: salt stress-induced protein-like      61.6    8e-10   
ref|XP_009608047.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  65.5    8e-10   
gb|KDP38566.1|  hypothetical protein JCGZ_04491                       64.7    8e-10   
ref|XP_010428208.1|  PREDICTED: jacalin-related lectin 19-like is...  62.0    9e-10   
ref|XP_010030255.1|  PREDICTED: agglutinin-like                       63.9    9e-10   
ref|NP_001056189.1|  Os05g0541800                                     61.6    9e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004490606.1|  PREDICTED: mannose/glucose-specific lectin-l...  64.7    1e-09   
ref|XP_010233169.1|  PREDICTED: jacalin-related lectin 3-like         65.1    1e-09   
ref|NP_001176790.1|  Os12g0144100                                     60.5    1e-09   
ref|XP_004490607.1|  PREDICTED: mannose/glucose-specific lectin-l...  64.3    1e-09   
emb|CDX96652.1|  BnaA08g21950D                                        64.3    1e-09   
ref|XP_004961357.1|  PREDICTED: agglutinin-like                       62.0    1e-09   
gb|AAB72098.1|  32 kDa protein                                        63.2    1e-09   
ref|XP_009110261.1|  PREDICTED: agglutinin-like                       64.3    1e-09   
ref|XP_007146775.1|  hypothetical protein PHAVU_006G068800g           64.3    1e-09   
ref|XP_010477196.1|  PREDICTED: pentatricopeptide repeat-containi...  64.7    1e-09   
ref|XP_010428207.1|  PREDICTED: jacalin-related lectin 19-like is...  61.6    1e-09   
emb|CDY63700.1|  BnaC08g19180D                                        64.3    1e-09   
ref|XP_010924945.1|  PREDICTED: jacalin-related lectin 19-like is...  61.6    1e-09   
ref|XP_007142198.1|  hypothetical protein PHAVU_008G260500g           63.9    1e-09   
gb|KFK41744.1|  hypothetical protein AALP_AA2G166700                  61.6    1e-09   
emb|CDY48032.1|  BnaA02g16250D                                        62.0    1e-09   
ref|XP_010428206.1|  PREDICTED: jacalin-related lectin 19-like is...  61.6    1e-09   
ref|XP_010924946.1|  PREDICTED: jacalin-related lectin 19-like is...  61.6    1e-09   
ref|XP_007142199.1|  hypothetical protein PHAVU_008G260500g           63.9    1e-09   
ref|XP_002510454.1|  hypothetical protein RCOM_1595950                63.9    1e-09   
ref|XP_010062570.1|  PREDICTED: jacalin-related lectin 19             62.4    1e-09   
emb|CBI19765.3|  unnamed protein product                              63.9    2e-09   
gb|EYU45843.1|  hypothetical protein MIMGU_mgv1a014002mg              61.2    2e-09   
gb|ABC70328.1|  agglutinin isoform                                    62.4    2e-09   
ref|XP_004164005.1|  PREDICTED: agglutinin-like                       60.8    2e-09   
sp|P82859.1|LECA_CASCR  RecName: Full=Agglutinin; AltName: Full=CCA   62.4    2e-09   
ref|XP_006416472.1|  hypothetical protein EUTSA_v10007145mg           63.5    2e-09   
gb|EMT33809.1|  hypothetical protein F775_16156                       60.8    2e-09   
ref|XP_010654564.1|  PREDICTED: jacalin-related lectin 19-like        60.8    2e-09   
ref|XP_004977415.1|  PREDICTED: uncharacterized protein LOC101784...  62.0    2e-09   
gb|KCW69706.1|  hypothetical protein EUGRSUZ_F03098                   61.2    2e-09   
gb|KDP38565.1|  hypothetical protein JCGZ_04490                       63.5    2e-09   
ref|XP_003575754.1|  PREDICTED: uncharacterized protein LOC100829827  62.4    3e-09   
gb|EEC79620.1|  hypothetical protein OsI_20824                        60.8    3e-09   
ref|XP_009608045.1|  PREDICTED: putative late blight resistance p...  63.9    3e-09   
ref|XP_009608041.1|  PREDICTED: putative late blight resistance p...  63.9    3e-09   
gb|EEE59214.1|  hypothetical protein OsJ_11170                        62.4    3e-09   
gb|AFW82809.1|  hypothetical protein ZEAMMB73_630227                  60.5    3e-09   
emb|CDX82115.1|  BnaC02g21750D                                        61.2    3e-09   
ref|XP_002467724.1|  hypothetical protein SORBIDRAFT_01g033080        60.5    3e-09   
gb|ABA96465.1|  Protein GOS9, putative                                60.1    3e-09   
emb|CBI35988.3|  unnamed protein product                              60.5    3e-09   
emb|CAJ38387.1|  jacalin-domain protein                               60.5    3e-09   
gb|AGT16242.1|  Jacalin-like lectin domain containing protein         62.8    3e-09   
gb|EEE60415.1|  hypothetical protein OsJ_13609                        59.3    3e-09   
gb|AAB22274.1|  jacalin heavy chain, agglutinin heavy chain=Thoms...  59.7    4e-09   
sp|P83304.1|LEC_PARPC  RecName: Full=Mannose/glucose-specific lectin  62.4    4e-09   
ref|XP_007017646.1|  Mannose-binding lectin superfamily protein, ...  62.8    4e-09   
ref|XP_010110011.1|  hypothetical protein L484_021900                 63.2    4e-09   
pdb|1TOQ|A  Chain A, Crystal Structure Of A Galactose Specific Le...  59.7    4e-09   
pdb|3P8S|A  Chain A, Crystal Structure Of Single Chain Recombinan...  60.1    4e-09   
gb|AGT16237.1|  Jacalin-like lectin domain containing protein         62.4    4e-09   
ref|XP_007024409.1|  Mannose-binding lectin superfamily protein       61.2    4e-09   
emb|CDM80401.1|  unnamed protein product                              60.8    4e-09   
ref|XP_007017648.1|  Mannose-binding lectin superfamily protein, ...  62.8    4e-09   
ref|XP_009602425.1|  PREDICTED: mannose/glucose-specific lectin-like  59.3    4e-09   
gb|KHN02073.1|  Agglutinin                                            62.4    5e-09   
ref|XP_010026053.1|  PREDICTED: jacalin-related lectin 3-like         60.1    6e-09   
ref|XP_006372328.1|  hypothetical protein POPTR_0017s00620g           59.3    6e-09   
gb|KDP40814.1|  hypothetical protein JCGZ_24813                       59.7    6e-09   
gb|KHG23822.1|  Agglutinin alpha chain                                59.3    6e-09   
ref|XP_006602089.1|  PREDICTED: agglutinin-like                       62.0    6e-09   
ref|XP_008671662.1|  PREDICTED: horcolin-like                         59.3    7e-09   
ref|XP_002893063.1|  jacalin lectin family protein                    62.0    7e-09   
ref|XP_004147859.1|  PREDICTED: myrosinase-binding protein-like A...  62.0    7e-09   
gb|EAY92859.1|  hypothetical protein OsI_14658                        59.7    7e-09   
ref|XP_002458583.1|  hypothetical protein SORBIDRAFT_03g036175        60.1    7e-09   
gb|AAY35064.1|  lectin KM+                                            59.3    7e-09   
emb|CAE76030.1|  B1292H11.16                                          58.9    7e-09   
ref|XP_002893064.1|  hypothetical protein ARALYDRAFT_472198           62.4    7e-09   
pdb|1VBP|A  Chain A, Crystal Structure Of Artocarpin-Mannopentose...  59.3    7e-09   
pdb|1VBO|A  Chain A, Crystal Structure Of Artocarpin-Mannotriose ...  59.3    7e-09   
gb|EMT07556.1|  hypothetical protein F775_11805                       58.5    7e-09   
ref|XP_008778289.1|  PREDICTED: mannose/glucose-specific lectin-like  60.8    7e-09   
pdb|1J4T|A  Chain A, Structure Of Artocarpin: A Lectin With Manno...  58.9    8e-09   
pdb|1J4S|A  Chain A, Structure Of Artocarpin: A Lectin With Manno...  58.9    8e-09   
ref|XP_010227994.1|  PREDICTED: jacalin-related lectin 3-like         60.8    8e-09   
ref|XP_011001803.1|  PREDICTED: mannose/glucose-specific lectin-like  61.6    8e-09   
gb|EMT07446.1|  hypothetical protein F775_10439                       60.1    8e-09   
ref|XP_010932865.1|  PREDICTED: jacalin-related lectin 3-like iso...  59.3    9e-09   
ref|XP_009588746.1|  PREDICTED: putative late blight resistance p...  62.0    9e-09   
ref|XP_009588743.1|  PREDICTED: putative late blight resistance p...  62.0    9e-09   
gb|EMT29229.1|  B3 domain-containing protein                          62.0    1e-08   
ref|XP_002439535.1|  hypothetical protein SORBIDRAFT_09g010668        58.9    1e-08   
ref|XP_010239309.1|  PREDICTED: LOW QUALITY PROTEIN: protein GOS9...  59.7    1e-08   
gb|AAY35063.1|  lectin KM+                                            58.9    1e-08   
emb|CDP07465.1|  unnamed protein product                              61.6    1e-08   
pdb|4AKD|A  Chain A, High Resolution Structure Of Mannose Binding...  58.5    1e-08   
tpg|DAA39774.1|  TPA: hypothetical protein ZEAMMB73_034611            58.5    1e-08   
gb|EMT31922.1|  hypothetical protein F775_02779                       58.9    1e-08   
ref|XP_010030903.1|  PREDICTED: agglutinin alpha chain-like           58.2    1e-08   
pdb|1UGW|A  Chain A, Crystal Structure Of Jacalin- Gal Complex        58.5    1e-08   
sp|P18670.2|LECA_ARTIN  RecName: Full=Agglutinin alpha chain; Alt...  58.5    1e-08   
ref|XP_008388156.1|  PREDICTED: uncharacterized protein LOC103450568  61.2    1e-08   
ref|XP_008466552.1|  PREDICTED: agglutinin-like                       58.5    1e-08   
ref|XP_010231090.1|  PREDICTED: jacalin-related lectin 19-like is...  58.9    1e-08   
gb|AAA32679.1|  jacalin                                               58.9    1e-08   
ref|XP_010099935.1|  hypothetical protein L484_020123                 58.9    1e-08   
ref|NP_001117315.1|  Mannose-binding lectin superfamily protein       60.8    2e-08   
ref|NP_001185041.1|  Mannose-binding lectin superfamily protein       60.8    2e-08   
gb|AAB23126.1|  jacalin minor alpha'-subunit=65 kda lectin minor ...  58.2    2e-08   
gb|ACN33395.1|  unknown                                               60.1    2e-08   
ref|XP_009614721.1|  PREDICTED: jacalin-related lectin 19             58.5    2e-08   
ref|XP_010231089.1|  PREDICTED: jacalin-related lectin 19-like is...  58.5    2e-08   
ref|NP_849691.1|  Mannose-binding lectin superfamily protein          60.8    2e-08   
gb|AAA32680.1|  jacalin                                               58.5    2e-08   
ref|XP_010231088.1|  PREDICTED: jacalin-related lectin 19-like is...  59.3    2e-08   
ref|XP_006383724.1|  hypothetical protein POPTR_0005s25390g           60.8    2e-08   
ref|XP_003578760.1|  PREDICTED: mannose/glucose-specific lectin-like  59.7    2e-08   
ref|XP_006838698.1|  hypothetical protein AMTR_s00002p00248970        57.8    2e-08   
ref|XP_002461766.1|  hypothetical protein SORBIDRAFT_02g007740        59.7    2e-08   
gb|AAA32678.1|  jacalin                                               58.5    2e-08   
ref|XP_009336846.1|  PREDICTED: uncharacterized protein LOC103929382  60.8    2e-08   
ref|XP_010674585.1|  PREDICTED: uncharacterized protein LOC104890703  61.2    2e-08   
ref|XP_011048832.1|  PREDICTED: jacalin-related lectin 3-like iso...  60.8    2e-08   
gb|KEH34301.1|  mannose-binding lectin superfamily protein            60.5    2e-08   
gb|ACR38528.1|  unknown                                               58.2    2e-08   
ref|XP_011048833.1|  PREDICTED: jacalin-related lectin 3-like iso...  60.5    2e-08   
pdb|4AK4|A  Chain A, High Resolution Structure Of Galactose Bindi...  57.4    2e-08   
pdb|4AKB|A  Chain A, Structure Of Galactose Binding Lectin From C...  57.4    2e-08   
gb|AFW74848.1|  hypothetical protein ZEAMMB73_609032                  57.4    2e-08   
ref|XP_010932856.1|  PREDICTED: mannose/glucose-specific lectin-l...  58.9    2e-08   
gb|EMS51477.1|  Mannose/glucose-specific lectin                       59.7    3e-08   
ref|XP_008656997.1|  PREDICTED: cysteine-rich receptor-like prote...  60.1    3e-08   
ref|XP_003597652.1|  Agglutinin alpha chain                           60.5    3e-08   
gb|KCW67998.1|  hypothetical protein EUGRSUZ_F01690                   60.5    3e-08   
gb|EMT04092.1|  hypothetical protein F775_28592                       59.3    3e-08   
gb|ACF78865.1|  unknown                                               58.5    3e-08   
gb|AAC49284.1|  unknown                                               59.3    3e-08   
ref|XP_009391798.1|  PREDICTED: agglutinin-like                       57.8    3e-08   
gb|KCW67999.1|  hypothetical protein EUGRSUZ_F01690                   60.5    3e-08   
ref|NP_001042994.2|  Os01g0355100                                     57.4    3e-08   
gb|EAY73967.1|  hypothetical protein OsI_01851                        57.4    3e-08   
gb|EMS65594.1|  hypothetical protein TRIUR3_06346                     58.9    3e-08   
ref|XP_010064569.1|  PREDICTED: jacalin-related lectin 4-like         60.5    4e-08   
pdb|4MQ0|A  Chain A, Crystal Structure Of Parkia Biglobosa Seed L...  59.7    4e-08   
ref|XP_002461767.1|  hypothetical protein SORBIDRAFT_02g007750        58.9    4e-08   
gb|ABI24164.1|  beta-glucosidase aggregating factor                   58.9    4e-08   
ref|XP_010110012.1|  hypothetical protein L484_021901                 60.1    4e-08   
gb|AFW84361.1|  putative protein kinase superfamily protein           59.7    4e-08   
gb|AFW74846.1|  hypothetical protein ZEAMMB73_609032                  57.8    4e-08   
gb|AFW74847.1|  hypothetical protein ZEAMMB73_609032                  57.8    4e-08   
emb|CDM80828.1|  unnamed protein product                              57.0    4e-08   
gb|AAL09163.1|  galactose-binding lectin                              57.4    4e-08   
ref|XP_010109960.1|  hypothetical protein L484_009242                 57.4    4e-08   
gb|EMT33622.1|  Cysteine proteinase RD21a                             60.1    5e-08   
gb|EAY82243.1|  hypothetical protein OsI_37448                        58.5    5e-08   
ref|XP_009614655.1|  PREDICTED: mannose/glucose-specific lectin-like  57.0    5e-08   
gb|AAA32677.1|  jacalin                                               57.4    5e-08   
ref|XP_010099937.1|  hypothetical protein L484_020125                 58.9    5e-08   
ref|XP_010108457.1|  hypothetical protein L484_014128                 56.6    6e-08   
ref|XP_010108459.1|  hypothetical protein L484_014130                 56.6    6e-08   
ref|XP_006342218.1|  PREDICTED: agglutinin-like                       58.5    7e-08   
emb|CDM86052.1|  unnamed protein product                              58.5    7e-08   
ref|XP_004970153.1|  PREDICTED: myrosinase-binding protein-like A...  59.3    7e-08   
ref|NP_001142347.1|  uncharacterized protein LOC100274518             58.2    7e-08   
ref|WP_014434222.1|  hypothetical protein                             57.8    7e-08   
ref|XP_009413293.1|  PREDICTED: protein GOS9-like                     56.2    7e-08   
gb|ABA94727.1|  Jacalin-like lectin domain containing protein         56.2    8e-08   
gb|KCW56858.1|  hypothetical protein EUGRSUZ_I02520                   59.3    8e-08   
ref|XP_010029904.1|  PREDICTED: jacalin-related lectin 4-like         59.3    8e-08   
emb|CDM86063.1|  unnamed protein product                              58.9    9e-08   
gb|AFK34206.1|  unknown                                               56.2    9e-08   
ref|NP_001174671.1|  Os06g0226050                                     55.8    9e-08   
ref|XP_004979016.1|  PREDICTED: salt stress-induced protein-like      55.8    1e-07   
ref|XP_009782510.1|  PREDICTED: jacalin-related lectin 19             56.2    1e-07   
gb|ABS86033.1|  mannose-specific recombinant lectin                   55.8    1e-07   
gb|EMS47771.1|  hypothetical protein TRIUR3_34363                     55.5    1e-07   
emb|CDY39357.1|  BnaC05g15300D                                        58.5    1e-07   
ref|XP_004500273.1|  PREDICTED: agglutinin-like                       58.5    1e-07   
gb|KEH39538.1|  mannose-binding lectin superfamily protein            55.8    1e-07   
gb|KEH39537.1|  mannose-binding lectin superfamily protein            55.8    1e-07   
gb|KEH39536.1|  mannose-binding lectin superfamily protein            55.8    1e-07   
ref|XP_009413935.1|  PREDICTED: protein GOS9-like                     55.5    1e-07   
dbj|BAD52599.1|  putative salT                                        57.0    1e-07   
ref|XP_002458378.1|  hypothetical protein SORBIDRAFT_03g032480        55.8    1e-07   
gb|AFW74852.1|  hypothetical protein ZEAMMB73_609032                  57.4    1e-07   
ref|NP_001042975.1|  Os01g0348800                                     55.1    1e-07   
gb|EEE54522.1|  hypothetical protein OsJ_01681                        54.7    2e-07   
ref|XP_010320537.1|  PREDICTED: agglutinin-like                       55.5    2e-07   
gb|EMS47225.1|  hypothetical protein TRIUR3_25909                     57.4    2e-07   
gb|AEE92792.1|  lectin                                                55.8    2e-07   
ref|XP_003561042.1|  PREDICTED: jacalin-related lectin 3-like         57.4    2e-07   
gb|KHN34265.1|  Agglutinin                                            57.8    2e-07   
gb|ADV38315.1|  mannose/glucose-specific lectin                       55.1    2e-07   
ref|XP_003539332.1|  PREDICTED: agglutinin-like isoform X1            57.8    2e-07   
ref|XP_006597184.1|  PREDICTED: agglutinin-like isoform X4            55.1    2e-07   
ref|XP_006591219.1|  PREDICTED: agglutinin-like isoform X2            57.8    2e-07   
gb|KHN32674.1|  Agglutinin alpha chain                                55.1    2e-07   
ref|XP_010320393.1|  PREDICTED: jacalin-related lectin 3-like         57.0    2e-07   
sp|P18674.2|LECA_MACPO  RecName: Full=Agglutinin alpha chain; Alt...  54.7    2e-07   
gb|EYU45162.1|  hypothetical protein MIMGU_mgv1a025414mg              57.0    2e-07   
gb|AEQ30064.1|  mannose/glucose-specific lectin                       54.7    2e-07   
ref|XP_009384722.1|  PREDICTED: agglutinin alpha chain-like isofo...  55.1    2e-07   
ref|XP_006597181.1|  PREDICTED: agglutinin-like isoform X1            57.8    2e-07   
ref|XP_009384641.1|  PREDICTED: agglutinin alpha chain-like isofo...  55.1    3e-07   
gb|KFK44089.1|  hypothetical protein AALP_AA1G214700                  57.4    3e-07   
gb|AHZ86978.1|  extracellular jacalin-like lectin                     54.7    3e-07   
ref|XP_006354454.1|  PREDICTED: probable disease resistance RPP8-...  56.2    3e-07   
ref|XP_006383725.1|  hypothetical protein POPTR_0005s25400g           57.0    3e-07   
gb|EYU34206.1|  hypothetical protein MIMGU_mgv1a025615mg              56.6    3e-07   
dbj|BAE95375.1|  lectin                                               56.2    3e-07   
ref|XP_003578759.1|  PREDICTED: mannose/glucose-specific lectin-like  56.2    3e-07   
emb|CBI35989.3|  unnamed protein product                              55.1    3e-07   
ref|XP_003576339.1|  PREDICTED: jacalin-related lectin 3-like         55.8    3e-07   
ref|XP_010029921.1|  PREDICTED: jacalin-related lectin 4-like iso...  57.4    4e-07   
gb|KDP46660.1|  hypothetical protein JCGZ_10969                       57.0    4e-07   
ref|XP_010029918.1|  PREDICTED: jacalin-related lectin 4-like iso...  57.4    4e-07   
ref|XP_011048836.1|  PREDICTED: jacalin-related lectin 3-like iso...  57.0    4e-07   
ref|XP_010029920.1|  PREDICTED: myrosinase-binding protein 2-like...  57.4    4e-07   
ref|XP_004170416.1|  PREDICTED: LOW QUALITY PROTEIN: agglutinin-like  56.2    4e-07   
ref|XP_002281330.1|  PREDICTED: jacalin-related lectin 19-like        54.3    4e-07   
ref|XP_011048835.1|  PREDICTED: jacalin-related lectin 3-like iso...  57.0    4e-07   
ref|XP_010026052.1|  PREDICTED: agglutinin-like                       54.3    4e-07   
ref|XP_009149456.1|  PREDICTED: agglutinin                            56.6    4e-07   
emb|CDM83580.1|  unnamed protein product                              56.2    4e-07   
gb|EYU36743.1|  hypothetical protein MIMGU_mgv1a007927mg              56.2    5e-07   
dbj|BAG24500.1|  jacalin-related lectin                               55.8    5e-07   
gb|KDP26963.1|  hypothetical protein JCGZ_22259                       55.8    5e-07   
ref|XP_008782838.1|  PREDICTED: agglutinin alpha chain-like           54.3    5e-07   
pdb|1X1V|A  Chain A, Structure Of Banana Lectin- Methyl-Alpha-Man...  53.9    5e-07   
ref|NP_001183767.1|  hypothetical protein                             53.9    5e-07   
gb|EMT09327.1|  hypothetical protein F775_29083                       55.8    5e-07   



>gb|AAG10403.1|AF233284_1 mannose-binding lectin [Convolvulus arvensis]
Length=152

 Score =   107 bits (268),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = -2

Query  283  TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP  104
            T+GG G ++ +T  DT++I G DEY+T ISGTFG +   +NVLRSIKF TN + +G YGP
Sbjct  59   TVGGAGPDS-ITGTDTVDI-GADEYVTGISGTFGIYLD-NNVLRSIKFITNLKAYGPYGP  115

Query  103  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYN  2
            NVGTPF+ +   GN+IVGF GRSGYY+DAIGTYN
Sbjct  116  NVGTPFSSENVVGNEIVGFLGRSGYYVDAIGTYN  149



>gb|AAC49564.1| lectin [Calystegia sepium]
Length=153

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 69/94 (73%), Gaps = 3/94 (3%)
 Frame = -2

Query  283  TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP  104
            T+GGGG ++ +T  + +NI G DEYLT ISGTFG +   +NVLRSI FTTN +  G YG 
Sbjct  60   TVGGGGPDS-ITGTEMVNI-GTDEYLTGISGTFGIYLD-NNVLRSITFTTNLKAHGPYGQ  116

Query  103  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYN  2
             VGTPF+     GN+IVGF GRSGYY+DAIGTYN
Sbjct  117  KVGTPFSSANVVGNEIVGFLGRSGYYVDAIGTYN  150



>pdb|1OUW|A Chain A, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|B Chain B, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|C Chain C, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|D Chain D, Crystal Structure Of Calystegia Sepium Agglutinin
Length=152

 Score =   100 bits (248),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 69/94 (73%), Gaps = 3/94 (3%)
 Frame = -2

Query  283  TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP  104
            T+GGGG ++ +T  + +NI G DEYLT ISGTFG +   +NVLRSI FTTN +  G YG 
Sbjct  59   TVGGGGPDS-ITGTEMVNI-GTDEYLTGISGTFGIYLD-NNVLRSITFTTNLKAHGPYGQ  115

Query  103  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYN  2
             VGTPF+     GN+IVGF GRSGYY+DAIGTYN
Sbjct  116  KVGTPFSSANVVGNEIVGFLGRSGYYVDAIGTYN  149



>dbj|BAA14024.1| ipomoelin [Ipomoea batatas]
Length=154

 Score = 98.2 bits (243),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 67/93 (72%), Gaps = 5/93 (5%)
 Frame = -2

Query  283  TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP  104
            T+GG G E  +T+ +T+NIDG+   + EISG    +    NV+RSIKFTTN +E+G YG 
Sbjct  63   TVGGVGPEP-LTYTETVNIDGD---IIEISGMIANYKGY-NVIRSIKFTTNKKEYGPYGA  117

Query  103  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            N GTPFN +  +GNKIVGFFG SG+Y+DAIG Y
Sbjct  118  NAGTPFNIKIPDGNKIVGFFGNSGWYVDAIGAY  150



>pdb|3R50|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|E Chain E, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
Length=160

 Score = 98.2 bits (243),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 67/93 (72%), Gaps = 5/93 (5%)
 Frame = -2

Query  283  TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP  104
            T+GG G E  +T+ +T+NIDG+   + EISG    +    NV+RSIKFTTN +E+G YG 
Sbjct  69   TVGGVGPEP-LTYTETVNIDGD---IIEISGMIANYKGY-NVIRSIKFTTNKKEYGPYGA  123

Query  103  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            N GTPFN +  +GNKIVGFFG SG+Y+DAIG Y
Sbjct  124  NAGTPFNIKIPDGNKIVGFFGNSGWYVDAIGAY  156



>gb|EEC68267.1| hypothetical protein OsI_36302 [Oryza sativa Indica Group]
Length=1396

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/73 (52%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  223   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
             G  E+L E+SGTFG F ++ N++ S+ F TNA+ +G YG   GTPF+   Q+   IVGFF
Sbjct  1010  GPSEFLVEVSGTFGRFRAALNIITSLTFVTNAQSYGPYGQREGTPFHIPVQSSGCIVGFF  1069

Query  43    GRSGYYIDAIGTY  5
             GR+G+Y+DAIG Y
Sbjct  1070  GRAGWYVDAIGIY  1082


 Score = 74.7 bits (182),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 38/81 (47%), Positives = 48/81 (59%), Gaps = 1/81 (1%)
 Frame = -2

Query  247   HNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
             +N TI   G  E LT +SGTFG++ +S +V+ SI   TN   +G +G   G  FNF  Q 
Sbjct  1158  NNQTIQF-GPSELLTTVSGTFGSYNTSYDVITSITLVTNIGCYGPFGKEKGISFNFPIQG  1216

Query  67    GNKIVGFFGRSGYYIDAIGTY  5
                IVGFFG +  YIDAIG Y
Sbjct  1217  NGSIVGFFGHAELYIDAIGVY  1237


 Score = 64.7 bits (156),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 36/91 (40%), Positives = 50/91 (55%), Gaps = 6/91 (7%)
 Frame = -2

Query  274   GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNV  98
             GGG E N      IN+ G  E++T++ GTFG +     V+ S+ F  NA  ++G +G   
Sbjct  1307  GGGGENNYK----INL-GPSEFITKVHGTFGPYGEFPIVITSLTFINNAGHQYGPFGQGG  1361

Query  97    GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GTPF+        IVGFFG  G  ++AIG Y
Sbjct  1362  GTPFHAPISGNGSIVGFFGHQGACLEAIGFY  1392



>gb|ABA93998.1| NB-ARC domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=1384

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 37/73 (51%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  223   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
             G  E+L E+SGTFG F ++ +++ S+ F TNA+ +G YG   GTPF+   Q+   IVGFF
Sbjct  1038  GPSEFLVEVSGTFGRFRAALDIITSLTFVTNAQSYGPYGQREGTPFHISVQSRGCIVGFF  1097

Query  43    GRSGYYIDAIGTY  5
             GR+G+Y+DAIG Y
Sbjct  1098  GRAGWYVDAIGIY  1110


 Score = 74.7 bits (182),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 40/92 (43%), Positives = 50/92 (54%), Gaps = 1/92 (1%)
 Frame = -2

Query  280   IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPN  101
             IG  G      H+  I   G  E LT +SGTFG++ +S +V+ SI   TN   +G +G  
Sbjct  1129  IGPCGGNGGKAHDIMIQF-GPSELLTTVSGTFGSYNTSYDVITSITLVTNIGCYGPFGKE  1187

Query  100   VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
              G  FNF  Q    IVGFFG +  YIDAIG Y
Sbjct  1188  KGISFNFPIQGNGSIVGFFGHAELYIDAIGVY  1219



>ref|XP_004168675.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like, 
partial [Cucumis sativus]
Length=1090

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPN  101
            G GGT+T     DT+ +D  DEYLT I G +G+F S D V +RS+ F +N +++G YG  
Sbjct  907  GNGGTKT-----DTVKLDFPDEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVE  961

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F+F    G KIVGF GRSG Y+DAIG Y
Sbjct  962  QGTIFSFPTTEG-KIVGFHGRSGLYLDAIGVY  992



>gb|EEE52195.1| hypothetical protein OsJ_34074 [Oryza sativa Japonica Group]
Length=1311

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/73 (51%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  223   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
             G  E+L E+SGTFG F ++ +++ S+ F TNA+ +G YG   GTPF+   Q+   IVGFF
Sbjct  970   GPSEFLVEVSGTFGRFRAALDIITSLTFVTNAQSYGPYGQREGTPFHISVQSRGCIVGFF  1029

Query  43    GRSGYYIDAIGTY  5
             GR+G+Y+DAIG Y
Sbjct  1030  GRAGWYVDAIGIY  1042


 Score = 73.9 bits (180),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 40/92 (43%), Positives = 50/92 (54%), Gaps = 1/92 (1%)
 Frame = -2

Query  280   IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPN  101
             IG  G      H+  I   G  E LT +SGTFG++ +S +V+ SI   TN   +G +G  
Sbjct  1061  IGPCGGNGGKAHDIMIQF-GPSELLTTVSGTFGSYNTSYDVITSITLVTNIGCYGPFGKE  1119

Query  100   VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
              G  FNF  Q    IVGFFG +  YIDAIG Y
Sbjct  1120  KGISFNFPIQGNGSIVGFFGHAELYIDAIGVY  1151


 Score = 65.5 bits (158),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 50/91 (55%), Gaps = 6/91 (7%)
 Frame = -2

Query  274   GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNV  98
             GGG E N      IN+ G  E++T++ GTFG F     V+ S+ F  NA  ++G +G   
Sbjct  1222  GGGGENNYK----INL-GPSEFITKVHGTFGPFGEFPIVITSLTFINNAGHQYGPFGQGG  1276

Query  97    GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GTPF+        IVGFFG  G  ++AIG Y
Sbjct  1277  GTPFHAPISGNGSIVGFFGHQGACLEAIGFY  1307



>ref|XP_004152769.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
[Cucumis sativus]
Length=1463

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 7/92 (8%)
 Frame = -2

Query  277   GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPN  101
             G GGT+T     DT+ +D  DEYLT I G +G+F S D V +RS+ F +N +++G YG  
Sbjct  934   GNGGTKT-----DTVKLDFPDEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVE  988

Query  100   VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
              GT F+F    G KIVGF GRSG Y+DAIG Y
Sbjct  989   QGTIFSFPTTEG-KIVGFHGRSGLYLDAIGVY  1019


 Score = 57.0 bits (136),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = -2

Query  241   DTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
             D +  D   E LT ++G +G       NV++S+ F T   ++G +G   GTPF+   + G
Sbjct  1169  DKVIFDYPYEILTHVTGHYGPVMYMGPNVIKSLTFHTTKAKYGPFGEAQGTPFSTNVKEG  1228

Query  64    NKIVGFFGRSGYYIDAIGTY  5
              KIVGF GR G ++DA+G +
Sbjct  1229  -KIVGFHGRKGLFLDALGVH  1247


 Score = 54.3 bits (129),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 33/91 (36%), Positives = 47/91 (52%), Gaps = 5/91 (5%)
 Frame = -2

Query  271   GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNV  98
             GG      H   + +D   E LT ISG +G     +    ++S+ F T+  +FG +G  V
Sbjct  1357  GGNSGTTIHR--VKLDYPHEVLTCISGYYGYIGKDERQQAVKSLTFHTSRGKFGPFGEEV  1414

Query  97    GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             G+ F      G K+VGF GRS  Y+DAIG +
Sbjct  1415  GSFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  1444



>ref|XP_006663483.1| PREDICTED: probable disease resistance RPP8-like protein 4-like 
[Oryza brachyantha]
Length=1368

 Score = 84.3 bits (207),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -2

Query  241   DTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  62
             D I +    E+L E+SGTFG F ++ NV+ S+ F TNA  +G YG   GTPF+   Q+  
Sbjct  976   DMIQL-APSEFLLEVSGTFGRFRTALNVMTSLTFVTNAHSYGPYGKIEGTPFHMPVQSNG  1034

Query  61    KIVGFFGRSGYYIDAIGTY  5
              IVGFFGR+G+Y+DAIG Y
Sbjct  1035  CIVGFFGRAGWYVDAIGIY  1053


 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = -2

Query  244   NDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
             N  I  D E E++T + GT G++ +S +V+ SI   TN   +G +G   G PF+F  Q  
Sbjct  1130  NQLIQFDPE-EFITSVCGTIGSYNTSFDVITSITLVTNIDCYGPFGQENGIPFHFPIQGN  1188

Query  64    NKIVGFFGRSGYYIDAIGTY  5
               IVGFFG +  Y+DAIG Y
Sbjct  1189  GSIVGFFGHADIYVDAIGVY  1208


 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = -2

Query  244   NDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVGTPFNFQAQN  68
             N TIN+ G  E+LT++ GTFG F     V+ S+ F +N   ++G +G   GTPF+     
Sbjct  1285  NYTINL-GPSEFLTKVLGTFGQFDEFPIVITSLTFFSNTGHQYGPFGQGGGTPFHAPISG  1343

Query  67    GNKIVGFFGRSGYYIDAIGTY  5
                IVGFFG  G  ++AIG Y
Sbjct  1344  NGSIVGFFGYQGDCVEAIGFY  1364



>gb|EMT18893.1| Disease resistance protein RPM1 [Aegilops tauschii]
Length=809

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 1/81 (1%)
 Frame = -2

Query  247  HNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            +ND I+++   E L E+SGT G++ +  NV+ S+   T+AR +G +G   G PF+ +A +
Sbjct  726  NNDVIHLE-PSEILKEVSGTVGSYGALTNVITSLTLVTSARTYGPFGKGDGIPFSMEAAS  784

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
             + I+GFFGRSG+Y+DAIG Y
Sbjct  785  NSSIIGFFGRSGWYLDAIGVY  805



>gb|KGN62634.1| hypothetical protein Csa_2G362470 [Cucumis sativus]
Length=598

 Score = 82.8 bits (203),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPN  101
            G GGT+T     DT+ +D  DEYLT I G +G+F S D V +RS+ F +N +++G YG  
Sbjct  65   GNGGTKT-----DTVKLDFPDEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVE  119

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F+F    G KIVGF GRSG Y+DAIG Y
Sbjct  120  QGTIFSFPTTEG-KIVGFHGRSGLYLDAIGVY  150


 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D +  D   E LT ++G +G       NV++S+ F T   ++G +G   GTPF+   + G
Sbjct  304  DKVIFDYPYEILTHVTGHYGPVMYMGPNVIKSLTFHTTKAKYGPFGEAQGTPFSTNVKEG  363

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             KIVGF GR G ++DA+G +
Sbjct  364  -KIVGFHGRKGLFLDALGVH  382


 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 44/79 (56%), Gaps = 3/79 (4%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  62
            + +D   E LT ISG +G     +    ++S+ F T+  +FG +G  VG+ F      G 
Sbjct  502  VKLDYPHEVLTCISGYYGYIGKDERQQAVKSLTFHTSRGKFGPFGEEVGSFFTSTTTEG-  560

Query  61   KIVGFFGRSGYYIDAIGTY  5
            K+VGF GRS  Y+DAIG +
Sbjct  561  KVVGFHGRSSLYLDAIGVH  579



>ref|XP_008444758.1| PREDICTED: LOW QUALITY PROTEIN: myrosinase-binding protein-like 
At3g16470 [Cucumis melo]
Length=598

 Score = 82.4 bits (202),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 60/92 (65%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPN  101
            G GGT+T     DT+ +D  DEYLT I G +G+F S D V +RS+ F +N +++G YG  
Sbjct  65   GNGGTKT-----DTVKLDFPDEYLTMIRGYYGSFVSFDKVFVRSLTFMSNKKKYGPYGVE  119

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F+F    G KIVGF GRSG Y+DAIG Y
Sbjct  120  QGTVFSFPTTEG-KIVGFHGRSGLYLDAIGVY  150


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D +  D   E LT ++G +G       NV++S+ F T   ++G +G   GTPF+   + G
Sbjct  304  DKVIFDYPYEILTHVTGHYGPVMYMGPNVIKSLSFHTTKAKYGPFGEAQGTPFSTNVKEG  363

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             KIVGF GR G ++DA+G +
Sbjct  364  -KIVGFHGRKGLFLDALGVH  382


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 6/92 (7%)
 Frame = -2

Query  274  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPN  101
            GG + TNV     + +D   E LT ISG +G     +    ++S+ F T+  +FG +G  
Sbjct  492  GGNSGTNV---HRVKLDYPHEVLTCISGYYGYIGKDERQQAVKSLTFHTSRGKFGPFGEE  548

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            VG+ F      G K+VGF GRS  Y+DAIG +
Sbjct  549  VGSFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  579



>gb|ACF87628.1| unknown [Zea mays]
Length=122

 Score = 77.8 bits (190),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 51/77 (66%), Gaps = 0/77 (0%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  56
            I++   DE LTEISGT G   + DN+++S+KF TN R +G YG + GTPF  +  N   +
Sbjct  42   IDLCRFDESLTEISGTTGPAYNIDNLVKSLKFVTNKRAYGPYGRDEGTPFRVKVMNNGHV  101

Query  55   VGFFGRSGYYIDAIGTY  5
             GFFGRSG  +DAIG Y
Sbjct  102  AGFFGRSGDCLDAIGLY  118



>gb|EEC68269.1| hypothetical protein OsI_36304 [Oryza sativa Indica Group]
Length=1419

 Score = 82.8 bits (203),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  214   EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
             E L E+SGTFG FA   N++ S+ F TN + +G +G   GTPF+   Q G +IVGFFGR+
Sbjct  1047  EVLVEVSGTFGRFAGFQNIITSLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFFGRA  1106

Query  34    GYYIDAIGTY  5
             G+  DAIG Y
Sbjct  1107  GWCFDAIGIY  1116


 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 38/91 (42%), Positives = 51/91 (56%), Gaps = 6/91 (7%)
 Frame = -2

Query  274   GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR-EFGTYGPNV  98
             G G E+N T    I + G  E+  ++SGTFG F    NV+ S+ F TN   ++G +G   
Sbjct  1330  GSGGESNYT----IQL-GPSEFFVKVSGTFGPFGEFPNVITSLTFVTNTHHQYGPFGQGG  1384

Query  97    GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GTPF+        IVGFFGR G  I+A+G Y
Sbjct  1385  GTPFHAPMSGNGSIVGFFGREGLCIEAVGFY  1415


 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = -2

Query  208   LTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSGY  29
             +T + GT G++ +  +V+ SI   TNA  +G +G   G PF+F  Q    IVGFFG +  
Sbjct  1192  ITRVYGTSGSYNTPSDVVTSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFFGHANL  1251

Query  28    YIDAIGTY  5
             Y+DAIG Y
Sbjct  1252  YVDAIGVY  1259



>ref|XP_004298563.1| PREDICTED: myrosinase-binding protein-like At2g25980-like [Fragaria 
vesca subsp. vesca]
Length=379

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 58/90 (64%), Gaps = 4/90 (4%)
 Frame = -2

Query  268  GTETNVTHNDT-INIDGEDEYLTEISGTFGA---FASSDNVLRSIKFTTNAREFGTYGPN  101
            G++ N   +D  I +D  DE+L  +SG +        +  VLRS+KF TN R FG +G  
Sbjct  95   GSDLNKPLSDAEIKLDYPDEFLVSVSGYYCGVTWIVGAPVVLRSLKFETNKRTFGPFGVE  154

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIG  11
            VGTPF F+ ++G KIVGF GR+G+Y+DAIG
Sbjct  155  VGTPFTFRVKDGVKIVGFKGRNGWYLDAIG  184


 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 52/78 (67%), Gaps = 3/78 (4%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGA---FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            I ++  +E++  ++G +G       +  VL S++F +N R FG +G  VGTPF F+ ++G
Sbjct  259  IKLEYPNEFIVSVTGHYGGVTWIVGAPVVLLSLRFESNRRTFGPFGVQVGTPFTFRVKDG  318

Query  64   NKIVGFFGRSGYYIDAIG  11
            ++IVG  GR+G+Y+DAIG
Sbjct  319  DQIVGLKGRNGWYLDAIG  336



>ref|NP_001106057.1| PL3K2 [Zea mays]
 gb|ABR68026.1| PL3K2 [Zea mays]
 gb|ACF80462.1| unknown [Zea mays]
 gb|ACG30569.1| hypothetical protein [Zea mays]
Length=151

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = -2

Query  217  DEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
            DE LTEISGT G   + DN+++S+KF TN R +G YG + GTPF  +  N   + GFFGR
Sbjct  77   DESLTEISGTTGPAYNIDNLVKSLKFVTNKRAYGPYGRDEGTPFRVKVMNNGHVAGFFGR  136

Query  37   SGYYIDAIGTY  5
            SG  +DAIG Y
Sbjct  137  SGDCLDAIGLY  147



>gb|EEE52196.1| hypothetical protein OsJ_34075 [Oryza sativa Japonica Group]
Length=1431

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  214   EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
             E L E+SGTFG FA   N++ S+ F TN + +G +G   GTPF+   Q G +IVGFFGR+
Sbjct  1047  EVLVEVSGTFGRFAGFQNIITSLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFFGRA  1106

Query  34    GYYIDAIGTY  5
             G+  DAIG Y
Sbjct  1107  GWCFDAIGIY  1116


 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = -2

Query  244   NDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
             N TI   G  E++T + GT G++ +  +V+ SI   TNA  +G +G   G PF+F  Q  
Sbjct  1193  NQTIQF-GPSEFITRVYGTIGSYNTPSDVVTSITLVTNAGCYGPFGQENGIPFDFPVQGN  1251

Query  64    NKIVGFFGRSGYYIDAIGTY  5
               IVGFFG +  Y+DAIG Y
Sbjct  1252  GSIVGFFGHANLYVDAIGVY  1271


 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/91 (42%), Positives = 51/91 (56%), Gaps = 6/91 (7%)
 Frame = -2

Query  274   GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR-EFGTYGPNV  98
             G G E+N T    I + G  E+  ++SGTFG F    NV+ S+ F TN   ++G +G   
Sbjct  1342  GSGGESNYT----IQL-GPSEFFVKVSGTFGPFGEFPNVITSLTFVTNTHHQYGPFGQGG  1396

Query  97    GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GTPF+        IVGFFGR G  I+A+G Y
Sbjct  1397  GTPFHAPMSGNGSIVGFFGREGLCIEAVGFY  1427



>gb|ABA94002.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=1386

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/70 (51%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  214   EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
             E L E+SGTFG FA   N++ S+ F TN + +G +G   GTPF+   Q G +IVGFFGR+
Sbjct  1002  EVLVEVSGTFGRFAGFQNIITSLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFFGRA  1061

Query  34    GYYIDAIGTY  5
             G+  DAIG Y
Sbjct  1062  GWCFDAIGIY  1071


 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/80 (43%), Positives = 47/80 (59%), Gaps = 1/80 (1%)
 Frame = -2

Query  244   NDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
             N TI   G  E++T + GT G++ +  +V+ SI   TNA  +G +G   G PF+F  Q  
Sbjct  1148  NQTIQF-GPSEFITRVYGTIGSYNTPSDVVTSITLVTNAGCYGPFGQENGIPFDFPVQGN  1206

Query  64    NKIVGFFGRSGYYIDAIGTY  5
               IVGFFG +  Y+DAIG Y
Sbjct  1207  GSIVGFFGHANLYVDAIGVY  1226


 Score = 69.7 bits (169),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 38/91 (42%), Positives = 51/91 (56%), Gaps = 6/91 (7%)
 Frame = -2

Query  274   GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR-EFGTYGPNV  98
             G G E+N T    I + G  E+  ++SGTFG F    NV+ S+ F TN   ++G +G   
Sbjct  1297  GSGGESNYT----IQL-GPSEFFVKVSGTFGPFGEFPNVITSLTFVTNTHHQYGPFGQGG  1351

Query  97    GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GTPF+        IVGFFGR G  I+A+G Y
Sbjct  1352  GTPFHAPMSGNGSIVGFFGREGLCIEAVGFY  1382



>ref|NP_001066367.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|ABA96667.1| jasmonate-induced protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29386.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|EAY82558.1| hypothetical protein OsI_37779 [Oryza sativa Indica Group]
 gb|EAZ19941.1| hypothetical protein OsJ_35533 [Oryza sativa Japonica Group]
Length=307

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 49/73 (67%), Gaps = 1/73 (1%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+L E+SGTFG +     V+RSIKF TN + +G +G   GTPF+   QN + IVGFF
Sbjct  232  GSSEFLKEVSGTFGPYEGW-KVIRSIKFVTNKKTYGPFGRQEGTPFSVPVQNNSTIVGFF  290

Query  43   GRSGYYIDAIGTY  5
            GRSG Y+D +G Y
Sbjct  291  GRSGKYLDTVGIY  303



>gb|ACG29554.1| hypothetical protein [Zea mays]
 gb|ACG44268.1| hypothetical protein [Zea mays]
Length=151

 Score = 77.4 bits (189),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = -2

Query  217  DEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
            DE LTEISGT G   + DN+++S+KF TN R +G YG + GTPF  +  N   + GFFGR
Sbjct  77   DESLTEISGTTGPAYNIDNLVKSLKFVTNKRTYGPYGRDEGTPFRVKVMNNGHVAGFFGR  136

Query  37   SGYYIDAIGTY  5
            SG  +DAIG Y
Sbjct  137  SGDCLDAIGLY  147



>ref|XP_006663484.1| PREDICTED: putative disease resistance RPP13-like protein 3-like 
[Oryza brachyantha]
Length=1366

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 40/91 (44%), Positives = 51/91 (56%), Gaps = 6/91 (7%)
 Frame = -2

Query  277   GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
             G GG+  N    +        E L E+SGTFG F    N++ S+ F TN R +G YG   
Sbjct  965   GYGGSSVNAIQLEP------SEILVEVSGTFGRFIGFQNIITSLTFVTNTRSYGPYGQRK  1018

Query  97    GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GTPF+   Q    IVGFFGR+G+ +DAIG Y
Sbjct  1019  GTPFDIPVQGSGCIVGFFGRAGWCVDAIGIY  1049


 Score = 75.1 bits (183),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -2

Query  223   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
             G  E++T +SGT G++ +  +V+ SI   TN   +G +G   G PFNF  Q   +IVGFF
Sbjct  1132  GSSEFITRVSGTIGSYNTPSDVVTSITLVTNVGCYGPFGQENGIPFNFPVQGNGRIVGFF  1191

Query  43    GRSGYYIDAIGTY  5
             G +  Y+DAIG Y
Sbjct  1192  GHADLYVDAIGVY  1204


 Score = 62.4 bits (150),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 33/74 (45%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = -2

Query  223   GEDEYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVGTPFNFQAQNGNKIVGF  47
             G  E+L ++ GTFG F    NV+ S+ F TN    +G +G   GTPF         IVGF
Sbjct  1289  GPLEFLVKVLGTFGPFGEFPNVITSLTFVTNTDHHYGPFGQGGGTPFYGPMSGHGSIVGF  1348

Query  46    FGRSGYYIDAIGTY  5
             FGR G  I+AIG Y
Sbjct  1349  FGRKGPCIEAIGFY  1362



>gb|AAA87042.1| putative 32.7 kDa jasmonate-induced protein [Hordeum vulgare 
subsp. vulgare]
 gb|AAB72097.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 50/76 (66%), Gaps = 1/76 (1%)
 Frame = -2

Query  229  IDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIV  53
            + G  E++ E+SGTFG +     N++ S+KF TN + +G +G   GTPF   AQ  + IV
Sbjct  225  VLGASEFMKEVSGTFGIYDKDRHNIITSLKFITNVKTYGPFGEAKGTPFTIPAQKNSSIV  284

Query  52   GFFGRSGYYIDAIGTY  5
            GFFGRSG Y+DA+G Y
Sbjct  285  GFFGRSGIYLDALGVY  300



>gb|EAY82651.1| hypothetical protein OsI_37872 [Oryza sativa Indica Group]
Length=304

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 2/79 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  62
            +TI +    E+L E+SGTFG +  S NV+ SIKF TN + +G +G   GTPF+   QN +
Sbjct  224  NTIELS-SSEFLKEVSGTFGTYYGS-NVITSIKFVTNVKTYGPFGKQNGTPFSIPVQNNS  281

Query  61   KIVGFFGRSGYYIDAIGTY  5
             +VGFFGR G Y+DA+G Y
Sbjct  282  SVVGFFGRGGKYLDAVGVY  300



>ref|NP_001066495.1| Os12g0247700 [Oryza sativa Japonica Group]
 gb|ABA97248.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABB51090.1| mannose-specific jacalin-related lectin [Oryza sativa Japonica 
Group]
 dbj|BAF29514.1| Os12g0247700 [Oryza sativa Japonica Group]
 gb|EAZ20117.1| hypothetical protein OsJ_35712 [Oryza sativa Japonica Group]
Length=306

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+L E+SGTFG +  S  V+ SI F TN + +G +G   GTPF+  AQN + IVGFF
Sbjct  231  GSSEFLKEVSGTFGPYEGS-TVITSINFITNKQTYGPFGRQEGTPFSVPAQNNSSIVGFF  289

Query  43   GRSGYYIDAIGTY  5
            GRSG YI+A+G Y
Sbjct  290  GRSGKYINAVGVY  302



>gb|EEC69076.1| hypothetical protein OsI_37951 [Oryza sativa Indica Group]
Length=250

 Score = 77.4 bits (189),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+L E+S TFG +  S  V+RSI F TN + +G +G   GTPF+  AQN + +VGFF
Sbjct  175  GSSEFLKEVSRTFGPYEGS-TVIRSINFITNKQTYGPFGRQEGTPFSVPAQNNSSVVGFF  233

Query  43   GRSGYYIDAIGTY  5
            GRSG YI+A+G Y
Sbjct  234  GRSGKYINAVGVY  246



>ref|XP_008677998.1| PREDICTED: mannose/glucose-specific lectin-like isoform X9 [Zea 
mays]
Length=616

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G   GTPF+ Q QN  +IVGFF
Sbjct  178  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  237

Query  43   GRSGYYIDAIGTY  5
            GRSG Y+ AIG Y
Sbjct  238  GRSGQYLYAIGVY  250


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  373  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  432

Query  34   GYYIDAIGTY  5
            G Y++AIG Y
Sbjct  433  GRYLNAIGVY  442



>ref|XP_008677990.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Zea 
mays]
Length=781

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G   GTPF+ Q QN  +IVGFF
Sbjct  343  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  402

Query  43   GRSGYYIDAIGTY  5
            GRSG Y+ AIG Y
Sbjct  403  GRSGQYLYAIGVY  415


 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  538  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  597

Query  34   GYYIDAIGTY  5
            G Y++AIG Y
Sbjct  598  GRYLNAIGVY  607



>ref|XP_008677986.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677987.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677988.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677989.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
Length=783

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G   GTPF+ Q QN  +IVGFF
Sbjct  345  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  404

Query  43   GRSGYYIDAIGTY  5
            GRSG Y+ AIG Y
Sbjct  405  GRSGQYLYAIGVY  417


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  540  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  599

Query  34   GYYIDAIGTY  5
            G Y++AIG Y
Sbjct  600  GRYLNAIGVY  609



>ref|XP_008677991.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Zea 
mays]
Length=778

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G   GTPF+ Q QN  +IVGFF
Sbjct  345  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  404

Query  43   GRSGYYIDAIGTY  5
            GRSG Y+ AIG Y
Sbjct  405  GRSGQYLYAIGVY  417


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  540  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  599

Query  34   GYYIDAIGTY  5
            G Y++AIG Y
Sbjct  600  GRYLNAIGVY  609



>ref|XP_008677994.1| PREDICTED: mannose/glucose-specific lectin-like isoform X6 [Zea 
mays]
Length=684

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G   GTPF+ Q QN  +IVGFF
Sbjct  246  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  305

Query  43   GRSGYYIDAIGTY  5
            GRSG Y+ AIG Y
Sbjct  306  GRSGQYLYAIGVY  318


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  441  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  500

Query  34   GYYIDAIGTY  5
            G Y++AIG Y
Sbjct  501  GRYLNAIGVY  510



>ref|XP_010273654.1| PREDICTED: mannose/glucose-specific lectin-like [Nelumbo nucifera]
Length=147

 Score = 75.5 bits (184),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/82 (52%), Positives = 51/82 (62%), Gaps = 4/82 (5%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAFASSDN---VLRSIKFTTNAREFGTYGPNVGTPFNFQAQ  71
            D I I   DEYLT ISGTFG    + N   V+RSI+F TNAR +G YG   GT F+   +
Sbjct  64   DQIQIAWPDEYLTSISGTFGRRWKNQNGHVVVRSIQFNTNARSYGPYGSTDGTAFSLPVK  123

Query  70   NGNKIVGFFGRSGYYIDAIGTY  5
             G KIVGF GR G  +D+IG Y
Sbjct  124  QG-KIVGFHGRCGADLDSIGVY  144



>ref|XP_008677996.1| PREDICTED: mannose/glucose-specific lectin-like isoform X8 [Zea 
mays]
 ref|XP_008677997.1| PREDICTED: mannose/glucose-specific lectin-like isoform X8 [Zea 
mays]
Length=652

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G   GTPF+ Q QN  +IVGFF
Sbjct  214  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  273

Query  43   GRSGYYIDAIGTY  5
            GRSG Y+ AIG Y
Sbjct  274  GRSGQYLYAIGVY  286


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  409  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  468

Query  34   GYYIDAIGTY  5
            G Y++AIG Y
Sbjct  469  GRYLNAIGVY  478



>ref|XP_008677992.1| PREDICTED: mannose/glucose-specific lectin-like isoform X4 [Zea 
mays]
Length=760

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G   GTPF+ Q QN  +IVGFF
Sbjct  322  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  381

Query  43   GRSGYYIDAIGTY  5
            GRSG Y+ AIG Y
Sbjct  382  GRSGQYLYAIGVY  394


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  517  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  576

Query  34   GYYIDAIGTY  5
            G Y++AIG Y
Sbjct  577  GRYLNAIGVY  586



>gb|EMT23136.1| hypothetical protein F775_18655 [Aegilops tauschii]
Length=118

 Score = 74.7 bits (182),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 58/91 (64%), Gaps = 8/91 (9%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GGTE      DTIN+D  + Y+TEISGT G F + D+++ S+K  T+     TYG   
Sbjct  33   GTGGTE------DTINLDATN-YVTEISGTVGKFGT-DDIVTSLKIVTSKGVTKTYGSGT  84

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            GTPF     +G KIVGFFGR+G ++DAIG Y
Sbjct  85   GTPFRVPVLDGGKIVGFFGRAGAFLDAIGFY  115



>gb|EMS66150.1| hypothetical protein TRIUR3_12251 [Triticum urartu]
Length=307

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 51/76 (67%), Gaps = 1/76 (1%)
 Frame = -2

Query  229  IDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIV  53
            + G  E++ E+SGT+G + A   N++ S+KF TN + +G +G   GTPF    +N + IV
Sbjct  228  VLGASEFVKEVSGTYGIYDADQHNIIMSLKFITNVKAYGPFGEANGTPFTIPVENNSSIV  287

Query  52   GFFGRSGYYIDAIGTY  5
            GFFGRSG Y+DA+G Y
Sbjct  288  GFFGRSGIYLDALGVY  303



>ref|XP_006647196.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Oryza 
brachyantha]
Length=960

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  56
            IN+D E EYL E+ GT G F  S   + S+   TN R +G +G   GTPF    +  + I
Sbjct  881  INLD-EREYLVEVIGTVGPFNVSSEAITSLTLVTNVRSYGPFGQPQGTPFRTPLKKNSCI  939

Query  55   VGFFGRSGYYIDAIGTY  5
            VGFFGRSG Y+DA+G Y
Sbjct  940  VGFFGRSGTYLDAVGVY  956



>ref|XP_006647195.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Oryza 
brachyantha]
Length=1077

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 37/77 (48%), Positives = 47/77 (61%), Gaps = 1/77 (1%)
 Frame = -2

Query  235   INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  56
             IN+D E EYL E+ GT G F  S   + S+   TN R +G +G   GTPF    +  + I
Sbjct  998   INLD-EREYLVEVIGTVGPFNVSSEAITSLTLVTNVRSYGPFGQPQGTPFRTPLKKNSCI  1056

Query  55    VGFFGRSGYYIDAIGTY  5
             VGFFGRSG Y+DA+G Y
Sbjct  1057  VGFFGRSGTYLDAVGVY  1073



>gb|EMT07650.1| Horcolin [Aegilops tauschii]
Length=320

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/72 (47%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = -2

Query  220  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFG  41
            +DEYLT + G +G F  +  V+RS+   +N R +G+YG   G PF   A  G KI+GF  
Sbjct  244  QDEYLTSVHGHYGQFKDT-VVIRSLTLVSNLRSYGSYGKEDGVPFALHAGPGGKIIGFHA  302

Query  40   RSGYYIDAIGTY  5
            RSG ++DAIGTY
Sbjct  303  RSGQFLDAIGTY  314



>gb|EMT11070.1| hypothetical protein F775_02114 [Aegilops tauschii]
Length=332

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -2

Query  220  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFG  41
            +DEYLT + G +G F     V+RS+ F +N R +G YG   G PF   A  G KI+GF  
Sbjct  256  QDEYLTSVHGHYGQFKDF-VVIRSLTFVSNLRSYGPYGKEDGVPFALHAGPGGKIIGFHA  314

Query  40   RSGYYIDAIGTY  5
            RSG ++DAIGTY
Sbjct  315  RSGQFLDAIGTY  326



>gb|AFW60405.1| putative protein kinase superfamily protein [Zea mays]
Length=634

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+LT +SGT G F +  NV+ S+ F TN R +G +G   GTPF+ Q QN  +IVGFF
Sbjct  223  GPSEFLTGVSGTSGPFKNLTNVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFF  282

Query  43   GRSGYYIDAIG  11
            GRSG Y+ AIG
Sbjct  283  GRSGQYLYAIG  293


 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  391  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  450

Query  34   GYYIDAIGTY  5
            G Y++AIG Y
Sbjct  451  GRYLNAIGVY  460



>ref|XP_002440163.1| hypothetical protein SORBIDRAFT_09g027055 [Sorghum bicolor]
 gb|EES18593.1| hypothetical protein SORBIDRAFT_09g027055 [Sorghum bicolor]
Length=206

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 50/83 (60%), Gaps = 2/83 (2%)
 Frame = -2

Query  250  THNDTINIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGTPFNFQA  74
            +H   I +   DEYLT +SG +   A     V+RS+ F TN R +G +G   GTPF+F  
Sbjct  72   SHTTQIKLSCPDEYLTTVSGHYAPIAHGGSPVIRSLAFRTNLRAYGPFGAAEGTPFSFPV  131

Query  73   QNGNKIVGFFGRSGYYIDAIGTY  5
              G  IVGF+GRSG+ +DA+G Y
Sbjct  132  -VGGVIVGFYGRSGWQLDAVGLY  153



>gb|AAA87041.1| putative 32.6 kDa jasmonate-induced protein [Hordeum vulgare 
subsp. vulgare]
 gb|AAB72096.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = -2

Query  229  IDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIV  53
            + G  E++ E+SGTFG +     N++ S+KF TN + +G +G   GTPF    Q  + IV
Sbjct  225  VLGASEFVKEVSGTFGIYDKDRHNIITSLKFITNVKTYGPFGEAKGTPFTIAVQKNSSIV  284

Query  52   GFFGRSGYYIDAIGTY  5
            GFF RSG Y+DA+G Y
Sbjct  285  GFFARSGIYLDALGVY  300



>ref|XP_004982894.1| PREDICTED: salt stress-induced protein-like [Setaria italica]
Length=151

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 53/91 (58%), Gaps = 6/91 (7%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GG E  V H     + G  E++ EISGT+G F     V+RS+ F TN  + G +G   
Sbjct  64   GSGGQEHKVRH-----MFGAGEFVKEISGTYGPFGG-HTVVRSLTFVTNIGKHGPFGTPW  117

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             TPF+   Q+G  +VGFFGRSG  +DA+G Y
Sbjct  118  QTPFSVPVQDGAHVVGFFGRSGSLLDAVGVY  148



>ref|XP_004980504.1| PREDICTED: protein GOS9-like [Setaria italica]
Length=128

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 48/77 (62%), Gaps = 1/77 (1%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  56
            IN+ G  E++ E+SGT+G F+   NV+ S    TN   +G +G   GTPF+ +      I
Sbjct  47   INL-GPSEFVKEVSGTYGRFSHLPNVITSFTLVTNLCSYGPFGQPSGTPFHTRVDRTGSI  105

Query  55   VGFFGRSGYYIDAIGTY  5
            VGFFGRSG Y+DAIG Y
Sbjct  106  VGFFGRSGKYLDAIGVY  122



>ref|XP_006662244.1| PREDICTED: uncharacterized protein LOC102708001 [Oryza brachyantha]
Length=334

 Score = 73.2 bits (178),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/74 (50%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN-KIVGF  47
            GE E +TE+SGT G F   +NV+ S+   TN R +G +G   G PF+      N  IVGF
Sbjct  256  GESEVVTEVSGTIGPFHHLNNVITSLSIVTNLRSYGPFGSAKGIPFSTSTLVSNSSIVGF  315

Query  46   FGRSGYYIDAIGTY  5
            FGRSG Y+DAIG Y
Sbjct  316  FGRSGSYLDAIGVY  329



>gb|EEE60695.1| hypothetical protein OsJ_14181 [Oryza sativa Japonica Group]
Length=95

 Score = 70.1 bits (170),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = -2

Query  280  IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYG-  107
            +G  G++  V H   +   G  +++ EISGT G + S   NVLRS+K TT  R +G YG 
Sbjct  1    MGHWGSDGGVPHEIHL---GLMDFVMEISGTTGMWVSGMSNVLRSLKITTLKRTYGPYGN  57

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            P  G PF+F     ++I GFF R+G+  DAIG Y
Sbjct  58   PKAGIPFSFSVDGSDRITGFFVRAGFITDAIGVY  91



>ref|XP_009589464.1| PREDICTED: agglutinin-like, partial [Nicotiana tomentosiformis]
Length=363

 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 50/81 (62%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
             D + I+    EYLT I GTFG    S  V++S+ F TNAR +G +G  +GTPF+   + 
Sbjct  99   RDKVVIEAASLEYLTGIKGTFG-HCGSYLVIKSLCFETNARNYGPFGSEIGTPFSLVMKE  157

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G  IVGF GR G Y+DAIG Y
Sbjct  158  GGAIVGFHGRCGAYLDAIGVY  178


 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYL  I GTF  + S   V+ S+ F TNA+ +G +G   G TPF+F  + G  I GF GR
Sbjct  297  EYLIGIKGTFRRYGS-HFVINSLCFITNAKNYGPFGSEAGGTPFSFVMKEGGAIEGFHGR  355

Query  37   SGYYIDAI  14
             G Y+DAI
Sbjct  356  CGAYLDAI  363



>ref|XP_009763450.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X3 [Nicotiana sylvestris]
Length=1740

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 40/91 (44%), Positives = 52/91 (57%), Gaps = 6/91 (7%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GG    V   +T       EYLT I GTFG +    +V++S+ F TNA+ +G +G   
Sbjct  19   GDGGRRDKVVMEET-----PLEYLTCIKGTFG-YCGGYSVVKSLCFITNAKNYGPFGCEA  72

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            GTPF+   + G  IVGF GR G Y+DAIG Y
Sbjct  73   GTPFSLVMKEGGAIVGFHGRCGAYLDAIGVY  103


 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GG    V   +T       E+LT I GT G F    +V++S+ FTTN + +G +G   
Sbjct  201  GNGGRINKVVFEET-----PLEHLTGIKGTLGCF-DGYSVIKSLCFTTNVKNYGPFGSEG  254

Query  97   G-TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            G TPF+   + G  IVGF GR G Y+DAIG Y
Sbjct  255  GGTPFSLVMKEGVAIVGFHGRCGAYLDAIGVY  286


 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG + +   V++S+ F TNA  +G +G + G TPF+   + G  IVGF G 
Sbjct  423  EYLTGIKGTFGCY-NGHCVIKSLCFITNANNYGPFGSDAGGTPFSLVMKEGVAIVGFHGL  481

Query  37   SGYYIDAIGTY  5
             G Y+DAIG Y
Sbjct  482  CGAYLDAIGIY  492



>ref|XP_009772163.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009772164.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
Length=1547

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG +     V++S+ F TNA  +G +G N G TPF+   + G  IVGF GR
Sbjct  241  EYLTGIKGTFGCYYDH-CVIKSLCFITNANNYGPFGSNAGGTPFSLVMKEGVAIVGFHGR  299

Query  37   SGYYIDAIGTY  5
            SG+Y+DAIG Y
Sbjct  300  SGFYLDAIGVY  310


 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 50/92 (54%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GG    V   +T       E LT I GT G F +   V++S+ FTTN + +G +G   
Sbjct  19   GNGGQINKVVFEET-----PLERLTGIKGTLGRF-NGHLVVKSLCFTTNVKNYGPFGSEG  72

Query  97   G-TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            G TPF+   + G  I+GF GR G Y+DAIG Y
Sbjct  73   GGTPFSHVMKEGGAIMGFHGRCGEYLDAIGVY  104



>ref|XP_009772162.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X2 [Nicotiana sylvestris]
Length=1598

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG +     V++S+ F TNA  +G +G N G TPF+   + G  IVGF GR
Sbjct  293  EYLTGIKGTFGCYYDH-CVIKSLCFITNANNYGPFGSNAGGTPFSLVMKEGVAIVGFHGR  351

Query  37   SGYYIDAIGTY  5
            SG+Y+DAIG Y
Sbjct  352  SGFYLDAIGVY  362


 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 50/92 (54%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GG    V   +T       E LT I GT G F +   V++S+ FTTN + +G +G   
Sbjct  71   GNGGQINKVVFEET-----PLERLTGIKGTLGRF-NGHLVVKSLCFTTNVKNYGPFGSEG  124

Query  97   G-TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            G TPF+   + G  I+GF GR G Y+DAIG Y
Sbjct  125  GGTPFSHVMKEGGAIMGFHGRCGEYLDAIGVY  156



>ref|XP_009772161.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X1 [Nicotiana sylvestris]
Length=1599

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG +     V++S+ F TNA  +G +G N G TPF+   + G  IVGF GR
Sbjct  293  EYLTGIKGTFGCYYDH-CVIKSLCFITNANNYGPFGSNAGGTPFSLVMKEGVAIVGFHGR  351

Query  37   SGYYIDAIGTY  5
            SG+Y+DAIG Y
Sbjct  352  SGFYLDAIGVY  362


 Score = 63.5 bits (153),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 38/92 (41%), Positives = 50/92 (54%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GG    V   +T       E LT I GT G F +   V++S+ FTTN + +G +G   
Sbjct  71   GNGGQINKVVFEET-----PLERLTGIKGTLGRF-NGHLVVKSLCFTTNVKNYGPFGSEG  124

Query  97   G-TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            G TPF+   + G  I+GF GR G Y+DAIG Y
Sbjct  125  GGTPFSHVMKEGGAIMGFHGRCGEYLDAIGVY  156



>ref|XP_009763421.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763428.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763437.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
Length=1810

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 40/91 (44%), Positives = 52/91 (57%), Gaps = 6/91 (7%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GG    V   +T       EYLT I GTFG +    +V++S+ F TNA+ +G +G   
Sbjct  89   GDGGRRDKVVMEET-----PLEYLTCIKGTFG-YCGGYSVVKSLCFITNAKNYGPFGCEA  142

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            GTPF+   + G  IVGF GR G Y+DAIG Y
Sbjct  143  GTPFSLVMKEGGAIVGFHGRCGAYLDAIGVY  173


 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GG    V   +T       E+LT I GT G F    +V++S+ FTTN + +G +G   
Sbjct  271  GNGGRINKVVFEET-----PLEHLTGIKGTLGCF-DGYSVIKSLCFTTNVKNYGPFGSEG  324

Query  97   G-TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            G TPF+   + G  IVGF GR G Y+DAIG Y
Sbjct  325  GGTPFSLVMKEGVAIVGFHGRCGAYLDAIGVY  356


 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG + +   V++S+ F TNA  +G +G + G TPF+   + G  IVGF G 
Sbjct  493  EYLTGIKGTFGCY-NGHCVIKSLCFITNANNYGPFGSDAGGTPFSLVMKEGVAIVGFHGL  551

Query  37   SGYYIDAIGTY  5
             G Y+DAIG Y
Sbjct  552  CGAYLDAIGIY  562



>emb|CDM80625.1| unnamed protein product [Triticum aestivum]
 emb|CDM80626.1| unnamed protein product [Triticum aestivum]
Length=307

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 35/72 (49%), Positives = 45/72 (63%), Gaps = 1/72 (1%)
 Frame = -2

Query  220  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFG  41
            +DEYLT + G +G F     V+RS+KF +N R +G YG   G  F   A  G KI+GF  
Sbjct  231  QDEYLTSVHGHYGQFKGF-VVVRSLKFVSNLRSYGPYGKEDGVSFALHAGPGGKIIGFHA  289

Query  40   RSGYYIDAIGTY  5
            RSG ++DAIGTY
Sbjct  290  RSGQFLDAIGTY  301



>sp|Q5U9T2.1|LECH_HORVU RecName: Full=Horcolin; AltName: Full=Agglutinin; AltName: Full=Mannose-specific 
lectin [Hordeum vulgare]
 sp|P82953.2|LECH_HORVD RecName: Full=Horcolin; AltName: Full=Agglutinin; AltName: Full=Mannose-specific 
lectin [Hordeum vulgare subsp. vulgare]
 gb|AAK54458.1| horcolin [Hordeum vulgare subsp. vulgare]
 gb|AAV39531.1| horcolin [Hordeum vulgare]
 dbj|BAJ87539.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=146

 Score = 70.5 bits (171),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 56/91 (62%), Gaps = 8/91 (9%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GGTE      DTIN+D  + Y+TEISGT G F + D+++ S+K  T+     TYG   
Sbjct  61   GTGGTE------DTINLDATN-YVTEISGTVGKFGT-DDIVTSLKIITSKGVTRTYGSGT  112

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            G PF     +G KI GFFGR+G ++DAIG Y
Sbjct  113  GIPFRVPVLDGGKIAGFFGRAGAFLDAIGFY  143



>gb|EMS55842.1| hypothetical protein TRIUR3_32339 [Triticum urartu]
Length=288

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  229  IDGEDEYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIV  53
            + G  E++ E+SGTFG +   + N++ S+KF TN + +G +G   GT F    Q  + IV
Sbjct  209  VLGTSEFVKEVSGTFGLYGRDNHNIITSLKFVTNMKTYGPFGQAKGTTFTIPVQKNSSIV  268

Query  52   GFFGRSGYYIDAIGTY  5
            GFFGRSG Y+DA+G Y
Sbjct  269  GFFGRSGIYLDALGVY  284



>gb|EMT24046.1| hypothetical protein F775_25349 [Aegilops tauschii]
Length=304

 Score = 72.0 bits (175),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  229  IDGEDEYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIV  53
            + G  E++ E+SGTFG +   + N++ S+KF TN + +G +G   GT F    Q  + IV
Sbjct  225  VLGTSEFVKEVSGTFGLYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIV  284

Query  52   GFFGRSGYYIDAIGTY  5
            GFFGRSG Y+DA+G Y
Sbjct  285  GFFGRSGIYLDALGVY  300



>gb|AAR20919.1| jasmonate-induced protein [Triticum aestivum]
Length=304

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  229  IDGEDEYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIV  53
            + G  E++ E+SGTFG +   + N++ S+KF TN + +G +G   GT F    Q  + IV
Sbjct  225  VLGTSEFVKEVSGTFGLYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIV  284

Query  52   GFFGRSGYYIDAIGTY  5
            GFFGRSG Y+DA+G Y
Sbjct  285  GFFGRSGIYLDALGVY  300



>ref|XP_004297619.1| PREDICTED: agglutinin-like [Fragaria vesca subsp. vesca]
Length=321

 Score = 72.0 bits (175),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 3/78 (4%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGA---FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            I ++  DE+L  ISG +        +  VLRS+KF +N R FG +G   GTPF F+ ++ 
Sbjct  91   IKLECPDEFLVSISGYYCGVTWIVGAPVVLRSLKFESNKRTFGPFGNQFGTPFTFKVKDS  150

Query  64   NKIVGFFGRSGYYIDAIG  11
            ++IVGF GR G Y+DAIG
Sbjct  151  DRIVGFKGRKGRYLDAIG  168


 Score = 72.0 bits (175),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 57/83 (69%), Gaps = 4/83 (5%)
 Frame = -2

Query  241  DTINIDGE--DEYLTEISG--TFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQA  74
            DT+ +  E  +E++  +SG  ++  + S   V+RS+KF +N R +G +G  VGTPF+F+ 
Sbjct  238  DTVQVKLEYPNEFMVTVSGHISWVPWMSGTRVVRSLKFDSNRRTYGPFGVQVGTPFSFRV  297

Query  73   QNGNKIVGFFGRSGYYIDAIGTY  5
            ++G++IVG  GRSG+Y+ AIG Y
Sbjct  298  KDGDQIVGLRGRSGWYLYAIGFY  320



>gb|ABS82785.1| jasmonate-induced protein [Triticum aestivum]
Length=304

 Score = 71.6 bits (174),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = -2

Query  229  IDGEDEYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIV  53
            + G  E++ E+SGTFG +   + N++ S+KF TN + +G +G   GT F    Q  + IV
Sbjct  225  VLGTSEFVREVSGTFGLYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIV  284

Query  52   GFFGRSGYYIDAIGTY  5
            GFFGRSG Y+DA+G Y
Sbjct  285  GFFGRSGIYLDALGVY  300



>ref|XP_009769147.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1335

 Score = 73.9 bits (180),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG F    +V++S+ F TNA+ +G +G   G TPF+   + G  IVGF GR
Sbjct  99   EYLTGIKGTFGRFYGH-SVIKSLCFITNAKNYGPFGSEAGGTPFSLVMKEGVAIVGFHGR  157

Query  37   SGYYIDAIGTY  5
            SG Y+DAIG Y
Sbjct  158  SGLYLDAIGVY  168



>ref|XP_004291831.1| PREDICTED: uncharacterized protein LOC101310192 [Fragaria vesca 
subsp. vesca]
Length=642

 Score = 73.6 bits (179),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 50/80 (63%), Gaps = 1/80 (1%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            DT+ +D  +E+LT   G +G  +    V LRSI F +N R +G +G   GT F+     G
Sbjct  72   DTVQLDYPEEFLTSFHGYYGKISEWGTVSLRSITFKSNKRSYGPFGMEQGTYFSLPVTTG  131

Query  64   NKIVGFFGRSGYYIDAIGTY  5
            NKIVGF G+SG+Y+DAIG +
Sbjct  132  NKIVGFHGKSGWYVDAIGAH  151


 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            +D I  D  +E LT I+GTFG       NV++S+ F T  ++ G YG   GT F+ Q + 
Sbjct  308  SDRIIFDYPNEILTHITGTFGPVMGMGPNVIKSMSFHTTKKKHGPYGEEQGTQFSTQLRE  367

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G KIVG  GR+G ++DAIG +
Sbjct  368  G-KIVGIHGRTGLFLDAIGVH  387


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 51/93 (55%), Gaps = 8/93 (9%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGP  104
            G GGT  +      I ++   E L+ ISG +   + ++   +++S+ F T+  ++G +G 
Sbjct  536  GNGGTSPH-----RIKLEYPHEVLSCISGYYSCISKNERPQIIKSLTFYTSRGKYGPFGE  590

Query  103  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             VGT F      G K+VGF GRS  Y+DAIG +
Sbjct  591  EVGTFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  622



>ref|XP_002449838.1| hypothetical protein SORBIDRAFT_05g024220 [Sorghum bicolor]
 gb|EES08826.1| hypothetical protein SORBIDRAFT_05g024220 [Sorghum bicolor]
Length=281

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = -2

Query  220  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFG  41
            + E++ E+SGTFG +A   NV+ SIK  TN + +G +G   G+ F+   Q  + + GFFG
Sbjct  206  DSEFVKEVSGTFGMYAKVVNVINSIKLVTNVKTYGPFGQENGSSFSVPVQGNSGVAGFFG  265

Query  40   RSGYYIDAIGTY  5
            RSG ++DAIG Y
Sbjct  266  RSGKFLDAIGVY  277



>ref|XP_009614996.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009614997.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1313

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG F    +V++S+ F TNA+ +G +G   G TPF+   + G  IVGF GR
Sbjct  55   EYLTGIKGTFGCFYGH-SVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHGR  113

Query  37   SGYYIDAIGTY  5
            SG Y+DAIG Y
Sbjct  114  SGLYLDAIGVY  124



>ref|XP_009614994.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=1334

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG F    +V++S+ F TNA+ +G +G   G TPF+   + G  IVGF GR
Sbjct  102  EYLTGIKGTFGCFYGH-SVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHGR  160

Query  37   SGYYIDAIGTY  5
            SG Y+DAIG Y
Sbjct  161  SGLYLDAIGVY  171



>ref|XP_009614993.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=1351

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG F    +V++S+ F TNA+ +G +G   G TPF+   + G  IVGF GR
Sbjct  102  EYLTGIKGTFGCFYGH-SVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHGR  160

Query  37   SGYYIDAIGTY  5
            SG Y+DAIG Y
Sbjct  161  SGLYLDAIGVY  171



>ref|XP_009614991.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009614992.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=1360

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/71 (52%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG F    +V++S+ F TNA+ +G +G   G TPF+   + G  IVGF GR
Sbjct  102  EYLTGIKGTFGCFYGH-SVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHGR  160

Query  37   SGYYIDAIGTY  5
            SG Y+DAIG Y
Sbjct  161  SGLYLDAIGVY  171



>ref|XP_003573652.1| PREDICTED: horcolin-like [Brachypodium distachyon]
Length=102

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 57/93 (61%), Gaps = 7/93 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFG--TYGP  104
            G GG E NV     I +D  D Y+T ISGTFG    +D V+ S+K +T   + G  TYG 
Sbjct  12   GPGGDEQNVQ----ITLDPTD-YVTGISGTFGTAFDNDRVVTSLKISTFKEKDGSKTYGK  66

Query  103  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
              GTPF+   ++G ++VGFFGRSG  +DAIG Y
Sbjct  67   PNGTPFHIPVRDGGRVVGFFGRSGDMLDAIGVY  99



>ref|NP_001052399.1| Os04g0295400 [Oryza sativa Japonica Group]
 emb|CAD40444.2| OSJNBa0041M21.2 [Oryza sativa Japonica Group]
 dbj|BAF14313.1| Os04g0295400 [Oryza sativa Japonica Group]
Length=150

 Score = 69.7 bits (169),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = -2

Query  280  IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYG-  107
            +G  G++  V H   +   G  +++ EISGT G + S   NVLRS+K TT  R +G YG 
Sbjct  56   MGHWGSDGGVPHEIHL---GLMDFVMEISGTTGMWVSGMSNVLRSLKITTLKRTYGPYGN  112

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            P  G PF+F     ++I GFF R+G+  DAIG Y
Sbjct  113  PKAGIPFSFSVDGSDRITGFFVRAGFITDAIGVY  146



>ref|XP_008804538.1| PREDICTED: uncharacterized protein LOC103717797 [Phoenix dactylifera]
Length=602

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 57/91 (63%), Gaps = 6/91 (7%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GGT+T     D + +D   E LT +SG FG+ +S   ++RS+ F +N  ++G +G   
Sbjct  65   GNGGTKT-----DKVKLDHPHEILTSVSGYFGSLSSGSPLIRSLTFESNQAKYGPFGFEQ  119

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            G  F+F   +G KIVGF GRSG+Y+D+IG Y
Sbjct  120  GMRFSF-PMSGGKIVGFHGRSGWYLDSIGFY  149


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 47/92 (51%), Gaps = 7/92 (8%)
 Frame = -2

Query  274  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN--VLRSIKFTTNAREFGTYGPN  101
            GG  ET  TH   I  D   E L  +SG +      +   V++S+ F T   ++G +G  
Sbjct  495  GGSGET--THR--IKFDYPHEVLNCVSGYYATINRDERPTVIKSLTFCTTRGKYGPFGEE  550

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            VGT F      G K+VGF GRS  Y+DAIG +
Sbjct  551  VGTHFTSATTKG-KVVGFHGRSALYLDAIGVH  581


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 48/92 (52%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPN  101
            G GG  T     D I  D   E LT I+G FG A       ++S+ F T  R++G +G  
Sbjct  300  GSGGIRT-----DKIVFDFPFEILTYITGYFGTAMFMGPTAIKSLTFHTTKRKYGPFGDE  354

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             G  F+    +   +VGF GRSG+YID+IG +
Sbjct  355  QGMFFSSGLADA-MVVGFHGRSGWYIDSIGVH  385



>gb|EAY93469.1| hypothetical protein OsI_15270 [Oryza sativa Indica Group]
Length=150

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 5/94 (5%)
 Frame = -2

Query  280  IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYG-  107
            +G  G++  V H   +   G  +++ EISGT G + S   NVLRS+K TT  R +G YG 
Sbjct  56   MGHWGSDGGVPHEIHL---GLMDFVMEISGTTGMWVSGMRNVLRSLKITTLKRTYGPYGN  112

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            P  G PF+F     ++I GFF R+G+  DAIG Y
Sbjct  113  PEAGIPFSFSVDGSDRITGFFVRAGFITDAIGVY  146



>ref|XP_009784520.1| PREDICTED: uncharacterized protein LOC104232941, partial [Nicotiana 
sylvestris]
Length=1047

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/92 (46%), Positives = 54/92 (59%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP-N  101
            GGGG    V    T       EYLT I+GTFG +  S  V++S+ F TNA+ +G +G  +
Sbjct  78   GGGGRRAKVVFEAT-----PLEYLTGINGTFG-YGGSHLVIKSLCFITNAKSYGPFGSKD  131

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GTPF+   + G  IVGF G SG Y+DAIG Y
Sbjct  132  GGTPFSLVMKEGVAIVGFHGCSGLYLDAIGVY  163



>ref|XP_009768641.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana sylvestris]
Length=1282

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG    S +V++S+ F TNA+ +G +G   G TPF+   + G  IVGF GR
Sbjct  29   EYLTGIKGTFG-LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHGR  87

Query  37   SGYYIDAIGTY  5
             G Y+DAIG Y
Sbjct  88   CGAYLDAIGVY  98



>gb|EAZ01021.1| hypothetical protein OsI_23055 [Oryza sativa Indica Group]
Length=694

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 54/93 (58%), Gaps = 5/93 (5%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPN  101
            GG G    + H  TI++ G  EYL EISGT G F  + + V+ S+   T  R +G YG  
Sbjct  296  GGHGANKGIDH--TIHL-GPSEYLIEISGTVGPFTYAPHGVITSLTLVTTIRTYGPYGEL  352

Query  100  VGTPFNFQAQN-GNKIVGFFGRSGYYIDAIGTY  5
            VG PF+   QN G  IVGFF R G+Y+DA G Y
Sbjct  353  VGNPFHIPMQNKGGSIVGFFARVGWYVDAFGIY  385


 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG-NKIVGF  47
            G  E++T + GT G F +  +V+ S++F TNA ++G +G  +GT F      G + IVGF
Sbjct  617  GPSEFVTAVYGTVGPFGNYSSVITSLRFVTNAGKYGPFGQGIGTHFQAPMHKGSSSIVGF  676

Query  46   FGRSGYYIDAIGTY  5
            FGRS   +++IG Y
Sbjct  677  FGRSSSCVESIGFY  690


 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 41/70 (59%), Gaps = 5/70 (7%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E+LT  SGT G      NV+ S+   TNAR +G +G   G PF    +N   IVGFFGR+
Sbjct  470  EFLTGFSGTTG-----HNVVTSLTLITNARSYGPFGQVGGAPFQVPMRNNASIVGFFGRA  524

Query  34   GYYIDAIGTY  5
              Y++AIG Y
Sbjct  525  DQYLNAIGVY  534



>ref|XP_009768640.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=1339

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG    S +V++S+ F TNA+ +G +G   G TPF+   + G  IVGF GR
Sbjct  86   EYLTGIKGTFG-LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHGR  144

Query  37   SGYYIDAIGTY  5
             G Y+DAIG Y
Sbjct  145  CGAYLDAIGVY  155



>ref|XP_009768636.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768638.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768639.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1355

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 46/71 (65%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG    S +V++S+ F TNA+ +G +G   G TPF+   + G  IVGF GR
Sbjct  102  EYLTGIKGTFG-LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHGR  160

Query  37   SGYYIDAIGTY  5
             G Y+DAIG Y
Sbjct  161  CGAYLDAIGVY  171



>ref|XP_009768586.1| PREDICTED: jacalin-related lectin 3-like [Nicotiana sylvestris]
Length=225

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 55/99 (56%), Gaps = 14/99 (14%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            GGGG    V    T       EYLT I+GTFG    SD V++S+ F TNA+ +G +G + 
Sbjct  109  GGGGRRAKVVFEAT-----PLEYLTGINGTFG-HDGSDLVIKSLCFITNAKSYGPFGSSY  162

Query  97   G--------TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            G        TPF+   + G  IVGF GRSG Y+DAIG Y
Sbjct  163  GPFGSMVGGTPFSLVMKEGVAIVGFHGRSGLYLDAIGVY  201



>gb|EAY80990.1| hypothetical protein OsI_36172 [Oryza sativa Indica Group]
Length=1081

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 50/91 (55%), Gaps = 6/91 (7%)
 Frame = -2

Query  277   GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
             GG G    + H D        E +TE+SGT G F+   +V+ S++  TN R +G +G   
Sbjct  994   GGVGGSVRMIHLDP------SEIVTEVSGTCGPFSQFPSVVTSLQLVTNLRSYGPFGQAK  1047

Query  97    GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F  + +    IVGFFGRS  Y+DAIG Y
Sbjct  1048  GTKFRTRVKQNGSIVGFFGRSTIYLDAIGVY  1078



>ref|XP_006663456.1| PREDICTED: disease resistance protein RPM1-like [Oryza brachyantha]
Length=1102

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 36/91 (40%), Positives = 49/91 (54%), Gaps = 6/91 (7%)
 Frame = -2

Query  277   GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
             GG G    + H          E++ E+SGT+G F S  +V+ S++  TN R +G +G   
Sbjct  1015  GGAGGTVRMVHL------APSEFVKEVSGTYGPFFSFPSVITSLQLRTNIRSYGPFGEPK  1068

Query  97    GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F  + +    IVGFFG S  YIDAIG Y
Sbjct  1069  GTTFRTRVKQNGSIVGFFGHSTVYIDAIGVY  1099



>ref|XP_008244775.1| PREDICTED: LOW QUALITY PROTEIN: agglutinin-like [Prunus mume]
Length=343

 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 53/91 (58%), Gaps = 8/91 (9%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGA--FASSDNVLRSIKFTTNAREFGTYGP  104
            G GG +T     D I +   DE+L  +SG +    F     ++RS+KF +N R FG YG 
Sbjct  230  GRGGNQT-----DEIKLQYPDEFLVGVSGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGI  284

Query  103  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIG  11
              GTPF F   +G KIVG  GRSG+Y+DAIG
Sbjct  285  EEGTPFTFTV-DGGKIVGLKGRSGWYLDAIG  314


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 45/77 (58%), Gaps = 3/77 (4%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGA--FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  62
            I +   DEYL   SG +    F     ++RS+KF +N R FG YG   GTPF F   +G 
Sbjct  83   IKLQYPDEYLVGASGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGG  141

Query  61   KIVGFFGRSGYYIDAIG  11
            +IVG  GR G+Y++AIG
Sbjct  142  QIVGLKGRDGWYLNAIG  158



>ref|XP_010230396.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
 ref|XP_010230397.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
Length=246

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  56
            I +D +DEYLT + G +G F    +V+R++ F +N R  G YG + G  F   A  G KI
Sbjct  168  ICLD-KDEYLTGVKGRYGQF-DGWSVIRALTFVSNRRTIGPYGTDEGMEFELPAAGGGKI  225

Query  55   VGFFGRSGYYIDAIGTY  5
            VGF GRSG  +DAIGTY
Sbjct  226  VGFHGRSGGLVDAIGTY  242



>gb|EEC72970.1| hypothetical protein OsI_06866 [Oryza sativa Indica Group]
Length=1072

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = -2

Query  235   INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  56
             I++D E E+L E+ GT G F      + S+   TN R +G +G   GTPF    +  + I
Sbjct  993   IDLD-EREFLMEVIGTVGPFNVLSEAITSLTLVTNVRSYGPFGQPQGTPFRTPRKKNSCI  1051

Query  55    VGFFGRSGYYIDAIGTY  5
             VGFFGRSG Y+DA+G Y
Sbjct  1052  VGFFGRSGTYLDAVGVY  1068



>dbj|BAD23250.1| putative LZ-NBS-LRR class RGA [Oryza sativa Japonica Group]
 dbj|BAD23344.1| putative LZ-NBS-LRR class RGA [Oryza sativa Japonica Group]
 gb|EAZ22703.1| hypothetical protein OsJ_06375 [Oryza sativa Japonica Group]
Length=1072

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 1/77 (1%)
 Frame = -2

Query  235   INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  56
             I++D E E+L E+ GT G F      + S+   TN R +G +G   GTPF    +  + I
Sbjct  993   IDLD-EREFLMEVIGTVGPFNVLSEAITSLTLVTNVRSYGPFGQPQGTPFRTPRKKNSCI  1051

Query  55    VGFFGRSGYYIDAIGTY  5
             VGFFGRSG Y+DA+G Y
Sbjct  1052  VGFFGRSGTYLDAVGVY  1068



>ref|XP_009795366.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795367.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795368.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795369.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795370.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795371.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795372.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795373.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795374.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795375.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1346

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 35/71 (49%), Positives = 47/71 (66%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG-PNVGTPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG F    ++++S+ F TNA+ +G +G    GTPF+   + G  IVGF GR
Sbjct  102  EYLTGIKGTFGRFYDR-SIIKSLCFITNAKNYGPFGCEAAGTPFSLVMEEGVAIVGFHGR  160

Query  37   SGYYIDAIGTY  5
            SG ++DAIG Y
Sbjct  161  SGLFLDAIGVY  171



>emb|CDP17400.1| unnamed protein product [Coffea canephora]
Length=317

 Score = 69.3 bits (168),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = -2

Query  274  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG-PNV  98
            GG    N+   + I I    EYLT I+GT+G F +   V+ S+ F TN + +G +G P+ 
Sbjct  79   GGNNPNNIGKEEKITIQWPSEYLTSITGTYGDF-NGLLVIYSLSFVTNQKAYGPFGSPSS  137

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            G  F+    +GN IVGF GRSG+YIDAIG Y
Sbjct  138  GQAFS-SPPDGNVIVGFHGRSGWYIDAIGIY  167


 Score = 66.6 bits (161),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 51/91 (56%), Gaps = 2/91 (2%)
 Frame = -2

Query  274  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG-PNV  98
            GG    N+   + I I    EYLT I GTFG F + D V+ S+ F TN + +G +G  N 
Sbjct  223  GGKDPNNIGKEEKITIQWPSEYLTSIKGTFGNF-NGDVVIYSLSFITNNKTYGPFGSANS  281

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            G  F      GN +VGF G SG++IDA+G Y
Sbjct  282  GQAFTASPPAGNVVVGFHGMSGWFIDALGIY  312



>gb|EEE52450.1| hypothetical protein OsJ_34606 [Oryza sativa Japonica Group]
Length=370

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVGTPFNFQAQNGNKIVGF  47
            G  E++  +SGT G+F    NV+ S+KFTTN  R +G YG   GTPF    ++   IVGF
Sbjct  292  GAFEHIKGLSGTVGSFGMLQNVITSLKFTTNLNRTYGPYGKGGGTPFVVPVEDAASIVGF  351

Query  46   FGRSGYYIDAIGTY  5
            FGR+G  ++A+G Y
Sbjct  352  FGRAGPCVEAVGVY  365



>ref|XP_009338132.1| PREDICTED: uncharacterized protein LOC103930515 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009338133.1| PREDICTED: uncharacterized protein LOC103930515 isoform X1 [Pyrus 
x bretschneideri]
Length=764

 Score = 70.9 bits (172),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 38/90 (42%), Positives = 53/90 (59%), Gaps = 7/90 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPN  101
            G GGT+T       I ++  DEYL  ++G +   A     ++RS+KF +N R FG +G  
Sbjct  649  GRGGTQTA-----EIKLEYPDEYLVSVTGNYCLLAYGGTAIIRSLKFQSNRRTFGPFGIQ  703

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIG  11
             GT F +  + G KIVG  GR+G+YIDAIG
Sbjct  704  EGTTFTYNVEGG-KIVGLKGRNGWYIDAIG  732



>ref|XP_006853911.1| hypothetical protein AMTR_s00036p00183970 [Amborella trichopoda]
 gb|ERN15378.1| hypothetical protein AMTR_s00036p00183970 [Amborella trichopoda]
Length=126

 Score = 67.0 bits (162),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I     +E++T +SG +     S   V+RS+KF TN + +G YG   GTPF+F   +G  
Sbjct  16   IKFQYPEEFITGVSGHYSPMVHSGTPVIRSLKFATNRKTYGPYGVEEGTPFSF-PMDGGH  74

Query  58   IVGFFGRSGYYIDAIG  11
            IVGF GRSG+Y+DAIG
Sbjct  75   IVGFKGRSGWYLDAIG  90



>ref|XP_010232946.1| PREDICTED: uncharacterized protein LOC104583002 [Brachypodium 
distachyon]
Length=250

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 1/72 (1%)
 Frame = -2

Query  220  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFG  41
             DE+LT + G  G  A    V++S+ F +N R +G YG + G PF   A  G +IVGF G
Sbjct  153  RDEHLTCVKGLLGNHAQW-FVVKSLTFVSNRRTYGPYGEDHGVPFELPAPAGGRIVGFHG  211

Query  40   RSGYYIDAIGTY  5
            RSG  +DAIGTY
Sbjct  212  RSGGLLDAIGTY  223



>ref|NP_001148739.1| LOC100282355 [Zea mays]
 gb|ACG32703.1| agglutinin [Zea mays]
Length=207

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 48/83 (58%), Gaps = 2/83 (2%)
 Frame = -2

Query  250  THNDTINIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGTPFNFQA  74
            +H   I +   DEYLT +SG +   A     V+RS+ F TN   +G +G   GTPF F  
Sbjct  73   SHTTQIKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV  132

Query  73   QNGNKIVGFFGRSGYYIDAIGTY  5
             +G  IVGF GRSG+ +DA+G Y
Sbjct  133  -DGGVIVGFCGRSGWQLDAVGLY  154



>ref|NP_001148448.1| jasmonate-induced protein [Zea mays]
 gb|ACG31498.1| jasmonate-induced protein [Zea mays]
Length=184

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 52/94 (55%), Gaps = 9/94 (10%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR---EFGTYG  107
            GG G ET       I + G+ E LTE+SGT G       V+ SIKF T+ +    FG +G
Sbjct  93   GGSGGETE----PVIQL-GDSEVLTELSGTIG-IVDGHTVITSIKFVTSLKTYGPFGAWG  146

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
                TPF    Q G+ IVGFF R+G Y+DA+G Y
Sbjct  147  DGSDTPFAIPVQQGSAIVGFFARAGVYLDALGVY  180



>ref|XP_008677993.1| PREDICTED: mannose/glucose-specific lectin-like isoform X5 [Zea 
mays]
Length=703

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  460  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  519

Query  34   GYYIDAIGTY  5
            G Y++AIG Y
Sbjct  520  GRYLNAIGVY  529



>ref|XP_008654965.1| PREDICTED: LOC100282355 isoform X4 [Zea mays]
Length=211

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 48/83 (58%), Gaps = 2/83 (2%)
 Frame = -2

Query  250  THNDTINIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGTPFNFQA  74
            +H   I +   DEYLT +SG +   A     V+RS+ F TN   +G +G   GTPF F  
Sbjct  79   SHTTQIKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV  138

Query  73   QNGNKIVGFFGRSGYYIDAIGTY  5
             +G  IVGF GRSG+ +DA+G Y
Sbjct  139  -DGGVIVGFCGRSGWQLDAVGLY  160



>ref|XP_006662272.1| PREDICTED: uncharacterized protein LOC102701759 [Oryza brachyantha]
Length=283

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 46/70 (66%), Gaps = 1/70 (1%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E++ E+SGT GAF   DNV+ S+K  TN   +G +G   GTPFN      N I+GFFGR+
Sbjct  212  EFIREVSGTTGAFLG-DNVVTSLKIITNLNMYGPFGVPFGTPFNVPLHGNNGIIGFFGRA  270

Query  34   GYYIDAIGTY  5
            G +++AIG Y
Sbjct  271  GQFLNAIGVY  280



>ref|XP_004964114.1| PREDICTED: mannose/glucose-specific lectin-like [Setaria italica]
Length=118

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 1/72 (1%)
 Frame = -2

Query  220  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFG  41
            + E++ EIS TFG F  +  V+ S+KF TN R FG +   +GTPF+   Q+ + IVGFF 
Sbjct  44   DSEFVKEISRTFGTFDGA-IVVTSLKFVTNVRTFGPWSRGIGTPFSVPVQSRSGIVGFFA  102

Query  40   RSGYYIDAIGTY  5
              G Y+DAIG +
Sbjct  103  HVGKYLDAIGVH  114



>ref|XP_006343016.1| PREDICTED: agglutinin-like [Solanum tuberosum]
Length=201

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  250  THNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQA  74
            +    I +   +EYLT +SG +         V+RS+ F++N R+FG +G   GTPF+   
Sbjct  70   SRTAQIKLQFPEEYLTSVSGYYSPVVYGGSPVIRSLTFSSNKRKFGPFGVEGGTPFSMPM  129

Query  73   QNGNKIVGFFGRSGYYIDAIGTY  5
            + G +IVGF GRSG+Y+DAIG Y
Sbjct  130  E-GGQIVGFKGRSGWYLDAIGFY  151



>ref|XP_004235622.1| PREDICTED: jacalin-related lectin 19 [Solanum lycopersicum]
Length=201

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  250  THNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQA  74
            +    I +   +EYLT +SG +         V+RS+ F++N R+FG +G   GTPF+   
Sbjct  70   SRTAQIKLQFPEEYLTSVSGYYCPVVYGGSPVIRSLTFSSNKRKFGPFGVEGGTPFSMPM  129

Query  73   QNGNKIVGFFGRSGYYIDAIGTY  5
            + G +IVGF GRSG+Y+DAIG Y
Sbjct  130  EGG-QIVGFKGRSGWYVDAIGFY  151



>ref|XP_008677995.1| PREDICTED: mannose/glucose-specific lectin-like isoform X7 [Zea 
mays]
Length=680

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E+LT +SG+ G F    NV+ S+ F TNAR +G +G   GT F+   Q    IVGFFGRS
Sbjct  437  EFLTGVSGSIGTFNGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFFGRS  496

Query  34   GYYIDAIGTY  5
            G Y++AIG Y
Sbjct  497  GRYLNAIGVY  506



>ref|XP_010232948.1| PREDICTED: jacalin-related lectin 19-like [Brachypodium distachyon]
Length=266

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 45/75 (60%), Gaps = 7/75 (9%)
 Frame = -2

Query  217  DEYLTEISGTFGAFASSDNVL--RSIKFTTNARE-FGTYGPNVGTPFNFQAQ-NGNKIVG  50
            DEYL  + G  G +   DN L  RS+ F TNAR  FG YG   G PF   A   G +I+G
Sbjct  191  DEYLAGVKGHVGHY---DNCLVVRSLTFVTNARRSFGPYGKEEGVPFALPAAVAGGRIIG  247

Query  49   FFGRSGYYIDAIGTY  5
            FFG SG Y+DAIGTY
Sbjct  248  FFGSSGLYLDAIGTY  262



>ref|XP_009608039.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
Length=1307

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG    S  V++S+ F TNA+ +G +G   G TPF+   + G  IVGF GR
Sbjct  54   EYLTGIKGTFGR-CGSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHGR  112

Query  37   SGYYIDAIGTY  5
             G Y+DAIG Y
Sbjct  113  CGAYLDAIGVY  123



>ref|XP_009608038.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana tomentosiformis]
Length=1338

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG    S  V++S+ F TNA+ +G +G   G TPF+   + G  IVGF GR
Sbjct  85   EYLTGIKGTFGR-CGSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHGR  143

Query  37   SGYYIDAIGTY  5
             G Y+DAIG Y
Sbjct  144  CGAYLDAIGVY  154



>ref|XP_009608035.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608036.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608037.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=1354

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/71 (51%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG    S  V++S+ F TNA+ +G +G   G TPF+   + G  IVGF GR
Sbjct  101  EYLTGIKGTFGR-CGSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHGR  159

Query  37   SGYYIDAIGTY  5
             G Y+DAIG Y
Sbjct  160  CGAYLDAIGVY  170



>gb|EMT07330.1| Disease resistance protein RPM1 [Aegilops tauschii]
Length=885

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 31/70 (44%), Positives = 45/70 (64%), Gaps = 0/70 (0%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E + EISGTFG +    ++++S+   TN R +G +G   GTPF+ + +    IVGFFG S
Sbjct  813  ELVLEISGTFGPYGQFPSIIKSLMLVTNLRTYGPFGQLHGTPFHSRVKKNGTIVGFFGCS  872

Query  34   GYYIDAIGTY  5
            G ++DAIG Y
Sbjct  873  GEFLDAIGVY  882



>ref|XP_004960703.1| PREDICTED: agglutinin-like [Setaria italica]
Length=321

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 8/93 (9%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GGT T +     IN+ G  E++ E+SGT GA+   +N++R++   TN R +G +G  +
Sbjct  230  GKGGTRTQL-----INL-GPSEFVKEVSGTIGAYRHYNNIIRTLAIVTNVRTYGPFGNQL  283

Query  97   G--TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
                PF+   QN + IVGFF R   ++DAIG Y
Sbjct  284  NGTAPFSIPVQNNSSIVGFFARGQQFLDAIGVY  316



>gb|EMS51533.1| hypothetical protein TRIUR3_05238 [Triticum urartu]
Length=304

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPN  101
            G GG      H   I +   DE+LT +SG +GA A   + V+RS+ F T    +G +G  
Sbjct  158  GAGGN-----HTTQIKLSFPDEHLTAVSGRYGAVAPGGSPVIRSLAFRTERAAYGPFGAA  212

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GTPF F A  G  IVG  GRSG+ +DA+G Y
Sbjct  213  EGTPFEF-AVEGGVIVGLCGRSGWQLDAVGMY  243



>ref|XP_002440568.1| hypothetical protein SORBIDRAFT_09g003330 [Sorghum bicolor]
 gb|EES18998.1| hypothetical protein SORBIDRAFT_09g003330 [Sorghum bicolor]
Length=120

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 52/92 (57%), Gaps = 10/92 (11%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG-PN  101
            G GG +  V   DT       E + EISGT+GAF   +    S+ F TNA + G +G P 
Sbjct  35   GSGGQKHKVRFADT-------EVVKEISGTYGAFDGHEA--SSLTFVTNAGKHGPFGEPR  85

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GTPF+    NG ++VGFF RSG  +DA+G Y
Sbjct  86   QGTPFSVPVHNGGRVVGFFWRSGSLLDALGVY  117



>gb|EAY96520.1| hypothetical protein OsI_18424 [Oryza sativa Indica Group]
Length=144

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVG-TPFNFQAQNGNKIVG  50
            GE E +TE+SGT G +     V+RS+ F T+A +  G +G  VG   F    + G ++VG
Sbjct  67   GEAERITEVSGTLGPWGPHACVVRSLAFVTSAGKTHGPFGEEVGGAAFRVPVKGGGRVVG  126

Query  49   FFGRSGYYIDAIGTY  5
            FF RSG+ +DA+G Y
Sbjct  127  FFARSGWLLDAVGVY  141



>gb|EMS58273.1| hypothetical protein TRIUR3_17900 [Triticum urartu]
Length=304

 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = -2

Query  229  IDGEDEYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIV  53
            + G  E++ E SGTF  +   + N++ S+KF TN + +G +G   GT F    Q  + IV
Sbjct  225  VLGTSEFVKEFSGTFSLYGRDNHNIITSLKFVTNMKTYGPFGQAKGTTFTIPVQKNSNIV  284

Query  52   GFFGRSGYYIDAIGTY  5
            GFFGRSG Y+DA+G Y
Sbjct  285  GFFGRSGIYLDALGVY  300



>ref|NP_001054618.1| Os05g0143600 [Oryza sativa Japonica Group]
 gb|AAU90197.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF16532.1| Os05g0143600 [Oryza sativa Japonica Group]
 gb|EEE62296.1| hypothetical protein OsJ_17084 [Oryza sativa Japonica Group]
Length=152

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVG-TPFNFQAQNGNKIVG  50
            GE E +TE+SGT G +     V+RS+ F T+A +  G +G  VG   F    + G ++VG
Sbjct  75   GEAERVTEVSGTLGPWGPHACVVRSLAFVTSAGKTHGPFGEEVGGAAFRVPVKGGGRVVG  134

Query  49   FFGRSGYYIDAIGTY  5
            FF RSG+ +DA+G Y
Sbjct  135  FFARSGWLLDAVGVY  149



>ref|XP_009622525.1| PREDICTED: agglutinin-like isoform X2 [Nicotiana tomentosiformis]
Length=546

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            EYLT I GTFG    S +V++ + F TNA+ +G +G   GTPF+   + G  IVGF GR 
Sbjct  12   EYLTGIKGTFGR-CGSYSVIKFLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGRC  70

Query  34   GYYIDAIGTY  5
            G Y+DAIG Y
Sbjct  71   GAYLDAIGVY  80


 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            E+LT I GTF  F    +V++S+ F TNA  +G +G   G TPF+   + G  IVGF GR
Sbjct  401  EHLTGIKGTFECF-DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHGR  459

Query  37   SGYYIDAIGTY  5
            SG Y+DAIG Y
Sbjct  460  SGLYLDAIGVY  470


 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = -2

Query  211  YLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSG  32
            YLT I GTFG + S  +V++S+ F TNA+ +G +G   GTPF+   + G  I GF G   
Sbjct  196  YLTGIKGTFGRYGSY-SVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHCR  254

Query  31   YYIDAIGTY  5
             Y+DAIG Y
Sbjct  255  AYLDAIGVY  263



>gb|AHW81907.1| mannose-binding lectin [Morus alba var. atropurpurea]
Length=161

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 49/78 (63%), Gaps = 4/78 (5%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAF---ASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            I +D  +E+L  +SG  G     A+  +V+RS+ F TN + +G YG   GTPF+   +NG
Sbjct  80   ITLDFPNEFLVSVSGYTGVLPRLATGKDVIRSLTFKTNKKTYGPYGTEEGTPFSLPIENG  139

Query  64   NKIVGFFGRSGYYIDAIG  11
              IVGF GRSGY +DAIG
Sbjct  140  -LIVGFKGRSGYVVDAIG  156



>ref|XP_009622524.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Nicotiana 
tomentosiformis]
Length=569

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 1/70 (1%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            EYLT I GTFG    S +V++ + F TNA+ +G +G   GTPF+   + G  IVGF GR 
Sbjct  35   EYLTGIKGTFGR-CGSYSVIKFLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGRC  93

Query  34   GYYIDAIGTY  5
            G Y+DAIG Y
Sbjct  94   GAYLDAIGVY  103


 Score = 65.1 bits (157),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            E+LT I GTF  F    +V++S+ F TNA  +G +G   G TPF+   + G  IVGF GR
Sbjct  424  EHLTGIKGTFECF-DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHGR  482

Query  37   SGYYIDAIGTY  5
            SG Y+DAIG Y
Sbjct  483  SGLYLDAIGVY  493


 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = -2

Query  211  YLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSG  32
            YLT I GTFG + S  +V++S+ F TNA+ +G +G   GTPF+   + G  I GF G   
Sbjct  219  YLTGIKGTFGRYGSY-SVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHCR  277

Query  31   YYIDAIGTY  5
             Y+DAIG Y
Sbjct  278  AYLDAIGVY  286



>ref|XP_008348486.1| PREDICTED: agglutinin alpha chain-like [Malus domestica]
Length=189

 Score = 66.6 bits (161),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 7/90 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPN  101
            G GGT+T       I +   DEY+  ++G +G        ++RS+KF +N R FG +G +
Sbjct  74   GRGGTQTA-----EIKLQYPDEYIVSVTGHYGTMVYGGTPIIRSLKFQSNRRTFGPFGMD  128

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIG  11
             GTPF +   +G KIVG  GR+G+YIDAIG
Sbjct  129  EGTPFTYTL-DGGKIVGLKGRNGWYIDAIG  157



>dbj|BAK00987.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E+LTE+SGT     S   V+ SI+F TN + +G +G   GTPF F      K+VGFFGR 
Sbjct  233  EFLTEVSGTISD--SRCEVVESIQFVTNIQTYGPFGTQDGTPFTFSVPRYKKVVGFFGRG  290

Query  34   GYYIDAIGTY  5
            G ++DAIG Y
Sbjct  291  GLFLDAIGIY  300



>gb|ABA94728.1| Jacalin-like lectin domain containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ12138.1| hypothetical protein OsJ_02021 [Oryza sativa Japonica Group]
Length=837

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+L  + GT G F +S  V+ S+ F TN R +G +G   GTPF+   Q+  KIVGFF
Sbjct  761  GSSEFLVRVFGTIGPFRASRCVVTSVTFVTNVRSYGPFGQGGGTPFDVPMQSNGKIVGFF  820

Query  43   GRSGYYIDAIGTY  5
            G +  Y++A+G Y
Sbjct  821  GHARSYVEALGVY  833


 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGF  47
            G  E+L E+SGT G FA S  NV+ S+   TN   +G +G   G PF    Q    IVGF
Sbjct  441  GPSEFLLEVSGTIGRFANSRSNVITSLTLVTNEDRYGHFGTERGDPFCTTLQTNCSIVGF  500

Query  46   FGRSGYYIDAIGTY  5
            F R+  Y+ AIG Y
Sbjct  501  FARASRYMHAIGVY  514



>ref|XP_002439182.1| hypothetical protein SORBIDRAFT_09g001880 [Sorghum bicolor]
 gb|EES17612.1| hypothetical protein SORBIDRAFT_09g001880 [Sorghum bicolor]
Length=304

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 50/91 (55%), Gaps = 8/91 (9%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GGT   +  +D        EY+ E+SGT+G F     VL S K  TN R +G +    
Sbjct  220  GPGGTAHRIDLDDA-------EYVKEVSGTYGTF-EGITVLTSFKLVTNVRTWGPWAIEN  271

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            GTPF+  A   + IVGF+GR+G  IDAIG Y
Sbjct  272  GTPFSITAPTNSSIVGFYGRAGRLIDAIGVY  302



>gb|EEE68468.1| hypothetical protein OsJ_26865 [Oryza sativa Japonica Group]
Length=474

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 39/91 (43%), Positives = 49/91 (54%), Gaps = 4/91 (4%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            GG G +  V H    ++    EYLT ISGT  A +    ++ S+   TN R +G YG   
Sbjct  373  GGDGPDKGVNHTIQFSLS---EYLTGISGTI-ASSPYGVIITSLTLVTNTRTYGPYGQVG  428

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            GTPF    Q    IVGFFGR G+Y+DA G Y
Sbjct  429  GTPFQIPIQIKGSIVGFFGRVGWYVDAFGIY  459



>ref|XP_009588771.1| PREDICTED: agglutinin-like [Nicotiana tomentosiformis]
Length=345

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 50/82 (61%), Gaps = 3/82 (4%)
 Frame = -2

Query  244  NDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQ  71
             D +NI+    EYLT I GT G   S   V++S+ F TNA+ +G +G   G TPF+   +
Sbjct  73   RDKVNIEATPLEYLTGIKGTLGHHGS-HLVVKSLSFITNAKNYGPFGTEGGGTPFSLVMK  131

Query  70   NGNKIVGFFGRSGYYIDAIGTY  5
             G  IVGF GRSG Y+DAIG Y
Sbjct  132  EGGAIVGFHGRSGLYLDAIGVY  153


 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 50/85 (59%), Gaps = 6/85 (7%)
 Frame = -2

Query  244  NDTI---NIDGEDEYLTEISGTFGAFASSDNV--LRSIKFTTNAREFGTYGPNVGTPFNF  80
            NDTI   +IDGE E L  I G +     +  +  +R I F TN  ++G YG  +GT F+ 
Sbjct  258  NDTIRKIHIDGESEILVGIEGFYSPVDDNGGLDTIRQIAFYTNKGKYGPYGTEIGTYFSS  317

Query  79   QAQNGNKIVGFFGRSGYYIDAIGTY  5
             A  G KIVGF G+SG +++AIG +
Sbjct  318  SAARG-KIVGFHGKSGVFLNAIGVH  341



>gb|EAZ25557.1| hypothetical protein OsJ_09383 [Oryza sativa Japonica Group]
Length=126

 Score = 65.5 bits (158),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E++T++ GT G F    +V+ SI FTTNA  +G +G   GT F     +   IVGFF
Sbjct  50   GPSEFVTKVYGTIGPFGKFSSVITSIHFTTNADRYGPFGQGTGTRFEAPMHSDGSIVGFF  109

Query  43   GRSGYYIDAIGTY  5
            GR+  Y+DAIG Y
Sbjct  110  GRTSSYVDAIGFY  122



>ref|XP_010935305.1| PREDICTED: jacalin-related lectin 3-like [Elaeis guineensis]
Length=499

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 58/92 (63%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPN  101
            G GGT+T     D I +D   E LT +SG +G+ +S S  ++RS+ F +N  ++G +G  
Sbjct  65   GNGGTKT-----DKIKLDHPLESLTSVSGYYGSLSSGSPAIIRSLTFESNQAKYGPFGYE  119

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             G  F+F   +G KIVGF GRSG+Y+D+IG Y
Sbjct  120  QGMRFSF-PMSGGKIVGFHGRSGWYLDSIGFY  150


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/93 (35%), Positives = 47/93 (51%), Gaps = 8/93 (9%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN--VLRSIKFTTNAREFGTYGP  104
            GG G  T+      I  D   E L  +SG +      +   V++S+ F T+  ++G +G 
Sbjct  392  GGSGVTTH-----RIKFDYPHEVLNCVSGYYATINRDERPTVIKSLSFYTSRGKYGPFGE  446

Query  103  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             VGT F      G K+VGF GRS  Y+DAIG +
Sbjct  447  EVGTHFTSATTEG-KVVGFHGRSALYLDAIGVH  478



>ref|XP_006301377.1| hypothetical protein CARUB_v10021789mg [Capsella rubella]
 gb|EOA34275.1| hypothetical protein CARUB_v10021789mg [Capsella rubella]
Length=177

 Score = 65.9 bits (159),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I +   DEYL  +SG +    SS   V+RS+ F +N + +G YG   GTPF F   NG +
Sbjct  75   IKLQYPDEYLIGVSGYYCPLVSSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGR  133

Query  58   IVGFFGRSGYYIDAIG  11
            IVG  GRSG+Y+D+IG
Sbjct  134  IVGMNGRSGWYLDSIG  149



>ref|XP_002450764.1| hypothetical protein SORBIDRAFT_05g017250 [Sorghum bicolor]
 gb|EES09752.1| hypothetical protein SORBIDRAFT_05g017250 [Sorghum bicolor]
Length=1080

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = -2

Query  214   EYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
             EY+ E+SGT+G  +   D V+ S+   TN   +G +G   GTPF+ +      IVGFFGR
Sbjct  1004  EYVKEVSGTYGLCSPHPDVVITSLTLVTNLCSYGPFGQPTGTPFHTRVDKTASIVGFFGR  1063

Query  37    SGYYIDAIGTY  5
             SG Y+DAIG Y
Sbjct  1064  SGIYLDAIGVY  1074



>ref|XP_004960459.1| PREDICTED: salt stress-induced protein-like [Setaria italica]
Length=149

 Score = 65.5 bits (158),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 1/73 (1%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E++ EISGT+G F     V+RS+ F TN  + G +G    TPF+   Q+  ++VGFF
Sbjct  75   GAGEFVKEISGTYGPFGGH-TVVRSLTFVTNVGKHGPFGNPGQTPFSVPVQDDARVVGFF  133

Query  43   GRSGYYIDAIGTY  5
            GRSG  +DA+G Y
Sbjct  134  GRSGSLLDAVGVY  146



>gb|AAL10685.1| mannose-binding lectin [Morus nigra]
Length=161

 Score = 65.9 bits (159),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 4/80 (5%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAF---ASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            I +D  +E+L  +SG  G     A+  +V+RS+ F TN + +G YG   GTPF+   +NG
Sbjct  80   ITLDFPNEFLVSVSGYTGVLPRLATGKDVIRSLTFKTNKKTYGPYGKEEGTPFSLPIENG  139

Query  64   NKIVGFFGRSGYYIDAIGTY  5
              IVGF GRSG+ +DAIG +
Sbjct  140  -LIVGFKGRSGFVVDAIGVH  158



>ref|XP_004979671.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Setaria 
italica]
Length=793

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+LT +SG+ G+F +  NV+ S+ F TN R +G +G   G  F+   ++   IVGFF
Sbjct  562  GPSEFLTGVSGSIGSFNTLVNVITSLTFVTNVRNYGPFGKGRGPHFHIPMESNGCIVGFF  621

Query  43   GRSGYYIDAIGTY  5
            GR+G Y+DAIG Y
Sbjct  622  GRAGRYLDAIGVY  634


 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+L  +SG+ G+F     V+ S+ F TNAR +G +G   G PF+ Q Q+   IVGFF
Sbjct  348  GPSEFLIGVSGSIGSFNGLKKVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGFF  407

Query  43   GRSGYYIDAIGTY  5
            G S  Y++AIG Y
Sbjct  408  GHSRRYLEAIGFY  420


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
            E++ ++SGTF A+    NVL S+   TN  R +G YG   GT F+   Q+ ++IVGFF  
Sbjct  719  EFIVKVSGTFCAWHGVKNVLSSLTLVTNTGRSYGPYGTEFGTAFHVPEQSNSRIVGFFAH  778

Query  37   SGYYIDAIGTY  5
               YI+AIG Y
Sbjct  779  GEDYIEAIGAY  789



>ref|XP_004979669.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Setaria 
italica]
Length=844

 Score = 68.9 bits (167),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+LT +SG+ G+F +  NV+ S+ F TN R +G +G   G  F+   ++   IVGFF
Sbjct  613  GPSEFLTGVSGSIGSFNTLVNVITSLTFVTNVRNYGPFGKGRGPHFHIPMESNGCIVGFF  672

Query  43   GRSGYYIDAIGTY  5
            GR+G Y+DAIG Y
Sbjct  673  GRAGRYLDAIGVY  685


 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+L  +SG+ G+F     V+ S+ F TNAR +G +G   G PF+ Q Q+   IVGFF
Sbjct  399  GPSEFLIGVSGSIGSFNGLKKVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGFF  458

Query  43   GRSGYYIDAIGTY  5
            G S  Y++AIG Y
Sbjct  459  GHSRRYLEAIGFY  471


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
            E++ ++SGTF A+    NVL S+   TN  R +G YG   GT F+   Q+ ++IVGFF  
Sbjct  770  EFIVKVSGTFCAWHGVKNVLSSLTLVTNTGRSYGPYGTEFGTAFHVPEQSNSRIVGFFAH  829

Query  37   SGYYIDAIGTY  5
               YI+AIG Y
Sbjct  830  GEDYIEAIGAY  840



>ref|XP_007215056.1| hypothetical protein PRUPE_ppa012210mg [Prunus persica]
 gb|EMJ16255.1| hypothetical protein PRUPE_ppa012210mg [Prunus persica]
Length=179

 Score = 65.5 bits (158),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I +   DE+L  +SG +         ++RS+KF +N R FG YG   GTPF F   +G K
Sbjct  76   IKLQYPDEFLVSVSGHYCPMVYGGGPIIRSLKFQSNRRTFGPYGIEEGTPFTFSV-DGGK  134

Query  58   IVGFFGRSGYYIDAIG  11
            IVG  GR+G+Y+DAIG
Sbjct  135  IVGLKGRNGWYLDAIG  150



>ref|NP_001140746.1| hypothetical protein [Zea mays]
 gb|ACF84532.1| unknown [Zea mays]
 gb|AFW78609.1| hypothetical protein ZEAMMB73_243066 [Zea mays]
Length=596

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 55/89 (62%), Gaps = 6/89 (7%)
 Frame = -2

Query  271  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  92
            GG+ET     D + +D  DE L  +SG +G+   +  ++RS+ F +N+  +G +G   GT
Sbjct  68   GGSET-----DKVKLDFPDEVLVSVSGHYGSVCGTPVIIRSLTFQSNSSTYGPFGTEDGT  122

Query  91   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            PF+    +G KI+GF GRSG Y+++IG Y
Sbjct  123  PFSLPVSSG-KIIGFHGRSGSYLNSIGFY  150


 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTF-GAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D I  D   E LT I+G +  A      V+RS+ F TN R +G YG   GT F+    NG
Sbjct  308  DKIIFDFPSEVLTHITGFYDSAIIMGPTVVRSLTFHTNKRTYGPYGDEYGTYFSTSFTNG  367

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             +IVGF GR G+YID IG +
Sbjct  368  -RIVGFHGREGWYIDGIGVH  386


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 47/89 (53%), Gaps = 4/89 (4%)
 Frame = -2

Query  268  GTETNVTHNDTINIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGT  92
            G   ++TH   + +D   E LT + G +         VLRS+ F TN  ++G +G   G 
Sbjct  490  GNSGHITHR--VKLDFPHEVLTCVYGYYNTSKEDGPRVLRSLTFLTNRGKYGPFGDEFGA  547

Query  91   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             F+     G K+VGF GRSG ++DAIG +
Sbjct  548  YFSSATTEG-KVVGFHGRSGQHLDAIGVH  575



>ref|XP_004979670.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Setaria 
italica]
Length=823

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+LT +SG+ G+F +  NV+ S+ F TN R +G +G   G  F+   ++   IVGFF
Sbjct  592  GPSEFLTGVSGSIGSFNTLVNVITSLTFVTNVRNYGPFGKGRGPHFHIPMESNGCIVGFF  651

Query  43   GRSGYYIDAIGTY  5
            GR+G Y+DAIG Y
Sbjct  652  GRAGRYLDAIGVY  664


 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFF  44
            G  E+L  +SG+ G+F     V+ S+ F TNAR +G +G   G PF+ Q Q+   IVGFF
Sbjct  399  GPSEFLIGVSGSIGSFNGLKKVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGFF  458

Query  43   GRSGYYIDAIGTY  5
            G S  Y++AIG Y
Sbjct  459  GHSRRYLEAIGFY  471


 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 43/71 (61%), Gaps = 1/71 (1%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
            E++ ++SGTF A+    NVL S+   TN  R +G YG   GT F+   Q+ ++IVGFF  
Sbjct  749  EFIVKVSGTFCAWHGVKNVLSSLTLVTNTGRSYGPYGTEFGTAFHVPEQSNSRIVGFFAH  808

Query  37   SGYYIDAIGTY  5
               YI+AIG Y
Sbjct  809  GEDYIEAIGAY  819



>gb|AAM46813.1| hessian fly response gene 1 protein [Triticum aestivum]
Length=345

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 4/83 (5%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGAFASSD---NVLRSIKFTTNAREFGTYGPNVGTPFNFQA  74
             DTI +    E +TE+SGT G FA  +   N + S+  TTN R +G +G    TPF+   
Sbjct  257  KDTIEL-APSEIVTEVSGTVGIFAEDNVEYNAIASLTITTNHRPYGPFGETQSTPFSVPV  315

Query  73   QNGNKIVGFFGRSGYYIDAIGTY  5
            Q+ N IVGFF  +G Y++A+G Y
Sbjct  316  QDNNNIVGFFACAGKYVEALGVY  338



>ref|XP_006372713.1| hypothetical protein POPTR_0017s043602g, partial [Populus trichocarpa]
 gb|ERP50510.1| hypothetical protein POPTR_0017s043602g, partial [Populus trichocarpa]
Length=173

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = -2

Query  274  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG  95
            GG    ++    T+ I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G   G
Sbjct  79   GGNNPNDIGERKTVLINWPSEHLISISGTYGNF-STLLTITSLSFTTNRATYGPFGTGSG  137

Query  94   TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            TPF+    N N +VGF GR+G+Y+DAIG +
Sbjct  138  TPFSIPINN-NTVVGFHGRAGHYLDAIGIF  166



>ref|XP_002440040.1| hypothetical protein SORBIDRAFT_09g024950 [Sorghum bicolor]
 gb|EES18470.1| hypothetical protein SORBIDRAFT_09g024950 [Sorghum bicolor]
Length=594

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 55/89 (62%), Gaps = 6/89 (7%)
 Frame = -2

Query  271  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  92
            GG+ET     D + +D  DE L  +SG +G+   +  ++RS+ F +N+  +G +G   GT
Sbjct  68   GGSET-----DKVKLDFPDEVLVSVSGHYGSVCGTPVIIRSLTFQSNSSTYGPFGTEDGT  122

Query  91   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            PF+    +G KI+GF GRSG Y+++IG Y
Sbjct  123  PFSLPVSSG-KIIGFHGRSGSYLNSIGFY  150


 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTF-GAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D I  D   E LT I+G +  A      V+RS+ F TN R +G YG   GT F+    NG
Sbjct  306  DKIIFDFPSEVLTHITGFYDSAIIMGPTVVRSLTFHTNKRTYGPYGDEYGTYFSTSFTNG  365

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             +IVGF GR G+YID IG +
Sbjct  366  -RIVGFHGREGWYIDGIGVH  384


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 4/89 (4%)
 Frame = -2

Query  268  GTETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGT  92
            G   ++TH   + +D   E LT + G +         VLRS+ F TN  ++G +G   G+
Sbjct  488  GNSGHITHR--VKLDFPHEVLTCVYGYYNTNREDGPRVLRSLTFITNRGKYGPFGDEFGS  545

Query  91   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             F+     G K+VGF GRSG ++DAIG +
Sbjct  546  YFSSATTEG-KVVGFHGRSGQHLDAIGVH  573



>ref|XP_006853909.1| hypothetical protein AMTR_s00036p00182710 [Amborella trichopoda]
 gb|ERN15376.1| hypothetical protein AMTR_s00036p00182710 [Amborella trichopoda]
Length=196

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -2

Query  247  HNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQAQ  71
            H   I +   +E++TE+SG +         V+RS+KF T+ R +G YG   GTPF+F   
Sbjct  82   HTAHIKLQYPEEFITEVSGHYCPVVHGGTPVIRSLKFITSKRTYGPYGVEEGTPFSF-LM  140

Query  70   NGNKIVGFFGRSGYYIDAI  14
            +G  IVGF GR+G+Y+DAI
Sbjct  141  DGGLIVGFKGRNGWYLDAI  159



>emb|CAD40628.2| OSJNBa0016N04.16 [Oryza sativa Japonica Group]
 emb|CAD40707.2| OSJNBb0042I07.4 [Oryza sativa Japonica Group]
 emb|CAH66364.1| H0607F01.9 [Oryza sativa Indica Group]
Length=477

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -2

Query  214  EYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
            EY+TE+SGT G F  +   V+ S+ F TN   +G +G   GTPF+   Q+   IVGFF R
Sbjct  79   EYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGFFAR  138

Query  37   SGYYIDAIGTY  5
            +G+Y+DA G Y
Sbjct  139  AGWYVDAFGIY  149



>ref|XP_008244753.1| PREDICTED: agglutinin-like [Prunus mume]
Length=179

 Score = 65.5 bits (158),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I +   DE+L  +SG +         ++RS+KF +N R FG YG   GTPF F   +G K
Sbjct  76   IKLQYPDEFLVSVSGHYCPMVYGGGPIIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGGK  134

Query  58   IVGFFGRSGYYIDAIG  11
            IVG  GR+G+Y+DAIG
Sbjct  135  IVGLKGRNGWYLDAIG  150



>ref|XP_004961574.1| PREDICTED: mannose/glucose-specific lectin-like [Setaria italica]
Length=595

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 57/89 (64%), Gaps = 2/89 (2%)
 Frame = -2

Query  271  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  92
            GGT+ + +  D + +D  DE L  +SG +G+   +  ++RS+ F +N+ ++G +G   GT
Sbjct  64   GGTDGS-SQADKVKLDFPDEALVSVSGHYGSVCGTPVIIRSLTFQSNSSKYGPFGTEDGT  122

Query  91   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            PF+    +G KI+GF GRSG Y+++IG Y
Sbjct  123  PFSLPVSSG-KIIGFHGRSGSYLNSIGFY  150


 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTF-GAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D I  D   E LT I+G    A      V+RS+ F TN R +G YG   GT F+    NG
Sbjct  307  DKIVFDFPSEVLTHITGFLDSAIIMGPTVVRSLTFHTNKRTYGPYGDESGTYFSTSFTNG  366

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             +IVGF GR G+YID IG +
Sbjct  367  -RIVGFHGREGWYIDGIGVH  385


 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 48/89 (54%), Gaps = 4/89 (4%)
 Frame = -2

Query  268  GTETNVTHNDTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGT  92
            G   ++TH   + +D   E LT + G +  +      VLRS+ F TN  ++G +G   G 
Sbjct  489  GNSGHITHR--VKLDYPHEVLTCVYGYYNTSREDGPRVLRSLTFVTNRGKYGPFGDEFGA  546

Query  91   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             F+  A    K+VGF GRSG ++DAIG +
Sbjct  547  YFS-SAMTEGKVVGFHGRSGQHLDAIGVH  574



>ref|XP_003615697.1| Myrosinase-binding protein-like protein [Medicago truncatula]
 gb|AES98655.1| mannose-binding lectin superfamily protein [Medicago truncatula]
Length=604

 Score = 68.2 bits (165),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 4/90 (4%)
 Frame = -2

Query  271  GGTETNVTHNDTINIDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVG  95
            GGT  N T  D + +D  DE+LT + G +G+      N++RS+ F +N + +G +G   G
Sbjct  68   GGTGGNKT--DKVKLDYPDEFLTSVHGYYGSLNQWGHNLVRSLSFESNKKTYGPFGVEQG  125

Query  94   TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            T F+     G KIVGF GR G+Y+DAIG Y
Sbjct  126  TYFSV-PMTGAKIVGFHGRCGWYLDAIGVY  154


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 51/95 (54%), Gaps = 5/95 (5%)
 Frame = -2

Query  283  TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN--VLRSIKFTTNAREFGTY  110
            +I  GG   +  H   I ++   E LT ISG +G+    +   V++S+ F T+  ++G Y
Sbjct  494  SIKHGGNGGDTMHR--IQLEFPHEVLTCISGYYGSITKDEKHTVIKSLTFHTSRGQYGPY  551

Query  109  GPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            G  VG  F      G K+VGF GRS  Y+DAIG +
Sbjct  552  GEEVGKFFTSTTTEG-KVVGFHGRSSLYLDAIGIH  585


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 43/81 (53%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            +D I  D   E LT ISG  G        V+RS+ F T  R++G +G   GT F  + + 
Sbjct  308  SDKIVFDFPYEVLTYISGYHGPLMYMGPAVIRSLTFHTTKRKYGPFGEEQGTYFTTKVKE  367

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G KIVG  GR G ++DA G +
Sbjct  368  G-KIVGIHGRKGLFLDAFGVH  387



>ref|XP_006390600.1| hypothetical protein EUTSA_v10019210mg [Eutrema salsugineum]
 gb|ESQ27886.1| hypothetical protein EUTSA_v10019210mg [Eutrema salsugineum]
Length=176

 Score = 65.1 bits (157),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 52/90 (58%), Gaps = 7/90 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPN  101
            G GG +T+      I +   DEYL  +SG +     S   V+RSI F +N + +G YG  
Sbjct  66   GQGGNKTS-----EIKLQYPDEYLIGVSGYYWPVVHSGSPVIRSITFKSNKQVYGPYGVE  120

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIG  11
             GTPF F   NG +IVG  GRSG+Y+D+IG
Sbjct  121  QGTPFTFSV-NGGRIVGINGRSGWYLDSIG  149



>ref|XP_010092355.1| hypothetical protein L484_023733 [Morus notabilis]
 gb|EXB51031.1| hypothetical protein L484_023733 [Morus notabilis]
Length=185

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 4/78 (5%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAF---ASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            I +D  +E+L  +SG  G     A+  +V+RS+ F TN + +G YG   GTPF+   +NG
Sbjct  104  ITLDFPNEFLVSVSGHTGVLPRLATGKDVIRSLTFKTNQKTYGPYGKEEGTPFSLPIENG  163

Query  64   NKIVGFFGRSGYYIDAIG  11
              IVGF GRSG+ +DAIG
Sbjct  164  -LIVGFKGRSGFVVDAIG  180



>ref|XP_004984089.1| PREDICTED: protein GOS9-like [Setaria italica]
Length=151

 Score = 64.7 bits (156),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 51/90 (57%), Gaps = 2/90 (2%)
 Frame = -2

Query  274  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG  95
            GG  +     ++ I +D   EY+TE++GT G    + + + S+KF TN   +G +G   G
Sbjct  60   GGAAKGQGEGDENITLDAS-EYVTEVAGTIGPIGDAPHTISSLKFVTNRATYGPFGRGAG  118

Query  94   TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            TPFN    N + +V  F R+G Y+DAIG Y
Sbjct  119  TPFNVPLDNAS-VVAMFARAGDYLDAIGFY  147



>gb|KDO84683.1| hypothetical protein CISIN_1g007083mg [Citrus sinensis]
Length=528

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D + +D  DE+LT + G +GA     +V +RS+ F +N + +G +G   GT F+F    G
Sbjct  71   DQVKLDDPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTYFSF-PMTG  129

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             KIVGF GR G+Y+DAIG Y
Sbjct  130  GKIVGFHGRCGWYLDAIGIY  149


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            +D +  D   E LT+I+GT+G       N++RS+ F T   + G +G   G  F+ +   
Sbjct  323  HDRVIFDYPYEILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIGE  382

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G KIVGF GR G ++DAIG Y
Sbjct  383  G-KIVGFHGRDGLFLDAIGVY  402



>ref|NP_001052560.1| Os04g0369100 [Oryza sativa Japonica Group]
 dbj|BAF14474.1| Os04g0369100 [Oryza sativa Japonica Group]
Length=770

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -2

Query  214  EYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
            EY+TE+SGT G F  +   V+ S+ F TN   +G +G   GTPF+   Q+   IVGFF R
Sbjct  372  EYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGFFAR  431

Query  37   SGYYIDAIGTY  5
            +G+Y+DA G Y
Sbjct  432  AGWYVDAFGIY  442



>pdb|1XXQ|A Chain A, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra
 pdb|1XXQ|B Chain B, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra
 pdb|1XXQ|C Chain C, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra
 pdb|1XXQ|D Chain D, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra
 pdb|1XXR|A Chain A, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra In Complex With Mannose
 pdb|1XXR|B Chain B, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra In Complex With Mannose
 pdb|1XXR|C Chain C, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra In Complex With Mannose
 pdb|1XXR|D Chain D, Structure Of A Mannose-Specific Jacalin-Related Lectin 
From Morus Nigra In Complex With Mannose
Length=161

 Score = 64.7 bits (156),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 4/78 (5%)
 Frame = -2

Query  235  INIDGEDEYLTEISG---TFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            I +D  +E+L  +SG        A+  +V+RS+ F TN + +G YG   GTPF+   +NG
Sbjct  80   ITLDFPNEFLVSVSGYTGVLARLATGKDVIRSLTFKTNKKTYGPYGKEEGTPFSLPIENG  139

Query  64   NKIVGFFGRSGYYIDAIG  11
              IVGF GRSG+ +DAIG
Sbjct  140  -LIVGFKGRSGFVVDAIG  156



>ref|XP_008806712.1| PREDICTED: agglutinin-like isoform X2 [Phoenix dactylifera]
Length=197

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            + +   +E+LT +SG +         V+RS+ F +N R FG +G   GTPF F   +G  
Sbjct  73   VKLQYPEEFLTSVSGHYSPVVRGGSPVIRSLTFKSNERAFGPFGVEEGTPFTF-PMDGGM  131

Query  58   IVGFFGRSGYYIDAIG  11
            IVGF GRSG+Y+DAIG
Sbjct  132  IVGFSGRSGWYLDAIG  147



>ref|XP_008806706.1| PREDICTED: agglutinin-like isoform X1 [Phoenix dactylifera]
Length=200

 Score = 65.1 bits (157),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            + +   +E+LT +SG +       + V+RS+ F +N R FG +G   GTPF F   +G  
Sbjct  76   VKLQYPEEFLTSVSGHYSPVVRGGSPVIRSLTFKSNERAFGPFGVEEGTPFTF-PMDGGM  134

Query  58   IVGFFGRSGYYIDAIG  11
            IVGF GRSG+Y+DAIG
Sbjct  135  IVGFSGRSGWYLDAIG  150



>gb|EEE60834.1| hypothetical protein OsJ_14451 [Oryza sativa Japonica Group]
Length=736

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -2

Query  214  EYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
            EY+TE+SGT G F  +   V+ S+ F TN   +G +G   GTPF+   Q+   IVGFF R
Sbjct  338  EYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGFFAR  397

Query  37   SGYYIDAIGTY  5
            +G+Y+DA G Y
Sbjct  398  AGWYVDAFGIY  408



>ref|XP_011030089.1| PREDICTED: jacalin-related lectin 19 [Populus euphratica]
 ref|XP_011030090.1| PREDICTED: jacalin-related lectin 19 [Populus euphratica]
Length=191

 Score = 64.7 bits (156),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I +   +EYLT +SG +         V+RS+ F++N R FG +G   GTPF   + +G  
Sbjct  78   IKLRYPEEYLTSVSGHYCPVVYGGSPVIRSLTFSSNKRTFGPFGVEEGTPFTL-SMDGAS  136

Query  58   IVGFFGRSGYYIDAIG  11
            IVGF GRSG+Y+DAIG
Sbjct  137  IVGFKGRSGWYLDAIG  152



>ref|XP_009400545.1| PREDICTED: agglutinin alpha chain [Musa acuminata subsp. malaccensis]
Length=200

 Score = 64.7 bits (156),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I ++  +EYLT ISG +   A     V+RS+ F +N R FG +G   G PF    + G  
Sbjct  76   IKLEHPEEYLTTISGHYCPMAYGGSPVIRSLTFKSNQRTFGPFGVQDGIPFTLPMEGG-M  134

Query  58   IVGFFGRSGYYIDAIG  11
            IVGF GR G+Y+DAIG
Sbjct  135  IVGFSGRCGWYLDAIG  150



>ref|XP_006654724.1| PREDICTED: agglutinin-like [Oryza brachyantha]
Length=200

 Score = 64.7 bits (156),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 55/94 (59%), Gaps = 9/94 (10%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASS--DNVLRSIKFTTNAREFGTYGP  104
            G GG +T       I +   +EY+T +SG +   A+   +  +RS+ FTTN RE+G +G 
Sbjct  61   GAGGNQTT-----QIKLSFPEEYVTTVSGHYAPVAAHGGEPAIRSLAFTTNRREYGPFGA  115

Query  103  NV-GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
               GTPF F   +G  +VGF+GRSG  +DA+G +
Sbjct  116  AAEGTPFTFPV-DGGAVVGFWGRSGRQLDAVGVH  148



>tpg|DAA60181.1| TPA: hypothetical protein ZEAMMB73_326702 [Zea mays]
Length=297

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 53/95 (56%), Gaps = 9/95 (9%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR---EFGTYG  107
            GG G ET       I + G+ E LTE+SGT G       V+ SIKF T+ +    FG +G
Sbjct  155  GGSGGETE----PVIQL-GDSEVLTELSGTIGN-VDGHTVITSIKFVTSLKTYGPFGAWG  208

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYN  2
                TPF    Q G+ IVGFF R+G Y+DA+G Y+
Sbjct  209  DGSDTPFAIPVQQGSAIVGFFARAGVYLDALGVYD  243



>gb|KDO84682.1| hypothetical protein CISIN_1g007083mg [Citrus sinensis]
Length=619

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D + +D  DE+LT + G +GA     +V +RS+ F +N + +G +G   GT F+F    G
Sbjct  71   DQVKLDDPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTYFSF-PMTG  129

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             KIVGF GR G+Y+DAIG Y
Sbjct  130  GKIVGFHGRCGWYLDAIGIY  149


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 3/84 (4%)
 Frame = -2

Query  250  THNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQ  77
            T+   I ++   E LT ISG +G  +  +   V+RS+ F T+  ++G +G  VGT F   
Sbjct  517  TYTHRIKLEYPHEVLTCISGYYGPISKDERPKVIRSLTFYTSRGKYGPFGEEVGTFFTST  576

Query  76   AQNGNKIVGFFGRSGYYIDAIGTY  5
               G K+VGF GRS +Y+DAIG +
Sbjct  577  TTEG-KVVGFHGRSSFYLDAIGVH  599


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            +D +  D   E LT+I+GT+G       N++RS+ F T   + G +G   G  F+ +   
Sbjct  323  HDRVIFDYPYEILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIGE  382

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G KIVGF GR G ++DAIG Y
Sbjct  383  G-KIVGFHGRDGLFLDAIGVY  402



>ref|XP_008654961.1| PREDICTED: LOC100282355 isoform X1 [Zea mays]
Length=238

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I +   DEYLT +SG +   A     V+RS+ F TN   +G +G   GTPF F   +G  
Sbjct  111  IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  169

Query  58   IVGFFGRSGYYIDAIGTY  5
            IVGF GRSG+ +DA+G Y
Sbjct  170  IVGFCGRSGWQLDAVGLY  187



>gb|EAY90359.1| hypothetical protein OsI_11939 [Oryza sativa Indica Group]
Length=150

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 2/93 (2%)
 Frame = -2

Query  283  TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP  104
            T+G  G +  V+  +TI ++   EY+ E+ G+ G      +V+ S+K  TN R  G +G 
Sbjct  56   TVGPWGGQGGVS-EETITLE-PSEYVKEVHGSVGPIGDYTHVVTSLKLVTNQRTIGPFGN  113

Query  103  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
              GTPF     N   +VGFF R+G Y+++IG Y
Sbjct  114  GAGTPFAVPVLNNGSVVGFFARAGPYLESIGIY  146



>ref|XP_004974871.1| PREDICTED: mannose/glucose-specific lectin-like [Setaria italica]
Length=242

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 2/72 (3%)
 Frame = -2

Query  220  EDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFG  41
             DE+LT + G  G F   + V+RS+ F +N R +G YG   G PF   A  G +IVGF  
Sbjct  66   PDEHLTSVEGHCGEF-EGNFVVRSLTFVSNRRAYGPYGRPDGVPFALPAAGG-RIVGFHA  123

Query  40   RSGYYIDAIGTY  5
            RSG ++DAIGTY
Sbjct  124  RSGRHLDAIGTY  135



>ref|XP_008654963.1| PREDICTED: LOC100282355 isoform X3 [Zea mays]
 ref|XP_008654964.1| PREDICTED: LOC100282355 isoform X3 [Zea mays]
Length=231

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I +   DEYLT +SG +   A     V+RS+ F TN   +G +G   GTPF F   +G  
Sbjct  104  IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  162

Query  58   IVGFFGRSGYYIDAIGTY  5
            IVGF GRSG+ +DA+G Y
Sbjct  163  IVGFCGRSGWQLDAVGLY  180



>gb|KDP38344.1| hypothetical protein JCGZ_04269 [Jatropha curcas]
Length=564

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/75 (45%), Positives = 47/75 (63%), Gaps = 3/75 (4%)
 Frame = -2

Query  229  IDGEDEYLTEISGTFGAFA--SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  56
            +D  DEYLT I G +G++A   +DN +RS+ F +N R +G +G   GT F+     G  I
Sbjct  152  LDYPDEYLTSIHGHYGSYAVMGADNCVRSLSFESNRRTYGPFGQEEGTYFSVPMTEG-MI  210

Query  55   VGFFGRSGYYIDAIG  11
            VGF+GRS + IDAI 
Sbjct  211  VGFYGRSSHIIDAIA  225



>ref|XP_009391787.1| PREDICTED: agglutinin-like [Musa acuminata subsp. malaccensis]
Length=256

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 50/91 (55%), Gaps = 7/91 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GG  + V  +D       DEYL  +SG +G       V++S+ F TN R +G +G   
Sbjct  171  GRGGQLSEVVLDDE-----RDEYLACLSGRYG-ICGGYLVIKSLTFATNKRTYGPFGVED  224

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            G PF   A  G +IVGFF R+G ++DAIG Y
Sbjct  225  GAPFKLDA-GGQRIVGFFARAGQFLDAIGVY  254



>ref|XP_008654962.1| PREDICTED: LOC100282355 isoform X2 [Zea mays]
 gb|AFW80927.1| hypothetical protein ZEAMMB73_478294 [Zea mays]
Length=237

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 2/78 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I +   DEYLT +SG +   A     V+RS+ F TN   +G +G   GTPF F   +G  
Sbjct  110  IKLGYPDEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGV  168

Query  58   IVGFFGRSGYYIDAIGTY  5
            IVGF GRSG+ +DA+G Y
Sbjct  169  IVGFCGRSGWQLDAVGLY  186



>ref|NP_177447.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
 sp|Q9SSM3.1|JAL19_ARATH RecName: Full=Jacalin-related lectin 19 [Arabidopsis thaliana]
 gb|AAD55651.1|AC008017_24 Similar to jacalin [Arabidopsis thaliana]
 gb|AAX49365.1| At1g73040 [Arabidopsis thaliana]
 gb|ABR46196.1| At1g73040 [Arabidopsis thaliana]
 gb|AEE35407.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
Length=176

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I +   +EYLT +SG +    +S   V+RS+ F +N + +G YG   GTPF F   NG +
Sbjct  75   IKLQYPEEYLTGVSGYYCPMVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGR  133

Query  58   IVGFFGRSGYYIDAIG  11
            IVG  GRSG+Y+D+IG
Sbjct  134  IVGMNGRSGWYLDSIG  149



>ref|XP_006654618.1| PREDICTED: myrosinase-binding protein-like At1g52040-like [Oryza 
brachyantha]
Length=605

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 55/90 (61%), Gaps = 6/90 (7%)
 Frame = -2

Query  274  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG  95
            GGG+ET     D + +   DE+L  +SG +G+   +  ++RS+ F +N   +G +G   G
Sbjct  68   GGGSET-----DKVKLVFPDEFLVSVSGYYGSVCGTPVIIRSLTFQSNRSMYGPFGTEDG  122

Query  94   TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            TPF+    +G KI+GF GRSG Y+++IG Y
Sbjct  123  TPFSLPVSSG-KIIGFHGRSGSYLNSIGFY  151


 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D I  D   E LT I+G +GA       V+RS+ F TN R +G YG   GT F+    +G
Sbjct  319  DKIVFDFPSEILTHITGYYGATMIMGPTVIRSLTFHTNKRRYGPYGDECGTYFSTSFTDG  378

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             +IVGF GR G+YID IG +
Sbjct  379  -RIVGFHGREGWYIDGIGVH  397


 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 48/89 (54%), Gaps = 4/89 (4%)
 Frame = -2

Query  268  GTETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGT  92
            GT  ++TH   I +D   E LT + G +          LRSI F +N  ++G +G   G 
Sbjct  499  GTSGHITHR--IKLDYPHEVLTCVYGYYNTNREEGPRALRSITFISNRGKYGPFGEEFGA  556

Query  91   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             F+  A+   K+VGF GRSG ++DAIG +
Sbjct  557  YFS-SAKTEGKVVGFHGRSGQHLDAIGVH  584



>ref|XP_003577374.2| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Brachypodium 
distachyon]
Length=588

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
            E+LT +SGT G + S+   V++S+ F T A  +G +G   GTPF    Q+   IVGFF R
Sbjct  191  EFLTVVSGTIGPYDSAPAGVIKSLTFITTAGRYGPFGEEKGTPFQIPVQSNGSIVGFFAR  250

Query  37   SGYYIDAIGTY  5
            +G+Y+DA G Y
Sbjct  251  AGWYLDAFGIY  261


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 47/91 (52%), Gaps = 3/91 (3%)
 Frame = -2

Query  271  GGTETNVTHNDTINIDGEDEYLTEISGTFGAF--ASSDNVLRSIKFTTNAREFGTYGPNV  98
            G +  N    DTI +    E+LT + GT G F  ASSD ++ S+   TN   +G +G   
Sbjct  328  GASTGNPDQTDTILL-CSSEFLTGVRGTTGPFDPASSDVIVTSLTLITNTHSYGPFGQGR  386

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            GT F         IVGFFG S  YI+AIG Y
Sbjct  387  GTSFQIPLWGKGSIVGFFGCSESYINAIGVY  417


 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 4/74 (5%)
 Frame = -2

Query  214  EYLTEISGTFGAF-ASSDNVLRSIKFTTN-AREFGTYGPNVGTPFNFQAQNGN--KIVGF  47
            E L  +SGT G+   +S N++ S+ F T+ AR +G +G   GTPF+  A  GN   +V F
Sbjct  511  EVLQGVSGTVGSSDGTSSNLVTSLTFATDQARAYGPFGAGGGTPFSAAAAAGNDGPVVAF  570

Query  46   FGRSGYYIDAIGTY  5
            FGR+G  ++A+G Y
Sbjct  571  FGRAGLCLEALGVY  584



>ref|XP_008651439.1| PREDICTED: jasmonate-induced protein isoform X1 [Zea mays]
 gb|ACL53153.1| unknown [Zea mays]
 tpg|DAA60180.1| TPA: beta-glucosidase aggregating factor 1 [Zea mays]
Length=306

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 52/94 (55%), Gaps = 9/94 (10%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR---EFGTYG  107
            GG G ET       I + G+ E LTE+SGT G       V+ SIKF T+ +    FG +G
Sbjct  215  GGSGGETE----PVIQL-GDSEVLTELSGTIGN-VDGHTVITSIKFVTSLKTYGPFGAWG  268

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
                TPF    Q G+ IVGFF R+G Y+DA+G Y
Sbjct  269  DGSDTPFAIPVQQGSAIVGFFARAGVYLDALGVY  302



>ref|XP_010459648.1| PREDICTED: jacalin-related lectin 3 isoform X1 [Camelina sativa]
 ref|XP_010459649.1| PREDICTED: jacalin-related lectin 3 isoform X2 [Camelina sativa]
Length=570

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D + +D   EYL  ++GT+G+F A  +  +RS+   +N R++G +G   GT F    ++G
Sbjct  44   DNVKLDYPHEYLISVNGTYGSFDAWGNTCVRSLTLESNHRKYGPFGCESGTFFAL-PKSG  102

Query  64   NKIVGFFGRSGYYIDAIGTY  5
            +KI+GF G++G+YIDAIG +
Sbjct  103  SKIIGFHGKAGWYIDAIGVH  122


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            +D I  D   E LT ++GT+G       NV++S+ F TN  + G +G   G  F  +   
Sbjct  270  HDKIVFDYPSEVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDE  329

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G K+VGF GR G ++DAIG +
Sbjct  330  G-KVVGFLGREGLFLDAIGVH  349



>gb|AFW81812.1| putative protein kinase superfamily protein [Zea mays]
Length=503

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = -2

Query  214  EYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
            E+L  +SGT G +A    +V+RS+ F TN R + T G  VG PF  +A  G+ IVGF  R
Sbjct  429  EFLVGVSGTTGGYAGLPTSVIRSLTFVTNVRTYRTRGAPVGDPFALEAPAGSCIVGFHAR  488

Query  37   SGYYIDAIGTYN  2
            +G+++DA+G Y+
Sbjct  489  AGHFLDALGVYH  500



>gb|ABF96452.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAH01034.1| unnamed protein product [Oryza sativa Japonica Group]
Length=176

 Score = 64.3 bits (155),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E +TE+ GT G F   D+++ S+K  T+ R  G +G   GTPF+   +    +VGFF R+
Sbjct  98   ERVTEVHGTVGPFGDRDSLVTSLKLVTDRRTIGPFGYGAGTPFSVPVRGDGGVVGFFVRA  157

Query  34   GYYIDAIGTY  5
            G Y++AIG Y
Sbjct  158  GAYLEAIGVY  167



>ref|NP_001141303.1| uncharacterized protein LOC100273394 [Zea mays]
 gb|ACF86025.1| unknown [Zea mays]
Length=306

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 52/94 (55%), Gaps = 9/94 (10%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR---EFGTYG  107
            GG G ET       I + G+ E LTE+SGT G       V+ SIKF T+ +    FG +G
Sbjct  215  GGSGGETE----PVIQL-GDSEVLTELSGTIGN-VDGLTVITSIKFVTSLKTYGPFGAWG  268

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
                TPF    Q G+ IVGFF R+G Y+DA+G Y
Sbjct  269  DGSDTPFTIPVQQGSAIVGFFARAGIYLDAVGVY  302



>ref|XP_002300741.2| hypothetical protein POPTR_0002s03180g [Populus trichocarpa]
 gb|EEE80014.2| hypothetical protein POPTR_0002s03180g [Populus trichocarpa]
Length=587

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPN  101
            G GG +T      T+ +D  DE+LT + G +G+      V +RS+ F +N + +G +G  
Sbjct  64   GNGGMKT------TVKLDCPDEFLTSVHGYYGSLDGWGPVFVRSLTFRSNKKTYGPFGVE  117

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F+F   +G KIVGF G+SG+Y+DAIG Y
Sbjct  118  QGTYFSF-PMSGGKIVGFHGKSGWYLDAIGIY  148


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            +D I  D   E LT ++GT+G       N++RS+ F TN  + G +G   G  F  +   
Sbjct  289  SDKIIFDYPYEILTRVTGTYGPLMYMGPNIIRSLTFYTNKGKHGPFGEEQGPTFTNKIDE  348

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G KI+GF GR G+ +DAIG +
Sbjct  349  G-KIIGFHGREGFLLDAIGVH  368


 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 49/94 (52%), Gaps = 9/94 (10%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFAS---SDNVLRSIKFTTNAREFGTYG  107
            G GGT T+      + +    E L  +SG +G   S   S  V++S+ F T+   +G +G
Sbjct  479  GNGGTATH-----RVKLQCPHEVLVCLSGYYGPIGSDGNSPKVIKSLTFHTSRGNYGPFG  533

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
              +GT F      G K+VGF GRS  Y+DAIG +
Sbjct  534  EEIGTFFTSTTTEG-KVVGFHGRSSAYMDAIGVH  566



>ref|XP_006651478.1| PREDICTED: horcolin-like [Oryza brachyantha]
Length=165

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 42/70 (60%), Gaps = 0/70 (0%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E +TE+ GT G F   D+++ S+K  T+ R  G +G   GTPF+        +VGFF R+
Sbjct  87   ERVTEVHGTMGPFGDRDSLVTSLKLVTDRRTIGPFGYGAGTPFSLPVLGDGAVVGFFARA  146

Query  34   GYYIDAIGTY  5
            G +++AIG Y
Sbjct  147  GEHLEAIGVY  156



>ref|XP_002515891.1| hypothetical protein RCOM_1485780 [Ricinus communis]
 gb|EEF46311.1| hypothetical protein RCOM_1485780 [Ricinus communis]
Length=514

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/90 (41%), Positives = 51/90 (57%), Gaps = 7/90 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPN  101
            G GGT+        I +   +EYL   SG +       + V+RSI F +N R FG +G  
Sbjct  390  GVGGTKRT-----EIKLQYPEEYLVSASGNYCPVVYGGSPVIRSITFKSNRRTFGPFGIE  444

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIG  11
             GTPF   + +G ++VGF GRSG+Y+DAIG
Sbjct  445  EGTPFTL-SMDGRRVVGFTGRSGWYLDAIG  473



>ref|XP_010477194.1| PREDICTED: jacalin-related lectin 3-like isoform X1 [Camelina 
sativa]
Length=624

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D + +D   EYL  ++GT+G+F A  +  +RS+   +N R++G +G   GT F    ++G
Sbjct  98   DNVKLDYPHEYLISVNGTYGSFDAWGNTCVRSLILESNHRKYGPFGCESGTFFAL-PKSG  156

Query  64   NKIVGFFGRSGYYIDAIGTY  5
            +KI+GF G++G+YIDAIG +
Sbjct  157  SKIIGFHGKAGWYIDAIGVH  176


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            +D I  D   E LT ++GT+G       NV++S+ F TN  + G +G   G  F  +   
Sbjct  324  HDKIVFDYPSEVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDE  383

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G K+VGF GR G ++DAIG +
Sbjct  384  G-KVVGFLGREGLFLDAIGVH  403


 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 52/91 (57%), Gaps = 5/91 (5%)
 Frame = -2

Query  271  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNV  98
            GG     TH   I ++  +E LT ISG +G   +SD  NV++S+ F T+  ++G YG   
Sbjct  516  GGNNGVATHR--IKLEYPNETLTCISGFYGPLNNSDRSNVVKSLSFFTSRGKYGPYGEEC  573

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            GT F     +G K++GF GR G  +DAIG +
Sbjct  574  GTFFTSTTTHG-KVLGFHGRCGCNLDAIGVH  603



>gb|KHG26998.1| Agglutinin [Gossypium arboreum]
Length=600

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 56/93 (60%), Gaps = 9/93 (10%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVL-RSIKFTTNAREFGTYGPN  101
            G GG++T     D + +D  DE+LT I G +G+      ++ RS+ F +N + +G +G  
Sbjct  63   GNGGSKT-----DKVKLDFPDEFLTSIHGYYGSLNQRGPIIVRSLTFHSNRKAYGPFGIE  117

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTYN  2
             GT F+    N  KIVGF GRSG+Y+DAIG Y+
Sbjct  118  QGTSFSM---NKGKIVGFRGRSGWYLDAIGVYS  147


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 43/80 (54%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            + I  D   E LT I+GTF        NV+RS+ F TN  + G YG   G  F  +   G
Sbjct  305  ERIMFDYPSEILTHITGTFAPLMYMGPNVIRSLTFYTNKGKHGPYGDEQGPSFTNKMNEG  364

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             KIVGF GR G ++DA+G +
Sbjct  365  -KIVGFLGREGLFLDAVGVH  383


 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 44/79 (56%), Gaps = 3/79 (4%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDN--VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  62
            + +D   E L  ISG +G+    +   V+RS+ F T+  ++G +G  VGT F      G 
Sbjct  503  VKLDYPHEVLICISGYYGSINDEEKFKVIRSLTFYTSRGKYGPFGEEVGTYFTSTTTQG-  561

Query  61   KIVGFFGRSGYYIDAIGTY  5
            K+VGF GR   Y+DAIG +
Sbjct  562  KVVGFHGRCSSYLDAIGVH  580



>ref|XP_010237569.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Brachypodium 
distachyon]
Length=690

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 45/71 (63%), Gaps = 1/71 (1%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
            E+LT +SGT G + S+   V++S+ F T A  +G +G   GTPF    Q+   IVGFF R
Sbjct  293  EFLTVVSGTIGPYDSAPAGVIKSLTFITTAGRYGPFGEEKGTPFQIPVQSNGSIVGFFAR  352

Query  37   SGYYIDAIGTY  5
            +G+Y+DA G Y
Sbjct  353  AGWYLDAFGIY  363


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 47/91 (52%), Gaps = 3/91 (3%)
 Frame = -2

Query  271  GGTETNVTHNDTINIDGEDEYLTEISGTFGAF--ASSDNVLRSIKFTTNAREFGTYGPNV  98
            G +  N    DTI +    E+LT + GT G F  ASSD ++ S+   TN   +G +G   
Sbjct  430  GASTGNPDQTDTILL-CSSEFLTGVRGTTGPFDPASSDVIVTSLTLITNTHSYGPFGQGR  488

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            GT F         IVGFFG S  YI+AIG Y
Sbjct  489  GTSFQIPLWGKGSIVGFFGCSESYINAIGVY  519


 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 4/74 (5%)
 Frame = -2

Query  214  EYLTEISGTFGAF-ASSDNVLRSIKFTTN-AREFGTYGPNVGTPFNFQAQNGN--KIVGF  47
            E L  +SGT G+   +S N++ S+ F T+ AR +G +G   GTPF+  A  GN   +V F
Sbjct  613  EVLQGVSGTVGSSDGTSSNLVTSLTFATDQARAYGPFGAGGGTPFSAAAAAGNDGPVVAF  672

Query  46   FGRSGYYIDAIGTY  5
            FGR+G  ++A+G Y
Sbjct  673  FGRAGLCLEALGVY  686



>ref|XP_006838705.1| hypothetical protein AMTR_s00002p00249920 [Amborella trichopoda]
 gb|ERN01274.1| hypothetical protein AMTR_s00002p00249920 [Amborella trichopoda]
Length=610

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 58/92 (63%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPN  101
            G GG +T     D + ++  +E LT +SG +G  +S    ++RS+ F TN +++G +G  
Sbjct  65   GNGGCKT-----DKVKLEYPEEVLTWLSGHYGPMSSGCPTIIRSLTFQTNLKKYGPFGVQ  119

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F+F   +G K+VGF GRSG+++D+IG +
Sbjct  120  QGTHFSF-TMSGGKVVGFHGRSGWHLDSIGLH  150


 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            +D +  D   E LT I+G +GA F     V++S+ F T   ++G YG   G  F+ Q+  
Sbjct  311  SDKVVFDYPFEILTYITGNYGAAFLMGPMVIKSLTFHTTKGQYGPYGDQQGMSFSSQSVA  370

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G +IVGF GRSG+Y+DAIG +
Sbjct  371  G-RIVGFHGRSGWYLDAIGVH  390


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 7/93 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN--VLRSIKFTTNAREFGTYGP  104
            GG G ET  TH   I  +  +E LT I+G +GA A  D   V++S+ F T+  ++G YG 
Sbjct  501  GGRGGET--THR--IKFEYPNEVLTCITGYYGAVARDDRLEVIKSLTFCTSRGKYGPYGE  556

Query  103  NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             +GT F      G K+VGF GRSG Y+ AIG +
Sbjct  557  ELGTYFTSNRTEG-KVVGFHGRSGSYLYAIGVH  588



>gb|EMS53468.1| hypothetical protein TRIUR3_21407 [Triticum urartu]
Length=135

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 44/71 (62%), Gaps = 2/71 (3%)
 Frame = -2

Query  217  DEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
            DE+ T + G +G F  S  V+RS+ F +NAR FG YG   G PF   A  G KI+GF  R
Sbjct  54   DEHFTGVVGHYGEFDGS-FVVRSLTFVSNARSFGPYGQEDGVPFALPAA-GGKILGFHAR  111

Query  37   SGYYIDAIGTY  5
            SG  +DA+GTY
Sbjct  112  SGRRLDALGTY  122



>ref|XP_004298564.1| PREDICTED: uncharacterized protein LOC101299670 [Fragaria vesca 
subsp. vesca]
Length=890

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 38/90 (42%), Positives = 50/90 (56%), Gaps = 7/90 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPN  101
            G GG  T       I +   DE+L  +SG +       + V+RS+KF +N R FG +G  
Sbjct  766  GLGGNRTA-----EIKLQYPDEFLVSVSGHYCPVVYGGSPVIRSLKFESNRRTFGPFGVE  820

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIG  11
             GTPF F   +G KIVG  GR G+Y+DAIG
Sbjct  821  EGTPFTFTV-DGGKIVGLKGRGGWYLDAIG  849



>ref|XP_004986922.1| PREDICTED: horcolin-like [Setaria italica]
Length=132

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 44/71 (62%), Gaps = 1/71 (1%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSD-NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
            E+LTE+SGTF    +   + + S+ F TN R+ G +G   GTPF+   ++G +IV  FGR
Sbjct  55   EFLTEVSGTFAYIGTQPTDAVTSLTFVTNLRKHGPFGDVDGTPFSVPVRDGGRIVALFGR  114

Query  37   SGYYIDAIGTY  5
               YIDAIG Y
Sbjct  115  GWDYIDAIGVY  125



>ref|XP_010471351.1| PREDICTED: jacalin-related lectin 19 [Camelina sativa]
Length=177

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I +   DEYL  +SG +    +S   V+RS+ F +N + +G YG   GTPF F   NG +
Sbjct  75   IKLQYPDEYLIGVSGYYCPMVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGR  133

Query  58   IVGFFGRSGYYIDAIG  11
            IVG  GRSG+Y+D+IG
Sbjct  134  IVGMNGRSGWYLDSIG  149



>ref|XP_010690084.1| PREDICTED: jacalin-related lectin 19 [Beta vulgaris subsp. vulgaris]
Length=189

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I +   +EYL  +SG +         V+RS+ F +N R FG +G   GTPF F  + G +
Sbjct  77   IKLIYPEEYLISVSGYYSPVVQGMTPVVRSLSFKSNRRSFGPFGVEEGTPFYFPVE-GGR  135

Query  58   IVGFFGRSGYYIDAIGTY  5
            I+GF GRSG+Y+D+IG Y
Sbjct  136  IIGFKGRSGWYLDSIGFY  153



>ref|NP_001050311.2| Os03g0399800 [Oryza sativa Japonica Group]
 dbj|BAF12225.2| Os03g0399800, partial [Oryza sativa Japonica Group]
Length=199

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E +TE+ GT G F   D+++ S+K  T+ R  G +G   GTPF+   +    +VGFF R+
Sbjct  121  ERVTEVHGTVGPFGDRDSLVTSLKLVTDRRTIGPFGYGAGTPFSVPVRGDGGVVGFFVRA  180

Query  34   GYYIDAIGTY  5
            G Y++AIG Y
Sbjct  181  GAYLEAIGVY  190



>gb|AAK55472.1|AC084295_5 putative salt-induced protein [Oryza sativa Japonica Group]
 gb|AAP12924.1| putative salt-induced protein [Oryza sativa Japonica Group]
 gb|EAY90358.1| hypothetical protein OsI_11938 [Oryza sativa Indica Group]
Length=191

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 43/70 (61%), Gaps = 0/70 (0%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRS  35
            E +TE+ GT G F   D+++ S+K  T+ R  G +G   GTPF+   +    +VGFF R+
Sbjct  113  ERVTEVHGTVGPFGDRDSLVTSLKLVTDRRTIGPFGYGAGTPFSVPVRGDGGVVGFFVRA  172

Query  34   GYYIDAIGTY  5
            G Y++AIG Y
Sbjct  173  GAYLEAIGVY  182



>ref|XP_010477195.1| PREDICTED: jacalin-related lectin 3-like isoform X2 [Camelina 
sativa]
Length=573

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D + +D   EYL  ++GT+G+F A  +  +RS+   +N R++G +G   GT F    ++G
Sbjct  47   DNVKLDYPHEYLISVNGTYGSFDAWGNTCVRSLILESNHRKYGPFGCESGTFFAL-PKSG  105

Query  64   NKIVGFFGRSGYYIDAIGTY  5
            +KI+GF G++G+YIDAIG +
Sbjct  106  SKIIGFHGKAGWYIDAIGVH  125


 Score = 57.0 bits (136),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            +D I  D   E LT ++GT+G       NV++S+ F TN  + G +G   G  F  +   
Sbjct  273  HDKIVFDYPSEVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDE  332

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G K+VGF GR G ++DAIG +
Sbjct  333  G-KVVGFLGREGLFLDAIGVH  352


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 52/91 (57%), Gaps = 5/91 (5%)
 Frame = -2

Query  271  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNV  98
            GG     TH   I ++  +E LT ISG +G   +SD  NV++S+ F T+  ++G YG   
Sbjct  465  GGNNGVATHR--IKLEYPNETLTCISGFYGPLNNSDRSNVVKSLSFFTSRGKYGPYGEEC  522

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            GT F     +G K++GF GR G  +DAIG +
Sbjct  523  GTFFTSTTTHG-KVLGFHGRCGCNLDAIGVH  552



>ref|XP_006473571.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
isoform X1 [Citrus sinensis]
Length=619

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D + +D  DE+LT + G +GA     +V +RS+ F +N + +G +G   GT F+F    G
Sbjct  71   DQVKLDYPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTYFSF-PMTG  129

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             KIVGF GR G+Y+DAIG Y
Sbjct  130  GKIVGFHGRCGWYLDAIGIY  149


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 3/84 (4%)
 Frame = -2

Query  250  THNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQ  77
            T+   I ++   E LT ISG +G  +  +   V+RS+ F T+  ++G +G  VGT F   
Sbjct  517  TYTHRIKLEFPHEVLTCISGYYGPISRDERPKVIRSLTFDTSRGKYGPFGEEVGTFFTST  576

Query  76   AQNGNKIVGFFGRSGYYIDAIGTY  5
               G K+VGF GRS +Y+DAIG +
Sbjct  577  TTEG-KVVGFHGRSSFYLDAIGVH  599


 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            +D +  D   E LT+I+GT+G       N++RS+ F T   + G +G   G  F+ +   
Sbjct  323  HDRVIFDYPYEILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIGE  382

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G KIVGF GR G ++DAIG Y
Sbjct  383  G-KIVGFHGRDGLFLDAIGVY  402



>ref|XP_006435072.1| hypothetical protein CICLE_v10000604mg [Citrus clementina]
 gb|ESR48312.1| hypothetical protein CICLE_v10000604mg [Citrus clementina]
Length=619

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D + +D  DE+LT + G +GA     +V +RS+ F +N + +G +G   GT F+F    G
Sbjct  71   DQVKLDYPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTYFSF-PMTG  129

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             KIVGF GR G+Y+DAIG Y
Sbjct  130  GKIVGFHGRCGWYLDAIGIY  149


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 3/84 (4%)
 Frame = -2

Query  250  THNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQ  77
            T+   I ++   E LT ISG +G  +  +   V+RS+ F T+  ++G +G  VGT F   
Sbjct  517  TYTHRIKLEYPHEVLTCISGYYGPISKDERPKVIRSLTFYTSRGKYGPFGEEVGTFFTST  576

Query  76   AQNGNKIVGFFGRSGYYIDAIGTY  5
               G K+VGF GRS +Y+DAIG +
Sbjct  577  TTEG-KVVGFHGRSSFYLDAIGVH  599


 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            +D +  D   E LT+I+GT+G       N++RS+ F T   + G +G   G  F+ +   
Sbjct  323  HDRVIFDYPYEILTQITGTYGPLMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIGE  382

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G KIVGF GR G ++DAIG Y
Sbjct  383  G-KIVGFHGRDGLFLDAIGVY  402



>ref|XP_009599288.1| PREDICTED: jacalin-related lectin 3 isoform X1 [Nicotiana tomentosiformis]
Length=661

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPN  101
            G GG +T     D + ++  DE+LT + G +G+     +V +RS+ F +N R +G YG  
Sbjct  64   GSGGAKT-----DKVRLNYPDEFLTCLHGYYGSLHERGSVFVRSLTFQSNKRTYGPYGVQ  118

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F      G K+VGF G+SG+Y+DAIG Y
Sbjct  119  QGTYFTLPISRG-KVVGFHGKSGWYLDAIGVY  149


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  62
            + ++   E LT I+G +G  +      V++S+ F T  R+FG +G  +GT F      G 
Sbjct  564  VKLEYPHEVLTCITGFYGPISKDMGLKVIKSLTFHTTRRKFGPFGEELGTYFTSATTEG-  622

Query  61   KIVGFFGRSGYYIDAIGTY  5
            K+VGF GRSG Y+DAIG +
Sbjct  623  KVVGFHGRSGMYLDAIGVH  641


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            + I  D   E LT I+G +G A     N+++S+ F T   + G YG   G  F+ + + G
Sbjct  314  ERIIFDYPSEILTHITGYYGPAMIMGPNIIQSLTFHTTKGKHGPYGEEQGQQFSTKLKEG  373

Query  64   NKIVGFFGRSGYYIDAIGTY  5
              IVGF GR G ++DA+G +
Sbjct  374  I-IVGFHGRKGLFLDALGVH  392



>ref|XP_009599289.1| PREDICTED: jacalin-related lectin 3 isoform X2 [Nicotiana tomentosiformis]
Length=649

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPN  101
            G GG +T     D + ++  DE+LT + G +G+     +V +RS+ F +N R +G YG  
Sbjct  64   GSGGAKT-----DKVRLNYPDEFLTCLHGYYGSLHERGSVFVRSLTFQSNKRTYGPYGVQ  118

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F      G K+VGF G+SG+Y+DAIG Y
Sbjct  119  QGTYFTLPISRG-KVVGFHGKSGWYLDAIGVY  149


 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  62
            + ++   E LT I+G +G  +      V++S+ F T  R+FG +G  +GT F      G 
Sbjct  552  VKLEYPHEVLTCITGFYGPISKDMGLKVIKSLTFHTTRRKFGPFGEELGTYFTSATTEG-  610

Query  61   KIVGFFGRSGYYIDAIGTY  5
            K+VGF GRSG Y+DAIG +
Sbjct  611  KVVGFHGRSGMYLDAIGVH  629


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            + I  D   E LT I+G +G A     N+++S+ F T   + G YG   G  F+ + + G
Sbjct  314  ERIIFDYPSEILTHITGYYGPAMIMGPNIIQSLTFHTTKGKHGPYGEEQGQQFSTKLKEG  373

Query  64   NKIVGFFGRSGYYIDAIGTY  5
              IVGF GR G ++DA+G +
Sbjct  374  I-IVGFHGRKGLFLDALGVH  392



>ref|XP_007216928.1| hypothetical protein PRUPE_ppa016643mg, partial [Prunus persica]
 gb|EMJ18127.1| hypothetical protein PRUPE_ppa016643mg, partial [Prunus persica]
Length=351

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 3/77 (4%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGA--FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  62
            I +   DE+L  +SG +    F     ++RS+KF +N R FG YG   GTPF F   +G 
Sbjct  247  IKLQYPDEFLVGVSGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGG  305

Query  61   KIVGFFGRSGYYIDAIG  11
            KIVG  GR G+Y+DAIG
Sbjct  306  KIVGLKGRDGWYLDAIG  322


 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 46/77 (60%), Gaps = 3/77 (4%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGA--FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  62
            I +   DE+L  +SG +    F     ++RS+KF +N R FG YG   GTPF F   +G 
Sbjct  92   IKLQYPDEHLVGVSGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGG  150

Query  61   KIVGFFGRSGYYIDAIG  11
            +IVG  GR G+Y+DAIG
Sbjct  151  QIVGLKGRDGWYLDAIG  167



>ref|XP_008656248.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Zea 
mays]
 ref|XP_008656249.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Zea 
mays]
Length=488

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/72 (44%), Positives = 47/72 (65%), Gaps = 1/72 (1%)
 Frame = -2

Query  214  EYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
            E+L  +SGT G +A    +V+RS+ F TN R + T G  VG PF  +A  G+ IVGF  R
Sbjct  414  EFLVGVSGTTGGYAGLPTSVIRSLTFVTNVRTYRTRGAPVGDPFALEAPAGSCIVGFHAR  473

Query  37   SGYYIDAIGTYN  2
            +G+++DA+G Y+
Sbjct  474  AGHFLDALGVYH  485



>gb|EAY98637.1| hypothetical protein OsI_20561 [Oryza sativa Indica Group]
Length=724

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 6/89 (7%)
 Frame = -2

Query  271  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  92
            GG+ET     D + +D  DE L  +SG +G+   +  ++RS+ F +N   +G +G   GT
Sbjct  188  GGSET-----DKVKLDFPDEILVSVSGYYGSVCGTPVIIRSLTFQSNRSIYGPFGTEDGT  242

Query  91   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            PF+    +G KI+GF GRSG Y+++IG Y
Sbjct  243  PFSLPVSSG-KIIGFHGRSGSYLNSIGFY  270


 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D I  D   E LT I+G +G        V+RS+ F TN R +G YG   GT F+    +G
Sbjct  438  DKIVFDFPSEVLTHITGYYGTTMIMGPTVVRSLTFHTNKRRYGPYGDECGTYFSTSFSDG  497

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             +IVGF GR G+YID IG +
Sbjct  498  -RIVGFHGREGWYIDGIGVH  516


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 4/89 (4%)
 Frame = -2

Query  268  GTETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGT  92
            GT  ++TH   I +D   E LT + G +         VLRSI F +N  ++G +G   G 
Sbjct  618  GTSGHITHR--IKLDYPHEVLTCVYGYYNTNREEGPRVLRSITFISNRGKYGPFGEEFGA  675

Query  91   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             F+  A+   K+VGF GRSG ++DAIG +
Sbjct  676  YFS-SAKTEGKVVGFHGRSGQHLDAIGVH  703



>ref|NP_001055995.1| Os05g0508400 [Oryza sativa Japonica Group]
 gb|AAT44259.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17909.1| Os05g0508400 [Oryza sativa Japonica Group]
Length=604

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 6/89 (7%)
 Frame = -2

Query  271  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  92
            GG+ET     D + +D  DE L  +SG +G+   +  ++RS+ F +N   +G +G   GT
Sbjct  68   GGSET-----DKVKLDFPDEILVSVSGYYGSVCGTPVIIRSLTFQSNRSIYGPFGTEDGT  122

Query  91   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            PF+    +G KI+GF GRSG Y+++IG Y
Sbjct  123  PFSLPVSSG-KIIGFHGRSGSYLNSIGFY  150


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D I  D   E LT I+G +G        V+RS+ F TN R +G YG   GT F+    +G
Sbjct  318  DKIVFDFPSEVLTHITGYYGTTMIMGPTVVRSLTFHTNKRRYGPYGDECGTYFSTSFSDG  377

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             +IVGF GR G+YID IG +
Sbjct  378  -RIVGFHGREGWYIDGIGVH  396


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 4/89 (4%)
 Frame = -2

Query  268  GTETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGT  92
            GT  ++TH   I +D   E LT + G +         VLRSI F +N  ++G +G   G 
Sbjct  498  GTSGHITHR--IKLDYPHEVLTCVYGYYNTNREEGPRVLRSITFISNRGKYGPFGEEFGA  555

Query  91   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             F+  A+   K+VGF GRSG ++DAIG +
Sbjct  556  YFS-SAKTEGKVVGFHGRSGQHLDAIGVH  583



>ref|XP_006473572.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
isoform X2 [Citrus sinensis]
Length=1252

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  250  THNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTPFNFQA  74
            T  D + +D  DE+LT + G +GA     +V +RS+ F +N + +G +G   GT F+F  
Sbjct  701  TKFDQVKLDYPDEFLTSVHGHYGATNDRGSVFVRSLTFQSNRKTYGPFGVEQGTYFSF-P  759

Query  73   QNGNKIVGFFGRSGYYIDAIGTY  5
              G KIVGF GR G+Y+DAIG Y
Sbjct  760  MTGGKIVGFHGRCGWYLDAIGIY  782


 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 8/93 (9%)
 Frame = -2

Query  277   GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGP  104
             G GGT T+      I ++   E LT ISG +G  +  +   V+RS+ F T+  ++G +G 
Sbjct  1146  GNGGTYTH-----RIKLEFPHEVLTCISGYYGPISRDERPKVIRSLTFDTSRGKYGPFGE  1200

Query  103   NVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
              VGT F      G K+VGF GRS +Y+DAIG +
Sbjct  1201  EVGTFFTSTTTEG-KVVGFHGRSSFYLDAIGVH  1232


 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 46/82 (56%), Gaps = 2/82 (2%)
 Frame = -2

Query  247   HNDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQ  71
              +D +  D   E LT+I+GT+G       N++RS+ F T   + G +G   G  F+ +  
Sbjct  955   RHDRVIFDYPYEILTQITGTYGPVMYMGPNIIRSLTFHTTKGKHGPFGEEQGQSFSNKIG  1014

Query  70    NGNKIVGFFGRSGYYIDAIGTY  5
              G KIVGF GR G ++DAIG Y
Sbjct  1015  EG-KIVGFHGRDGLFLDAIGVY  1035



>ref|XP_010236764.1| PREDICTED: jacalin-related lectin 19-like [Brachypodium distachyon]
Length=168

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 45/77 (58%), Gaps = 1/77 (1%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  56
            I +   DE+ T ++G +G      +V+RS+ F +N R FG +G   G PF   A  G +I
Sbjct  80   ICLRDPDEHFTSVTGHYGDLDGGLSVVRSLTFVSNRRSFGPFGKEEGVPFALPA-CGGRI  138

Query  55   VGFFGRSGYYIDAIGTY  5
            +GF  RSG ++ AIGTY
Sbjct  139  LGFHARSGTHLHAIGTY  155



>gb|EEE64302.1| hypothetical protein OsJ_19139 [Oryza sativa Japonica Group]
Length=1105

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 54/89 (61%), Gaps = 6/89 (7%)
 Frame = -2

Query  271  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  92
            GG+ET     D + +D  DE L  +SG +G+   +  ++RS+ F +N   +G +G   GT
Sbjct  569  GGSET-----DKVKLDFPDEILVSVSGYYGSVCGTPVIIRSLTFQSNRSIYGPFGTEDGT  623

Query  91   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            PF+    +G KI+GF GRSG Y+++IG Y
Sbjct  624  PFSLPVSSG-KIIGFHGRSGSYLNSIGFY  651


 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 45/80 (56%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D I  D   E LT I+G +G        V+RS+ F TN R +G YG   GT F+    +G
Sbjct  819  DKIVFDFPSEVLTHITGYYGTTMIMGPTVVRSLTFHTNKRRYGPYGDECGTYFSTSFSDG  878

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             +IVGF GR G+YID IG +
Sbjct  879  -RIVGFHGREGWYIDGIGVH  897


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 4/89 (4%)
 Frame = -2

Query  268   GTETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGT  92
             GT  ++TH   I +D   E LT + G +         VLRSI F +N  ++G +G   G 
Sbjct  999   GTSGHITHR--IKLDYPHEVLTCVYGYYNTNREEGPRVLRSITFISNRGKYGPFGEEFGA  1056

Query  91    PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
              F+  A+   K+VGF GRSG ++DAIG +
Sbjct  1057  YFS-SAKTEGKVVGFHGRSGQHLDAIGVH  1084



>ref|XP_009763456.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X4 [Nicotiana sylvestris]
Length=1606

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GG    V   +T       E+LT I GT G F    +V++S+ FTTN + +G +G   
Sbjct  67   GNGGRINKVVFEET-----PLEHLTGIKGTLGCF-DGYSVIKSLCFTTNVKNYGPFGSEG  120

Query  97   G-TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            G TPF+   + G  IVGF GR G Y+DAIG Y
Sbjct  121  GGTPFSLVMKEGVAIVGFHGRCGAYLDAIGVY  152


 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG + +   V++S+ F TNA  +G +G + G TPF+   + G  IVGF G 
Sbjct  289  EYLTGIKGTFGCY-NGHCVIKSLCFITNANNYGPFGSDAGGTPFSLVMKEGVAIVGFHGL  347

Query  37   SGYYIDAIGTY  5
             G Y+DAIG Y
Sbjct  348  CGAYLDAIGIY  358



>ref|XP_008466548.1| PREDICTED: agglutinin-like [Cucumis melo]
Length=476

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 4/83 (5%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFG---AFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQA  74
            +  + +D  +EYL  I G +G    +  + NV+RS+ F TN + +G +G   G  F+F  
Sbjct  72   SSKVVLDYPNEYLISIYGYYGYIGKWGLAHNVIRSLTFQTNRKTYGPFGKEEGVKFSFPI  131

Query  73   QNGNKIVGFFGRSGYYIDAIGTY  5
              G KIVGF GRSG+Y+DAIG Y
Sbjct  132  M-GAKIVGFHGRSGWYLDAIGLY  153


 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 47/89 (53%), Gaps = 4/89 (4%)
 Frame = -2

Query  262  ETNVTHNDTINIDGEDEYLTEISGTFG---AFASSDNVLRSIKFTTNAREFGTYGPNVGT  92
            +TN +    + ++  DEY   + G +        S  V+RS+ F TN R +G +G   GT
Sbjct  218  DTNGSSKSEVVLEFPDEYFVSVHGYYSHIRVLEDSATVIRSLTFKTNRRTYGPFGIEDGT  277

Query  91   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             F+     G  IVG +GRSG ++DAIG Y
Sbjct  278  RFSCPIL-GTDIVGVYGRSGLFLDAIGLY  305


 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 49/94 (52%), Gaps = 10/94 (11%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFG---AFASSDNVLRSIKFTTNAREFGTYG  107
            G GG+ + V       ++  DEYL  I G +     +  +  V+RS+   TN + +G +G
Sbjct  384  GDGGSRSEVV------LEFPDEYLVSIRGYYSDIRRWGLATTVIRSLTLETNKKSYGPFG  437

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
               G+ F+F    G K+VG  GRSG ++ AIG +
Sbjct  438  VEDGSKFSFPTV-GLKVVGIHGRSGLFLYAIGLH  470



>gb|KHN46147.1| Agglutinin [Glycine soja]
Length=597

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPN  101
            G GG +T     D + +D  +E+LT+I G +G+      N +RS+ F +N + +G +G  
Sbjct  64   GSGGRKT-----DKVKLDCPNEFLTKIHGYYGSSNQRGPNFVRSLSFESNKKTYGPFGVE  118

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            +GT F+     G KIVGF GR G+Y+DAIG Y
Sbjct  119  LGTYFSVPL-TGAKIVGFHGRCGWYVDAIGVY  149


 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            ND I  D   E LT ISG +G       +V+RS+ F T  R++G YG   GT F  + + 
Sbjct  301  NDKIVFDFPYEALTHISGYYGPLMYMGPSVIRSLTFHTTKRKYGPYGEEQGTYFTTKVKE  360

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G KIVG  GR G ++DA G +
Sbjct  361  G-KIVGIHGRKGLFLDAFGVH  380


 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 53/95 (56%), Gaps = 5/95 (5%)
 Frame = -2

Query  283  TIGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN--VLRSIKFTTNAREFGTY  110
            ++  GG+  +  H   I ++  +E LT ISG +G  A  +   +++S+ F T+  ++G +
Sbjct  487  SVKHGGSGGDTMHR--IQLEYPNEVLTCISGYYGPIAKDEQHIIMKSLTFNTSRGKYGPF  544

Query  109  GPNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            G  VG  F      G K+VGF GRS  Y+DAIG +
Sbjct  545  GEEVGKFFTSTTTEG-KVVGFHGRSSLYLDAIGVH  578



>ref|XP_010664949.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720 
[Vitis vinifera]
Length=1593

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 36/92 (39%), Positives = 52/92 (57%), Gaps = 7/92 (8%)
 Frame = -2

Query  277   GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPN  101
             G GGT TN      + +D  DE+LT I G +G+      V +RS+   +N R +G +G  
Sbjct  1017  GSGGTRTN-----RVKLDSPDEFLTSIHGHYGSLLERGPVFVRSLTLESNKRTYGPFGIE  1071

Query  100   VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
              G  F+     G KI+GF G+SG+Y+DAIG +
Sbjct  1072  QGIYFSLPT-TGGKIIGFHGKSGWYLDAIGVH  1102


 Score = 60.5 bits (145),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = -2

Query  244   NDTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
             ND I ID   E LT I+G +        N+++S+ F T   ++G +G   GTPF+   + 
Sbjct  1289  NDKIVIDYPYEVLTHITGYYAPTMVMGPNIIKSLTFHTTKTKYGPFGEEQGTPFSSNIKE  1348

Query  67    GNKIVGFFGRSGYYIDAIGTY  5
             G  IVGF GR+G +IDAIG +
Sbjct  1349  G-VIVGFHGRTGLFIDAIGVH  1368


 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 30/91 (33%), Positives = 50/91 (55%), Gaps = 5/91 (5%)
 Frame = -2

Query  271   GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNV  98
             GG     TH   + ++   E ++ I G +G  + ++  N ++S+ F T+  ++G +G  +
Sbjct  1486  GGDYGTTTHR--VKLEYPHEVVSCICGYYGPISINEPWNAIKSLTFYTSRGKYGPFGEEI  1543

Query  97    GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F      G K+VGF GRS  Y+DAIG +
Sbjct  1544  GTYFTSTRTEG-KVVGFHGRSSLYLDAIGVH  1573



>ref|XP_009763443.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana sylvestris]
Length=1742

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 39/92 (42%), Positives = 51/92 (55%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GG    V   +T       E+LT I GT G F    +V++S+ FTTN + +G +G   
Sbjct  203  GNGGRINKVVFEET-----PLEHLTGIKGTLGCF-DGYSVIKSLCFTTNVKNYGPFGSEG  256

Query  97   G-TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            G TPF+   + G  IVGF GR G Y+DAIG Y
Sbjct  257  GGTPFSLVMKEGVAIVGFHGRCGAYLDAIGVY  288


 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG + +   V++S+ F TNA  +G +G + G TPF+   + G  IVGF G 
Sbjct  425  EYLTGIKGTFGCY-NGHCVIKSLCFITNANNYGPFGSDAGGTPFSLVMKEGVAIVGFHGL  483

Query  37   SGYYIDAIGTY  5
             G Y+DAIG Y
Sbjct  484  CGAYLDAIGIY  494


 Score = 63.2 bits (152),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGP-NVGTPFNFQAQNGNKIVGFFGR  38
            EYLT I GTF        V+ S+ F TNA+ +G +G  + GTPF+F  + G  I GF GR
Sbjct  35   EYLTGIKGTFRG-CGIHLVINSLCFITNAKNYGPFGSKDGGTPFSFAMKEGGAIEGFQGR  93

Query  37   SGYYIDAIGTY  5
             G Y+DAIG Y
Sbjct  94   CGAYLDAIGVY  104



>gb|ABA94732.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=597

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 46/71 (65%), Gaps = 1/71 (1%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNA-REFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
            E++  +SGT G+F    NV+ S+KFTTN  R +G YG   GTPF    ++   IVGFFGR
Sbjct  522  EHIKGLSGTVGSFGMLQNVITSLKFTTNLNRTYGPYGKGGGTPFVVPVEDAASIVGFFGR  581

Query  37   SGYYIDAIGTY  5
            +G  ++A+G Y
Sbjct  582  AGPCVEAVGVY  592


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 48/74 (65%), Gaps = 2/74 (3%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGF  47
            G  E+LTEISGT G +  +  +V++S+   TN+  +G +G   GT F+    NG+ IVGF
Sbjct  359  GPSEFLTEISGTTGPYVCAVADVVKSLTLVTNSGSYGPFGQGGGTAFHTSQSNGS-IVGF  417

Query  46   FGRSGYYIDAIGTY  5
            FGR+G ++ +IG Y
Sbjct  418  FGRAGGFLHSIGVY  431



>ref|XP_006372325.1| Mannose/glucose-specific lectin family protein [Populus trichocarpa]
 gb|ERP50122.1| Mannose/glucose-specific lectin family protein [Populus trichocarpa]
Length=446

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = -2

Query  274  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG  95
            GG    ++    T+ I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G   G
Sbjct  352  GGENPNDIGERKTVLINWPSEHLISISGTYGKF-STLLTITSLSFTTNRATYGPFGTGSG  410

Query  94   TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            TPF+    N N +VGF GR+G+Y+DAIG +
Sbjct  411  TPFSIPINN-NTVVGFHGRAGHYLDAIGIF  439


 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 50/94 (53%), Gaps = 2/94 (2%)
 Frame = -2

Query  283  TIGGGGTETNVT-HNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG  107
            T GG G + N       I I    EYL  ISGT+G +     V+ S+ FTTN    G +G
Sbjct  55   TFGGTGNDPNDRGEEKKIAIQWPTEYLKSISGTYGRYKGVLAVITSLSFTTNLTTHGPFG  114

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
               G PF+    +G  +VGF GR GYY+DA+G +
Sbjct  115  TAPGEPFSIPIADG-VVVGFHGRCGYYLDALGVF  147


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 49/77 (64%), Gaps = 2/77 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  56
            I IDG  E+LT I+GT+G +A    V+ S+ F TN   +G +G   GT F+   + G+ +
Sbjct  219  IEIDGLSEHLTSITGTYGDYAGM-VVITSLAFQTNLTTYGPFGNATGTSFSIPIE-GSVV  276

Query  55   VGFFGRSGYYIDAIGTY  5
            +GF GR G+Y+DAIG +
Sbjct  277  IGFHGRGGHYLDAIGIH  293



>ref|XP_010088386.1| hypothetical protein L484_008121 [Morus notabilis]
 gb|EXB34860.1| hypothetical protein L484_008121 [Morus notabilis]
Length=193

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I ++  +EYL  +SG +       + V+RS+   +N R FG YG   GTPF+F  Q G  
Sbjct  78   IKLNYPEEYLVSVSGYYCPVVHGGSPVIRSLTLKSNKRTFGPYGVEEGTPFSFPIQ-GGL  136

Query  58   IVGFFGRSGYYIDAIG  11
            IVGF GR+G+Y+DAIG
Sbjct  137  IVGFKGRNGWYLDAIG  152



>ref|NP_001044410.1| Os01g0775500 [Oryza sativa Japonica Group]
 dbj|BAF06324.1| Os01g0775500, partial [Oryza sativa Japonica Group]
Length=349

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 6/91 (7%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            G GGT+T     D + +D   E LT +SG +G+      V+RS+ F +N  ++G +G   
Sbjct  64   GDGGTKT-----DQVKLDYPQEILTSVSGYYGSLGGCI-VVRSLTFRSNLSKYGPFGSEE  117

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            GTPF+       K++GF G+SG+++D+IG +
Sbjct  118  GTPFSLPVAVTGKVIGFHGKSGWFLDSIGCH  148



>ref|XP_002510452.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF52639.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=1218

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPN  101
            G GG  T     D + +D  DEYL  +SG +G+      V +RS+ F +N R +G +G  
Sbjct  686  GNGGNRT-----DKVKLDYPDEYLASVSGHYGSLNQWGPVFVRSLTFQSNKRTYGPFGVE  740

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F+F    G +IVGF G+ GY++DAIG Y
Sbjct  741  QGTYFSF-PMTGGRIVGFHGKGGYFVDAIGIY  771


 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 10/94 (11%)
 Frame = -2

Query  277   GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN---VLRSIKFTTNAREFGTYG  107
             G GGT TN      + ++   E LT ISG +G  AS D    V++S+ F T+  ++G +G
Sbjct  1112  GSGGTATN-----RVKLEYPHEVLTRISGYYGP-ASRDERPTVVKSLTFYTSRGQYGPFG  1165

Query  106   PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
               +GT F      G K+VGF GR G Y+DAIG +
Sbjct  1166  EEIGTFFTSTTTEG-KVVGFHGRCGAYLDAIGVH  1198


 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 45/79 (57%), Gaps = 2/79 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            + I  D   E LT ISGT+G       N+++S+ F TN  + G +G   G  F+ +  NG
Sbjct  923  EKITFDYPYEILTHISGTYGPLMFMGPNIIKSLTFYTNKGKHGPFGDEQGPSFSTKP-NG  981

Query  64   NKIVGFFGRSGYYIDAIGT  8
             KIVGF G+ G ++DAIG 
Sbjct  982  GKIVGFHGKEGLFLDAIGV  1000



>ref|XP_011081586.1| PREDICTED: jacalin-related lectin 19-like [Sesamum indicum]
Length=308

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDNVL-RSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            + +   DEYLTE+SG         N + RS+KF +N R +G +G    TPF F  + G  
Sbjct  24   VKLQFPDEYLTEVSGHCSPLGRRGNAMVRSLKFRSNWRTYGPFGVESETPFCFPME-GGM  82

Query  58   IVGFFGRSGYYIDAIG  11
            IVGF GR G Y+DAIG
Sbjct  83   IVGFRGRCGLYVDAIG  98


 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASS-DNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I +   +E+LT ++G           V+RS+ F +N R FG +G   G PF+F  + G +
Sbjct  219  IKLKFPEEFLTTVTGHCSPVVCGGSPVIRSLTFKSNRRTFGPFGVEEGVPFSFPME-GGQ  277

Query  58   IVGFFGRSGYYIDAIG  11
            IVGF GR+G+Y+DAIG
Sbjct  278  IVGFKGRAGWYLDAIG  293



>ref|XP_010533565.1| PREDICTED: jacalin-related lectin 3 isoform X1 [Tarenaya hassleriana]
Length=601

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D + ++  DEYLT + GT+G+F     + +RS+ F +N R++G +G   GT F+      
Sbjct  74   DKVKLEYPDEYLTSVHGTYGSFDVWGTLCVRSLTFESNRRKYGPFGSESGTYFSLPKSEA  133

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             KIVGF G++G+Y+DAIG +
Sbjct  134  -KIVGFHGKTGWYLDAIGVH  152


 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            +D +  D   E LT I+GT+G+      NV+RS+ F TN  + G YG   G  F  +   
Sbjct  303  HDKVVFDFPSEVLTRITGTYGSLMYMGPNVIRSLTFYTNKGKHGPYGEEQGPSFTNKIGE  362

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G KIVGF GR G ++DAIG +
Sbjct  363  G-KIVGFLGREGLFLDAIGVH  382


 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  62
            I ++   E LT +SG +G  ++SD   V++S+ F T+  ++G YG   GT +      G 
Sbjct  505  IKLECPHEVLTCLSGYYGPVSNSDTTKVVKSVSFYTSRGKYGPYGEENGTYYTSTKTEG-  563

Query  61   KIVGFFGRSGYYIDAIGTY  5
            K+VGF GRS  Y+DAIG +
Sbjct  564  KVVGFHGRSSSYLDAIGVH  582



>ref|XP_002318228.2| hypothetical protein POPTR_0012s13320g [Populus trichocarpa]
 gb|EEE96448.2| hypothetical protein POPTR_0012s13320g [Populus trichocarpa]
Length=237

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I +   +EYLT +SG +         V+RS+ F++N R FG +G   GTPF   + +G  
Sbjct  124  IKLQYPEEYLTSVSGHYCPVVYGGSPVIRSLAFSSNKRTFGPFGVEEGTPFTL-SMDGAS  182

Query  58   IVGFFGRSGYYIDAIG  11
            IVGF GR G+Y+DAIG
Sbjct  183  IVGFKGRGGWYLDAIG  198



>ref|XP_009367509.1| PREDICTED: agglutinin alpha chain [Pyrus x bretschneideri]
Length=189

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I +   DEY+  ++G +G        ++RS+KF +N R FG +G + GTPF +     +K
Sbjct  83   IKLQYPDEYIVSVTGHYGTMVYGGTPIIRSLKFQSNRRTFGPFGMDEGTPFTYTLDR-SK  141

Query  58   IVGFFGRSGYYIDAIG  11
            IVG  GR+G+YIDAIG
Sbjct  142  IVGLKGRNGWYIDAIG  157



>ref|NP_001068257.2| Os11g0607900 [Oryza sativa Japonica Group]
 dbj|BAF28620.2| Os11g0607900, partial [Oryza sativa Japonica Group]
Length=107

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 41/71 (58%), Gaps = 1/71 (1%)
 Frame = -2

Query  217  DEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGR  38
             EYLT ISGT  + +    ++ S+   TN R +G YG   GTPF    Q    IVGFFGR
Sbjct  23   SEYLTGISGTIAS-SPYGVIITSLTLVTNTRTYGPYGQVGGTPFQIPIQIKGSIVGFFGR  81

Query  37   SGYYIDAIGTY  5
             G+Y+DA G Y
Sbjct  82   VGWYVDAFGIY  92



>ref|XP_010533571.1| PREDICTED: jacalin-related lectin 3 isoform X2 [Tarenaya hassleriana]
Length=598

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (64%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D + ++  DEYLT + GT+G+F     + +RS+ F +N R++G +G   GT F+      
Sbjct  71   DKVKLEYPDEYLTSVHGTYGSFDVWGTLCVRSLTFESNRRKYGPFGSESGTYFSLPKSEA  130

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             KIVGF G++G+Y+DAIG +
Sbjct  131  -KIVGFHGKTGWYLDAIGVH  149


 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 46/81 (57%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            +D +  D   E LT I+GT+G+      NV+RS+ F TN  + G YG   G  F  +   
Sbjct  300  HDKVVFDFPSEVLTRITGTYGSLMYMGPNVIRSLTFYTNKGKHGPYGEEQGPSFTNKIGE  359

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G KIVGF GR G ++DAIG +
Sbjct  360  G-KIVGFLGREGLFLDAIGVH  379


 Score = 53.9 bits (128),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 3/79 (4%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  62
            I ++   E LT +SG +G  ++SD   V++S+ F T+  ++G YG   GT +      G 
Sbjct  502  IKLECPHEVLTCLSGYYGPVSNSDTTKVVKSVSFYTSRGKYGPYGEENGTYYTSTKTEG-  560

Query  61   KIVGFFGRSGYYIDAIGTY  5
            K+VGF GRS  Y+DAIG +
Sbjct  561  KVVGFHGRSSSYLDAIGVH  579



>ref|XP_009398855.1| PREDICTED: protein GOS9-like [Musa acuminata subsp. malaccensis]
Length=143

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 54/91 (59%), Gaps = 8/91 (9%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
            GGGG + +       N+D +DE L  I G +G F    ++LRS+ F +N R +G +G   
Sbjct  59   GGGGGQMS-----EFNLD-DDETLRSIRGHYGRFDGV-SILRSLTFVSNKRTYGPFGREE  111

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            G  F  +A  G++IVGF GRSG Y+DA+G Y
Sbjct  112  GVAFTLEAP-GSRIVGFTGRSGLYLDALGIY  141



>ref|XP_007222058.1| hypothetical protein PRUPE_ppa003185mg [Prunus persica]
 gb|EMJ23257.1| hypothetical protein PRUPE_ppa003185mg [Prunus persica]
Length=595

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (61%), Gaps = 8/94 (9%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPN  101
            G GG +T     DT+ +   +E+LT I G +G  +    V +RS+KF +N + +G +G  
Sbjct  65   GNGGWKT-----DTVKLAYPEEFLTSIEGHYGKISEWGPVSIRSLKFKSNKKTYGPFGIE  119

Query  100  VGTPFNFQAQNG--NKIVGFFGRSGYYIDAIGTY  5
             GT F+  A     +KIVGFFG+SG+++D+IG Y
Sbjct  120  QGTYFSLPAARAGSSKIVGFFGKSGWFLDSIGAY  153


 Score = 61.6 bits (148),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 48/81 (59%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            +D I  D  +E LT I+GTFGA       V++S+ F T  ++ G YG   GTPF  + + 
Sbjct  286  SDKIVFDFPNEILTHITGTFGAAMMMGPIVIKSLTFHTTKKKHGPYGEEQGTPFTTKLRE  345

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G KIVG  GR G ++DA+G +
Sbjct  346  G-KIVGIHGRKGLFLDALGVH  365


 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 48/84 (57%), Gaps = 3/84 (4%)
 Frame = -2

Query  250  THNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQ  77
            T    I ++   E LT ISG +G  + ++   +++S+ F T+  ++G +G  VGT F   
Sbjct  493  TAPHRIKLEYPHEVLTCISGYYGCISKNERPQIIKSLTFYTSRGKYGPFGEEVGTFFTST  552

Query  76   AQNGNKIVGFFGRSGYYIDAIGTY  5
               G K+VG  GRS +Y+DAIG +
Sbjct  553  TTEG-KVVGLHGRSSFYLDAIGVH  575



>ref|XP_010092351.1| hypothetical protein L484_023729 [Morus notabilis]
 gb|EXB51027.1| hypothetical protein L484_023729 [Morus notabilis]
Length=201

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 53/91 (58%), Gaps = 7/91 (8%)
 Frame = -2

Query  259  TNVTHNDT---INIDGEDEYLTEISG---TFGAFASSDNVLRSIKFTTNAREFGTYGPNV  98
             + THN +   I ++   E+L  +SG        A+  +V+RS+ F TN + +G YG   
Sbjct  109  VDATHNLSHRGITLEFPYEFLVSVSGHTSVLPRLATGKDVIRSLTFKTNKKTYGPYGDEE  168

Query  97   GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            GTPF+   +NG  IVGF GRSG+ +DAIG Y
Sbjct  169  GTPFSLPIENG-LIVGFKGRSGFVLDAIGFY  198



>ref|NP_001104964.1| beta-glucosidase aggregating factor precursor [Zea mays]
 gb|AAF71261.2|AF232008_1 beta-glucosidase aggregating factor precursor [Zea mays]
Length=306

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 52/94 (55%), Gaps = 9/94 (10%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR---EFGTYG  107
            GG G ET       I + G+ E LTE+SGT G       V+ SIKF T+ +    FG +G
Sbjct  215  GGSGGETE----PVIQL-GDSEVLTELSGTIGN-VDGLTVITSIKFVTSLKTYGPFGAWG  268

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
                TPF    Q G+ IVGFF R+G Y+DA+G Y
Sbjct  269  NGSDTPFAIPVQQGSAIVGFFARAGVYLDALGVY  302



>ref|XP_008348484.1| PREDICTED: agglutinin-like isoform X2 [Malus domestica]
Length=174

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 52/92 (57%), Gaps = 9/92 (10%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASS---DNVLRSIKFTTNAREFGTYG  107
            G GGT+T       I +   DEY+  ++G +     +     ++RS+KF +N R FG +G
Sbjct  54   GHGGTQTA-----EIKLLYPDEYIVSVTGHYCTMVDAGIYSPIIRSLKFQSNRRTFGPFG  108

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIG  11
             + GTPF +   +G KIVG  GR G YIDAIG
Sbjct  109  RDQGTPFTYTL-DGGKIVGLKGRDGLYIDAIG  139



>ref|XP_008221341.1| PREDICTED: uncharacterized protein LOC103321320 [Prunus mume]
Length=622

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (61%), Gaps = 8/94 (9%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPN  101
            G GG +T     DT+ +   +E+LT I G +G  +    V +RS+KF +N + +G +G  
Sbjct  66   GNGGWKT-----DTVKLAYPEEFLTSIEGHYGKISEWGPVSIRSLKFKSNKKTYGPFGIE  120

Query  100  VGTPFNFQAQNG--NKIVGFFGRSGYYIDAIGTY  5
             GT F+  A     +KIVGFFG+SG+++D+IG Y
Sbjct  121  QGTYFSLPAARAGSSKIVGFFGKSGWFLDSIGAY  154


 Score = 64.7 bits (156),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            +D I  D  +E LT I+GTFGA      NV++S+ F T  ++ G YG   GTPF  + + 
Sbjct  313  SDKIVFDFPNEILTHITGTFGAAMMMGPNVIKSLTFHTTKKKHGPYGEEQGTPFTTKLRE  372

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G KIVG  GR G ++DA+G +
Sbjct  373  G-KIVGIHGRKGLFLDALGVH  392


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  62
            I ++   E LT ISG +G  + ++   +++S+ F T+  ++G +G  VGT F      G 
Sbjct  525  IKLEYPHEVLTCISGYYGCISKNERPQIIKSLTFYTSRGKYGPFGEEVGTFFTSTTTEG-  583

Query  61   KIVGFFGRSGYYIDAIGTY  5
            K+VG  GRS  Y+DAIG +
Sbjct  584  KVVGLHGRSSLYLDAIGVH  602



>ref|XP_008348483.1| PREDICTED: agglutinin-like isoform X1 [Malus domestica]
Length=194

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 52/92 (57%), Gaps = 9/92 (10%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASS---DNVLRSIKFTTNAREFGTYG  107
            G GGT+T       I +   DEY+  ++G +     +     ++RS+KF +N R FG +G
Sbjct  74   GHGGTQTA-----EIKLLYPDEYIVSVTGHYCTMVDAGIYSPIIRSLKFQSNRRTFGPFG  128

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIG  11
             + GTPF +   +G KIVG  GR G YIDAIG
Sbjct  129  RDQGTPFTYTL-DGGKIVGLKGRDGLYIDAIG  159



>gb|ABJ97445.1| beta-glucosidase aggregating factor 1 [Zea mays]
Length=306

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 4/76 (5%)
 Frame = -2

Query  223  GEDEYLTEISGTFGAFASSDNVLRSIKFTTNAR---EFGTYGPNVGTPFNFQAQNGNKIV  53
            G+ E LTE+SGT G       V+ SIKF T+ +    FG +G    TPF    Q G+ IV
Sbjct  228  GDSEVLTELSGTIGN-VDGLTVITSIKFVTSLKTYGPFGAWGNGSDTPFAIPVQQGSAIV  286

Query  52   GFFGRSGYYIDAIGTY  5
            GFF R+G Y+DA+G Y
Sbjct  287  GFFARAGVYLDALGVY  302



>emb|CAE76026.1| B1292H11.12 [Oryza sativa Japonica Group]
 gb|EAZ29534.1| hypothetical protein OsJ_13607 [Oryza sativa Japonica Group]
Length=183

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 6/77 (8%)
 Frame = -2

Query  217  DEYLTEISGTFGAFASSDN-VLRSIKFTTNA-REFGTYG----PNVGTPFNFQAQNGNKI  56
            DE +T + GT G F   D  V+ S+ F TNA + +G YG       GTPF+    NG  +
Sbjct  103  DEQVTSVEGTIGRFRDVDEPVITSLTFRTNAGKTYGPYGGASDKQAGTPFSIPVDNGGVV  162

Query  55   VGFFGRSGYYIDAIGTY  5
            VGF+GR+G+ IDAIG Y
Sbjct  163  VGFWGRAGWLIDAIGVY  179



>ref|XP_002467725.1| hypothetical protein SORBIDRAFT_01g033090 [Sorghum bicolor]
 gb|EER94723.1| hypothetical protein SORBIDRAFT_01g033090 [Sorghum bicolor]
Length=149

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            +D +   G  EY+TE++G+ G      + + S+KF TN   +G +G   GTPFN    N 
Sbjct  66   SDEVITLGAHEYVTEVAGSVGPIGDLTHTITSLKFVTNRGTYGPFGRGDGTPFNVPVLNN  125

Query  64   NKIVGFFGRSGYYIDAIGTY  5
              +VG F R+  Y+DAIG Y
Sbjct  126  GSVVGMFARADQYLDAIGFY  145



>ref|XP_006853910.1| hypothetical protein AMTR_s00036p00183430 [Amborella trichopoda]
 gb|ERN15377.1| hypothetical protein AMTR_s00036p00183430 [Amborella trichopoda]
Length=191

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 53/89 (60%), Gaps = 7/89 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPN  101
            G GG  T  TH   I     +E++TE+SG +         V+RS+KFTTN R +G YG  
Sbjct  75   GDGGNRT--TH---IKFQYPEEFITEVSGHYCPVVHGGTPVIRSLKFTTNMRTYGPYGVE  129

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAI  14
             GTPF+    +G  IVGF GR+G+Y+D+I
Sbjct  130  EGTPFSC-PMDGGLIVGFKGRNGWYLDSI  157



>ref|XP_002888904.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65163.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=176

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            + +   DEYLT +SG +     S   V+RS+ F +N + +G YG   GTPF F   NG +
Sbjct  75   LKLQYPDEYLTGVSGYYSIVVDSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGR  133

Query  58   IVGFFGRSGYYIDAIG  11
            IVG   RSG+Y+D+IG
Sbjct  134  IVGMSSRSGWYLDSIG  149



>gb|AAQ07258.1| jacalin-like lectin [Ananas comosus]
Length=145

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 47/80 (59%), Gaps = 2/80 (3%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            +DTI      EYL  I GT GA  +  N++RS+ F +N R +G +G   GTPF+    +G
Sbjct  64   SDTIEFQ-PGEYLIAIKGTTGALGAVTNLVRSLTFISNMRTYGPFGLEHGTPFSVPVASG  122

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             +IV F+GR G  +DA G Y
Sbjct  123  -RIVAFYGRFGSLVDAFGIY  141



>ref|XP_006306414.1| hypothetical protein CARUB_v10012347mg [Capsella rubella]
 gb|EOA39312.1| hypothetical protein CARUB_v10012347mg [Capsella rubella]
Length=1361

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 35/92 (38%), Positives = 57/92 (62%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPN  101
            G GG ++     D + +D   EYL  +SGT+G+F +  N+ +RS+   +N R++G +G  
Sbjct  828  GKGGRKS-----DKVKLDYPHEYLISVSGTYGSFDAWGNICVRSLTLESNHRKYGPFGVE  882

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F    ++G KI+GF G++G+Y DAIG +
Sbjct  883  SGTFFAL-PKSGTKIIGFHGKAGWYTDAIGVH  913


 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 36/91 (40%), Positives = 52/91 (57%), Gaps = 5/91 (5%)
 Frame = -2

Query  271   GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNV  98
             GG     TH   I ++  +E LT ISG +G   +SD  NV++S+ F T+  ++G YG   
Sbjct  1253  GGNNGVATHR--IKLEYPNETLTCISGFYGPLNNSDRSNVVKSLSFFTSRGKYGPYGEEN  1310

Query  97    GTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F+     G K++GF GRS   +DAIG +
Sbjct  1311  GTFFSSTTTQG-KVLGFHGRSSCNLDAIGVH  1340


 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/81 (36%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -2

Query  244   NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
             +D I  D   E LT ++GT+G       NV++S+ F TN  + G +G   G  F  +   
Sbjct  1061  HDKIVFDYPSEVLTHVTGTYGPLIYMGPNVIKSLTFRTNKGKHGPFGEEQGPSFTHKMDE  1120

Query  67    GNKIVGFFGRSGYYIDAIGTY  5
             G ++VGF GR G ++D+IG +
Sbjct  1121  G-RVVGFLGREGLFLDSIGVH  1140



>gb|KCW56701.1| hypothetical protein EUGRSUZ_I02393, partial [Eucalyptus grandis]
Length=481

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = -2

Query  271  GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  92
            GGT+    H   I++   DEYLT ISG   + +S   V+RS+ F +N R  G  G   G 
Sbjct  91   GGTDQGEIH--VIDLSDSDEYLTSISGYIRSSSSCPTVIRSLTFQSNKRTIGPVGDEKGV  148

Query  91   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             F+     G KI+GF+GRSG ++DAIG Y
Sbjct  149  YFS-SPTTGGKIIGFYGRSGDHLDAIGVY  176


 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 47/90 (52%), Gaps = 2/90 (2%)
 Frame = -2

Query  274  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG  95
            G GT         + +D   EYLT ISG +        V+ S+ F +N   +G +G  +G
Sbjct  239  GAGTRNGKAKVTKVQLDYPREYLTSISG-YKRETDEPIVVYSLTFYSNKGRYGPFGKEIG  297

Query  94   TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
              F + +  G+KI+GF+G SG  +D+IG Y
Sbjct  298  RYFGYPS-TGSKIIGFYGTSGSNLDSIGVY  326



>gb|AAZ73669.1| At1g19715-like protein [Arabidopsis lyrata]
Length=175

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            + +D   EYL  I+GT+G+F     + +RS+ F +N R++G +G   GT F    ++G+K
Sbjct  1    VKLDYPHEYLISINGTYGSFDVWGTLCVRSLTFESNRRKYGPFGVESGTFFAL-PKSGSK  59

Query  58   IVGFFGRSGYYIDAIGTY  5
            I+GF G++G+Y+DAIG +
Sbjct  60   IIGFHGKAGWYLDAIGVH  77



>gb|KDO58671.1| hypothetical protein CISIN_1g037526mg, partial [Citrus sinensis]
Length=200

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I +   +E+L  +SG +         V+RS+ F +N R FG +G   GTPF F + +G  
Sbjct  87   IKLRFPEEFLISVSGHYCPVVYGGSPVIRSLTFKSNKRTFGPFGVEEGTPFTF-SMDGGL  145

Query  58   IVGFFGRSGYYIDAIGTY  5
            +VGF GRSG+Y+DAIG Y
Sbjct  146  VVGFKGRSGWYVDAIGFY  163



>ref|XP_011001797.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Populus 
euphratica]
Length=445

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = -2

Query  274  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG  95
            GG    ++    T+ I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G   G
Sbjct  351  GGNNPNDIGERKTVLINWPSEHLISISGTYGNF-STLLTITSLSFTTNRATYGPFGTGSG  409

Query  94   TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            TPF+    N N +VGF GR+G+Y+DAIG +
Sbjct  410  TPFSIPINN-NTVVGFHGRAGHYLDAIGIF  438


 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  56
            I IDG  E+LT I+GT+G +A    V+ S+ F TN    G +G   GT F+   + G+ +
Sbjct  218  IEIDGLSEHLTSITGTYGNYAGMV-VITSLSFITNLTTHGPFGTATGTSFSIPIE-GSVV  275

Query  55   VGFFGRSGYYIDAIGTY  5
            +GF GR G+Y+DAIG +
Sbjct  276  IGFHGRGGHYLDAIGIH  292


 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 3/94 (3%)
 Frame = -2

Query  283  TIGGGGTETNVT-HNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG  107
            T GG G + N       I I    EYL  ISGT+G++     V+ S+ F TN   +G +G
Sbjct  55   TFGGRGNDPNDRGEQKKIEIQWPSEYLKSISGTYGSYKGLL-VITSLSFITNLTTYGPFG  113

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
              +G  F+    + + +VGF GR GYY+DA+G +
Sbjct  114  TALGETFSIPIAD-SAVVGFHGRCGYYLDALGIF  146



>ref|XP_002461768.1| hypothetical protein SORBIDRAFT_02g007760 [Sorghum bicolor]
 gb|EER98289.1| hypothetical protein SORBIDRAFT_02g007760 [Sorghum bicolor]
Length=361

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  62
            +TI +  E E +TE+SGT G F   + V+ SIKF TN + +G +G     PF    Q G+
Sbjct  225  ETIQL-AESEVVTEVSGTVGNF-YDNTVITSIKFVTNLQTYGPWGDGQDAPFTIPVQPGS  282

Query  61   KIVGFFGRSGYYIDAIGTY  5
             IVGFF R+G  +DAIG Y
Sbjct  283  GIVGFFARAGDCLDAIGVY  301



>ref|XP_009760249.1| PREDICTED: agglutinin-like [Nicotiana sylvestris]
Length=345

 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = -2

Query  247  HNDTINIDGED-EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQA  74
              D +NI+    EYLT I GT G + S + V++S+ F TN + +G +G   G T F+   
Sbjct  72   RRDKVNIEATPLEYLTGIKGTLGHYGS-NLVVKSLSFITNGKNYGPFGTEAGGTLFSLVM  130

Query  73   QNGNKIVGFFGRSGYYIDAIGTY  5
            + G  IVGF GRSG Y+DAIG Y
Sbjct  131  KEGGAIVGFHGRSGLYLDAIGVY  153


 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 51/85 (60%), Gaps = 6/85 (7%)
 Frame = -2

Query  244  NDT---INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNF  80
            NDT   IN+DGE+E L  I G +     +   + +R I F TN  ++G YG  +GT F+ 
Sbjct  258  NDTVRKINVDGENELLIGIEGFYSPVDDNGGLDAIRQIAFYTNKGKYGPYGTEIGTYFSS  317

Query  79   QAQNGNKIVGFFGRSGYYIDAIGTY  5
             A  G KIVGF G+SG +++AIG +
Sbjct  318  SAARG-KIVGFHGKSGVFLNAIGVH  341



>ref|XP_006426466.1| hypothetical protein CICLE_v10026553mg [Citrus clementina]
 ref|XP_006466099.1| PREDICTED: agglutinin-like [Citrus sinensis]
 gb|ESR39706.1| hypothetical protein CICLE_v10026553mg [Citrus clementina]
Length=190

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I +   +E+L  +SG +         V+RS+ F +N R FG +G   GTPF F + +G  
Sbjct  77   IKLRFPEEFLISVSGHYCPVVYGGSPVIRSLTFKSNKRTFGPFGVEEGTPFTF-SMDGGL  135

Query  58   IVGFFGRSGYYIDAIGTY  5
            +VGF GRSG+Y+DAIG Y
Sbjct  136  VVGFKGRSGWYVDAIGFY  153



>ref|XP_011001798.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Populus 
euphratica]
Length=445

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = -2

Query  274  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG  95
            GG    ++    T+ I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G   G
Sbjct  351  GGNNPNDIGERKTVLINWPSEHLISISGTYGNF-STLLTITSLSFTTNRATYGPFGTGSG  409

Query  94   TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            TPF+    N N +VGF GR+G+Y+DAIG +
Sbjct  410  TPFSIPINN-NTVVGFHGRAGHYLDAIGIF  438


 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  56
            I IDG  E+LT I+GT+G +A    V+ S+ F TN    G +G   GT F+   + G+ +
Sbjct  218  IEIDGLSEHLTSITGTYGNYAGMV-VITSLSFITNLTTHGPFGTATGTSFSIPIE-GSVV  275

Query  55   VGFFGRSGYYIDAIGTY  5
            +GF GR G+Y+DAIG +
Sbjct  276  IGFHGRGGHYLDAIGIH  292


 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 3/94 (3%)
 Frame = -2

Query  283  TIGGGGTETNVT-HNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG  107
            T GG G + N       I I    EYL  ISGT+G++     V+ S+ F TN   +G +G
Sbjct  55   TFGGRGNDPNDRGEQKKIEIQWPSEYLKSISGTYGSYKGLL-VITSLSFITNLTTYGPFG  113

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
              +G  F+    + + +VGF GR GYY+DA+G +
Sbjct  114  TALGETFSIPIAD-SAVVGFHGRCGYYLDALGIF  146



>ref|XP_009770862.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770863.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770864.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770865.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770866.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1328

 Score = 66.2 bits (160),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 33/71 (46%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            EYLT I GTFG +    +V++S+ F TN + +G +G   G TPF+   + G  IVGF GR
Sbjct  78   EYLTGIKGTFGHYCGL-SVIKSLCFITNVKNYGPFGCEAGGTPFSLVMKEGVAIVGFHGR  136

Query  37   SGYYIDAIGTY  5
             G ++DAIG Y
Sbjct  137  CGAFLDAIGVY  147



>gb|EMS65495.1| hypothetical protein TRIUR3_18396 [Triticum urartu]
Length=431

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = -2

Query  268  GTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTP  89
            G+  + +  D + +D   E L  +SG +G+   S  ++RS+ F +N  ++G +G   GTP
Sbjct  62   GSTEDGSETDKVKLDVPGETLLSVSGHYGSVCGSPIIIRSLTFQSNRSKYGPFGTEDGTP  121

Query  88   FNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            F+    +G KI+GF GRSG Y+++IG Y
Sbjct  122  FSLPVSSG-KIIGFHGRSGSYLNSIGFY  148


 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 46/87 (53%), Gaps = 8/87 (9%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAR-------EFGTYGPNVGTPF  86
            D I  D   E LT I+G +G         +RS+ F TN R       E+G +G  VGT F
Sbjct  324  DKIAFDFPTEVLTHITGYYGPTIIMGPTAVRSLTFHTNRRRYGPYGDEYGPFGDEVGTYF  383

Query  85   NFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            +  A    K+VGF GRSG ++DAIG +
Sbjct  384  SSPATAEGKVVGFHGRSGQHLDAIGVH  410



>gb|ADE77248.1| unknown [Picea sitchensis]
Length=168

 Score = 62.8 bits (151),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 2/81 (2%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQ--AQN  68
            +TI ++   E L  +SG +G  +    V+RS+ F T  +++ + G   GTPF       N
Sbjct  73   ETIELNYPSETLVSVSGNYGQISPGSPVIRSLTFETKLKKYPSIGLAEGTPFTLPNNPNN  132

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
              KIVGF GRSG+++D+IG Y
Sbjct  133  TTKIVGFHGRSGWFLDSIGVY  153



>ref|XP_010498396.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
[Camelina sativa]
Length=1235

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAF-ASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D + +D   EYL  ++GT+G+F A  +  +RS+   +N R++G +G   GT F    ++G
Sbjct  709  DNVKLDYPHEYLISVNGTYGSFDAWGNTCVRSLTLESNHRKYGPFGCESGTFFAL-PKSG  767

Query  64   NKIVGFFGRSGYYIDAIGTY  5
            +KI+GF G++G+YIDAIG +
Sbjct  768  SKIIGFHGKAGWYIDAIGVH  787


 Score = 56.6 bits (135),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -2

Query  244   NDTINIDGEDEYLTEISGTFGAFAS-SDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
             +D I  D   E LT ++GT+G       NV++S+ F TN  + G +G   G  F  +   
Sbjct  935   HDKIVFDYPSEVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDE  994

Query  67    GNKIVGFFGRSGYYIDAIGTY  5
             G K+VGF GR G ++DAIG +
Sbjct  995   G-KVVGFLGREGLFLDAIGVH  1014



>ref|XP_009771019.1| PREDICTED: jacalin-related lectin 3 isoform X1 [Nicotiana sylvestris]
Length=666

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPN  101
            G GG +T     D + ++  DE+LT + G  G+     +V +RS+ F +N R +G YG  
Sbjct  64   GSGGAKT-----DKVRLNYPDEFLTCLHGYHGSLHERGSVFVRSLTFQSNKRTYGPYGVQ  118

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F     +G K+VGF G+SG+Y+DAIG Y
Sbjct  119  QGTYFTLPISSG-KVVGFHGKSGWYLDAIGVY  149


 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  62
            + ++   E LT I+G +G  +      V++S+ F T  R+FG +G  +GT F      G 
Sbjct  569  VKLEYPHEVLTCITGFYGPISKDMGLKVIKSLTFHTTRRKFGPFGEELGTYFTSATTEG-  627

Query  61   KIVGFFGRSGYYIDAIGTY  5
            K+VGF GR+G Y+DAIG +
Sbjct  628  KVVGFHGRNGMYLDAIGVH  646


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            + I  D   E LT I+G +G A     N+++S+ F T   + G YG   G  F+ + + G
Sbjct  319  EKIIFDYPSEILTHITGYYGPAMIMGPNIIQSLTFHTTKGKHGPYGEEQGQQFSTKLKEG  378

Query  64   NKIVGFFGRSGYYIDAIGTY  5
              IVGF GR G ++DA+G +
Sbjct  379  I-IVGFHGRKGLFLDALGVH  397



>ref|XP_009771020.1| PREDICTED: jacalin-related lectin 3 isoform X2 [Nicotiana sylvestris]
Length=654

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPN  101
            G GG +T     D + ++  DE+LT + G  G+     +V +RS+ F +N R +G YG  
Sbjct  64   GSGGAKT-----DKVRLNYPDEFLTCLHGYHGSLHERGSVFVRSLTFQSNKRTYGPYGVQ  118

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F     +G K+VGF G+SG+Y+DAIG Y
Sbjct  119  QGTYFTLPISSG-KVVGFHGKSGWYLDAIGVY  149


 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGN  62
            + ++   E LT I+G +G  +      V++S+ F T  R+FG +G  +GT F      G 
Sbjct  557  VKLEYPHEVLTCITGFYGPISKDMGLKVIKSLTFHTTRRKFGPFGEELGTYFTSATTEG-  615

Query  61   KIVGFFGRSGYYIDAIGTY  5
            K+VGF GR+G Y+DAIG +
Sbjct  616  KVVGFHGRNGMYLDAIGVH  634


 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFG-AFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            + I  D   E LT I+G +G A     N+++S+ F T   + G YG   G  F+ + + G
Sbjct  319  EKIIFDYPSEILTHITGYYGPAMIMGPNIIQSLTFHTTKGKHGPYGEEQGQQFSTKLKEG  378

Query  64   NKIVGFFGRSGYYIDAIGTY  5
              IVGF GR G ++DA+G +
Sbjct  379  I-IVGFHGRKGLFLDALGVH  397



>dbj|BAJ88436.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=586

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = -2

Query  268  GTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTP  89
            G+  + +  D + +D   E L  +SG +G+   S  ++RS+ F +N  ++G +G   GTP
Sbjct  64   GSTEDGSETDKVKLDVPGEILLSVSGYYGSVCGSPVIIRSLTFQSNRSKYGPFGTEDGTP  123

Query  88   FNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            F+    +G KI+GF GRSG Y+++IG Y
Sbjct  124  FSLPVSSG-KIIGFHGRSGSYLNSIGFY  150


 Score = 62.8 bits (151),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 3/89 (3%)
 Frame = -2

Query  268  GTETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGT  92
            GT  ++TH   + +D   E LT + G + A  A     LRSI F +N   +G +   VGT
Sbjct  479  GTSGHITHR--VKLDAPHEVLTCVRGYYNADPAEGPRALRSITFVSNRGRYGPFRDEVGT  536

Query  91   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             F+  A  G K+VGF GRSG ++DAIG +
Sbjct  537  YFSSPATAGGKVVGFHGRSGQHLDAIGVH  565


 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D I  D   E LT I+G +G         +RS+ F TN R +G YG   GT F+    +G
Sbjct  305  DKIAFDFPSEVLTHITGYYGPTIIMGPTAVRSLTFHTNRRRYGPYGDEYGTYFSTSFADG  364

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             ++VGF GR G+YID IG +
Sbjct  365  -RVVGFHGREGWYIDGIGVH  383



>ref|XP_009622527.1| PREDICTED: agglutinin-like isoform X4 [Nicotiana tomentosiformis]
Length=490

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            E+LT I GTF  F    +V++S+ F TNA  +G +G   G TPF+   + G  IVGF GR
Sbjct  345  EHLTGIKGTFECF-DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHGR  403

Query  37   SGYYIDAIGTY  5
            SG Y+DAIG Y
Sbjct  404  SGLYLDAIGVY  414


 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = -2

Query  211  YLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSG  32
            YLT I GTFG + S  +V++S+ F TNA+ +G +G   GTPF+   + G  I GF G   
Sbjct  140  YLTGIKGTFGRYGSY-SVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHCR  198

Query  31   YYIDAIGTY  5
             Y+DAIG Y
Sbjct  199  AYLDAIGVY  207



>ref|XP_010267066.1| PREDICTED: jacalin-related lectin 19 [Nelumbo nucifera]
Length=205

 Score = 62.8 bits (151),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = -2

Query  247  HNDTINIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQAQ  71
            H  TI +   +E+LT +SG +         V+RS+ F +N   FG +G   G PF+F   
Sbjct  73   HTTTIKLQYPEEFLTTVSGHYSPVVHGGTPVIRSLTFKSNQGSFGPFGVEEGMPFSF-PM  131

Query  70   NGNKIVGFFGRSGYYIDAIG  11
            +G  I+GF+GR+G+Y+DAIG
Sbjct  132  DGGSIIGFWGRNGWYLDAIG  151



>ref|XP_011015046.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Populus 
euphratica]
 ref|XP_011015047.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Populus 
euphratica]
Length=445

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = -2

Query  274  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG  95
            GG    ++    T+ I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G   G
Sbjct  351  GGENPNDIGERKTVLINWPSEHLISISGTYGNF-STLLTITSLSFTTNRATYGPFGTGSG  409

Query  94   TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            TPF+    N N +VGF GR+G+Y+DAIG +
Sbjct  410  TPFSIPINN-NTVVGFHGRAGHYLDAIGIF  438


 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  56
            I IDG  E+LT I+GT+G +A    V+ S+ F TN   +G +G   GT F+   + G+ +
Sbjct  218  IEIDGHSEHLTSITGTYGDYAGMV-VITSLAFQTNLTTYGPFGNATGTSFSIPIE-GSVV  275

Query  55   VGFFGRSGYYIDAIGTY  5
             GF GR G+Y+DAIG +
Sbjct  276  TGFHGRGGHYLDAIGIH  292


 Score = 47.0 bits (110),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 47/94 (50%), Gaps = 3/94 (3%)
 Frame = -2

Query  283  TIGGGGTETNVTHNDT-INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG  107
            T GG G + N    +  I I    E+L  ISGT G       V+ S+ F TN   +G +G
Sbjct  55   TFGGTGNDPNDRGKEKKIAIQWPSEHLKSISGTCGR-CKGLLVITSLSFITNLTTYGPFG  113

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
                  F+    + + +VGF GR GYY+DA+G +
Sbjct  114  TAARETFSIPIAD-STVVGFHGRCGYYLDALGIF  146



>ref|XP_010029744.1| PREDICTED: jacalin-related lectin 4-like [Eucalyptus grandis]
Length=1327

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = -2

Query  271   GGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGT  92
             GGT+    H   I++   DEYLT ISG   + +S   V+RS+ F +N R  G  G   G 
Sbjct  937   GGTDQGEIH--VIDLSDSDEYLTSISGYIRSSSSCPTVIRSLTFQSNKRTIGPVGDEKGV  994

Query  91    PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
              F+     G KI+GF+GRSG ++DAIG Y
Sbjct  995   YFS-SPTTGGKIIGFYGRSGDHLDAIGVY  1022


 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 51/85 (60%), Gaps = 5/85 (6%)
 Frame = -2

Query  247  HND----TINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNF  80
            H+D    T+ +D  +EYLT ISG    +     V++S+KF TN + +G +G   G  F+F
Sbjct  488  HHDGNIFTVKLDYPNEYLTSISGHIRDYQIP-IVIQSLKFHTNRKTYGPFGFERGQFFHF  546

Query  79   QAQNGNKIVGFFGRSGYYIDAIGTY  5
               +G +I+GF G+ G ++D+IG +
Sbjct  547  PQVDGGRIIGFHGKCGSHLDSIGAH  571


 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 53/92 (58%), Gaps = 5/92 (5%)
 Frame = -2

Query  280  IGGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPN  101
            + GG +  N+     + +   DEY+T  SG   +  ++ ++++S+ F TN R +G  G  
Sbjct  781  MHGGSSGENIC---EVKLAYPDEYITSFSGYMNS-NNNHSLIKSLTFRTNKRIWGPIGKE  836

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             G  F+  ++ G K+VGFFGRSG  +D+IG +
Sbjct  837  EGKYFSLPSEAG-KLVGFFGRSGTLLDSIGAH  867


 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 47/90 (52%), Gaps = 2/90 (2%)
 Frame = -2

Query  274   GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG  95
             G GT         + +D   EYLT ISG +        V+ S+ F +N   +G +G  +G
Sbjct  1085  GAGTRNGKAKVTKVQLDYPREYLTSISG-YKRETDEPIVVYSLTFYSNKGRYGPFGKEIG  1143

Query  94    TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
               F + +  G+KI+GF+G SG  +D+IG Y
Sbjct  1144  RYFGYPS-TGSKIIGFYGTSGSNLDSIGVY  1172



>dbj|BAJ85606.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=586

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 1/88 (1%)
 Frame = -2

Query  268  GTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTP  89
            G+  + +  D + +D   E L  +SG +G+   S  ++RS+ F +N  ++G +G   GTP
Sbjct  64   GSTEDGSETDKVKLDVPGEILLSVSGYYGSVCGSPVIIRSLTFQSNRSKYGPFGTEDGTP  123

Query  88   FNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            F+    +G KI+GF GRSG Y+++IG Y
Sbjct  124  FSLPVSSG-KIIGFHGRSGSYLNSIGFY  150


 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = -2

Query  268  GTETNVTHNDTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGT  92
            GT  ++TH   + +D   E LT + G + A  A     LRSI F +N   +G +G  VGT
Sbjct  479  GTSGHITHR--VKLDAPHEVLTCVRGYYNADPAEGPRALRSITFVSNRGRYGPFGDEVGT  536

Query  91   PFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             F+  A  G K+VGF GRSG ++DAIG +
Sbjct  537  YFSSPATAGGKVVGFHGRSGQHLDAIGVH  565


 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 44/80 (55%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            D I  D   E LT I+G +G         +RS+ F TN R +G YG   GT F+    +G
Sbjct  305  DKIAFDFPSEVLTHITGYYGPTIIMGPTAVRSLTFHTNRRRYGPYGDEYGTYFSTSFADG  364

Query  64   NKIVGFFGRSGYYIDAIGTY  5
             ++VGF GR G+YID IG +
Sbjct  365  -RVVGFHGREGWYIDGIGVH  383



>ref|XP_006362248.1| PREDICTED: myrosinase-binding protein-like At3g16470-like isoform 
X2 [Solanum tuberosum]
Length=654

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 53/92 (58%), Gaps = 7/92 (8%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPN  101
            GG G +T     D I +   DE+LT + G +G+     +V +RS+ F +N R +G YG  
Sbjct  64   GGVGAKT-----DKIILSYPDEFLTSMHGYYGSLYERGSVFVRSLTFESNKRTYGPYGVE  118

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F      G KIVGF G+SG+Y+DAIG Y
Sbjct  119  QGTYFTLPISRG-KIVGFHGKSGWYLDAIGVY  149


 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 47/81 (58%), Gaps = 3/81 (4%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGAFASSD--NVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
            + + ++   E LT I+G +G  +      V++S+ F T  R+FG +G  +GT F      
Sbjct  555  NKVKLEFPHEVLTCITGFYGPISKDMGLKVIKSLTFHTTRRKFGPFGEELGTYFTSSTTE  614

Query  67   GNKIVGFFGRSGYYIDAIGTY  5
            G K+VGF GRSG Y+DAIG +
Sbjct  615  G-KVVGFHGRSGMYLDAIGVH  634


 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 43/80 (54%), Gaps = 2/80 (3%)
 Frame = -2

Query  241  DTINIDGEDEYLTEISGTFGA-FASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNG  65
            + I  D   E LT I+G +G       N++ S+ F T   + G YG   G  F+ + ++G
Sbjct  319  EKIIFDYPSEILTHITGYYGPTMIMGPNIIHSLTFHTTKGKHGPYGEEQGQQFSTKLKDG  378

Query  64   NKIVGFFGRSGYYIDAIGTY  5
              IVGF GR G ++DA+G +
Sbjct  379  -MIVGFHGRKGMFLDALGVH  397



>ref|XP_009127966.1| PREDICTED: agglutinin [Brassica rapa]
Length=176

 Score = 62.4 bits (150),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 47/76 (62%), Gaps = 2/76 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDN-VLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            I +   +EYL  +SG +     S   V+RS+ F +N + +G YG   GTPF+F   NG +
Sbjct  75   IKLQYPEEYLIGVSGYYCPVVHSGTPVIRSMTFKSNKQVYGPYGVEQGTPFSFSV-NGGR  133

Query  58   IVGFFGRSGYYIDAIG  11
            IVG  GRSG+Y+D+IG
Sbjct  134  IVGMNGRSGWYLDSIG  149



>ref|XP_011001796.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Populus 
euphratica]
Length=591

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 2/90 (2%)
 Frame = -2

Query  274  GGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG  95
            GG    ++    T+ I+   E+L  ISGT+G F S+   + S+ FTTN   +G +G   G
Sbjct  497  GGNNPNDIGERKTVLINWPSEHLISISGTYGNF-STLLTITSLSFTTNRATYGPFGTGSG  555

Query  94   TPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
            TPF+    N N +VGF GR+G+Y+DAIG +
Sbjct  556  TPFSIPINN-NTVVGFHGRAGHYLDAIGIF  584


 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  56
            I IDG  E+LT I+GT+G +A    V+ S+ F TN    G +G   GT F+   + G+ +
Sbjct  218  IEIDGLSEHLTSITGTYGNYAGMV-VITSLSFITNLTTHGPFGTATGTSFSIPIE-GSVV  275

Query  55   VGFFGRSGYYIDAIGTY  5
            +GF GR GYY+DA+G +
Sbjct  276  IGFHGRGGYYLDALGIF  292


 Score = 59.3 bits (142),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKI  56
            I IDG  E+LT I+GT+G +A    V+ S+ F TN    G +G   GT F+   + G+ +
Sbjct  364  IEIDGLSEHLTSITGTYGNYAGMV-VITSLSFITNLTTHGPFGTATGTSFSIPIE-GSVV  421

Query  55   VGFFGRSGYYIDAIGTY  5
            +GF GR G+Y+DAIG +
Sbjct  422  IGFHGRGGHYLDAIGIH  438


 Score = 55.8 bits (133),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 51/94 (54%), Gaps = 3/94 (3%)
 Frame = -2

Query  283  TIGGGGTETNVT-HNDTINIDGEDEYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYG  107
            T GG G + N       I I    EYL  ISGT+G++     V+ S+ F TN   +G +G
Sbjct  55   TFGGRGNDPNDRGEQKKIEIQWPSEYLKSISGTYGSYKGLL-VITSLSFITNLTTYGPFG  113

Query  106  PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
              +G  F+    + + +VGF GR GYY+DA+G +
Sbjct  114  TALGETFSIPIAD-SAVVGFHGRCGYYLDALGIF  146



>ref|XP_009622528.1| PREDICTED: agglutinin-like isoform X5 [Nicotiana tomentosiformis]
Length=460

 Score = 65.1 bits (157),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 45/71 (63%), Gaps = 2/71 (3%)
 Frame = -2

Query  214  EYLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVG-TPFNFQAQNGNKIVGFFGR  38
            E+LT I GTF  F    +V++S+ F TNA  +G +G   G TPF+   + G  IVGF GR
Sbjct  315  EHLTGIKGTFECF-DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHGR  373

Query  37   SGYYIDAIGTY  5
            SG Y+DAIG Y
Sbjct  374  SGLYLDAIGVY  384


 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 1/69 (1%)
 Frame = -2

Query  211  YLTEISGTFGAFASSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNKIVGFFGRSG  32
            YLT I GTFG + S  +V++S+ F TNA+ +G +G   GTPF+   + G  I GF G   
Sbjct  110  YLTGIKGTFGRYGSY-SVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHCR  168

Query  31   YYIDAIGTY  5
             Y+DAIG Y
Sbjct  169  AYLDAIGVY  177



>ref|XP_011028924.1| PREDICTED: uncharacterized protein LOC105128794 isoform X2 [Populus 
euphratica]
Length=1277

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 8/92 (9%)
 Frame = -2

Query  277  GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPN  101
            G GG +T      T+ +D  DE+LT + G +G+      V +RS+ F +N + +G +G  
Sbjct  698  GNGGMKT------TVKLDCPDEFLTSVHGYYGSLDGWGPVFVRSLTFRSNKKTYGPFGVE  751

Query  100  VGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
             GT F+    +G KIVGF G+SG+Y+DAIG Y
Sbjct  752  QGTYFSL-PMSGGKIVGFHGKSGWYLDAIGIY  782


 Score = 54.7 bits (130),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 35/94 (37%), Positives = 49/94 (52%), Gaps = 9/94 (10%)
 Frame = -2

Query  277   GGGGTETNVTHNDTINIDGEDEYLTEISGTFGAFASSDN---VLRSIKFTTNAREFGTYG  107
             G GGT T+      + +    E L  +SG +G   S  N   V++S+ F T    +G +G
Sbjct  1169  GNGGTATH-----RVKLQCPHEVLVCLSGYYGPIGSDGNGPKVIKSLTFHTTRGNYGPFG  1223

Query  106   PNVGTPFNFQAQNGNKIVGFFGRSGYYIDAIGTY  5
               +GT F   A  G K+VGF GRS  Y+DAIG +
Sbjct  1224  EEIGTFFTSTATEG-KVVGFHGRSSAYMDAIGVH  1256


 Score = 52.8 bits (125),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -2

Query  244   NDTINIDGEDEYLTEISGTFGAFA-SSDNVLRSIKFTTNAREFGTYGPNVGTPFNFQAQN  68
             +D I  D   E LT ++GT+G       N+++S+ F TN  + G +G   G  F  +   
Sbjct  979   SDKIIFDYPYEILTRVTGTYGPLMYMGPNIIKSLTFYTNKGKHGPFGEEQGPTFTNKIDE  1038

Query  67    GNKIVGFFGRSGYYIDAIGTY  5
             G KI+GF GR G+ +DAIG +
Sbjct  1039  G-KIIGFHGREGFLLDAIGLH  1058



>gb|EMT07336.1| hypothetical protein F775_29709 [Aegilops tauschii]
Length=345

 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 4/83 (5%)
 Frame = -2

Query  244  NDTINIDGEDEYLTEISGTFGAFASSD---NVLRSIKFTTNAREFGTYGPNVGTPFNFQA  74
             DTI +    E +TE+SGT G FA  +   N + S+  TTN   +G +G    TPF+   
Sbjct  257  KDTIEL-APSEIVTEVSGTVGIFAEDNVEYNAIASLTITTNLCPYGPFGETQSTPFSVPV  315

Query  73   QNGNKIVGFFGRSGYYIDAIGTY  5
            Q+ N IVGFF  +G Y++A+G Y
Sbjct  316  QDNNNIVGFFACAGKYVEALGVY  338



>gb|AAZ73661.1| At1g19715 [Arabidopsis thaliana]
 gb|AAZ73662.1| At1g19715 [Arabidopsis thaliana]
Length=175

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 52/78 (67%), Gaps = 2/78 (3%)
 Frame = -2

Query  235  INIDGEDEYLTEISGTFGAFASSDNV-LRSIKFTTNAREFGTYGPNVGTPFNFQAQNGNK  59
            +  D   EYL  ++GT+G+F     + +RS+ F +N R++G +G + GT F    ++G+K
Sbjct  1    VKFDYPHEYLISVNGTYGSFDVWGTICIRSLTFESNRRKYGPFGVDSGTFFAL-PKSGSK  59

Query  58   IVGFFGRSGYYIDAIGTY  5
            I+GF G++G+Y+DAIG +
Sbjct  60   IIGFHGKAGWYLDAIGVH  77



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 523828991340