BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16466_g2_i1 len=1086 path=[1:0-1016 1018:1017-1085]

Length=1086
                                                                      Score     E

ref|XP_009592681.1|  PREDICTED: uncharacterized protein At1g66480...    168   5e-46   
ref|XP_009789651.1|  PREDICTED: uncharacterized protein At1g66480...    165   7e-45   
ref|XP_009608883.1|  PREDICTED: uncharacterized protein At1g66480...    164   2e-44   
ref|XP_009789650.1|  PREDICTED: uncharacterized protein At1g66480...    164   2e-44   
ref|XP_009596673.1|  PREDICTED: uncharacterized protein At1g66480...    157   6e-42   
ref|XP_002315887.1|  hypothetical protein POPTR_0010s12400g             156   1e-41   Populus trichocarpa [western balsam poplar]
ref|XP_002284189.1|  PREDICTED: uncharacterized protein At1g66480       156   1e-41   Vitis vinifera
gb|EPS72336.1|  hypothetical protein M569_02423                         153   5e-41   
ref|XP_004253408.1|  PREDICTED: uncharacterized protein At1g66480...    154   7e-41   
ref|XP_009805058.1|  PREDICTED: uncharacterized protein At1g66480...    154   1e-40   
ref|XP_006344228.1|  PREDICTED: uncharacterized protein At1g66480...    154   1e-40   
ref|XP_011075706.1|  PREDICTED: uncharacterized protein At1g66480...    152   2e-40   
ref|XP_009356153.1|  PREDICTED: uncharacterized protein At1g66480...    153   2e-40   
ref|XP_004238847.1|  PREDICTED: uncharacterized protein At1g66480...    153   3e-40   
ref|XP_010259616.1|  PREDICTED: uncharacterized protein At1g66480...    152   4e-40   
ref|XP_006372588.1|  hypothetical protein POPTR_0017s03000g             152   5e-40   
ref|XP_011038667.1|  PREDICTED: uncharacterized protein At1g66480...    152   6e-40   
ref|XP_011001592.1|  PREDICTED: uncharacterized protein At1g66480...    151   7e-40   
ref|XP_006344226.1|  PREDICTED: uncharacterized protein At1g66480...    151   8e-40   
ref|XP_011001505.1|  PREDICTED: uncharacterized protein At1g66480...    150   1e-39   
ref|XP_008389224.1|  PREDICTED: uncharacterized protein At1g66480       151   1e-39   
ref|XP_011023151.1|  PREDICTED: uncharacterized protein At1g66480...    150   2e-39   
ref|XP_002311497.1|  hypothetical protein POPTR_0008s12770g             150   2e-39   Populus trichocarpa [western balsam poplar]
emb|CDP00754.1|  unnamed protein product                                149   8e-39   
ref|XP_010274640.1|  PREDICTED: uncharacterized protein At1g66480...    149   8e-39   
ref|XP_006344227.1|  PREDICTED: uncharacterized protein At1g66480...    149   1e-38   
gb|KEH40549.1|  plastid movement impaired protein                       147   1e-38   
ref|XP_004238848.1|  PREDICTED: uncharacterized protein At1g66480...    147   3e-38   
ref|XP_008339566.1|  PREDICTED: uncharacterized protein At1g66480...    147   4e-38   
gb|KDP22653.1|  hypothetical protein JCGZ_02495                         146   5e-38   
ref|XP_006372587.1|  hypothetical protein POPTR_0017s03000g             145   6e-38   
ref|XP_003555905.1|  PREDICTED: uncharacterized protein At1g66480...    145   8e-38   
ref|XP_003537453.1|  PREDICTED: uncharacterized protein At1g66480...    145   1e-37   
ref|XP_007033077.1|  Plastid movement impaired 2                        145   1e-37   
ref|XP_002305871.1|  hypothetical protein POPTR_0004s08660g             144   2e-37   Populus trichocarpa [western balsam poplar]
ref|XP_007163405.1|  hypothetical protein PHAVU_001G232100g             144   3e-37   
ref|XP_004490863.1|  PREDICTED: uncharacterized protein At1g66480...    143   9e-37   
ref|XP_008243347.1|  PREDICTED: uncharacterized protein At1g66480...    143   1e-36   
ref|XP_003616384.1|  hypothetical protein MTR_5g079610                  142   2e-36   
ref|XP_010105767.1|  hypothetical protein L484_009963                   142   2e-36   
ref|XP_010032667.1|  PREDICTED: uncharacterized protein At1g66480...    142   2e-36   
ref|XP_004498324.1|  PREDICTED: uncharacterized protein At1g66480...    141   3e-36   
ref|XP_011070637.1|  PREDICTED: uncharacterized protein At1g66480...    141   3e-36   
ref|XP_007227565.1|  hypothetical protein PRUPE_ppa010741mg             142   5e-36   
ref|XP_006357781.1|  PREDICTED: uncharacterized protein At1g66480...    139   5e-36   
ref|XP_009357803.1|  PREDICTED: uncharacterized protein At1g66480       141   6e-36   
ref|XP_002526007.1|  conserved hypothetical protein                     140   8e-36   Ricinus communis
ref|XP_004505259.1|  PREDICTED: uncharacterized protein At1g66480...    139   2e-35   
ref|XP_006448285.1|  hypothetical protein CICLE_v10016683mg             139   2e-35   
ref|XP_010502111.1|  PREDICTED: uncharacterized protein At1g66480...    139   3e-35   
ref|XP_006293056.1|  hypothetical protein CARUB_v10019343mg             139   3e-35   
ref|XP_007045105.1|  Encodes a protein whose expression is respon...    139   4e-35   
ref|XP_006582842.1|  PREDICTED: uncharacterized protein LOC100306...    138   4e-35   
ref|NP_001236455.1|  uncharacterized protein LOC547691                  138   6e-35   
gb|KHN04248.1|  Hypothetical protein glysoja_049449                     137   7e-35   
ref|XP_006602004.1|  PREDICTED: uncharacterized protein At1g66480...    137   9e-35   
ref|NP_001238620.1|  uncharacterized protein LOC100306423               137   1e-34   
gb|KDP38041.1|  hypothetical protein JCGZ_04684                         137   1e-34   
ref|XP_010513852.1|  PREDICTED: uncharacterized protein At1g66480...    137   1e-34   
gb|AFK45330.1|  unknown                                                 136   2e-34   
ref|XP_002278115.1|  PREDICTED: uncharacterized protein At1g66480       136   3e-34   Vitis vinifera
ref|XP_007157721.1|  hypothetical protein PHAVU_002G092800g             136   3e-34   
ref|XP_004231997.1|  PREDICTED: uncharacterized protein At1g66480       134   3e-34   
ref|XP_010681969.1|  PREDICTED: uncharacterized protein At1g66480       137   4e-34   
gb|KDO64706.1|  hypothetical protein CISIN_1g029320mg                   135   4e-34   
ref|XP_009629230.1|  PREDICTED: uncharacterized protein At1g66480...    134   4e-34   
ref|XP_007141885.1|  hypothetical protein PHAVU_008G233900g             135   6e-34   
ref|XP_011006438.1|  PREDICTED: uncharacterized protein At1g66480...    135   9e-34   
ref|XP_009794002.1|  PREDICTED: uncharacterized protein At1g66480...    135   9e-34   
ref|XP_011006437.1|  PREDICTED: uncharacterized protein At1g66480...    134   1e-33   
ref|XP_004297360.1|  PREDICTED: uncharacterized protein At1g66480...    134   2e-33   
ref|XP_007216442.1|  hypothetical protein PRUPE_ppa021996mg             132   3e-33   
ref|XP_006482147.1|  PREDICTED: uncharacterized protein At1g66480...    134   3e-33   
ref|XP_003544245.1|  PREDICTED: uncharacterized protein At1g66480...    133   4e-33   
ref|XP_003519341.1|  PREDICTED: uncharacterized protein At1g66480...    132   7e-33   
ref|XP_010424880.1|  PREDICTED: uncharacterized protein At1g66480...    132   1e-32   
ref|XP_006430644.1|  hypothetical protein CICLE_v10012690mg             132   1e-32   
ref|XP_004297359.1|  PREDICTED: uncharacterized protein At1g66480...    132   2e-32   
ref|XP_009129247.1|  PREDICTED: uncharacterized protein At1g66480...    132   3e-32   
emb|CAN65027.1|  hypothetical protein VITISV_028979                     129   5e-32   Vitis vinifera
gb|KEH34686.1|  plastid movement impaired protein                       130   5e-32   
ref|XP_004503145.1|  PREDICTED: uncharacterized protein At1g66480...    130   7e-32   
ref|XP_008381317.1|  PREDICTED: uncharacterized protein At1g66480       130   8e-32   
ref|XP_010109016.1|  hypothetical protein L484_027215                   130   1e-31   
ref|XP_009101353.1|  PREDICTED: uncharacterized protein At1g66480...    129   1e-31   
ref|NP_001236465.1|  uncharacterized protein LOC547692                  129   2e-31   
ref|XP_002875068.1|  hypothetical protein ARALYDRAFT_322480             128   2e-31   
ref|XP_002271689.1|  PREDICTED: uncharacterized protein At1g66480       127   2e-31   Vitis vinifera
ref|NP_178243.2|  uncharacterized protein                               128   2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008229230.1|  PREDICTED: uncharacterized protein At1g66480...    128   4e-31   
emb|CDY37375.1|  BnaC02g33930D                                          128   5e-31   
emb|CDP02714.1|  unnamed protein product                                125   6e-31   
ref|XP_010066633.1|  PREDICTED: uncharacterized protein At1g66480       128   7e-31   
ref|XP_007153300.1|  hypothetical protein PHAVU_003G023400g             126   7e-31   
ref|XP_009371801.1|  PREDICTED: uncharacterized protein At1g66480       127   8e-31   
gb|KHG02457.1|  hypothetical protein F383_25869                         127   8e-31   
emb|CDX77816.1|  BnaC07g20700D                                          127   8e-31   
emb|CDY40384.1|  BnaA02g26980D                                          127   9e-31   
ref|XP_009114243.1|  PREDICTED: uncharacterized protein At1g66480...    126   2e-30   
ref|XP_010916176.1|  PREDICTED: uncharacterized protein At1g66480...    125   2e-30   
ref|XP_010932597.1|  PREDICTED: uncharacterized protein At1g66480...    124   4e-30   
ref|XP_008348593.1|  PREDICTED: uncharacterized protein At1g66480...    124   4e-30   
ref|XP_008775226.1|  PREDICTED: uncharacterized protein At1g66480...    124   7e-30   
gb|EYU30052.1|  hypothetical protein MIMGU_mgv1a023844mg                124   9e-30   
ref|XP_009399731.1|  PREDICTED: uncharacterized protein At1g66480...    123   1e-29   
ref|XP_004161194.1|  PREDICTED: uncharacterized protein At1g66480...    123   1e-29   
ref|XP_004140437.1|  PREDICTED: uncharacterized protein At1g66480...    123   2e-29   
ref|XP_008801161.1|  PREDICTED: uncharacterized protein At1g66480...    122   3e-29   
ref|XP_010910469.1|  PREDICTED: uncharacterized protein At1g66480...    122   4e-29   
ref|XP_010553923.1|  PREDICTED: uncharacterized protein At1g66480...    120   2e-28   
ref|XP_010553916.1|  PREDICTED: uncharacterized protein At1g66480...    120   2e-28   
ref|XP_009414071.1|  PREDICTED: uncharacterized protein At1g66480...    120   2e-28   
ref|XP_006398523.1|  hypothetical protein EUTSA_v10001016mg             120   2e-28   
gb|AAD14534.1|  unknown protein                                         120   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008800768.1|  PREDICTED: uncharacterized protein At1g66480...    119   4e-28   
ref|XP_002438190.1|  hypothetical protein SORBIDRAFT_10g009380          121   5e-28   Sorghum bicolor [broomcorn]
ref|XP_004965177.1|  PREDICTED: uncharacterized protein At1g66480...    120   8e-28   
ref|XP_006302789.1|  hypothetical protein CARUB_v10020914mg             119   1e-27   
ref|XP_008454773.1|  PREDICTED: uncharacterized protein At1g66480...    118   2e-27   
ref|XP_008454771.1|  PREDICTED: uncharacterized protein At1g66480...    118   2e-27   
gb|EEC80354.1|  hypothetical protein OsI_22441                          119   2e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_010553900.1|  PREDICTED: uncharacterized protein At1g66480...    118   3e-27   
ref|NP_001140541.1|  hypothetical protein                               119   3e-27   Zea mays [maize]
ref|XP_003578092.1|  PREDICTED: uncharacterized protein At1g66480...    117   4e-27   
ref|XP_010528525.1|  PREDICTED: uncharacterized protein At1g66480...    116   7e-27   
gb|KCW69333.1|  hypothetical protein EUGRSUZ_F02820                     116   7e-27   
ref|XP_010528526.1|  PREDICTED: uncharacterized protein At1g66480...    116   8e-27   
ref|XP_010062234.1|  PREDICTED: uncharacterized protein At1g66480...    116   9e-27   
dbj|BAJ94681.1|  predicted protein                                      117   9e-27   
dbj|BAD46205.1|  hypothetical protein                                   117   9e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006838369.1|  hypothetical protein AMTR_s00002p00035620          115   1e-26   
ref|NP_001057325.2|  Os06g0260000                                       117   1e-26   Oryza sativa Japonica Group [Japonica rice]
emb|CDY25937.1|  BnaC09g20500D                                          115   1e-26   
ref|NP_001144982.1|  uncharacterized protein LOC100278137               117   1e-26   Zea mays [maize]
ref|XP_003563985.1|  PREDICTED: uncharacterized protein At1g66480...    117   2e-26   
dbj|BAJ95074.1|  predicted protein                                      117   2e-26   
ref|XP_002462356.1|  hypothetical protein SORBIDRAFT_02g024320          114   3e-26   Sorghum bicolor [broomcorn]
dbj|BAE99768.1|  hypothetical protein                                   114   4e-26   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51153.1|AC074025_3  hypothetical protein                          114   5e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176821.2|  plastid movement impaired 2 protein                   114   5e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010554976.1|  PREDICTED: uncharacterized protein At1g66480...    113   8e-26   
gb|EAZ07066.1|  hypothetical protein OsI_29313                          113   9e-26   Oryza sativa Indica Group [Indian rice]
ref|NP_001175592.1|  Os08g0429250                                       113   1e-25   
ref|XP_004956774.1|  PREDICTED: uncharacterized protein At1g66480...    113   1e-25   
dbj|BAJ97523.1|  predicted protein                                      114   1e-25   
ref|XP_010471107.1|  PREDICTED: uncharacterized protein At1g66480...    111   3e-25   
ref|XP_010511478.1|  PREDICTED: uncharacterized protein At1g66480...    111   4e-25   
ref|XP_010046540.1|  PREDICTED: uncharacterized protein At1g66480...    110   6e-25   
ref|XP_004140307.1|  PREDICTED: uncharacterized protein At1g66480...    110   1e-24   
gb|KGN51042.1|  hypothetical protein Csa_5G418770                       110   1e-24   
ref|XP_002870572.1|  hypothetical protein ARALYDRAFT_493762             109   1e-24   
ref|XP_004953825.1|  PREDICTED: uncharacterized protein At1g66480...    110   2e-24   
ref|XP_010470524.1|  PREDICTED: uncharacterized protein At1g66480       109   2e-24   
ref|NP_001183195.1|  hypothetical protein                               110   2e-24   
gb|ABK23762.1|  unknown                                                 109   3e-24   Picea sitchensis
ref|XP_004140306.1|  PREDICTED: uncharacterized protein At1g66480...    110   3e-24   
dbj|BAK00399.1|  predicted protein                                      109   3e-24   
ref|XP_009401428.1|  PREDICTED: uncharacterized protein At1g66480...    108   3e-24   
ref|XP_009388226.1|  PREDICTED: uncharacterized protein At1g66480...    108   4e-24   
gb|KDO63111.1|  hypothetical protein CISIN_1g0323941mg                  106   5e-24   
ref|XP_009417656.1|  PREDICTED: uncharacterized protein At1g66480...    107   5e-24   
ref|XP_010415191.1|  PREDICTED: uncharacterized protein At1g66480...    108   6e-24   
ref|XP_002445525.1|  hypothetical protein SORBIDRAFT_07g020936          108   8e-24   Sorghum bicolor [broomcorn]
gb|EEC84556.1|  hypothetical protein OsI_31309                          108   8e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_009388031.1|  PREDICTED: uncharacterized protein At1g66480...    107   8e-24   
ref|XP_009409256.1|  PREDICTED: uncharacterized protein At1g66480...    107   8e-24   
dbj|BAD36318.1|  unknown protein                                        107   2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001182953.1|  uncharacterized protein LOC100501255               107   2e-23   
dbj|BAB10363.1|  unnamed protein product                                106   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198600.1|  uncharacterized protein                               106   3e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009419115.1|  PREDICTED: uncharacterized protein At1g66480...    105   3e-23   
ref|XP_006391401.1|  hypothetical protein EUTSA_v10019620mg             104   6e-23   
ref|XP_002888502.1|  hypothetical protein ARALYDRAFT_475748             105   8e-23   
ref|XP_006390815.1|  hypothetical protein EUTSA_v10019172mg             104   9e-23   
ref|XP_010450546.1|  PREDICTED: uncharacterized protein At1g66480...    103   2e-22   
ref|XP_010435694.1|  PREDICTED: uncharacterized protein At1g66480...    102   5e-22   
ref|XP_010435695.1|  PREDICTED: uncharacterized protein At1g66480...    102   6e-22   
ref|XP_010440894.1|  PREDICTED: uncharacterized protein At1g66480...    102   6e-22   
ref|XP_002454333.1|  hypothetical protein SORBIDRAFT_04g028880          102   6e-22   Sorghum bicolor [broomcorn]
ref|XP_002888813.1|  hypothetical protein ARALYDRAFT_894932             100   1e-21   
emb|CDX96144.1|  BnaA07g25870D                                          101   2e-21   
ref|XP_009105210.1|  PREDICTED: uncharacterized protein At1g66480...    101   2e-21   
ref|XP_009105209.1|  PREDICTED: uncharacterized protein At1g66480...    101   2e-21   
gb|ACN25188.1|  unknown                                                 101   2e-21   Zea mays [maize]
gb|EEC73945.1|  hypothetical protein OsI_08817                          101   2e-21   Oryza sativa Indica Group [Indian rice]
emb|CDX72768.1|  BnaC06g32160D                                          100   2e-21   
tpg|DAA61371.1|  TPA: hypothetical protein ZEAMMB73_422493              101   2e-21   
emb|CDY01698.1|  BnaC04g30540D                                          100   2e-21   
emb|CDY36204.1|  BnaC06g27480D                                          100   3e-21   
ref|XP_006285147.1|  hypothetical protein CARUB_v10006491mg           99.8    4e-21   
ref|NP_683488.1|  uncharacterized protein                             99.4    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010415796.1|  PREDICTED: uncharacterized protein At1g66480...  99.8    5e-21   
ref|XP_009139753.1|  PREDICTED: uncharacterized protein At1g66480     99.4    5e-21   
ref|XP_008646204.1|  PREDICTED: uncharacterized protein At1g66480...  99.8    8e-21   
ref|XP_010427914.1|  PREDICTED: uncharacterized protein At1g66480...  99.0    9e-21   
ref|XP_009105768.1|  PREDICTED: uncharacterized protein At1g66480     98.2    1e-20   
ref|XP_008457131.1|  PREDICTED: uncharacterized protein At1g66480...  96.7    2e-20   
ref|XP_003570504.1|  PREDICTED: uncharacterized protein At1g66480...  96.7    1e-19   
ref|XP_009390356.1|  PREDICTED: uncharacterized protein At1g66480...  93.6    5e-19   
ref|XP_006302856.1|  hypothetical protein CARUB_v10020986mg           93.2    5e-19   
gb|KGN57888.1|  hypothetical protein Csa_3G368690                     93.2    6e-19   
gb|KFK41526.1|  hypothetical protein AALP_AA2G141000                  93.2    7e-19   
ref|XP_003572217.1|  PREDICTED: uncharacterized protein At1g66480...  94.4    7e-19   
ref|XP_009127841.1|  PREDICTED: uncharacterized protein At1g66480...  90.9    5e-18   
ref|XP_004151549.1|  PREDICTED: uncharacterized protein At1g66480...  89.7    7e-18   
ref|XP_004169622.1|  PREDICTED: uncharacterized protein At1g66480...  89.7    8e-18   
emb|CDY09510.1|  BnaC02g20520D                                        89.4    1e-17   
gb|EYU44582.1|  hypothetical protein MIMGU_mgv1a025559mg              88.6    2e-17   
emb|CDY03707.1|  BnaA02g15300D                                        87.4    8e-17   
ref|XP_008664670.1|  PREDICTED: uncharacterized protein At1g66480...  88.2    1e-16   
ref|XP_008664669.1|  PREDICTED: uncharacterized protein At1g66480...  87.8    2e-16   
tpg|DAA49037.1|  TPA: hypothetical protein ZEAMMB73_148814            87.8    2e-16   
ref|XP_010693823.1|  PREDICTED: uncharacterized protein At1g66480...  85.1    6e-16   
ref|XP_006656858.1|  PREDICTED: uncharacterized protein LOC102699696  85.1    7e-16   
gb|EAZ36542.1|  hypothetical protein OsJ_20883                        85.5    9e-16   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010497880.1|  PREDICTED: uncharacterized protein At1g66480...  78.6    1e-14   
emb|CDX75954.1|  BnaC03g40370D                                        78.2    4e-14   
ref|XP_011099483.1|  PREDICTED: uncharacterized protein At1g66480...  77.0    2e-13   
gb|EAZ42812.1|  hypothetical protein OsJ_27397                        73.9    2e-12   Oryza sativa Japonica Group [Japonica rice]
gb|AAL16667.1|AF419849_1  unknown                                     63.5    4e-09   Musa acuminata [banana]
dbj|BAK00045.1|  predicted protein                                    63.5    3e-08   
emb|CDX74556.1|  BnaA04g08330D                                        55.8    3e-06   
ref|XP_008241872.1|  PREDICTED: uncharacterized protein LOC103340255  52.0    7e-05   
ref|XP_007203096.1|  hypothetical protein PRUPE_ppa023721mg           51.6    9e-05   
ref|XP_007047087.1|  Uncharacterized protein TCM_000492               51.6    1e-04   
ref|XP_006660146.1|  PREDICTED: uncharacterized protein LOC102701652  50.8    2e-04   
gb|EMS56085.1|  hypothetical protein TRIUR3_29230                     50.8    2e-04   
ref|XP_010942043.1|  PREDICTED: uncharacterized protein LOC105060128  50.1    3e-04   
ref|NP_001063126.2|  Os09g0403000                                     49.7    4e-04   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_009592681.1| PREDICTED: uncharacterized protein At1g66480-like [Nicotiana 
tomentosiformis]
Length=223

 Score =   168 bits (425),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 137/213 (64%), Gaps = 26/213 (12%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DGQT +FK P+ A EV+K  P  +L++SEAVK+FG RAKPL  +QEL+PKR+Y
Sbjct  10    TTKVMKIDGQTMKFKTPLYANEVLKNYPTMVLLESEAVKHFGVRAKPLEPQQELKPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP-----ESG  663
             FLV  P  P+E+     R   SGI MSA+ RLE+LMLAR +SVSD+S +K P     ES 
Sbjct  70    FLVELPKYPEEKPPRRVR---SGIQMSAKDRLETLMLAR-RSVSDLSILKPPSIITEESS  125

Query  662   ------------GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLN  519
                         GG VR+KLRLPKAEVEKL+ Q KD   G+VAEKIM+LCM  N  +   
Sbjct  126   YHNNSSPRKAEIGGSVRVKLRLPKAEVEKLMTQCKD--EGDVAEKIMQLCMSKNGGSGPL  183

Query  518   KSTRSRPTAPIPGIIKKDLKSSQKRVGFREIQQ  420
                +S       GIIKK LKS +KRVGF  I +
Sbjct  184   MEEQSYNNG---GIIKKGLKSREKRVGFLPITE  213



>ref|XP_009789651.1| PREDICTED: uncharacterized protein At1g66480-like [Nicotiana 
sylvestris]
Length=232

 Score =   165 bits (418),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 136/222 (61%), Gaps = 35/222 (16%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DGQT +FK P+ A EV+K  P  +L++SEAVK+FG RAKPL  +QEL+PKR+Y
Sbjct  10    TTKVMKIDGQTMKFKTPIYANEVLKNYPTMVLLESEAVKHFGVRAKPLEPQQELKPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK----------  678
             FLV  P  P+++     R   SGI MSA+ RLE+LMLAR +SVSD+S +K          
Sbjct  70    FLVELPKYPEQKTPRRVR---SGIQMSAKDRLETLMLAR-RSVSDLSILKPASITTEESS  125

Query  677   --------------SP--ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
                           SP     GG VR+KLRLPKAEVEKL+ Q KD    EVAEKIM+LCM
Sbjct  126   YHNNSASGSLVNNSSPCKTENGGPVRVKLRLPKAEVEKLMTQCKD--ENEVAEKIMQLCM  183

Query  545   GNNNAAVLNKSTRSRPTAPIPGIIKKDLKSSQKRVGFREIQQ  420
              NN  +      +S       GIIKK LKS +KRVGF  I +
Sbjct  184   SNNGGSGPLMEEQSHNNG---GIIKKGLKSREKRVGFLPITE  222



>ref|XP_009608883.1| PREDICTED: uncharacterized protein At1g66480-like [Nicotiana 
tomentosiformis]
Length=240

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 107/228 (47%), Positives = 141/228 (62%), Gaps = 38/228 (17%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DGQT +FK P+ A EV++  P  +L++SE+VK+FG RAKPL  +QEL+PKR+Y
Sbjct  10    TTKVMKIDGQTMKFKTPIYANEVLRNYPTMVLLESESVKHFGVRAKPLEPQQELKPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP--------  672
             FLV  P  P+E+     R   SGI MSA+ RLE+LMLAR +SVSD+S +K P        
Sbjct  70    FLVELPKYPEEKTPRRVR---SGIQMSAKDRLETLMLAR-RSVSDLSILKPPSIITEESS  125

Query  671   ----------------ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
                             E+GGG VRLKLRLP+AEVEKL+ +SK+   G+VAEKIMRLC+ N
Sbjct  126   YHNNYASGSVLNNSKTENGGGPVRLKLRLPRAEVEKLMMESKE--EGDVAEKIMRLCLVN  183

Query  539   NNAAVLNKSTRSRPTAPIP--------GIIKKDLKSSQKRVGFREIQQ  420
             N        ++S P             GIIKK ++S +KRVGF  I +
Sbjct  184   NGGGGDMFQSKSGPLLEEQSNWKNNNGGIIKKGIRSREKRVGFLPITE  231



>ref|XP_009789650.1| PREDICTED: uncharacterized protein At1g66480-like [Nicotiana 
sylvestris]
Length=242

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 138/230 (60%), Gaps = 40/230 (17%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DGQT +FK P+ A EV++  P  +L++SEAVK+FG RAKPL  +QEL+ KR+Y
Sbjct  10    TTKVMKIDGQTMKFKTPIYANEVLRNYPTMVLLESEAVKHFGVRAKPLEPQQELKSKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP--------  672
             FLV  P  P+++     R   SGI MSA+ RLE+LMLAR +SVSD+S MK          
Sbjct  70    FLVELPKYPEQKTPRRVR---SGIQMSAKDRLETLMLAR-RSVSDLSIMKPASIMTEESS  125

Query  671   ---------------ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
                            E+GGG VR+KLRLP+AEVEKL+ QSKD   G+VAEKIMRLC+ NN
Sbjct  126   YHNNFASGTLLNNKMENGGGPVRVKLRLPRAEVEKLMTQSKD--EGDVAEKIMRLCLVNN  183

Query  536   NAAVLNKSTRSRPTAPI-----------PGIIKKDLKSSQKRVGFREIQQ  420
                          + P+            GIIKK ++S +KRVGF  I +
Sbjct  184   GGGGGGADMFQNRSGPLLEEQSNWKNNNGGIIKKGIRSREKRVGFLPITE  233



>ref|XP_009596673.1| PREDICTED: uncharacterized protein At1g66480-like [Nicotiana 
tomentosiformis]
Length=241

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 139/229 (61%), Gaps = 39/229 (17%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGH-ILVDSEAVKNFGFRAKPLAAEQELQPKRV  831
              AKVM++DGQ  +FK PV A E++K+ P   +L++SE VK+FG +AKPL  +QEL+PKR+
Sbjct  10    TAKVMKIDGQIMKFKTPVYANEILKSYPNSMVLLESEEVKHFGIKAKPLEPQQELKPKRL  69

Query  830   YFLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK---------  678
             YFLV  P  P+E+     R   SGI MSA+ RLE+LMLAR +SVSD+S +K         
Sbjct  70    YFLVELPKYPEEKPPRRVR---SGIQMSAKDRLETLMLAR-RSVSDLSILKPVSIITEES  125

Query  677   ---------------SPESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMG  543
                              E+GGG VR+KLRLPKAEVEKL+ QSK  G  +VAEKIMRLCM 
Sbjct  126   SYNNNYASGSVLNNSKTENGGGPVRVKLRLPKAEVEKLMMQSK--GEEDVAEKIMRLCMA  183

Query  542   NNNAAVLNKSTRSRPTAPIP--------GIIKKDLKSSQKRVGFREIQQ  420
             NN        ++S P             GIIKK ++S +KRVGF  I +
Sbjct  184   NNGGGGDMFQSKSGPLLEEQSNWKNNNGGIIKKGIRSREKRVGFLPITE  232



>ref|XP_002315887.1| hypothetical protein POPTR_0010s12400g [Populus trichocarpa]
 gb|EEF02058.1| hypothetical protein POPTR_0010s12400g [Populus trichocarpa]
Length=215

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 98/201 (49%), Positives = 130/201 (65%), Gaps = 20/201 (10%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM++ G+T +FK PV AGEVVK  PGH+L++SEAVK++G RAKPL A Q+L PKR+Y
Sbjct  10    TAKVMKISGETFKFKTPVKAGEVVKDYPGHVLLESEAVKHYGIRAKPLEAHQDLVPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK-----SPESG  663
             FLV     P+       R   SGI+MSA+ RLESLML+R +S SD+S MK     + E+ 
Sbjct  70    FLV---ELPKTPTEKVPRRVRSGINMSAKDRLESLMLSR-RSTSDLSIMKPASIEAEEAK  125

Query  662   GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN-NAAVLNKSTRSRPT---  495
              G +R+K+RLPKAEVEKL+++SKD    E A KI+ LCM N   +A+L +    +     
Sbjct  126   SGAMRVKMRLPKAEVEKLMQESKD--ETEAAAKIVDLCMANTAESALLQQQVHWKSAGHG  183

Query  494   -APIPGIIKKDLKSSQKRVGF  435
                  GII    K+ +KRV F
Sbjct  184   RVSSQGII----KAREKRVSF  200



>ref|XP_002284189.1| PREDICTED: uncharacterized protein At1g66480 [Vitis vinifera]
 emb|CBI26915.3| unnamed protein product [Vitis vinifera]
Length=231

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 116/165 (70%), Gaps = 15/165 (9%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
             +AKVM++DG+  + K PV AGEVVK  PGH+L++SEAVK+FG RAKPL ++QEL+PKR+Y
Sbjct  10    IAKVMKIDGEVIKLKTPVYAGEVVKDYPGHVLLESEAVKHFGIRAKPLESQQELKPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPE-------  669
             FLV     P+       R   SGI+MSA+ RLESLML+R +SVSD++ MK          
Sbjct  70    FLV---ELPKGAEEKVPRRVRSGINMSAKDRLESLMLSR-RSVSDLTIMKPASIVHQEPK  125

Query  668   --SGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
               S  G VR+K+RLPKAEVEKL+++SKD    E AEKIM LC+ N
Sbjct  126   EASESGTVRMKMRLPKAEVEKLMRESKD--EAEAAEKIMDLCIAN  168



>gb|EPS72336.1| hypothetical protein M569_02423, partial [Genlisea aurea]
Length=172

 Score =   153 bits (386),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 114/163 (70%), Gaps = 13/163 (8%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T + K P+ AG +++ NPGH+L++SEAVK+FG RAKPL   QEL+P+R+YF
Sbjct  11    AKVMKIDGETFKTKAPIRAGSILEKNPGHVLLESEAVKHFGVRAKPLEPYQELKPRRLYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPES-------  666
             LV     P+       R   SGI MSA+ RLESLMLAR +S SD+S +K   S       
Sbjct  71    LV---ELPKLPEERGPRRVRSGIQMSAKDRLESLMLAR-RSSSDLSILKPTPSMAEERSE  126

Query  665   GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
             GG GVR+K+RLPKAEV++L+ +SKD  G E AEKI+ LCM  N
Sbjct  127   GGTGVRVKMRLPKAEVDRLMAESKD--GAEAAEKIVTLCMATN  167



>ref|XP_004253408.1| PREDICTED: uncharacterized protein At1g66480-like [Solanum lycopersicum]
Length=236

 Score =   154 bits (390),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 135/221 (61%), Gaps = 32/221 (14%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
              KVM++DGQT +FK PV A EV+K  P  +L++SE VK+FG RAKPL  +QEL+PKR+YF
Sbjct  12    TKVMKIDGQTMKFKTPVYANEVLKNYPSMVLLESEEVKHFGVRAKPLEPQQELKPKRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK-----------  678
             LV  P  P+E +  P R RS+ I MSA+ RLE+LMLAR +S SD+S MK           
Sbjct  72    LVELPKLPEENKKSPFRARSA-IQMSAKERLETLMLAR-RSASDLSIMKPTSMMMSTHEY  129

Query  677   ------SPESG---------GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMG  543
                   +P  G         G   RLKLRL K EVEKL+ +SKD    EVA KIM+LCM 
Sbjct  130   SSSHTNNPTLGILNSGGPAQGRPTRLKLRLSKVEVEKLMMESKD--ENEVAHKIMKLCMN  187

Query  542   NNNAAVLNKSTRSRPTAPIPGIIKKDLKSSQKRVGFREIQQ  420
             NNN    N+    + +    GI+KK +KS +KRVGF  I +
Sbjct  188   NNNGG--NEPLMEQQSHNNEGIVKKGVKSREKRVGFLPITE  226



>ref|XP_009805058.1| PREDICTED: uncharacterized protein At1g66480-like [Nicotiana 
sylvestris]
Length=247

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/235 (46%), Positives = 136/235 (58%), Gaps = 45/235 (19%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DGQ  +FK PV A EV+K  P  +L++SE VK+FG RAKPL  +QEL+ KR+Y
Sbjct  10    TTKVMKIDGQIMKFKTPVYANEVLKNYPTMVLLESEEVKHFGVRAKPLEPQQELKSKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK----------  678
             FLV  P  P+E+     R   SGI MSA+ RLE+LMLAR +SVSD+S MK          
Sbjct  70    FLVELPKYPEEKNTRRIR---SGIQMSAKDRLETLMLAR-RSVSDLSTMKPASIMTEESS  125

Query  677   -------------SPESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
                            E+GGG VR+KLRLP+AEVEKL+ QSK  G  +VAEKIMRLCM NN
Sbjct  126   HHNNFASGTLLNNKTETGGGPVRVKLRLPRAEVEKLMTQSK--GEEDVAEKIMRLCMANN  183

Query  536   NAAVLNK--------STRSRP--------TAPIPGIIKKDLKSSQKRVGFREIQQ  420
                             ++S P             GIIKK ++S +KRVGF  I +
Sbjct  184   GGGGGGGGGGGADMFQSKSGPLLDEKNNWKNNNGGIIKKGIRSREKRVGFLPITE  238



>ref|XP_006344228.1| PREDICTED: uncharacterized protein At1g66480-like [Solanum tuberosum]
Length=243

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 141/228 (62%), Gaps = 36/228 (16%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DGQT +FK PV A EV+K  P  +L++SE VK+FG RAKPL  +QEL+ KR+Y
Sbjct  10    TTKVMKIDGQTMKFKTPVYANEVLKNYPSMVLLESEEVKHFGVRAKPLEPQQELKSKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK----------  678
             FLV  P  P+E+   PRRVR SGI MSA+ RLE+LMLAR +S SD++ MK          
Sbjct  70    FLVELPKIPEEKNKNPRRVR-SGIQMSAKDRLETLMLAR-RSASDLTIMKPASVMMSEEY  127

Query  677   ------SPESGGG----GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAA  528
                    P +G G     VRLKLRLPKAEVEKL+ QSKD  G +V EKIM+LCM +NN  
Sbjct  128   SSSFASGPLNGVGPQAQPVRLKLRLPKAEVEKLMMQSKD--GSDVGEKIMKLCMNSNNDG  185

Query  527   VLNKSTRSRPTAPIPG------------IIKKDLKSSQKRVGFREIQQ  420
             V     +S+  + I              +IKK ++S +KRVGF  I +
Sbjct  186   VQADLFQSKSGSLIEEDQSQWKKNNGGILIKKGIRSREKRVGFLPITE  233



>ref|XP_011075706.1| PREDICTED: uncharacterized protein At1g66480-like [Sesamum indicum]
Length=220

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 134/210 (64%), Gaps = 24/210 (11%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM+++G+T + K PV AG VV+++PGH+L++SEAVK++G RAKPL  +QEL+PKR+YF
Sbjct  11    AKVMKINGETFKLKTPVRAGSVVESHPGHVLLESEAVKHYGVRAKPLEPQQELKPKRLYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG-----  660
             LV     P+       R   SGI MSA+ RLESLMLAR +S SD+S MK P S       
Sbjct  71    LV---ELPKFPEEKGARRVRSGIQMSAKDRLESLMLAR-RSASDLSIMK-PASMASEEEK  125

Query  659   --------GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM--GNNNAAVLNKST  510
                     GGVR+++RLPKAEVE+L+  SKD  G EVAEKI+ LCM  G   AA  N   
Sbjct  126   KGGSEGGGGGVRVRMRLPKAEVERLMADSKD--GAEVAEKIVSLCMKKGGGEAAAPNVHM  183

Query  509   RSRPTAPIPGIIKKDLKSSQKRVGFREIQQ  420
               +    +    K+ +K  +KRVGFR I +
Sbjct  184   HWKGDNGVD--FKRGIKPREKRVGFRPITE  211



>ref|XP_009356153.1| PREDICTED: uncharacterized protein At1g66480-like [Pyrus x bretschneideri]
Length=228

 Score =   153 bits (386),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 110/221 (50%), Positives = 137/221 (62%), Gaps = 34/221 (15%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM+V+G+T + K PV AGEVVK  PGH+L+ S  VK+FG RAKPL A Q+L+P R+YF
Sbjct  11    AKVMQVNGETFKLKTPVQAGEVVKDFPGHVLLKSSDVKHFGVRAKPLEAYQQLEPNRLYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP---------  672
             LV  P    ++   PRRVR SGI+MSA+ RLESLML+R +SVSD+S MKS          
Sbjct  71    LVELPKVDVKKESFPRRVR-SGINMSAKDRLESLMLSR-RSVSDLSVMKSSASTASIVPE  128

Query  671   ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTA  492
             E   G VR+++RLP+AEVEKL++QS  G   E A+KIM LCM N N    N  +  +   
Sbjct  129   EEANGAVRVRMRLPRAEVEKLMRQS--GDDAEAAQKIMDLCMVNTN----NVKSNDQGLG  182

Query  491   PIPGIIKKD----LKSS--------QKRVGFR-----EIQQ  420
               P I  KD    L+S         QKRV FR     EIQQ
Sbjct  183   LNPQIHWKDEGRLLESQGIKGRHRVQKRVSFRPANEGEIQQ  223



>ref|XP_004238847.1| PREDICTED: uncharacterized protein At1g66480-like [Solanum lycopersicum]
Length=243

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 110/228 (48%), Positives = 139/228 (61%), Gaps = 36/228 (16%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DGQT +FK PV A EV+K  P  +L++SE VK+FG RAKPL  +QEL+ KR+Y
Sbjct  10    TTKVMKIDGQTMKFKTPVYANEVLKNYPSMVLLESEEVKHFGVRAKPLEPQQELKSKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK----------  678
             FLV  P  P+E+   PRRVR SGI MSA+ RLE+LMLAR +S SD++ MK          
Sbjct  70    FLVELPKFPEEKNNNPRRVR-SGIQMSAKDRLETLMLAR-RSASDLTIMKPASVMMSEEY  127

Query  677   ------SPESGGG----GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAA  528
                    P  G G     VRLKLRLPK EVEKL+ QSKD  G +VAEKIM+LCM +NN  
Sbjct  128   SSSFGSGPLDGVGPQAQPVRLKLRLPKGEVEKLMMQSKD--GSDVAEKIMKLCMSSNNDG  185

Query  527   VLNKSTRSRPTAPIPG------------IIKKDLKSSQKRVGFREIQQ  420
             V     +S+    I              +IKK ++S +KRVGF  I +
Sbjct  186   VQTDLFQSKSGPLIEEDQSQWKKNNGGILIKKGIRSREKRVGFLPITE  233



>ref|XP_010259616.1| PREDICTED: uncharacterized protein At1g66480-like [Nelumbo nucifera]
Length=222

 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 100/215 (47%), Positives = 131/215 (61%), Gaps = 30/215 (14%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM+VDG+T + K PV  G+VVK  PG +L++SEAVK+FG RAKPL  + EL+PK++Y
Sbjct  11    TAKVMKVDGETFKLKTPVRVGQVVKDYPGFVLMESEAVKHFGVRAKPLEPQMELKPKKLY  70

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP--------  672
             FL+  P  P ++     R   SGI MSA+ RLESLMLAR +SVSD+S +KS         
Sbjct  71    FLIELPKLPDQKLPRRVR---SGIQMSAKDRLESLMLAR-RSVSDLSILKSSSAVYDEPG  126

Query  671   -ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN------------A  531
              ES  G VR+KLRLPK++V KL++ S D    + A KIM LC+  NN             
Sbjct  127   LESTAGAVRIKLRLPKSQVAKLVQDSND--VSDAAAKIMDLCISKNNGNADGFGPNSNEV  184

Query  530   AVLNKSTRSRPTAPIPGIIKKDLKSSQKRVGFREI  426
             ++LN+ T  +P     G I +  K   KRVGFR I
Sbjct  185   SLLNQETHWKPGL---GSITETCKPRVKRVGFRPI  216



>ref|XP_006372588.1| hypothetical protein POPTR_0017s03000g [Populus trichocarpa]
 gb|ERP50385.1| hypothetical protein POPTR_0017s03000g [Populus trichocarpa]
Length=216

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 94/195 (48%), Positives = 129/195 (66%), Gaps = 8/195 (4%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM+++G+T + K P  A +VVK  PG++L+DSEAVK+FG RAKPL  +QEL+ K++YF
Sbjct  11    AKVMKINGETFKLKTPARASDVVKDYPGYVLLDSEAVKHFGIRAKPLEPQQELKAKKIYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS----PESGGG  657
             LV  P  P+E+     R   SGIHMSA+ RLE LML+R +SVSDI  ++S       G  
Sbjct  71    LVELPKFPEEKDPRNTRRVQSGIHMSAKDRLECLMLSR-RSVSDIPMVRSSSGQTSDGPN  129

Query  656   GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAV-LNKSTRSRPTAPIPG  480
              VR+K+RLPKA+V+KL+++SKD    EVAEKI+ L M N+  A   +   R     P  G
Sbjct  130   TVRVKVRLPKAQVQKLVEESKD--EAEVAEKIIDLYMDNSGEANGEHDHNRHVQWQPELG  187

Query  479   IIKKDLKSSQKRVGF  435
              I +  K+++KRV F
Sbjct  188   SITESFKTTKKRVSF  202



>ref|XP_011038667.1| PREDICTED: uncharacterized protein At1g66480-like [Populus euphratica]
Length=229

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 91/172 (53%), Positives = 116/172 (67%), Gaps = 12/172 (7%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM++ G+T +FK PV AGEVVK  PGH+L++SEAVK++G RAKPL A Q+L PKR+Y
Sbjct  10    TAKVMKISGETFKFKTPVKAGEVVKDYPGHVLLESEAVKHYGIRAKPLEAHQDLVPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK-----SPESG  663
             FLV     P        R   SGI MSAE RLESLM +R +S SD+S MK     + E+ 
Sbjct  70    FLV---ELPNTPTEKVPRRVRSGITMSAEDRLESLMHSR-RSTSDLSIMKPASIAAEEAK  125

Query  662   GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTR  507
              G +R+K+RLPKAEVE+L+++SKD    E A KI+ LCM  N A   N S+R
Sbjct  126   SGAMRVKMRLPKAEVERLMQESKD--ETEAAAKIVDLCMA-NTAGGSNNSSR  174



>ref|XP_011001592.1| PREDICTED: uncharacterized protein At1g66480-like [Populus euphratica]
Length=216

 Score =   151 bits (382),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 128/195 (66%), Gaps = 8/195 (4%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM+++G T + K P  A +VVK  PG++L+DSEAVK+FG RAKPL  +QEL+ K++YF
Sbjct  11    AKVMKINGDTFKLKTPARASDVVKDYPGYVLLDSEAVKHFGIRAKPLEPQQELKAKKIYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS----PESGGG  657
             LV  P  P+E+     R   SGIHMSA+ RLE LML+R +SVSDI  ++S       G  
Sbjct  71    LVELPKFPEEKDPRNTRRVQSGIHMSAKDRLECLMLSR-RSVSDIPMVRSSSGQTSDGPN  129

Query  656   GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAV-LNKSTRSRPTAPIPG  480
              VR+K+RLPKA+V+KL++QSKD    EVAEKI+ L M N+  A   +   R     P  G
Sbjct  130   TVRVKVRLPKAQVQKLVEQSKD--EVEVAEKIIDLYMDNSGEANGEHDHNRQVQWQPELG  187

Query  479   IIKKDLKSSQKRVGF  435
              I +  K+++KRV F
Sbjct  188   SITESFKTTKKRVSF  202



>ref|XP_006344226.1| PREDICTED: uncharacterized protein At1g66480-like [Solanum tuberosum]
Length=222

 Score =   151 bits (382),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 136/219 (62%), Gaps = 38/219 (17%)
 Frame = -2

Query  995  MRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFLVA  816
            M++DGQT +FK P+ A EV+K  P  +L++SE VK+FG RAKPL  +QEL+PKR+YFLV 
Sbjct  1    MKIDGQTMKFKTPIYANEVLKNYPSMVLLESEEVKHFGVRAKPLEPQQELKPKRLYFLVE  60

Query  815  eplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK--------------  678
             P  P+E +  P R RS+ I MSA+ RLE+LMLAR +S SD+S MK              
Sbjct  61   LPKLPEENKKSPFRARSA-IQMSAKERLETLMLAR-RSASDLSIMKPTSMMMSTHEYSSS  118

Query  677  --------SPESGG----GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN  534
                    +  SGG       RLKLRL KAEVEKL+K+SKD    EVAEKIMRLCM NNN
Sbjct  119  HTNNSTSGTLNSGGPPQAHPTRLKLRLSKAEVEKLMKESKD--EDEVAEKIMRLCMNNNN  176

Query  533  AA---VLNKSTRSRPTAPIPGIIKKDLKSSQKRVGFREI  426
                 ++ + + +       G +KK++KS +KRVGF  I
Sbjct  177  GGSGPLIEQQSHNN-----GGRVKKEVKSREKRVGFLPI  210



>ref|XP_011001505.1| PREDICTED: uncharacterized protein At1g66480-like [Populus euphratica]
Length=216

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 128/195 (66%), Gaps = 8/195 (4%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM+++G T + K P  A +VVK  PG++L+DSEAVK+FG RAKPL  +QEL+ K++YF
Sbjct  11    AKVMKINGDTFKLKTPARASDVVKDYPGYVLLDSEAVKHFGIRAKPLEPQQELKAKKIYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS----PESGGG  657
             LV  P  P+E+     R   SGIHMSA+ RLE LML+R +SVSDI  ++S       G  
Sbjct  71    LVELPKFPEEKDPRNTRRVRSGIHMSAKDRLECLMLSR-RSVSDIPMVRSSSGQTSDGPN  129

Query  656   GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAV-LNKSTRSRPTAPIPG  480
              VR+K+RLPKA+V+KL++QSKD    EVAEKI+ L M N+  A   +   R     P  G
Sbjct  130   TVRVKVRLPKAQVQKLVEQSKD--EVEVAEKIIDLYMDNSGEANGEHDHNRQVQWQPELG  187

Query  479   IIKKDLKSSQKRVGF  435
              I +  K+++KRV F
Sbjct  188   SITESFKTTKKRVSF  202



>ref|XP_008389224.1| PREDICTED: uncharacterized protein At1g66480 [Malus domestica]
Length=228

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 109/221 (49%), Positives = 136/221 (62%), Gaps = 34/221 (15%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM+V+G+T + K PV AGEVVK  PGH+L+ S  VK+FG RAKPL   Q+L+P R+YF
Sbjct  11    AKVMQVNGETFKLKTPVQAGEVVKDFPGHVLLKSSDVKHFGVRAKPLEPYQQLEPNRLYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP---------  672
             LV  P    ++   PRRVR SGI+MSA+ RLESLML+R +SVSD+S MKS          
Sbjct  71    LVELPKVDVKKESFPRRVR-SGINMSAKDRLESLMLSR-RSVSDLSVMKSSASTASIVPE  128

Query  671   ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTA  492
             E   G VR+++RLP+AEVEKL++QS  G   E A+KIM LCM N N    N  +  +   
Sbjct  129   EEANGAVRVRMRLPRAEVEKLMRQS--GDDAEAAQKIMDLCMVNTN----NVKSNDQGLG  182

Query  491   PIPGIIKKD----LKSS--------QKRVGFR-----EIQQ  420
               P I  KD    L+S         QKRV FR     EIQQ
Sbjct  183   MNPQIHWKDEGRLLESQGIKERHRVQKRVSFRPANEGEIQQ  223



>ref|XP_011023151.1| PREDICTED: uncharacterized protein At1g66480-like [Populus euphratica]
 ref|XP_011016335.1| PREDICTED: uncharacterized protein At1g66480-like [Populus euphratica]
Length=228

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 125/196 (64%), Gaps = 12/196 (6%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM+++G+T +FK PV AG+VVK  PGH+L++SEAVK++G RAKPL A Q+L PKR+Y
Sbjct  10    TAKVMKINGETFKFKTPVKAGDVVKDYPGHVLLESEAVKHYGTRAKPLEAHQDLVPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK-----SPESG  663
             FLV     P+       R   SGI+MSA+ RLESLML+R +S SD+S MK     S E+ 
Sbjct  70    FLV---ELPETPTERVPRRVRSGINMSAKDRLESLMLSR-RSTSDLSIMKPSSIVSEEAK  125

Query  662   GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAPIP  483
              G +R+K+RLPK EVEKL+++SKD    E A KI+ LC+ N      N S          
Sbjct  126   RGAMRVKMRLPKEEVEKLMQESKD--EAEAAAKILDLCIANTAGGSNNSSREIAQNGQES  183

Query  482   GIIKK-DLKSSQKRVG  438
             G+ ++   KS   RVG
Sbjct  184   GLSQQVHWKSGHGRVG  199



>ref|XP_002311497.1| hypothetical protein POPTR_0008s12770g [Populus trichocarpa]
 gb|EEE88864.1| hypothetical protein POPTR_0008s12770g [Populus trichocarpa]
Length=215

 Score =   150 bits (378),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 114/162 (70%), Gaps = 11/162 (7%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM+++G+T +FK PV AG+VVK  PGH+L++SEAVK++G RAKPL A Q+L PKR+Y
Sbjct  10    TAKVMKINGETFKFKTPVKAGDVVKDYPGHVLLESEAVKHYGIRAKPLEAHQDLVPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK-----SPESG  663
             FLV     P+       R   SGI+MSA+ RLESLML+R +S SD+S MK     S E+ 
Sbjct  70    FLV---ELPETPTERVPRRVRSGINMSAKDRLESLMLSR-RSTSDLSIMKPSSIVSEEAK  125

Query  662   GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
              G +R+K+RLPK +VEKL+++SKD    E A KI+ LCM N 
Sbjct  126   RGAMRVKMRLPKEQVEKLMQESKD--EAEAAAKILDLCMANT  165



>emb|CDP00754.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 130/202 (64%), Gaps = 15/202 (7%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
             VAKVM+++G+T + K P+ AGEVVK  PG +L++SEAVK+FG RAKPL  +QEL+PK +Y
Sbjct  10    VAKVMKINGETIKLKTPIYAGEVVKDYPGFVLLESEAVKHFGIRAKPLEPQQELKPKGLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK---------S  675
             FLV E     EE     R   SGI MSA+ RLESLMLAR +SVSD+S +K         S
Sbjct  70    FLV-ELPKFPEENTKGPRRVRSGIQMSAKDRLESLMLAR-RSVSDLSHLKPASIVLDEQS  127

Query  674   PESG-GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM-GNNNAAVLNKSTRSR  501
              ES   G +RLK+RLPKA+V+K++ +SKD    E A KIM  CM     AA    S++  
Sbjct  128   QESSPNGAMRLKMRLPKAQVQKMMMESKD--EAEAAAKIMEFCMANTATAAGGAASSKVH  185

Query  500   PTAPIPGIIKKDLKSSQKRVGF  435
                   GI+K+ LK  +KRVGF
Sbjct  186   HWKNEHGIVKQGLKPREKRVGF  207



>ref|XP_010274640.1| PREDICTED: uncharacterized protein At1g66480-like [Nelumbo nucifera]
Length=224

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 134/217 (62%), Gaps = 31/217 (14%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AK+M++DG+T + K PV  G+VVK  PG +L++SEAVK+FG RAKPL  +QEL+P+++Y
Sbjct  10    TAKIMKIDGETFKLKAPVRVGDVVKDYPGFVLMESEAVKHFGIRAKPLEPQQELKPRKLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS---------  675
             FL+  P  PQ++     R   SGI MSA+ RLESLML+R +S SD++ +KS         
Sbjct  70    FLIELPTLPQQKVARRVR---SGIQMSAKDRLESLMLSR-RSTSDLTILKSTSVIPDESG  125

Query  674   PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN-------------  534
             PES  G +R+KLRLPK++V KL+++S D    E A KIM LC+  NN             
Sbjct  126   PESPSGALRVKLRLPKSQVAKLMEESSD--PSEAAAKIMDLCLSKNNGNGNVDGVAGRSN  183

Query  533   -AAVLNKSTRSRPTAPIPGIIKKDLKSSQKRVGFREI  426
               ++L + T+ +P   +  I +   K  +KRVGF  I
Sbjct  184   EGSLLQQQTQWKPG--LGSITETSCKPREKRVGFSPI  218



>ref|XP_006344227.1| PREDICTED: uncharacterized protein At1g66480-like [Solanum tuberosum]
Length=237

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/227 (47%), Positives = 138/227 (61%), Gaps = 40/227 (18%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DGQT +FK PV A EV+K  P  +L++SE VK++G RAKPL  +QEL+ KR+Y
Sbjct  10    TTKVMKIDGQTMKFKTPVYANEVLKNYPSMVLLESEEVKHYGVRAKPLEPQQELKSKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP--------  672
             FLV  P  P+E +   RRVRS+ I MSA+ RLE+LMLAR +S SD+S MK          
Sbjct  70    FLVELPKFPEENKKSTRRVRSA-IQMSAKDRLETLMLAR-RSASDLSIMKPASIVTEECS  127

Query  671   ----------------ESGGGG----VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRL  552
                              SGG       RLKLRL KAEVEKL+ +SKD    EVAEKIM+L
Sbjct  128   SYHNNNNNNSSASGVLNSGGPSQAHPTRLKLRLSKAEVEKLMMESKD--ENEVAEKIMKL  185

Query  551   CMGNNNA---AVLNKSTRSRPTAPIPGIIKKDLKSSQKRVGFREIQQ  420
             CM +NN    A++ + + +       GI+KK +KS +KRVGF  I +
Sbjct  186   CMNSNNCGSGALMEQQSHNN-----GGIVKKGVKSREKRVGFMPITE  227



>gb|KEH40549.1| plastid movement impaired protein [Medicago truncatula]
Length=211

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 130/204 (64%), Gaps = 21/204 (10%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
              KVM++DG+T + K PV AGEV+K +PG +L++SE VK++G RAKPL A +EL+PKR+YF
Sbjct  11    TKVMKIDGETFKLKTPVKAGEVLKDHPGLVLLESEEVKHYGVRAKPLEAHKELKPKRLYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK--------SPE  669
             LV  P   +  R V      S I+MSA+ RLESL LAR +S SD++ MK          +
Sbjct  71    LVELPKESRVTRRVR-----SVINMSAKDRLESLSLAR-RSASDLTIMKPMNDFEVGKED  124

Query  668   SGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN-NNAAVLNKSTRSRPTA  492
                GGVRLK+RLPKA+VEKL++ SKD   GE AEKIM LCM N NN   + K    + + 
Sbjct  125   LTNGGVRLKMRLPKADVEKLMQSSKD--EGEAAEKIMSLCMANGNNDKKMKKEMHWKGSR  182

Query  491   PIPGIIKKDLKSSQKRVGFREIQQ  420
              + G  K   K+ ++RV F  I +
Sbjct  183   GV-GEYK---KAYERRVSFMPINE  202



>ref|XP_004238848.1| PREDICTED: uncharacterized protein At1g66480-like [Solanum lycopersicum]
Length=236

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 105/230 (46%), Positives = 133/230 (58%), Gaps = 47/230 (20%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DGQT +FK P+ A EV+K  P  +L++SE VK++G RAKPL  +QEL+ KR+Y
Sbjct  10    TTKVMKIDGQTMKFKTPIYANEVLKNYPSMVLLESEEVKHYGVRAKPLEPQQELKSKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP--------  672
             FLV  P  P+E +   RRVRS+ I MSA+ RLE+LMLAR +S SD+S MK          
Sbjct  70    FLVELPKFPEENKKSTRRVRSA-IQMSAKDRLETLMLAR-RSTSDLSIMKPASIVTEECS  127

Query  671   ----------------------ESGGGG----VRLKLRLPKAEVEKLIKQSKDGGGGEVA  570
                                    SGG       RLKLRL K+EVEKL+ +SKD    EVA
Sbjct  128   SYHNNNNNNNNNNNNNSASDVLNSGGPSQAHPTRLKLRLSKSEVEKLMMESKD--ENEVA  185

Query  569   EKIMRLCMGNNNAAVLNKSTRSRPTAPIPGIIKKDLKSSQKRVGFREIQQ  420
             EKIM+LCM NNN    + +          G IKK LKS +KRVGF  I +
Sbjct  186   EKIMKLCMNNNNCGTSHNNG---------GAIKKGLKSREKRVGFMPITE  226



>ref|XP_008339566.1| PREDICTED: uncharacterized protein At1g66480-like [Malus domestica]
Length=230

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 116/166 (70%), Gaps = 13/166 (8%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM+V+G+  + K PV AGEVV+  PGH+L+ S  VK+FG RAKPL   ++L+P R+YF
Sbjct  11    AKVMQVNGEAFKLKTPVQAGEVVRDFPGHVLLKSSEVKHFGVRAKPLEPHEQLEPNRLYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP---------  672
             LV  P    ++    RRVR SGI+MSA+ RLESLML+R +SVSD+S MKS          
Sbjct  71    LVELPKVDVKKESFQRRVR-SGINMSAKDRLESLMLSR-RSVSDLSVMKSSASTASIVPE  128

Query  671   ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN  534
             E   G VR+++RLP+AEVEKL++QS+D   GE A++IM LCM N N
Sbjct  129   EEANGAVRVRMRLPRAEVEKLMRQSRD--DGEAAQQIMDLCMVNTN  172



>gb|KDP22653.1| hypothetical protein JCGZ_02495 [Jatropha curcas]
Length=216

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 130/199 (65%), Gaps = 18/199 (9%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AK+M+VDG+T + K P  A +VVK  PGH+L+DS+AVK+FG RAKPL  E EL PK++YF
Sbjct  11    AKIMKVDGETFKLKTPAKAMDVVKDYPGHVLLDSDAVKHFGIRAKPLEPEMELNPKKIYF  70

Query  824   LVAe-plppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS-----PESG  663
             LV    LP ++E +   R   SGIH+SA+ RLE LML+R +SVSD+S ++      P+ G
Sbjct  71    LVELPKLPEEKEPISITRRVRSGIHLSAKDRLEFLMLSR-RSVSDLSIVRPLPSQIPDDG  129

Query  662   GGG---VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTA  492
               G   VR+K+RLPKA++EKL+++SKD    EVAEKI+ L M N+           R   
Sbjct  130   HNGSGPVRVKMRLPKAQMEKLVEESKD--EVEVAEKIVDLFMENSG------DRNRRQWK  181

Query  491   PIPGIIKKDLKSSQKRVGF  435
             P  G I ++LK  +KRV F
Sbjct  182   PELGSIGENLKPREKRVNF  200



>ref|XP_006372587.1| hypothetical protein POPTR_0017s03000g [Populus trichocarpa]
 gb|ERP50384.1| hypothetical protein POPTR_0017s03000g [Populus trichocarpa]
Length=201

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 91/194 (47%), Positives = 128/194 (66%), Gaps = 8/194 (4%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM+++G+T + K P  A +VVK  PG++L+DSEAVK+FG RAKPL  +QEL+ K++YF
Sbjct  11    AKVMKINGETFKLKTPARASDVVKDYPGYVLLDSEAVKHFGIRAKPLEPQQELKAKKIYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS----PESGGG  657
             LV  P  P+E+     R   SGIHMSA+ RLE LML+R +SVSDI  ++S       G  
Sbjct  71    LVELPKFPEEKDPRNTRRVQSGIHMSAKDRLECLMLSR-RSVSDIPMVRSSSGQTSDGPN  129

Query  656   GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAV-LNKSTRSRPTAPIPG  480
              VR+K+RLPKA+V+KL+++SKD    EVAEKI+ L M N+  A   +   R     P  G
Sbjct  130   TVRVKVRLPKAQVQKLVEESKD--EAEVAEKIIDLYMDNSGEANGEHDHNRHVQWQPELG  187

Query  479   IIKKDLKSSQKRVG  438
              I +  K+++++ G
Sbjct  188   SITESFKTTKEKEG  201



>ref|XP_003555905.1| PREDICTED: uncharacterized protein At1g66480-like [Glycine max]
 gb|KHN32250.1| Hypothetical protein glysoja_039276 [Glycine soja]
Length=212

 Score =   145 bits (367),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 109/164 (66%), Gaps = 17/164 (10%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K PV  GEV+K +PG +L+DSEAVK++G RAKPL A ++LQPKR+Y
Sbjct  10    TTKVMKIDGETFKLKTPVKVGEVLKDHPGLVLLDSEAVKHYGVRAKPLEAHKDLQPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP--------  672
             FLV  P      RV       SGI+MSA+ RLESL+L R +S SD+S MK          
Sbjct  70    FLVELPKETTPRRVR------SGINMSAKDRLESLVLTR-RSASDLSIMKQSSNTDNKEN  122

Query  671   ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
              + GGGVRLK+RLPKAEVEKLI+  KD    E AE+IM L   N
Sbjct  123   SNNGGGVRLKMRLPKAEVEKLIQGCKD--EAEAAERIMNLYKAN  164



>ref|XP_003537453.1| PREDICTED: uncharacterized protein At1g66480-like [Glycine max]
 gb|KHN17929.1| Hypothetical protein glysoja_017980 [Glycine soja]
Length=214

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 96/199 (48%), Positives = 134/199 (67%), Gaps = 19/199 (10%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AK+M++DG+T + K P  A +VVK  PGH+L+DS AVKNFG RAKPL  + EL+PK++YF
Sbjct  10    AKIMKIDGETFKLKTPARANDVVKDYPGHVLLDSHAVKNFGPRAKPLEPDYELKPKKIYF  69

Query  824   LVAeplppqeervvprrvRSSGIH-MSAEARLESLMLARSKSVSDISFMKS---PESGGG  657
             LV E    + E +  RRVRSSGI  M+A+ RL+ LML++ +SVSD++ +K    PE+ GG
Sbjct  70    LV-ELPKVKPEPLGTRRVRSSGIRGMNAQDRLDFLMLSK-RSVSDLTMVKHGPGPEN-GG  126

Query  656   GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAPIPGI  477
               RLK+RLPKA +E+L+++S D  GGEVAEKI+ L MGNN A   + +T          +
Sbjct  127   PTRLKMRLPKAHLERLMEESHD--GGEVAEKIISLYMGNNAAVDGSGAT----------V  174

Query  476   IKKDLKSSQKRVGFREIQQ  420
                + K  +KRV F  ++Q
Sbjct  175   EAHNRKPRRKRVSFSPVEQ  193



>ref|XP_007033077.1| Plastid movement impaired 2 [Theobroma cacao]
 gb|EOY04003.1| Plastid movement impaired 2 [Theobroma cacao]
Length=219

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 137/206 (67%), Gaps = 17/206 (8%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T + K PV A +VVK  PGH+L+DSEAVK+FG RAKPL  +Q+L+PK++YF
Sbjct  11    AKVMKIDGETFKLKTPVRAWDVVKDYPGHVLLDSEAVKHFGIRAKPLEPQQDLKPKKIYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG-----  660
             LV   LP   E   PRRVRS GIHMSA+ RLE LML+R +SVSD+S ++   S G     
Sbjct  71    LV--ELPKFPEEKAPRRVRSGGIHMSAKDRLECLMLSR-RSVSDLSMVRPSSSLGSDGLG  127

Query  659   ---GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAA-VLNKSTRSRPTA  492
                GG+ +K+RLPK+++ KL+++S+D  G EVAEKI+ L + N       N+     P  
Sbjct  128   RSSGGMTVKMRLPKSQMAKLVEESRD--GVEVAEKILDLYVENAGGGDTDNQMHLEAPWK  185

Query  491   PIPGIIKKDLKSS-QKRVGFREIQQE  417
             P  G I ++ K+  +KRV F  I QE
Sbjct  186   PGLGSIGENFKAKREKRVSF--IPQE  209



>ref|XP_002305871.1| hypothetical protein POPTR_0004s08660g [Populus trichocarpa]
 gb|EEE86382.1| hypothetical protein POPTR_0004s08660g [Populus trichocarpa]
Length=216

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 96/206 (47%), Positives = 133/206 (65%), Gaps = 10/206 (5%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM V+G+T + K P  AGEVVK  PG++L+DSEAVK+FG RAKPL  +QEL+ K++YF
Sbjct  11    AKVMLVNGETFKLKTPARAGEVVKDYPGYVLLDSEAVKHFGIRAKPLEPQQELKAKKIYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPES----GGG  657
             L+  P  P+E+     R   S IHMSA+ RLE+LML R +SVSD+S ++   S    G  
Sbjct  71    LIELPQIPEEKDPRSTRRVRSAIHMSAKERLENLMLTR-RSVSDLSMVRPSSSQTSDGRE  129

Query  656   GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAPIPGI  477
              V++K+RLPKA+V+KL+++S+D    EVAEK++ L MGN+         R     P  G 
Sbjct  130   PVQVKVRLPKAQVQKLVEESQD--EVEVAEKLIDLYMGNSGGINGTDGHRHVHWKPELGN  187

Query  476   IKKDLKSS-QKRVGFREIQQEAEA*L  402
             I +  K++ +KRV F   Q+E E  L
Sbjct  188   ISESFKATNEKRVSF--AQEEGETRL  211



>ref|XP_007163405.1| hypothetical protein PHAVU_001G232100g [Phaseolus vulgaris]
 gb|ESW35399.1| hypothetical protein PHAVU_001G232100g [Phaseolus vulgaris]
Length=218

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 136/199 (68%), Gaps = 15/199 (8%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T + K P  A +VVK  PGH+L+DS AVKNFG RAKPL    EL+P+++YF
Sbjct  10    AKVMKIDGETFKLKTPATANDVVKDYPGHVLLDSHAVKNFGPRAKPLEPHHELRPRKLYF  69

Query  824   LVAeplppqeervvprrvRSSGIH-MSAEARLESLMLARSKSVSDISFMKS---PESGGG  657
             LV   LP      + RRVRSSGI  M+A+ RL+ LML++ +SVSD++ +K+   P+S  G
Sbjct  70    LV--ELPKVRPEPLTRRVRSSGIRGMNAKDRLDFLMLSK-RSVSDLAVVKNRPGPDS-SG  125

Query  656   GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAPIPGI  477
               R+++R+PKA++E+L+++S D  GGEVAEKI+ L MGNN AAV   +T       +   
Sbjct  126   PTRVRMRVPKAQLERLMEESHD--GGEVAEKILSLYMGNNAAAVDGGATVVEAEKEL---  180

Query  476   IKKDLKSSQKRVGFREIQQ  420
               ++ KS +KRV F  ++Q
Sbjct  181   --RNRKSQRKRVSFSPVEQ  197



>ref|XP_004490863.1| PREDICTED: uncharacterized protein At1g66480-like [Cicer arietinum]
Length=210

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 122/162 (75%), Gaps = 8/162 (5%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T + KIP  A +VVK  P H+L+DS+AVK+FG RA+PL   QEL+PK++YF
Sbjct  11    AKVMKIDGETFKVKIPSTANDVVKDYPNHVLLDSQAVKHFGLRARPLEPNQELKPKKIYF  70

Query  824   LV--AeplppqeervvprrvRSSGIH-MSAEARLESLMLARSKSVSDISFMKSPES--GG  660
             LV   +  P +E+  +PRRVRSSGI  M+A+ RLE LML++ +SVSD++ +K P +    
Sbjct  71    LVDLPKVQPEEEKTALPRRVRSSGIRTMNAKERLELLMLSK-RSVSDLTLVKQPPNLDLD  129

Query  659   GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN  534
             G +R+KLRLPKA++EKL+++S D  G +VAEKIM L MG NN
Sbjct  130   GPMRVKLRLPKAQLEKLMEESND--GSQVAEKIMSLYMGTNN  169



>ref|XP_008243347.1| PREDICTED: uncharacterized protein At1g66480-like [Prunus mume]
Length=238

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 134/219 (61%), Gaps = 32/219 (15%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++ G+T + K PV AGEVVK  PGH+L+ SE VK+FG RAKPL   Q L+P+ +YF
Sbjct  11    AKVMQISGETFKLKTPVQAGEVVKNYPGHVLLKSEEVKHFGVRAKPLEPYQNLEPRGIYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG-----  660
             LV  P     +  VPRRVR SGI+MSA+ RLESLML+R +SVSD+S MKS  +       
Sbjct  71    LVELPKVELPKERVPRRVR-SGINMSAKDRLESLMLSR-RSVSDLSVMKSSSAASGNSIV  128

Query  659   ---------GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAA-------  528
                      G VR+++RLPK +VEKL+KQS+D    E A++I+ LC+ NNN+        
Sbjct  129   PDEEAREIDGAVRVRMRLPKVQVEKLMKQSRD--EAEAAQRIVDLCLVNNNSGGQRASEK  186

Query  527   -------VLNKSTRSRPTAPIPGIIKKDLKSSQKRVGFR  432
                     LN+ T  +  A    +  + ++S +KRV FR
Sbjct  187   TNGNGGFGLNQQTHWKDGAHGGLLGSQGIRSREKRVSFR  225



>ref|XP_003616384.1| hypothetical protein MTR_5g079610 [Medicago truncatula]
 gb|AES99342.1| plastid movement impaired protein [Medicago truncatula]
Length=211

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 135/205 (66%), Gaps = 22/205 (11%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AK+M++DG+T + K P  + EVVK  P H+L+DS+AVK+FG RAKPL   QEL+PK++YF
Sbjct  11    AKIMKIDGETFKVKTPTTSNEVVKNYPNHVLLDSQAVKHFGLRAKPLEPNQELKPKKIYF  70

Query  824   LV--AeplppqeervvprrvRSSGI-HMSAEARLESLMLARSKSVSDISFMKSPESGG--  660
             LV   +  P  E+  +PRRVRSSGI ++ A+ RLE LML++ +SVSDIS +K P + G  
Sbjct  71    LVDLPKIEPENEKTSLPRRVRSSGIRNVDAKGRLELLMLSK-RSVSDISLVKPPSNLGFD  129

Query  659   ----GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTA  492
                 G +R+K+RLPKA++EKL+++S D  G EVAEKIM L MG    A  + S       
Sbjct  130   RPFDGSMRVKMRLPKAQLEKLMEESND--GSEVAEKIMSLYMGGGGDAAEHDSD------  181

Query  491   PIPGIIKKDLKSSQKRVGFREIQQE  417
                 +++++ K   KRV F  ++ E
Sbjct  182   ----VLRQNRKPRGKRVSFSPMEIE  202



>ref|XP_010105767.1| hypothetical protein L484_009963 [Morus notabilis]
 gb|EXC06052.1| hypothetical protein L484_009963 [Morus notabilis]
Length=226

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 119/174 (68%), Gaps = 16/174 (9%)
 Frame = -2

Query  995  MRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFLVA  816
            M++ G+  + + P+ AGEVVK  PGH+L++SEAVK++G RA+PL   QEL+PKR+YFLV 
Sbjct  1    MKITGEEFKLRTPIQAGEVVKDYPGHVLLESEAVKHYGTRARPLEPNQELKPKRLYFLVE  60

Query  815  eplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK---------SPESG  663
                P+  +    R   SGI+MSA+ RLESLMLAR +SVSD+S MK         + E+G
Sbjct  61   ---LPKVTKEKNPRRVRSGINMSAKDRLESLMLAR-RSVSDLSIMKPMSVLPEESTSENG  116

Query  662  GG-GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRS  504
            GG GVR+++RLP+AEVE+L+K+S+D    E AEKI+ LC+  N     +++  S
Sbjct  117  GGSGVRVRMRLPRAEVERLMKESRD--EAEAAEKIVDLCLVKNGGVYNDENINS  168



>ref|XP_010032667.1| PREDICTED: uncharacterized protein At1g66480-like [Eucalyptus 
grandis]
Length=227

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 119/163 (73%), Gaps = 9/163 (6%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM+++G T +   PV AG+VVK  PGH+L+DSEAVK+FG RAKPL  +QEL+PKRVYF
Sbjct  11    AKVMKINGDTFKLNTPVRAGDVVKDYPGHVLMDSEAVKHFGIRAKPLEPQQELKPKRVYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS------PESG  663
             LV  P  P+E+  VPRRVRS+GI MSA+ RLE LML+R ++ SD++  +S      P  G
Sbjct  71    LVELPKFPEEDDKVPRRVRSTGIRMSAKDRLECLMLSR-RAASDLALARSEGDGGLPRRG  129

Query  662   GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN  534
              G + +K+RL +AE+ KL+++S+D    EVAE+IM +C G+ N
Sbjct  130   EGPLTVKMRLTRAEMAKLVEESRD--EKEVAERIMGMCHGDRN  170



>ref|XP_004498324.1| PREDICTED: uncharacterized protein At1g66480-like [Cicer arietinum]
Length=210

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 113/166 (68%), Gaps = 17/166 (10%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K P+  GEV+K +PG +L++SE VK++G RAKPL + ++L+PKR+Y
Sbjct  10    TTKVMKIDGETFKLKTPIKVGEVLKDHPGLVLLESEEVKHYGIRAKPLESHKDLKPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESG-----  663
             FLV  P   +  R V      S I++SA+ RLE+L LAR +S SD+S MKS  SG     
Sbjct  70    FLVELPKESRVTRRVR-----SVINVSAKDRLENLSLAR-RSASDLSIMKSM-SGLEGRE  122

Query  662   ---GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN  534
                 G VRLK+RLPKAEVEKL++ SKD   GE AEKIM LCM N N
Sbjct  123   VMENGAVRLKMRLPKAEVEKLMQSSKD--EGEAAEKIMSLCMANGN  166



>ref|XP_011070637.1| PREDICTED: uncharacterized protein At1g66480-like [Sesamum indicum]
Length=206

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 123/197 (62%), Gaps = 12/197 (6%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM+++G+T + K PV  G VV  +PGH+L+DSEAV+++G RAKPL   QEL+P+R+YF
Sbjct  11    AKVMKINGETFKLKTPVRVGSVVGNHPGHVLLDSEAVRHYGVRAKPLEPHQELKPRRLYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLM--LARSKSVSDISFMKSPESGGGGV  651
             LV     P+       R   SGIHMSA+ RL S M  +A    +  +        GGGGV
Sbjct  71    LV---QLPKSPEQKRPRRVRSGIHMSAKDRLASPMAEVAAQALLQGVFGGGGGGGGGGGV  127

Query  650   RLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAPIPGIIK  471
             R+++RLPKAEVE+L+ +SKD  G EVAEKI+ LCM    AA  N   +        G+++
Sbjct  128   RVRMRLPKAEVERLMAESKD--GAEVAEKIVSLCMAGGGAAEQNVHWQGD-----RGLVE  180

Query  470   KDLKSSQKRVGFREIQQ  420
              D KS QKRVGF  I +
Sbjct  181   PDPKSRQKRVGFLPINE  197



>ref|XP_007227565.1| hypothetical protein PRUPE_ppa010741mg [Prunus persica]
 gb|EMJ28764.1| hypothetical protein PRUPE_ppa010741mg [Prunus persica]
Length=238

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 101/219 (46%), Positives = 135/219 (62%), Gaps = 32/219 (15%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++ G+T + K PV AGEVVK  PGH+L+ SE VK+FG RAKPL   Q L+P+ +YF
Sbjct  11    AKVMQISGETFKLKTPVQAGEVVKNYPGHVLLKSEEVKHFGVRAKPLEPYQNLEPRGIYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS----------  675
             LV  P     +  VPRRVR SGI+MSA+ RLESLML+R +SVSD+S MKS          
Sbjct  71    LVELPKVELPKERVPRRVR-SGINMSAKDRLESLMLSR-RSVSDLSVMKSSSAASANSIV  128

Query  674   PESGG----GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAA-------  528
             PE       G VR+++RLPK +VEKL+KQS+D    E A++I+ LC+ NNN+        
Sbjct  129   PEEEAREIDGAVRVRMRLPKVQVEKLMKQSRD--EAEAAQRIVDLCLVNNNSGGQKASEK  186

Query  527   -------VLNKSTRSRPTAPIPGIIKKDLKSSQKRVGFR  432
                     LN+ T  +  A    +  + ++S +KRV FR
Sbjct  187   TNGNGGFGLNQQTHWKDGAHGRLLGSQGIRSREKRVSFR  225



>ref|XP_006357781.1| PREDICTED: uncharacterized protein At1g66480-like [Solanum tuberosum]
Length=162

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 106/159 (67%), Gaps = 8/159 (5%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
              KVM+++G+  + K P+   EVVK  PGH+L++SEAVK FG RAKPL AEQEL+P ++YF
Sbjct  9     TKVMKINGEILKLKTPITTSEVVKDYPGHVLLESEAVKKFGIRAKPLEAEQELKPCKIYF  68

Query  824   LVAe---plppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGG  654
             LV     P           R   S +HM+A+ RLE LML+R +S SD+S  K   S G  
Sbjct  69    LVELPLFPKQEITSNNKVTRRVKSDVHMNAQDRLECLMLSR-RSASDLSISKP--SNGAV  125

Query  653   VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
             V+LK++LP++ V+KLI++S+D    EVAEKIM LCM N+
Sbjct  126   VQLKMKLPRSVVQKLIEESRD--ETEVAEKIMDLCMHNS  162



>ref|XP_009357803.1| PREDICTED: uncharacterized protein At1g66480 [Pyrus x bretschneideri]
Length=230

 Score =   141 bits (355),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 97/210 (46%), Positives = 130/210 (62%), Gaps = 25/210 (12%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM+V+G+  + K PV AGEVVK  PGH+L+ S  VK+FG RAKPL   ++L+P R+Y 
Sbjct  11    AKVMQVNGEAFKLKTPVQAGEVVKDFPGHVLLKSSEVKHFGVRAKPLEPYEQLEPNRLYL  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP---------  672
             LV  P    ++  + RRVR SGI+MSA+ RLESLML+R +SVS +S MKS          
Sbjct  71    LVELPKVDLKKETLQRRVR-SGINMSAKDRLESLMLSR-RSVSGLSVMKSSASTASIVPE  128

Query  671   ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM-------GNNNAAVLNKS  513
             E   G VR+++RLP+A+VEKL++QS+D   GE A++IM LCM       GN+    LN  
Sbjct  129   EEANGAVRVRMRLPRADVEKLMRQSRD--DGEAAQQIMDLCMVNTNNVKGNDQGLSLNPQ  186

Query  512   TRSRPTAPI---PGIIKKDLKSSQKRVGFR  432
                +    +    GI  +D    QKRV FR
Sbjct  187   MHWKDGGRLLGSQGIKGRD--RIQKRVSFR  214



>ref|XP_002526007.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF36347.1| conserved hypothetical protein [Ricinus communis]
Length=223

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 115/176 (65%), Gaps = 21/176 (12%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++ G+T + K PV AGEVV+  PGH+L++SEAVK++G RAKPL   Q+L  KR+Y
Sbjct  10    TVKVMKITGETFKLKTPVKAGEVVRDYPGHVLLESEAVKHYGTRAKPLEQHQDLVAKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS---------  675
             FLV  P PP E+     R   SGI MSA+ RLE+LMLAR +SVSD++ MK+         
Sbjct  70    FLVELPKPPTEKVPRRVR---SGIQMSAKDRLENLMLAR-RSVSDLTIMKNSACSSSGIA  125

Query  674   ------PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAV  525
                    +S G   R+K+RLPK+EVEKL+K+SKD    EVA K+M LC+ N+   +
Sbjct  126   PDQENETDSNGSITRVKMRLPKSEVEKLMKESKD--DAEVAAKLMDLCISNDKEKI  179



>ref|XP_004505259.1| PREDICTED: uncharacterized protein At1g66480-like [Cicer arietinum]
Length=209

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 119/213 (56%), Gaps = 39/213 (18%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K P+  GEV+K +PG +L+DSEAVK++G RAKPL A +ELQPKR+Y
Sbjct  10    TTKVMKIDGETLKLKTPIRVGEVLKDHPGLVLLDSEAVKHYGVRAKPLEAHKELQPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP--------  672
             FLV         + +  R   SGI+MSA+ RL++LML R +S SD+S MK          
Sbjct  70    FLVE------LPKEIKPRRVRSGINMSAKDRLDNLMLTR-RSTSDLSIMKQSKRDDNDND  122

Query  671   ---------ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLN  519
                      E+  GGVRLK+RLP++EVEKLI+  KD    E A +IM     N N    N
Sbjct  123   NDDDEKHGEENINGGVRLKVRLPRSEVEKLIRDCKD--EAEAAHRIMSFYKTNENTQNQN  180

Query  518   KSTRSRPTAPIPGIIKKDLKSSQKRVGFREIQQ  420
             +             +K      +KRV F  I +
Sbjct  181   Q-------------VKDTTTRREKRVSFMPINE  200



>ref|XP_006448285.1| hypothetical protein CICLE_v10016683mg [Citrus clementina]
 ref|XP_006495050.1| PREDICTED: uncharacterized protein At1g66480-like [Citrus sinensis]
 gb|ESR61525.1| hypothetical protein CICLE_v10016683mg [Citrus clementina]
Length=212

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 112/163 (69%), Gaps = 15/163 (9%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++ G+T + K PV AGEVVK  PGH+L++SE+VK++G RAKPL AEQ L+ KR+Y
Sbjct  14    TTKVMKITGETFKIKTPVKAGEVVKDYPGHVLLESESVKHYGVRAKPLGAEQNLEAKRLY  73

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS--------P  672
             FLV   LP    + +  R   SGI+MSA+ RLESL L+R +SVSD+S +K         P
Sbjct  74    FLV--ELPDVARKEIVPRRVRSGINMSAKDRLESLKLSR-RSVSDLSILKPVSSSSSSLP  130

Query  671   ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMG  543
             E   G +RLKL+LPKAEVEKL+++S +    E+AEKI  LCM 
Sbjct  131   ED--GAMRLKLKLPKAEVEKLMRESNN--DAEIAEKIRELCMA  169



>ref|XP_010502111.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=212

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 122/199 (61%), Gaps = 17/199 (9%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               K+M++DG++ + + PV A EV+K  PGH+++DSE+VK++G R+KPL A+Q LQ KR+Y
Sbjct  10    TTKIMKIDGESFKLRTPVTAEEVLKDFPGHVVLDSESVKHYGARSKPLEAKQRLQAKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK--------SP  672
             F+V      +  +  P R   SGIH+SA+ RLESLMLAR +S SD+S ++        + 
Sbjct  70    FVV------EPVKECPPRRVRSGIHVSAKERLESLMLAR-RSSSDLSILRPAGGWTTTTS  122

Query  671   ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTA  492
             E  GG VR+K+R+PKAE+E+L+K+       E  +KI  L M   N      +T   P A
Sbjct  123   EEEGGAVRVKVRVPKAELERLVKEG--ATEAEATQKIAALFMAKQNHQEPPHNTEEEPAA  180

Query  491   PIPGIIKKDLKSSQKRVGF  435
              +     +++KS  KRV F
Sbjct  181   SVSAATTREVKSRLKRVSF  199



>ref|XP_006293056.1| hypothetical protein CARUB_v10019343mg [Capsella rubella]
 gb|EOA25954.1| hypothetical protein CARUB_v10019343mg [Capsella rubella]
Length=207

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 88/195 (45%), Positives = 121/195 (62%), Gaps = 14/195 (7%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K PV A EV+K  PGH+++DSE+VK++G RAKPL A+Q L+ KR+Y
Sbjct  11    TTKVMKIDGETFKLKNPVTAEEVLKDFPGHVVLDSESVKHYGARAKPLEAKQRLEAKRLY  70

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK----SPESGG  660
             F+V      +  +  P R   SGIH+SA+ RLESLMLAR +S SD+S +K      E  G
Sbjct  71    FVV------EPVKECPPRRVRSGIHVSAKERLESLMLAR-RSSSDLSILKPAGGWTEEEG  123

Query  659   GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAPIPG  480
             G VR+K+R+PKAE+E+LIK+       E  +KI  L M   N      +TR     P P 
Sbjct  124   GAVRVKVRVPKAELERLIKEG--ATEAEATQKIAALFMAKQNHQEPPHNTRGEALDPSPA  181

Query  479   IIKKDLKSSQKRVGF  435
                +++KS  KRV F
Sbjct  182   AT-REVKSRLKRVSF  195



>ref|XP_007045105.1| Encodes a protein whose expression is responsive to nematode 
infection, putative [Theobroma cacao]
 gb|EOY00937.1| Encodes a protein whose expression is responsive to nematode 
infection, putative [Theobroma cacao]
Length=227

 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 114/167 (68%), Gaps = 16/167 (10%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM+++G+T + K PV A EVVK  PGH+L++SE+VK+FG RAKPL + Q L+PKR+Y
Sbjct  10    TTKVMKINGETFKLKTPVKAEEVVKDYPGHVLLESESVKHFGIRAKPLQSHQSLEPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK----------  678
             FLV  P  P+E      R   SGI+MSA+ RLESLML+R +SVSD++ MK          
Sbjct  70    FLVELPEAPKEIVTRRVR---SGINMSAKDRLESLMLSR-RSVSDLTLMKPKCVIPEESE  125

Query  677   SPESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
                S  G +R+K+RLP+AEVE+L+K+S +    E AEKIM+LC+ N 
Sbjct  126   EEGSESGAMRVKMRLPRAEVERLMKESNN--EAEAAEKIMQLCVANT  170



>ref|XP_006582842.1| PREDICTED: uncharacterized protein LOC100306423 isoform X1 [Glycine 
max]
 gb|KHN43039.1| Hypothetical protein glysoja_007569 [Glycine soja]
Length=210

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 111/162 (69%), Gaps = 15/162 (9%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K PV   EV+K +PG +L+DSEAVK++G RAKPL A +ELQPKR+Y
Sbjct  10    TTKVMKIDGETFKLKTPVKVREVLKDHPGLVLLDSEAVKHYGVRAKPLEAHKELQPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP------ES  666
             FLV      +  +    R   SGI+MSA+ RLESL+L R +S SD+S MK        E+
Sbjct  70    FLV------ELPKETKPRRVRSGINMSAKDRLESLVLTR-RSASDLSIMKQSNNMDNNEN  122

Query  665   GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
              GGGVRLK+RLPKAEVEKLI+  KD    E AE+IM+L M N
Sbjct  123   NGGGVRLKMRLPKAEVEKLIQGCKD--EAEAAERIMKLYMAN  162



>ref|NP_001236455.1| uncharacterized protein LOC547691 [Glycine max]
 gb|AAG38147.1| unknown [Glycine max]
Length=207

 Score =   138 bits (347),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 127/203 (63%), Gaps = 25/203 (12%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K P+   +V+K +PG +L++SEAVK++G RAKPL A +EL PKR Y
Sbjct  10    TTKVMKIDGETFKLKTPIKVCDVLKNHPGLVLLESEAVKHYGIRAKPLEAHKELMPKRFY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK-----SPESG  663
             FLV       +E  V  R   SGI+MSA+ RLESL+LAR +S SD++ MK     SP + 
Sbjct  70    FLV----ELPKEATVAPRRVRSGINMSAKDRLESLVLAR-RSASDLTIMKPACRVSP-AE  123

Query  662   GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM---GNNNAAVLN-KSTRSRPT  495
              GG+RLK+RLPKAEVE+L++  +     E AEKIM LCM   GN N  V + K  R+R  
Sbjct  124   NGGLRLKMRLPKAEVERLMRGCET--EAEAAEKIMGLCMVNGGNGNGEVKHWKGVRARAG  181

Query  494   APIPGIIKKDLKSSQKRVGFREI  426
                     +  K+ +KRV F  I
Sbjct  182   --------ESTKAREKRVSFMPI  196



>gb|KHN04248.1| Hypothetical protein glysoja_049449 [Glycine soja]
Length=200

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 117/176 (66%), Gaps = 14/176 (8%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K P+   +V+K +PG +L++SEAVK++G RAKPL A +EL PKR Y
Sbjct  10    TTKVMKIDGETFKLKTPIKVCDVLKNHPGLVLLESEAVKHYGIRAKPLEAHKELMPKRFY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK---SPESGGG  657
             FLV       +E  V  R   SGI+MSA+ RLESL+LAR +S SD++ MK   S  +  G
Sbjct  70    FLV----ELPKEATVAPRRVRSGINMSAKDRLESLVLAR-RSASDLTIMKPLSSEPAENG  124

Query  656   GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM---GNNNAAVLN-KSTRSR  501
             G+RLK+RLPKAEVE+L++  +     E AEKIM LCM   GN N  V + K  R+R
Sbjct  125   GLRLKMRLPKAEVERLMRGCET--EAEAAEKIMGLCMVNGGNGNGEVKHWKGVRAR  178



>ref|XP_006602004.1| PREDICTED: uncharacterized protein At1g66480-like [Glycine max]
Length=218

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 119/162 (73%), Gaps = 9/162 (6%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T +   P  A +VVK  PGH+L+DS AVKNFG RAKPL  + +L+PK++YF
Sbjct  10    AKVMKIDGETFKLNTPARANDVVKDYPGHVLLDSHAVKNFGPRAKPLEPDYQLKPKKIYF  69

Query  824   LVAeplppqeervvprrvRSSGIH-MSAEARLESLMLARSKSVSDISFMKS---PESGGG  657
             LV E    + E +V RRVRSSGI  M+A+ RL+ LML++ +SVSD++ +K    PE+ GG
Sbjct  70    LV-ELPKVKPEPLVTRRVRSSGIRGMNAQDRLDFLMLSK-RSVSDLTMVKHGPKPEN-GG  126

Query  656   GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNA  531
               R+K+RLPKA +E+L+++S D  G EVAEKI+ L MGNN A
Sbjct  127   PTRVKMRLPKAHLERLMEESHD--GSEVAEKIISLYMGNNAA  166



>ref|NP_001238620.1| uncharacterized protein LOC100306423 [Glycine max]
 gb|ACU14590.1| unknown [Glycine max]
Length=198

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 110/162 (68%), Gaps = 15/162 (9%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K PV   EV+K +PG +L+DSEAVK++G +AKPL A +ELQPKR+Y
Sbjct  10    TTKVMKIDGETFKLKTPVKVREVLKDHPGLVLLDSEAVKHYGVKAKPLEAHKELQPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP------ES  666
             FLV         +    R   SGI+MSA+ RLESL+L R +S SD+S MK        E+
Sbjct  70    FLVE------LPKETKPRRVRSGINMSAKDRLESLVLTR-RSASDLSIMKQSNNMDNNEN  122

Query  665   GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
              GGGVRLK+RLPKAEVEKLI+  KD    E AE+IM+L M N
Sbjct  123   NGGGVRLKMRLPKAEVEKLIQGCKD--EAEAAERIMKLYMAN  162



>gb|KDP38041.1| hypothetical protein JCGZ_04684 [Jatropha curcas]
Length=202

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 113/169 (67%), Gaps = 18/169 (11%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               K+M++ G+T + K PV AGEVVK  PG +L++SEAVK++G RAKPL   Q+L PKR+Y
Sbjct  10    TVKIMKITGETFKLKTPVKAGEVVKDYPGLVLLESEAVKHYGIRAKPLQPNQDLVPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG----  660
             FLV   LP      V RRVRS  I+MSA+ RLESLMLAR +S SD+S +K+  S      
Sbjct  70    FLVE--LPKSPTEKVARRVRSGPINMSAKDRLESLMLAR-RSASDLSIIKNTSSSSFVSD  126

Query  659   ---------GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
                        VR+K+RLPKAEVEKL+K+SK+    EVAEKIM L +GN
Sbjct  127   ETEKNGHEESAVRVKMRLPKAEVEKLMKESKN--EAEVAEKIMNLYVGN  173



>ref|XP_010513852.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=211

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 122/198 (62%), Gaps = 16/198 (8%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               K+M++DG++ + + PV A EV+K  PGH+++DSE+VK++G RAKPL A+Q L+ KR+Y
Sbjct  10    TTKIMKIDGESFKLRTPVTAEEVLKDFPGHVVLDSESVKHYGARAKPLEAKQRLEAKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK-------SPE  669
             F+V      +  +  P R   SGIH+SA+ RLESLMLAR +S SD+S +K       + +
Sbjct  70    FVV------EPVKECPPRRVRSGIHVSAKERLESLMLAR-RSSSDLSILKPAGGWTTTSK  122

Query  668   SGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAP  489
               G  VR+K+R+PKAE+E+L+K+       E  +KI  L M   N      +T   PTA 
Sbjct  123   EEGDAVRVKVRVPKAELERLVKEG--ATEAEATQKIAALFMAKQNHQEPPHNTEEEPTAS  180

Query  488   IPGIIKKDLKSSQKRVGF  435
             +     +++KS  KRV F
Sbjct  181   VSNAATREVKSRLKRVSF  198



>gb|AFK45330.1| unknown [Medicago truncatula]
 gb|AFP87383.1| unknown [Medicago sativa]
 gb|KEH30890.1| plastid movement impaired protein [Medicago truncatula]
Length=210

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 107/163 (66%), Gaps = 20/163 (12%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K P+ AGEV+K +PG +L+DSEAVK++G RAK + A +ELQPKR+Y
Sbjct  10    TTKVMKIDGETMKLKTPIKAGEVLKDHPGLVLLDSEAVKHYGVRAKVIEAHKELQPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP--------  672
             FLV      +  +    R   SGI MSA+ RL++L+L R +S SD+S +K          
Sbjct  70    FLV------ELPKETKPRRIRSGIQMSAKDRLDNLVLTR-RSASDLSILKQSKMNDNSGE  122

Query  671   ---ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRL  552
                +  GGGVRLK+RLPKAEVEKL++  KD    E AE IMRL
Sbjct  123   LEGKENGGGVRLKVRLPKAEVEKLMRDCKD--EAEAAEMIMRL  163



>ref|XP_002278115.1| PREDICTED: uncharacterized protein At1g66480 [Vitis vinifera]
 emb|CBI15547.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 107/158 (68%), Gaps = 10/158 (6%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM++D QT + K PV   E VK  PGH+L++SEA K+FG RAKPL  ++EL+PK++Y
Sbjct  10    TAKVMKIDSQTFKLKTPVRVWETVKDYPGHVLIESEAFKHFGIRAKPLEPQRELKPKKLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPES----GG  660
             FL+     P+       R   SGI+M+A  RL+SLML+R +SVSD+S +K   S      
Sbjct  70    FLLE---IPKHSGDRTVRRVQSGINMNAVDRLQSLMLSR-RSVSDLSTIKQTTSIRPLNC  125

Query  659   GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
             G +R++LRLPK+++ KLI++SKD    E AEKIM LCM
Sbjct  126   GAIRVQLRLPKSQLMKLIQESKD--NEEAAEKIMDLCM  161



>ref|XP_007157721.1| hypothetical protein PHAVU_002G092800g [Phaseolus vulgaris]
 gb|ESW29715.1| hypothetical protein PHAVU_002G092800g [Phaseolus vulgaris]
Length=217

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 108/167 (65%), Gaps = 20/167 (12%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K PV   EV+K +PG +L+DSEAVK++G RAKPL A +EL PKR+Y
Sbjct  10    TTKVMKIDGETFKLKTPVKVEEVLKDHPGLVLLDSEAVKHYGVRAKPLEAHKELHPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGG---  657
             FLV         + +  R   SGI+MSA+ RLE+L+L R +S SD+S MK      G   
Sbjct  70    FLVE------LPKEIKPRRVRSGINMSAKDRLENLVLTR-RSASDLSIMKQSNMSDGEQG  122

Query  656   --------GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
                     GVRLK+RLPKAEVEKLI+ SKD    E AE+I++L M N
Sbjct  123   NNKENNNGGVRLKMRLPKAEVEKLIQGSKD--QAEAAERIVKLYMAN  167



>ref|XP_004231997.1| PREDICTED: uncharacterized protein At1g66480 [Solanum lycopersicum]
Length=166

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 9/160 (6%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
              KVM+++G+  + K P+   EVVK  PGH+L++SEAVK FG RAKPL  EQEL+P ++YF
Sbjct  12    TKVMKINGEILKLKTPITTLEVVKDYPGHVLLESEAVKKFGIRAKPLEPEQELKPTKIYF  71

Query  824   LVAe----plppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGG  657
             LV                  R   S ++M+A+ RLE LML+R +S SD+S  K   S G 
Sbjct  72    LVELPLFPKEEIITSNNKVTRRVKSDVYMNAQDRLECLMLSR-RSASDLSISKP--SNGA  128

Query  656   GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
              V+LK++LP++ V+KLI++S+D    EVAEKIM LCM N+
Sbjct  129   VVQLKMKLPRSVVQKLIEESRD--ETEVAEKIMDLCMHNS  166



>ref|XP_010681969.1| PREDICTED: uncharacterized protein At1g66480 [Beta vulgaris subsp. 
vulgaris]
Length=240

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 114/177 (64%), Gaps = 17/177 (10%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AK+M+++G+T +FK P+ A EVVK  PGH++++S+AVK++G +AKPL     L+PK++Y
Sbjct  10    TAKIMKINGETMKFKTPIQAKEVVKDYPGHVVLESDAVKHYGIKAKPLDPFHNLEPKKLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFM-----------  681
             FLV  P  P + +    R   SGI MSA+ RLESLML+R +S+SDIS M           
Sbjct  70    FLVELPKFPHDHQHRVPRKVRSGIQMSAKDRLESLMLSR-RSMSDISIMGPATRVMVDGG  128

Query  680   ---KSPESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLN  519
                 S  +   G+R++++LPKAEV++L+ +S D  G  VAEKIM LC+G     V N
Sbjct  129   YHDASEGAPSSGLRVRMKLPKAEVDRLMSESTDQEG--VAEKIMDLCLGKTEQNVTN  183



>gb|KDO64706.1| hypothetical protein CISIN_1g029320mg [Citrus sinensis]
Length=195

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 110/161 (68%), Gaps = 15/161 (9%)
 Frame = -2

Query  995  MRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFLVA  816
            M++ G+T + K PV AGEVVK  PGH+L++SE+VK++G RAKPL AEQ L+ KR+YFLV 
Sbjct  1    MKITGETFKIKTPVKAGEVVKDYPGHVLLESESVKHYGVRAKPLGAEQNLEAKRLYFLV-  59

Query  815  eplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS--------PESGG  660
              LP    + +  R   SGI+MSA+ RLESL L+R +SVSD+S +K         PE   
Sbjct  60   -ELPDVARKEIVPRRVRSGINMSAKDRLESLKLSR-RSVSDLSILKPVSSSSSSLPEE--  115

Query  659  GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
            G +RLKL+LPKAEVEKL+++S +    E+AEKI  LCM   
Sbjct  116  GAMRLKLKLPKAEVEKLMRESNN--DAEIAEKIRELCMAKQ  154



>ref|XP_009629230.1| PREDICTED: uncharacterized protein At1g66480-like [Nicotiana 
tomentosiformis]
Length=165

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 108/157 (69%), Gaps = 6/157 (4%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
              KVM+++G+  + K PV   +VVK  PGH+L++SEAVK FG RAKPL  EQEL+P ++YF
Sbjct  12    TKVMKINGEILKLKTPVTTLDVVKDYPGHVLLESEAVKKFGVRAKPLEPEQELKPNKIYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGVRL  645
             LV  PL P+EE     R   S + MSA+ RLE LML R +S SD+S  K      G V+L
Sbjct  72    LVELPLFPKEEISRVPRRVKSAVQMSAKDRLECLMLTR-RSASDLSISK---PNNGPVQL  127

Query  644   KLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN  534
             K++LP++ V+KL+++S+D    EVAEKIM LCM N++
Sbjct  128   KMKLPRSLVQKLVEESRD--ETEVAEKIMDLCMPNSS  162



>ref|XP_007141885.1| hypothetical protein PHAVU_008G233900g [Phaseolus vulgaris]
 gb|ESW13879.1| hypothetical protein PHAVU_008G233900g [Phaseolus vulgaris]
Length=216

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 119/161 (74%), Gaps = 8/161 (5%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM+VDG+T + K P  A +VVK  PGH+L++SEAVK+FG RAKPL    EL+PK++YF
Sbjct  11    AKVMKVDGETLKLKTPARANDVVKDYPGHVLLESEAVKHFGLRAKPLEPHHELKPKKIYF  70

Query  824   LV--AeplppqeervvprrvRSSGIH-MSAEARLESLMLARSKSVSDISFMK-SPE-SGG  660
             LV   +  P +E+  + RRVRSSGI  M+A+ RL+ LML++ +S SD++ ++ SP  +  
Sbjct  71    LVELPKIQPEEEKTALHRRVRSSGIRGMNAKDRLDLLMLSK-RSASDLTLVRPSPNLASD  129

Query  659   GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
             G +R+K+RLPKA ++KL+++S D  G EVAEKI+ L MGNN
Sbjct  130   GPMRVKMRLPKAHLDKLMEESTD--GSEVAEKIISLYMGNN  168



>ref|XP_011006438.1| PREDICTED: uncharacterized protein At1g66480-like isoform X2 
[Populus euphratica]
Length=207

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 127/195 (65%), Gaps = 11/195 (6%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM ++G+T + K P  AGEVVK  PGH+L+DSEAVK+FG RAKPL  +QEL+  ++YF
Sbjct  11    AKVMLINGETFKLKTPARAGEVVKDYPGHVLLDSEAVKHFGIRAKPLEPQQELKANKIYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPES----GGG  657
             L+  P  P+E+     R   S IH+ A+ RLE+LML+R +SVSD+S ++   +    G  
Sbjct  71    LIELPEIPEEKDPRRVR---SAIHIGAKERLENLMLSR-RSVSDMSMVRPSSTQTSDGRQ  126

Query  656   GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAPIPGI  477
              V++K+RLP+A+V+KL+++S+D    EVAEK++ L MGN+         R     P   I
Sbjct  127   PVQVKVRLPRAQVQKLVEESQD--EVEVAEKLIDLYMGNSGGINGTDGHRHVHWKPELSI  184

Query  476   IKKDLKSS-QKRVGF  435
             I +  K++ +KRV F
Sbjct  185   ITESFKATNEKRVSF  199



>ref|XP_009794002.1| PREDICTED: uncharacterized protein At1g66480-like [Nicotiana 
sylvestris]
Length=223

 Score =   135 bits (340),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 107/157 (68%), Gaps = 6/157 (4%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
              KVM+++G+  + K PV   +VVK  PGH+L++SEA K FG RAKPL  EQEL+P ++YF
Sbjct  70    TKVMKINGEILKLKTPVTTSDVVKDYPGHVLLESEAAKKFGVRAKPLEPEQELKPNKIYF  129

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGVRL  645
             LV  PL P+EE     R   S + MSA+ RLE LML R +S SD+S +K      G ++L
Sbjct  130   LVELPLFPKEENRRVPRRVKSAVQMSAKDRLECLMLTR-RSASDLSILK---PNNGPIQL  185

Query  644   KLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN  534
             K++LP+  V+KL+++S+D    EVAEKIM LCM N++
Sbjct  186   KMKLPRTLVQKLVEESRD--ETEVAEKIMDLCMPNSS  220



>ref|XP_011006437.1| PREDICTED: uncharacterized protein At1g66480-like isoform X1 
[Populus euphratica]
Length=211

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 124/199 (62%), Gaps = 15/199 (8%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM ++G+T + K P  AGEVVK  PGH+L+DSEAVK+FG RAKPL  +QEL+  ++YF
Sbjct  11    AKVMLINGETFKLKTPARAGEVVKDYPGHVLLDSEAVKHFGIRAKPLEPQQELKANKIYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPES----GGG  657
             L+     P+       R   S IH+ A+ RLE+LML+R +SVSD+S ++   +    G  
Sbjct  71    LI---ELPEIPEEKDPRRVRSAIHIGAKERLENLMLSR-RSVSDMSMVRPSSTQTSDGRQ  126

Query  656   GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAPIPGI  477
              V++K+RLP+A+V+KL+++S+D    EVAEK++ L MGN+         R     P   I
Sbjct  127   PVQVKVRLPRAQVQKLVEESQD--EVEVAEKLIDLYMGNSGGINGTDGHRHVHWKPELSI  184

Query  476   IKKDLKSS-----QKRVGF  435
             I +  K++     QKRV F
Sbjct  185   ITESFKATNETNVQKRVSF  203



>ref|XP_004297360.1| PREDICTED: uncharacterized protein At1g66480-like isoform 2 [Fragaria 
vesca subsp. vesca]
Length=209

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 124/204 (61%), Gaps = 20/204 (10%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++ G+T + K PV AG+V+K  PGH+L+ S+ VK+ G RA+PL   Q L+ K VYF
Sbjct  11    AKVMQISGETLKLKTPVQAGQVMKNYPGHVLLKSQEVKHLGIRARPLEPHQHLEAKGVYF  70

Query  824   LVA--eplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS-PESG--G  660
             LV   +            R   SGI+M+A+ RLESLML+R +SVSD+S M+S PE     
Sbjct  71    LVELPKAAAAHSFSDKVPRRVRSGINMTAKDRLESLMLSR-RSVSDLSMMRSIPEKSHQD  129

Query  659   GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN--AAVLNKSTRSRPTAPI  486
             G VR+++RLPKA+VE L++QS++    E AEKI+ LCM N N       K    +     
Sbjct  130   GPVRVRMRLPKAQVEMLMQQSRN--EEEAAEKIVDLCMVNANIGGEFNEKDGHGK-----  182

Query  485   PGIIKKDLKSSQKRVGFR---EIQ  423
               ++K+  K  +KRV FR   EIQ
Sbjct  183   --VVKQATKMREKRVSFRNEGEIQ  204



>ref|XP_007216442.1| hypothetical protein PRUPE_ppa021996mg, partial [Prunus persica]
 gb|EMJ17641.1| hypothetical protein PRUPE_ppa021996mg, partial [Prunus persica]
Length=166

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 113/157 (72%), Gaps = 5/157 (3%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++ G+T + K P+ A +VVK  PGH+L++SEAVK+FG RAKPL  +Q+L+PK++YF
Sbjct  11    AKVMKISGETFKVKTPIRARDVVKDYPGHVLLNSEAVKHFGVRAKPLEPQQDLRPKKIYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGG-VR  648
             LV +     EE     R   SGI +SA+ RLE LML+R +SVSD++ +++  +G  G VR
Sbjct  71    LV-QLPKFPEEEKQVPRRVRSGIQVSAKDRLECLMLSR-RSVSDLTSVRAASAGSEGPVR  128

Query  647   LKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
             +K+R+P+A++ KL+++S D    E+AE+I+ L M NN
Sbjct  129   MKVRVPRAQMVKLVEESND--DAEIAERIIELYMANN  163



>ref|XP_006482147.1| PREDICTED: uncharacterized protein At1g66480-like [Citrus sinensis]
Length=225

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 129/212 (61%), Gaps = 21/212 (10%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T + K P+ A EVVK  PG++L+DSEAVK+FG RAKPL   Q+L+PK+VYF
Sbjct  11    AKVMKIDGETIKLKTPIQASEVVKDYPGYVLLDSEAVKHFGIRAKPLEPRQQLKPKKVYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPES-------  666
             LV   LP   +     R   SGI MSA+ RLE LML+R ++VSD++ +    S       
Sbjct  71    LV--ELPKLPDEEKITRRVRSGIQMSAKDRLECLMLSR-RAVSDLTAVNVRSSHGSEVAR  127

Query  665   --GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRS---R  501
               G G +R+K+RLP+A+VEKL+++S     GEVAEKI+ L +  +          S   R
Sbjct  128   GPGTGQMRVKMRLPRAQVEKLMEES--ANDGEVAEKIVDLYVEKSGGGGGGGRCYSGELR  185

Query  500   PTAPIP---GIIKKDLKSSQ-KRVGFREIQQE  417
             P        G +++D K+ + KRV F   ++E
Sbjct  186   PEEEWKAGQGGVRRDFKARENKRVSFVPTEEE  217



>ref|XP_003544245.1| PREDICTED: uncharacterized protein At1g66480-like [Glycine max]
Length=214

 Score =   133 bits (335),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 117/161 (73%), Gaps = 8/161 (5%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
              KVM+VDG+T + K P  A +VVK  PGH+L+DSEAVK+FG RAKPL   QEL+PK++YF
Sbjct  11    TKVMKVDGETFKLKTPARANDVVKDYPGHVLLDSEAVKHFGLRAKPLEPYQELKPKKIYF  70

Query  824   LVA--eplppqeervvprrvRSSGIH-MSAEARLESLMLARSKSVSDISFMKS-PESGGG  657
             LV   +  P +E+  +PRRVRSSGI  M+A  RLE LML++ +SVSD+   +  P+ G  
Sbjct  71    LVELPKIQPEEEKTALPRRVRSSGIRGMNASDRLELLMLSK-RSVSDLPLARQGPKMGSD  129

Query  656   G-VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
             G +R+K+RLPKA ++KL+++S D  G EVAEKIM L +G N
Sbjct  130   GPMRVKMRLPKAHLDKLMEESTD--GSEVAEKIMSLYVGTN  168



>ref|XP_003519341.1| PREDICTED: uncharacterized protein At1g66480-like [Glycine max]
 gb|KHN41087.1| Hypothetical protein glysoja_013429 [Glycine soja]
Length=214

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 85/161 (53%), Positives = 117/161 (73%), Gaps = 8/161 (5%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM+VDG+T + K P  A +VVK  PGH+L+DSEAVK+FG RAKPL   QEL+P ++YF
Sbjct  11    AKVMKVDGETLKLKTPARANDVVKDYPGHVLLDSEAVKHFGLRAKPLEPYQELKPTKIYF  70

Query  824   LV--AeplppqeervvprrvRSSGIH-MSAEARLESLMLARSKSVSDISFMK-SPESGGG  657
             LV   +  P +E+  +PRRVRSSGI  M+A  RL+ LML++ +SVSD+   + SP  G  
Sbjct  71    LVELPKIQPEEEKTALPRRVRSSGIRGMNASDRLQLLMLSK-RSVSDLPLSRQSPNLGSD  129

Query  656   G-VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
             G +R+K+RLPKA ++KL+++S D  G +VA+KI+ L MG N
Sbjct  130   GPIRVKMRLPKAHLDKLMEESTD--GSQVAQKIISLYMGTN  168



>ref|XP_010424880.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=211

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 122/199 (61%), Gaps = 18/199 (9%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               K+M++DG++ + K PV A EV+K  PGH+++DSE+VK++G RAKPL  +Q LQ KR+Y
Sbjct  10    TTKIMKIDGESFKLKTPVTAEEVLKDFPGHVVLDSESVKHYGARAKPLEGKQRLQAKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK-------SPE  669
             F+V      +  +  P R   SGIH+SA+ RLESLMLAR +S SD+S +K       + E
Sbjct  70    FVV------EPVKDCPPRRVRSGIHVSAKERLESLMLAR-RSSSDLSILKPAEGWTTTSE  122

Query  668   SGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAP  489
               GG VR+K+R+PKAE+E+L+++       E  +KI  L M   N      +T   PTA 
Sbjct  123   EEGGAVRVKVRVPKAELERLVREG--ATEAEATQKIAALFMAKQNHQEPPHNT-EEPTAT  179

Query  488   IP-GIIKKDLKSSQKRVGF  435
             +      +++KS  +RV F
Sbjct  180   VSNAATTREVKSRLRRVSF  198



>ref|XP_006430644.1| hypothetical protein CICLE_v10012690mg [Citrus clementina]
 gb|ESR43884.1| hypothetical protein CICLE_v10012690mg [Citrus clementina]
Length=223

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 126/204 (62%), Gaps = 19/204 (9%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T + K P+ A EVVK  PG++L+DSEAVK+FG RAKPL   Q+L+PK+VYF
Sbjct  11    AKVMKIDGETIKLKTPIQASEVVKDYPGYVLLDSEAVKHFGIRAKPLEPRQQLKPKKVYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK---------SP  672
             LV   LP   +     R   SGI MSA+ RLE LML+R ++VSD++ +          +P
Sbjct  71    LVE--LPKLPDEEKITRRVRSGIQMSAKDRLECLMLSR-RAVSDLTAVNVRSSHGSEVAP  127

Query  671   ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLN-KSTRSRPT  495
               G G +R+K+RLP+A+VEKL+++S      EVAEKI+ L +  +        S   RP 
Sbjct  128   GPGTGQMRVKMRLPRAQVEKLMEES--ANDEEVAEKIVDLYVEKSGGGGGRCYSGELRPE  185

Query  494   API---PGIIKKDLKSSQ-KRVGF  435
                    G +++D K+ + KRV F
Sbjct  186   EEWKAGQGGVRRDFKARENKRVSF  209



>ref|XP_004297359.1| PREDICTED: uncharacterized protein At1g66480-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=230

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 79/162 (49%), Positives = 108/162 (67%), Gaps = 8/162 (5%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++ G+T + K PV AG+V+K  PGH+L+ S+ VK+ G RA+PL   Q L+ K VYF
Sbjct  11    AKVMQISGETLKLKTPVQAGQVMKNYPGHVLLKSQEVKHLGIRARPLEPHQHLEAKGVYF  70

Query  824   LVAeplppqeervvprr--vRSSGIHMSAEARLESLMLARSKSVSDISFMKS-PESG--G  660
             LV  P          +      SGI+M+A+ RLESLML+R +SVSD+S M+S PE     
Sbjct  71    LVELPKAAAAHSFSDKVPRRVRSGINMTAKDRLESLMLSR-RSVSDLSMMRSIPEKSHQD  129

Query  659   GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN  534
             G VR+++RLPKA+VE L++QS++    E AEKI+ LCM N N
Sbjct  130   GPVRVRMRLPKAQVEMLMQQSRN--EEEAAEKIVDLCMVNAN  169



>ref|XP_009129247.1| PREDICTED: uncharacterized protein At1g66480-like [Brassica rapa]
Length=267

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 88/208 (42%), Positives = 125/208 (60%), Gaps = 26/208 (13%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K PV A EV+K  PGH+L++SE+VK++G RAKPL  +Q L+ KR+Y
Sbjct  57    TTKVMKIDGETFKLKTPVTAEEVLKDFPGHVLLESESVKHYGARAKPLEMKQMLEAKRLY  116

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFM-------KSPE  669
             F+V      +  +  P R   SGIHMSA+ RLE+LMLAR +S SD+S +       K+ E
Sbjct  117   FVV------EPVKECPPRRVRSGIHMSAKERLENLMLAR-RSSSDLSILKPAGEWSKTEE  169

Query  668   SGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSR----  501
               GG VR+KLR+PKAE+E+L+K+       E  +KI  L M  ++ +   ++T  R    
Sbjct  170   KEGGAVRVKLRIPKAELERLVKEG--ATEAEATQKIAALYMAKHSRSEATQNTPQRREDG  227

Query  500   ---PTAPIPGII---KKDLKSSQKRVGF  435
                PTA I        + +KS  KRV F
Sbjct  228   GDEPTAAIDTATPAATRGVKSRLKRVSF  255



>emb|CAN65027.1| hypothetical protein VITISV_028979 [Vitis vinifera]
Length=171

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 106/164 (65%), Gaps = 14/164 (9%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG   + + PV + EVV+  PGH+L++SEAVK+FG RAKPL   QEL+PK++YF
Sbjct  11    AKVMKIDGTIFKLRTPVRSMEVVQDYPGHVLLESEAVKHFGIRAKPLQPHQELKPKKIYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPE--------  669
             L+   LP         R   S I+MSA+ RLE LML+R +SVSD+S +KS          
Sbjct  71    LI--ELPTLPPEEKAHRRARSAINMSAKDRLECLMLSR-RSVSDLSIVKSTNVASDGPGT  127

Query  668   -SGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
              +G G  R+K+RLPKA+V KLI++SKD    E AEKI+     N
Sbjct  128   SAGPGVTRVKVRLPKAQVTKLIEESKD--EDEAAEKIIHFYTEN  169



>gb|KEH34686.1| plastid movement impaired protein [Medicago truncatula]
Length=217

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 134/216 (62%), Gaps = 27/216 (13%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T + K P  A +VVK  PGH L+DS+AVK+FG RAKPL   Q+L+ K++YF
Sbjct  12    AKVMKIDGETFKLKTPAKANDVVKHYPGHALLDSQAVKHFGLRAKPLEPHQQLKAKKIYF  71

Query  824   LVAeplppqeervvprrvRSSGIH----MSAEARLESLMLARSKSVSDISFMKSPESG--  663
             LV   LP  + + +PRRVRSSG+H    M+A  RL+ LML++ +SVSD+  +K    G  
Sbjct  72    LVE--LPKVQSQPLPRRVRSSGLHPSCGMNATERLDFLMLSK-RSVSDLPSVKRSNLGDD  128

Query  662   ------GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSR  501
                    G  R+K+R+PKA+++KL+++S+D  G EVAEKI+ L MGNN +        + 
Sbjct  129   GPGLVRDGSTRVKMRIPKAQLDKLMEESRD--GAEVAEKIVSLYMGNNASVKGGGGGINE  186

Query  500   PTAPIPGIIKKDLKSSQKRVGFR-----EIQQEAEA  408
                 +      + +S +KRV F      EI +EA A
Sbjct  187   GKVEV-----HNQRSRRKRVSFSPVEEGEIHEEATA  217



>ref|XP_004503145.1| PREDICTED: uncharacterized protein At1g66480-like [Cicer arietinum]
Length=217

 Score =   130 bits (326),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 119/169 (70%), Gaps = 16/169 (9%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T + KIP  A +VVK  PGH L++S+AVK+FG RAKPL   Q L+PK++YF
Sbjct  12    AKVMKLDGETFKLKIPARANDVVKDYPGHALLESQAVKHFGLRAKPLEPYQMLKPKKIYF  71

Query  824   LVAeplppqeervvprrvRSSGIH-MSAEARLESLMLARSKSVSDISFMKSPESG-----  663
             LV   LP  +   +PRRVRSSGI  M+A  RL+ LML++ +SVSD+S +K   SG     
Sbjct  72    LVE--LPKLQPEPLPRRVRSSGIRGMNAMERLDFLMLSK-RSVSDLSLVKRNSSGVVHDG  128

Query  662   -----GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNA  531
                   G  R+K+RLPKA++++L+++S+D    EVAEKI+ L MGNN+A
Sbjct  129   PSLVRDGSKRIKMRLPKAQLDRLMEESRD--ETEVAEKIVSLYMGNNDA  175



>ref|XP_008381317.1| PREDICTED: uncharacterized protein At1g66480 [Malus domestica]
Length=219

 Score =   130 bits (326),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 87/208 (42%), Positives = 133/208 (64%), Gaps = 20/208 (10%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++ G+T + K P+ A +VVK  PGH+L++SEAVK FG RA+PL  ++EL+PK++YF
Sbjct  11    AKVMKISGETFKVKTPIRAWDVVKDYPGHVLLNSEAVKRFGVRARPLEPQEELKPKKIYF  70

Query  824   LVAe-plppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG----  660
             LV     P +EE     R   SGI +SA+ RLE LML+R +SVSD++ +++  +      
Sbjct  71    LVQLPKFPAEEEEKQVTRRVRSGIQVSAKDRLECLMLSR-RSVSDLTSVRASSTTSSSSS  129

Query  659   -GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAPIP  483
              G VR+K+RLPKA++ KL+++SKD    E+AE+I+ L M NN   V  +           
Sbjct  130   EGPVRMKMRLPKAQMVKLVEESKD--DVEIAERIIELYMVNNGGKVEGQMVEKE-----E  182

Query  482   GIIKK-----DLK-SSQKRVGFREIQQE  417
             G++++     +LK S +KRV F  +++E
Sbjct  183   GVLQRKRGGXNLKPSHEKRVSFVPVEEE  210



>ref|XP_010109016.1| hypothetical protein L484_027215 [Morus notabilis]
 gb|EXC20656.1| hypothetical protein L484_027215 [Morus notabilis]
Length=230

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/210 (42%), Positives = 129/210 (61%), Gaps = 19/210 (9%)
 Frame = -2

Query  1001  KVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFL  822
             K+M+++G+T + KIP+ A +V K + GH+L+DSEAVK+FG +A PL  +Q L+P +VYFL
Sbjct  14    KIMKINGETFKVKIPIRALDVTKDHQGHVLLDSEAVKHFGIKANPLEPQQHLKPNKVYFL  73

Query  821   VA-----eplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGG  657
             V           Q+E     R   SGI+MSA+ RLE LML+R +SVSD+S ++   S G 
Sbjct  74    VEIPRFPTSENNQDEISRGARRVRSGINMSAKDRLECLMLSR-RSVSDMSLLRPSSSTGL  132

Query  656   G------VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKS-----T  510
                    VR+K+RLP A+VEKL+++S+D    EVAEKI+ L MG++  A +  +      
Sbjct  133   SSGGPGPVRVKMRLPLAQVEKLVEESRD--KVEVAEKILALYMGDDGGAHVAAAKDGGLI  190

Query  509   RSRPTAPIPGIIKKDLKSSQKRVGFREIQQ  420
             R     P    I K+ ++ QKRV F  I++
Sbjct  191   RREEWKPGRASITKNHEARQKRVSFLPIEE  220



>ref|XP_009101353.1| PREDICTED: uncharacterized protein At1g66480-like [Brassica rapa]
 emb|CDY17681.1| BnaA06g35000D [Brassica napus]
Length=216

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/204 (42%), Positives = 120/204 (59%), Gaps = 22/204 (11%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AK+M++DG++ + K PV A EV++  PG++L+DSE+VK++G RAKPL A+Q L+ KR+Y
Sbjct  10    TAKIMKIDGESFKLKTPVTAEEVLQDFPGYVLLDSESVKHYGARAKPLEAKQRLEAKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK---------S  675
             F+V        +   P R   SGIHM+A+ RLE LML R +S SD+S +K          
Sbjct  70    FVV-----EPVKECPPPRRVRSGIHMNAKERLEHLMLTR-RSSSDLSILKPSGGWTTKTE  123

Query  674   PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKST----R  507
              E  GG VR+KLR+PKAE+EKL+K+       E   KI  L M  ++    +K+T     
Sbjct  124   EEDEGGAVRVKLRIPKAELEKLVKEG--ATEAEATHKIASLFMAKHSHEEASKNTLRLGH  181

Query  506   SRPTAPIPGIIKKDLKSSQKRVGF  435
               P A I     + +KS  KRV F
Sbjct  182   DEPAATI-ATDTRGVKSRLKRVSF  204



>ref|NP_001236465.1| uncharacterized protein LOC547692 [Glycine max]
 gb|AAG38148.1| unknown [Glycine max]
Length=211

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 117/203 (58%), Gaps = 17/203 (8%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K P+   +V+K +PG +L++SEAVK++G RAKPL A +EL PKR+Y
Sbjct  10    TTKVMKIDGETFKLKTPIKVCDVLKDHPGLVLLESEAVKHYGIRAKPLEAHKELMPKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPE-------  669
             FLV       +E  V  R   SGI+MSA+ R        +   SD++   +P        
Sbjct  70    FLV----ELPKEVTVAPRRVRSGINMSAKERPREPRFGVAGRASDLTDHGNPRRAKKRLL  125

Query  668   SGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAP  489
               GGGVRLK+RLPKAEVE+L++  +     E AEKIM LCM NN   V  ++        
Sbjct  126   ESGGGVRLKMRLPKAEVERLMRGCET--EAEAAEKIMGLCMANNGGGVEARNG----DGE  179

Query  488   IPGIIKKDLKSSQKRVGFREIQQ  420
             + G + +  K+ +KRV F  I +
Sbjct  180   VKGRVGESTKAREKRVSFMPINE  202



>ref|XP_002875068.1| hypothetical protein ARALYDRAFT_322480 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51327.1| hypothetical protein ARALYDRAFT_322480 [Arabidopsis lyrata subsp. 
lyrata]
Length=210

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/198 (42%), Positives = 119/198 (60%), Gaps = 16/198 (8%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K PV A EV++  PGH+L+DSE+VK++G RAKPL A Q L+ KR+Y
Sbjct  10    TTKVMKIDGETFKLKTPVTAEEVLQDFPGHVLLDSESVKHYGARAKPLEARQRLEAKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK------SPES  666
             F+V      +  +  P R   SGIH+SA+ RLESLMLAR +S SD+S +K      + E 
Sbjct  70    FVV------EPVKECPPRRVRSGIHVSAKERLESLMLAR-RSSSDLSILKQAGGWTTEEE  122

Query  665   GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSR-PTAP  489
              G   R+K+R+PKAE+E+L+K+       E  +KI  L M        +++TR   P   
Sbjct  123   EGAVRRVKVRIPKAELERLVKEG--ATEAEATQKIAALFMAKQRQEEAHQNTREDVPATT  180

Query  488   IPGIIKKDLKSSQKRVGF  435
             +     + +KS  KRV F
Sbjct  181   VTAAATRGVKSRLKRVSF  198



>ref|XP_002271689.1| PREDICTED: uncharacterized protein At1g66480 [Vitis vinifera]
 emb|CBI33547.3| unnamed protein product [Vitis vinifera]
Length=171

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/164 (48%), Positives = 105/164 (64%), Gaps = 14/164 (9%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG   + + PV + EVV+  PGH+L++SEAVK+FG RAKPL   QEL+PK++YF
Sbjct  11    AKVMKIDGTIFKLRTPVRSMEVVQDYPGHVLLESEAVKHFGIRAKPLQPHQELKPKKIYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPE--------  669
             L+   LP         R   S I+MSA+ RLE LML+R +SVSD+S +KS          
Sbjct  71    LI--ELPTLPPEEKAHRRARSAINMSAKDRLECLMLSR-RSVSDLSIVKSTNVASDGPGT  127

Query  668   -SGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
              +G G  R+K+RLPKA+V  LI++SKD    E AEKI+     N
Sbjct  128   SAGPGVTRVKVRLPKAQVTNLIEESKD--EDEAAEKIIHFYTEN  169



>ref|NP_178243.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAY17424.1| At2g01340 [Arabidopsis thaliana]
 gb|ABF19028.1| At2g01340 [Arabidopsis thaliana]
 dbj|BAE98639.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC05438.1| uncharacterized protein AT2G01340 [Arabidopsis thaliana]
Length=215

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 109/173 (63%), Gaps = 15/173 (9%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K PV A EV+K  PGH+L+DSE+VK++G RAKPL A+Q L+ KR+Y
Sbjct  10    TTKVMKIDGETFKLKTPVTAEEVLKDFPGHVLLDSESVKHYGARAKPLEAKQRLEAKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP------ES  666
             F+V      +  +  P R   SGIH+SA+ RLESLMLAR +S SD+S +K P      E 
Sbjct  70    FVV------EPVKECPPRRVRSGIHVSAKERLESLMLAR-RSSSDLSILKPPGGWTTEEE  122

Query  665   GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTR  507
              G   R+K+R+PKAE+EKL+K+       E  +KI  L M         ++TR
Sbjct  123   EGAVRRVKVRIPKAELEKLVKEG--ATEAEATQKIAALFMAKQRQEEAYQNTR  173



>ref|XP_008229230.1| PREDICTED: uncharacterized protein At1g66480-like [Prunus mume]
Length=223

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 112/161 (70%), Gaps = 5/161 (3%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++ G+T + K P+ A +VVK  PGH+L++SEAVK+FG RAKPL  +Q+L+PK++YF
Sbjct  11    AKVMKISGETFKVKTPIRAWDVVKDYPGHVLLNSEAVKHFGVRAKPLEPQQDLRPKKIYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGG-VR  648
             LV +     EE     R   SGI +SA+ RLE LML+R +SVSD++ +++  +     VR
Sbjct  71    LV-QLPKFPEEEKQVPRRVRSGIQVSAKDRLECLMLSR-RSVSDLTSVRAASACSEDPVR  128

Query  647   LKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAV  525
             +K+R+P+A++ KL+++S D    E+AE+I+ L M NN   V
Sbjct  129   MKVRVPRAQMVKLVEESND--DAEIAERIIELYMANNGGKV  167



>emb|CDY37375.1| BnaC02g33930D [Brassica napus]
Length=220

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 113/176 (64%), Gaps = 16/176 (9%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K PV A EV+K  PGH+L++SE+VK++G RAKPL  +Q L+ KR+Y
Sbjct  10    TTKVMKIDGETFKLKTPVTAEEVLKDFPGHVLLESESVKHYGARAKPLEMKQMLEAKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFM-------KSPE  669
             F+V      +  +  P R   SGIHMSA+ RLE+LMLAR +S SD+S +       K+ E
Sbjct  70    FVV------EPVKECPPRRVRSGIHMSAKERLENLMLAR-RSSSDLSILKPAGEWSKTEE  122

Query  668   SGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSR  501
               GG VR+KLR+P+AE+E+L+K+       E  +KI  L M  ++ +   ++T  R
Sbjct  123   KEGGAVRVKLRIPRAELERLVKEG--ATEAEATQKIAALYMAKHSRSEATQNTLQR  176



>emb|CDP02714.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 107/155 (69%), Gaps = 8/155 (5%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++ G+T + K PV A +VVK  PGH+L++SEAVK  G RAKPL  ++EL+PK++YF
Sbjct  14    AKVMKISGETFKLKTPVLAFDVVKDYPGHVLLESEAVKRHGIRAKPLEPQEELKPKKIYF  73

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGVRL  645
             LV     P+       R   S +HM+A+ RLE L+L+R +S SD+S  +  ++  G V++
Sbjct  74    LVE---LPKLPEERAPRRARSAVHMNAKDRLECLVLSR-RSGSDVSVQR--QNPAGPVQV  127

Query  644   KLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
             K+RLP+ +VEKL+ +S+D    E+AE+I+ LCM N
Sbjct  128   KMRLPRTQVEKLVGESRD--ETELAERIVDLCMKN  160



>ref|XP_010066633.1| PREDICTED: uncharacterized protein At1g66480 [Eucalyptus grandis]
 gb|KCW64604.1| hypothetical protein EUGRSUZ_G02193 [Eucalyptus grandis]
Length=237

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 109/170 (64%), Gaps = 21/170 (12%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM++ G+TT+ + PV AG+V+   PGH+L++SEAVK+FG RA PL A Q L+PKR+Y
Sbjct  12    TAKVMKISGETTKLRTPVLAGDVLGDYPGHVLLESEAVKHFGVRATPLDARQNLEPKRLY  71

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPES------  666
             FLV     P+  R    R   SGI MSA  RLE LMLAR +SVSD+S + +P S      
Sbjct  72    FLV---ELPESSRDRMPRRVRSGITMSARDRLEGLMLAR-RSVSDLSIV-NPASIGAAKD  126

Query  665   --------GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
                      GG  RL +RLPK EVE+L+K+S+D   GE AEKIM L + N
Sbjct  127   AKGGGGGGEGGSKRLTMRLPKGEVERLMKESRD--EGEAAEKIMNLYITN  174



>ref|XP_007153300.1| hypothetical protein PHAVU_003G023400g [Phaseolus vulgaris]
 gb|ESW25294.1| hypothetical protein PHAVU_003G023400g [Phaseolus vulgaris]
Length=189

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 106/161 (66%), Gaps = 10/161 (6%)
 Frame = -2

Query  1001  KVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFL  822
             KVM++DGQT +FK P+   +V+K +PG +L++SEAVK++G RAKPL   +EL PKR+YFL
Sbjct  12    KVMKIDGQTFKFKTPIRVADVLKDHPGLVLLESEAVKHYGVRAKPLEVHRELAPKRLYFL  71

Query  821   VAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG---GGV  651
             V        E  V  R   S I+MSA+ RLESL+LAR +S SD++ MK     G   GGV
Sbjct  72    V----ELPREATVAPRRVRSVINMSAKDRLESLVLAR-RSASDLTIMKGQGMEGAEKGGV  126

Query  650   RLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAA  528
             RL++R+ KAEVE++++  +     E AEKI+ LCM     A
Sbjct  127   RLRMRVAKAEVERVMRGCET--EAEAAEKIVGLCMAKTGGA  165



>ref|XP_009371801.1| PREDICTED: uncharacterized protein At1g66480 [Pyrus x bretschneideri]
Length=219

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 113/166 (68%), Gaps = 9/166 (5%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++ G+T + K P+ A +VVK  PGH+L++SEAVK FG RA+PL  +QEL+PK++YF
Sbjct  11    AKVMKISGETFKVKTPIRAWDVVKDYPGHVLLNSEAVKRFGMRARPLEPKQELKPKKIYF  70

Query  824   LVAe-plppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG----  660
             LV     P +EE    +R   SGI +SA+ RLE LML+R +SVSD++ ++   +      
Sbjct  71    LVQLPKFPAEEEEKQVKRRVRSGIQVSAKDRLECLMLSR-RSVSDLTSVRESSTTSSSSS  129

Query  659   -GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAV  525
                VR+K+RLPKA++ KL+++SKD    E+AE+I+ L M NN   V
Sbjct  130   EDPVRMKMRLPKAQMLKLVEESKD--DVEIAERIIELYMVNNGGKV  173



>gb|KHG02457.1| hypothetical protein F383_25869 [Gossypium arboreum]
Length=218

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 126/205 (61%), Gaps = 26/205 (13%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANP-GHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
             AKVM++DG+T + K PV   +V+K  P GH+L+DS+ VK++G RAKPL  ++ L+PK++Y
Sbjct  11    AKVMKIDGETIKLKTPVRVWDVLKDYPTGHVLLDSQTVKHYGIRAKPLEPQESLKPKKIY  70

Query  827   FLVAe-plppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESG--GG  657
             FLV    L   E    PRRVRS GIHMSA+ RLE LML+R ++VSD+S ++   +     
Sbjct  71    FLVELPKLADDEVHKAPRRVRSGGIHMSAKDRLECLMLSR-RTVSDLSMVQPSSTSIVSD  129

Query  656   GVRL----------------KLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAA-  528
             GVRL                K+RLPK+++ KL+++SKD  G EVAEKI+ L +GN  +  
Sbjct  130   GVRLGGGGGGGTSGGGMMTVKMRLPKSQMAKLVEESKD--GVEVAEKILDLYIGNGGSGG  187

Query  527   --VLNKSTRSRPTAPIPGIIKKDLK  459
                 N+  R  P  P  G + ++ K
Sbjct  188   DDAGNRIHREAPWKPGLGTVGENFK  212



>emb|CDX77816.1| BnaC07g20700D [Brassica napus]
Length=216

 Score =   127 bits (318),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 84/204 (41%), Positives = 118/204 (58%), Gaps = 22/204 (11%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               K+M++DG+T + K PV A EV++  PGH+L+DSE+VK++G RAKPL A+Q L+ KR+Y
Sbjct  10    TTKIMKIDGETFKLKTPVTAEEVLEDFPGHVLLDSESVKHYGARAKPLEAKQRLEAKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFM---------KS  675
             F+V        +   P R   SGIHM+A+ RLE LML R +S SD+S +         K 
Sbjct  70    FVV-----EPVKECPPPRKVRSGIHMNAKERLEHLMLTR-RSSSDLSILKPSGGWTTTKE  123

Query  674   PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKST----R  507
              E  GG VR+KLR+PKAE+E+L+K+       E   KI  L M  ++    +K+      
Sbjct  124   EEDEGGAVRVKLRIPKAELERLVKEG--ATELEATHKIASLFMAKHSHEEASKNALRLGH  181

Query  506   SRPTAPIPGIIKKDLKSSQKRVGF  435
               P A I     + +KS  KRV F
Sbjct  182   DEPAATI-ATDTRGVKSRLKRVSF  204



>emb|CDY40384.1| BnaA02g26980D [Brassica napus]
Length=220

 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 77/176 (44%), Positives = 112/176 (64%), Gaps = 16/176 (9%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K PV A EV+K  PGH+L++ E+VK++G RAKPL  +Q L+ KR+Y
Sbjct  10    TTKVMKIDGETFKLKTPVTAEEVLKDFPGHVLLECESVKHYGARAKPLEMKQMLEAKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFM-------KSPE  669
             F+V      +  +  P R   SGIHMSA+ RLE+LMLAR +S SD+S +       K+ E
Sbjct  70    FVV------EPVKECPPRRVRSGIHMSAKERLENLMLAR-RSSSDLSILKPAGEWSKTEE  122

Query  668   SGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSR  501
               GG VR+KLR+PKAE+E+L+K+       E  +KI  L M  ++ +   ++T  R
Sbjct  123   KEGGAVRVKLRIPKAELERLVKEG--ATEAEATQKIAALYMAKHSRSEATQNTPQR  176



>ref|XP_009114243.1| PREDICTED: uncharacterized protein At1g66480-like [Brassica rapa]
 emb|CDY41078.1| BnaA09g18570D [Brassica napus]
Length=217

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 119/205 (58%), Gaps = 23/205 (11%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++DG+T + K PV A EV+K  PGH+L++SE+VK++G RAKPL A+Q L  KR+Y
Sbjct  10    TTKVMKIDGETLKLKTPVTAEEVLKDFPGHVLLESESVKHYGARAKPLDAKQRLVAKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK---------S  675
             F+V      +  +  P R   SGI MSA+ RLE+LMLAR +S SD+S +K          
Sbjct  70    FVV------EPVKECPPRRVRSGIQMSAKERLENLMLAR-RSSSDLSLLKPAGRWTTKEE  122

Query  674   PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMG--NNNAAVLNKSTR--  507
              E  GG +R+KLR+PKAE+E+L+K+       E  +KI  L M    N+ A  NK  R  
Sbjct  123   EEKDGGAMRVKLRIPKAELERLVKEG--ATEAEATQKIAALFMAKQKNDKARQNKLQRGD  180

Query  506   -SRPTAPIPGIIKKDLKSSQKRVGF  435
                  A       + +KS  KRV F
Sbjct  181   VGEEPAIATAATTRVVKSCLKRVSF  205



>ref|XP_010916176.1| PREDICTED: uncharacterized protein At1g66480-like [Elaeis guineensis]
Length=197

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 75/161 (47%), Positives = 107/161 (66%), Gaps = 9/161 (6%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM++DG T   K+P  AG+V++ +  H L+++E VK  G RA+PL  +Q ++P ++Y
Sbjct  12    TAKVMKLDGTTIRLKLPAQAGDVLRDHLEHTLLEAEEVKRLGVRAQPLEPDQAIKPGKLY  71

Query  827   FLVAeplppqeervvprrvRSSG-IHMSAEARLESLMLARSKSVSDISFMKSPES----G  663
             FLV  P  P+ +     R   SG IHMSA+ RLESLML+R +S SD++  K P S    G
Sbjct  72    FLVEIPRLPRLQDRRVPRRAWSGAIHMSAKDRLESLMLSR-RSASDLTLAK-PSSVETVG  129

Query  662   GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
              GGVR+++RLPKA+V KL+++S D    E AE+IM LC+ N
Sbjct  130   EGGVRIRMRLPKAQVAKLVEESSD--SCEAAERIMALCVAN  168



>ref|XP_010932597.1| PREDICTED: uncharacterized protein At1g66480-like [Elaeis guineensis]
Length=191

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 99/157 (63%), Gaps = 10/157 (6%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM++DG T   K P  AG V++ +PG  L+D+E VK  G R++PL  E  L+P ++Y
Sbjct  11    TAKVMKIDGTTFRLKPPATAGGVLRDHPGFSLLDAEEVKQLGLRSRPLQPETLLRPGKLY  70

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGVR  648
             FLV             RR  S  +H+SA+ RLESLML+R +SVSD+S  KS     G VR
Sbjct  71    FLV-----ELPRLPDQRRTWSGALHVSAKERLESLMLSR-RSVSDLSLTKS--EPDGPVR  122

Query  647   LKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
             L++RLPKA+V K +++SKD    E AEKIM LC+  +
Sbjct  123   LRMRLPKAQVTKFMEESKD--SAEAAEKIMELCLAKD  157



>ref|XP_008348593.1| PREDICTED: uncharacterized protein At1g66480-like [Malus domestica]
Length=187

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 75/163 (46%), Positives = 111/163 (68%), Gaps = 9/163 (6%)
 Frame = -2

Query  995  MRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFLVA  816
            M++ G+T + K P+ A +VVK  PGH+L++SEAVK FG RA+PL  ++EL+PK++YFLV 
Sbjct  1    MKISGETFKVKTPIRAWDVVKDYPGHVLLNSEAVKRFGVRARPLEPQEELKPKKIYFLVQ  60

Query  815  e-plppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG-----GG  654
                P +EE     R   SGI +SA+ RLE LML+R +SVSD++ +++  +       G 
Sbjct  61   LPKFPAEEEEKQVTRRVRSGIQVSAKDRLECLMLSR-RSVSDLTSVRASSTTSSSSSEGP  119

Query  653  VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAV  525
            VR+K+RLPKA++ KL+++SKD    E+AE+I+ L M NN   V
Sbjct  120  VRMKMRLPKAQMVKLVEESKD--DVEIAERIIELYMVNNGGKV  160



>ref|XP_008775226.1| PREDICTED: uncharacterized protein At1g66480-like [Phoenix dactylifera]
Length=193

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 116/172 (67%), Gaps = 8/172 (5%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKV+++DG T   K+P  AG+V++ +P H L+++E VK  G RA+PL  +Q ++P+++Y
Sbjct  12    TAKVVKLDGTTIRLKLPTQAGDVLRDHPEHTLLEAEEVKRLGVRAQPLDPDQAIKPRKLY  71

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK-SPES-GGGG  654
              LV   LP  +ER +PRR  S  IHMSA+ RLESLML+R +S SD++  K S E+ G GG
Sbjct  72    VLV--ELPRLQERRLPRRAWSGAIHMSAKDRLESLMLSR-RSASDLTLAKPSVETVGEGG  128

Query  653   VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRP  498
             VR+++RLP+A+V KL+++S D    E AEKI+ LC   N A     ST  RP
Sbjct  129   VRIRMRLPRAQVAKLVEESSD--SSEAAEKIVALCAA-NGAETSAGSTVERP  177



>gb|EYU30052.1| hypothetical protein MIMGU_mgv1a023844mg [Erythranthe guttata]
Length=214

 Score =   124 bits (311),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 122/210 (58%), Gaps = 30/210 (14%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM+++G+T + K PV A  V++++PGH+L++SE+V++ G RAKPL    EL+PKR+YF
Sbjct  11    AKVMKINGETFKLKTPVQARSVLESHPGHVLLESESVRHHGARAKPLEPHHELKPKRLYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK----SPESGGG  657
             LV     P+       R   SGIHMSA+ RL+SLMLAR +S SD+S +K      E    
Sbjct  71    LV---QLPKFPEDKSVRRVRSGIHMSAKDRLDSLMLAR-RSASDLSTVKPVRFEIEEERK  126

Query  656   GV-----------RLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKST  510
             G+           R+ +RLPK+EVE+L+ +SKD  G E AEKI+ LCM     A    + 
Sbjct  127   GILETRGGGGRGVRVTMRLPKSEVERLMAESKD--GAEAAEKIVSLCMAAGGGAAAEMNA  184

Query  509   RSRPTAPIPGIIKKDLKSSQKRVGFREIQQ  420
                         K+  K  +KRVGF  I +
Sbjct  185   EE---------CKRGPKLREKRVGFLPINE  205



>ref|XP_009399731.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=205

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 119/203 (59%), Gaps = 19/203 (9%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM+VDG T + K P  A  V++ +PGH L+D+E V+  G RA+PL  +  L+P ++YF
Sbjct  12    AKVMKVDGTTFKVKPPAQAMNVLRDHPGHALLDAEKVQRLGLRARPLDPDVPLKPGKLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDI-------SFMKSPES  666
             LV        ++   RR  S  + + A+ RLESL L+  +S+SD+       S +++ E+
Sbjct  72    LV--DHRQLPDQRGARRAWSGSLQVGAKERLESLRLS-HRSMSDLSRATWRPSALEAEET  128

Query  665   GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAPI  486
               G VRLK+RLPKA+VEKL+++SKD    E AEKIM+LC   + A   N S    P AP 
Sbjct  129   KDGTVRLKMRLPKAQVEKLMQESKD--AAEAAEKIMQLCSPKDGA---NPSPSPEPIAPT  183

Query  485   PGIIKKDLKSSQKRVGFREIQQE  417
                 +KD+    KR  F E+  E
Sbjct  184   SKAGRKDI----KRTRFLEVPDE  202



>ref|XP_004161194.1| PREDICTED: uncharacterized protein At1g66480-like [Cucumis sativus]
Length=203

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/174 (47%), Positives = 107/174 (61%), Gaps = 22/174 (13%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM++ G+T + K PV AG+VVK  PG +L++SEAVK++G RAKPL   Q+L  KR+Y
Sbjct  10    TVKVMKISGETMKLKTPVQAGDVVKDYPGFVLLESEAVKHYGVRAKPLELHQKLSTKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPES------  666
             FLV     P+  +    R   S I+MSA+ RLESLMLAR +S SD++ MK P+S      
Sbjct  70    FLV---DLPRLPKEQAPRRVRSAINMSAKDRLESLMLAR-RSASDLTIMK-PKSMLTEEG  124

Query  665   ---------GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNA  531
                       G   R+K+RLPKAEVE+L+K+ KD    E AE+IM L     NA
Sbjct  125   GGESEEGSVSGAPTRVKMRLPKAEVERLLKECKD--EAEAAERIMGLYKTRENA  176



>ref|XP_004140437.1| PREDICTED: uncharacterized protein At1g66480-like [Cucumis sativus]
Length=215

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/172 (47%), Positives = 107/172 (62%), Gaps = 22/172 (13%)
 Frame = -2

Query  1001  KVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFL  822
             KVM++ G+T + K PV AG+VVK  PG +L++SEAVK++G RAKPL   Q+L  KR+YFL
Sbjct  12    KVMKISGETMKLKTPVQAGDVVKDYPGFVLLESEAVKHYGVRAKPLELHQKLSTKRLYFL  71

Query  821   VAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPES--------  666
             V     P+  +    R   S I+MSA+ RLESLMLAR +S SD++ MK P+S        
Sbjct  72    V---DLPRLPKEQAPRRVRSAINMSAKDRLESLMLAR-RSASDLTIMK-PKSMLTEEGGG  126

Query  665   -------GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNA  531
                     G   R+K+RLPKAEVE+L+K+ KD    E AE+IM L     NA
Sbjct  127   ESEEGSVSGAPTRVKMRLPKAEVERLLKECKD--EAEAAERIMGLYKTRENA  176



>ref|XP_008801161.1| PREDICTED: uncharacterized protein At1g66480-like [Phoenix dactylifera]
Length=199

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 116/178 (65%), Gaps = 15/178 (8%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM++DG T   K P  AG+V++ +PG+ L++SE VK  G RA+PL  E  L+P R+Y
Sbjct  11    TAKVMKIDGTTFRPKPPTQAGDVLRDHPGYTLLESEEVKRLGLRARPLEPETPLKPGRLY  70

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPES----GG  660
             FLV   LP + +  VPRR  S  +HMSA+ RLESL+L+R +SVSD++  K P S      
Sbjct  71    FLV--ELPCRPDLRVPRRAWSGALHMSAKERLESLVLSR-RSVSDLTPTK-PSSVEAVTD  126

Query  659   GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN-----AAVLNKSTRSR  501
             G VRL++RLPK++V KL+++SKD    E AEKIM  C+  ++     AA +  S ++R
Sbjct  127   GMVRLRVRLPKSQVAKLMEESKD--CAEAAEKIMEFCVSKDSNTAKAAAAVPPSAKTR  182



>ref|XP_010910469.1| PREDICTED: uncharacterized protein At1g66480-like [Elaeis guineensis]
Length=200

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 83/203 (41%), Positives = 122/203 (60%), Gaps = 22/203 (11%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM++DG T   K P  AG+V++ +PG+ +++SE VK  G RA+PL  E  L+P R+Y
Sbjct  11    TAKVMKIDGTTFRLKPPSQAGDVLRDHPGYTILESEEVKRLGVRARPLEPETPLKPGRLY  70

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPE----SGG  660
             FLV   LP + +  VPRR  S  + +SA+ RLESL+L+R +SVSD++  K       + G
Sbjct  71    FLV--ELPQRLDLRVPRRAWSGALQLSAKERLESLVLSR-RSVSDVTATKPSSVEAVTDG  127

Query  659   GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAPIPG  480
             G VRL++RLPKA+V KL+++SKD    E A KIM LC+  ++            TA  P 
Sbjct  128   GTVRLRVRLPKAQVAKLMEESKD--SAEAAGKIMELCIAKDSK-----------TAKAPA  174

Query  479   IIKKDLKS--SQKRVGFREIQQE  417
             ++   +K+   +KR  F  +  E
Sbjct  175   VVSPTMKTGRKEKRTRFVTLPDE  197



>ref|XP_010553923.1| PREDICTED: uncharacterized protein At1g66480-like isoform X2 
[Tarenaya hassleriana]
 ref|XP_010553933.1| PREDICTED: uncharacterized protein At1g66480-like isoform X3 
[Tarenaya hassleriana]
Length=206

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 101/142 (71%), Gaps = 11/142 (8%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM++DG+T + K P+ A EV+K  PG +L+DSEAVK++G RAKPL A Q L+ KR+Y
Sbjct  10    TAKVMKIDGETLKMKTPMTAEEVLKEYPGLVLLDSEAVKHYGVRAKPLQAGQRLEAKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFM-------KSPE  669
             FLV    PP++   +P R   SGIHMSA+ RLESL+LAR +S SD+S +       ++  
Sbjct  70    FLV---EPPRQREGIPPRRVRSGIHMSAQERLESLVLAR-RSASDLSILNPSGRRTEAET  125

Query  668   SGGGGVRLKLRLPKAEVEKLIK  603
             +  G VR+K+R+PKAE+E+L++
Sbjct  126   AAAGSVRVKVRVPKAEIERLVR  147



>ref|XP_010553916.1| PREDICTED: uncharacterized protein At1g66480-like isoform X1 
[Tarenaya hassleriana]
Length=206

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 101/142 (71%), Gaps = 11/142 (8%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM++DG+T + K P+ A EV+K  PG +L+DSEAVK++G RAKPL A Q L+ KR+Y
Sbjct  10    TAKVMKIDGETLKIKTPMTAEEVLKEYPGLVLLDSEAVKHYGVRAKPLQAGQRLEAKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFM-------KSPE  669
             FLV    PP++   +P R   SGIHMSA+ RLESL+LAR +S SD+S +       ++  
Sbjct  70    FLV---EPPRQREGIPPRRVRSGIHMSAQERLESLVLAR-RSASDLSILNPSGRRTEAET  125

Query  668   SGGGGVRLKLRLPKAEVEKLIK  603
             +  G VR+K+R+PKAE+E+L++
Sbjct  126   AAAGSVRVKVRVPKAEIERLVR  147



>ref|XP_009414071.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=203

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 118/190 (62%), Gaps = 14/190 (7%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
             +AKVM+VDG T + K PV A  V++ +PG+ L+D++ V   G RA PL  +  L+P ++Y
Sbjct  11    IAKVMKVDGTTFKLKPPVQAVSVLRDHPGYNLLDADDVTRLGVRAMPLEPDTSLKPGKLY  70

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISF-MKSP-----ES  666
             FLV   LP    +  PRR  S  + +SA+ RLESL L R +S+SD+S   +SP     E+
Sbjct  71    FLV--ELPRVPNQRAPRRAWSGALQVSAKERLESLRLTR-RSLSDLSLATQSPSVEAEEA  127

Query  665   GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAPI  486
               G VRLK+RLPKA+VEKL+++SKD    E A+KIM+LC  ++ A     S    PT P 
Sbjct  128   KDGTVRLKMRLPKAQVEKLMQESKD--AAEAAQKIMQLCAASDGA---TPSASPEPTTPT  182

Query  485   PGIIKKDLKS  456
               + +K+ ++
Sbjct  183   VKVGRKEKRT  192



>ref|XP_006398523.1| hypothetical protein EUTSA_v10001016mg [Eutrema salsugineum]
 gb|ESQ39976.1| hypothetical protein EUTSA_v10001016mg [Eutrema salsugineum]
Length=222

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/208 (41%), Positives = 119/208 (57%), Gaps = 25/208 (12%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKA-NPGHILVDSEAVKNFGFRAKPLAAEQELQPKRV  831
               K+M++DG+T + K PV A EV+K   PGH+L+DSE+VK++G RAKPL A+Q L+  R+
Sbjct  10    TTKIMKIDGETFKLKTPVTAEEVLKDFPPGHVLLDSESVKHYGARAKPLEAKQRLEANRL  69

Query  830   YFLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK------SPE  669
             YF+V      +  +  P R   SGI MSA+ RLE+LMLAR +S SD+S +K      + E
Sbjct  70    YFVV-----DEPVKECPPRRVRSGIQMSAKERLENLMLAR-RSSSDLSILKPAGGWTTEE  123

Query  668   SGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKST-------  510
               GG VR+KLR+PKAE+++LIK+       E  +KI  L M         ++T       
Sbjct  124   KEGGAVRVKLRIPKAELQRLIKEG--ATEAEATQKIAALFMDKQRHEEARRNTLRLGGHG  181

Query  509   ---RSRPTAPIPGIIKKDLKSSQKRVGF  435
                 +  TA       K +KS  KRV F
Sbjct  182   GDELAATTAKPSAAATKGVKSRLKRVSF  209



>gb|AAD14534.1| unknown protein [Arabidopsis thaliana]
Length=225

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 109/183 (60%), Gaps = 25/183 (14%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPL----------AA  858
               KVM++DG+T + K PV A EV+K  PGH+L+DSE+VK++G RAKPL           A
Sbjct  10    TTKVMKIDGETFKLKTPVTAEEVLKDFPGHVLLDSESVKHYGARAKPLETKRLMLFGVQA  69

Query  857   EQELQPKRVYFLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK  678
             +Q L+ KR+YF+V      +  +  P R   SGIH+SA+ RLESLMLAR +S SD+S +K
Sbjct  70    KQRLEAKRLYFVV------EPVKECPPRRVRSGIHVSAKERLESLMLAR-RSSSDLSILK  122

Query  677   SP------ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNK  516
              P      E  G   R+K+R+PKAE+EKL+K+       E  +KI  L M         +
Sbjct  123   PPGGWTTEEEEGAVRRVKVRIPKAELEKLVKEG--ATEAEATQKIAALFMAKQRQEEAYQ  180

Query  515   STR  507
             +TR
Sbjct  181   NTR  183



>ref|XP_008800768.1| PREDICTED: uncharacterized protein At1g66480-like [Phoenix dactylifera]
Length=187

 Score =   119 bits (297),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 101/163 (62%), Gaps = 12/163 (7%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM++DG     K P  AG V++  PG+ L++SE VK  G RA+PL  E  L+P ++Y
Sbjct  11    TAKVMKIDGTAFRLKPPAMAGGVLRDYPGYSLLESEEVKQLGLRARPLEPEALLKPGKLY  70

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGVR  648
             FLV             RR  S  +H+SA+ RLE+LML+R +SVSD+S   +  +  G VR
Sbjct  71    FLV-----ELPRLPNQRRTWSGALHVSAKERLENLMLSR-RSVSDLSLANT--AADGAVR  122

Query  647   LKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM--GNNNAAV  525
             L++RLPKA+V K +++SKD    E AEK+M LC+  G N A V
Sbjct  123   LRMRLPKAQVAKFMEESKD--SAEAAEKLMGLCLAKGGNTAEV  163



>ref|XP_002438190.1| hypothetical protein SORBIDRAFT_10g009380 [Sorghum bicolor]
 gb|EER89557.1| hypothetical protein SORBIDRAFT_10g009380 [Sorghum bicolor]
Length=276

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 77/163 (47%), Positives = 101/163 (62%), Gaps = 15/163 (9%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG     K P  AG V++ +PG  L++SE VK  G RA+PLA + +L+P R+YF
Sbjct  12    AKVMQLDGTAFRVKPPAFAGTVLRDHPGFQLLESEEVKLLGVRARPLAHDAQLRPGRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK--------SPE  669
             LVA         V PRR  S  +H+ A  RLESLML R +S SD+S           S  
Sbjct  72    LVA----LPRPAVPPRRAWSGALHVGARERLESLMLTR-RSTSDLSLPAGTAPASPLSTA  126

Query  668   SGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
             S GG VRL++RLPKA+VEKL+ +S+D  G E A +IM+LC  N
Sbjct  127   SEGGPVRLRMRLPKAQVEKLMAESRD--GAEAAARIMQLCAAN  167



>ref|XP_004965177.1| PREDICTED: uncharacterized protein At1g66480-like [Setaria italica]
Length=274

 Score =   120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 77/165 (47%), Positives = 101/165 (61%), Gaps = 17/165 (10%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG     K P  AG V++ +PG  L++SE VK  G RA+PLA + +L+P R+YF
Sbjct  12    AKVMQLDGTAFRVKPPAFAGTVLRDHPGFQLLESEEVKLLGVRARPLAHDAQLRPGRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK----------S  675
             LVA         V PRR  S  +H+ A  RLESLML R +S SD+S             S
Sbjct  72    LVA----LPRPAVPPRRAWSGALHVGARERLESLMLTR-RSTSDLSLPASAATAPASPLS  126

Query  674   PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
               S GG VRL++RLPKA+VEKL+ +S+D  G E A +IM+LC  N
Sbjct  127   TASEGGPVRLRMRLPKAQVEKLMAESRD--GAEAAARIMQLCAAN  169



>ref|XP_006302789.1| hypothetical protein CARUB_v10020914mg [Capsella rubella]
 gb|EOA35687.1| hypothetical protein CARUB_v10020914mg [Capsella rubella]
Length=223

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/167 (44%), Positives = 105/167 (63%), Gaps = 19/167 (11%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T   K P  A EV    PG++L+DS+AVKNFG RAKPL   Q L+PK+ YF
Sbjct  12    AKVMKIDGETFRIKTPATAREVTAEYPGYVLLDSQAVKNFGVRAKPLEPNQILKPKKTYF  71

Query  824   LVAeplppqeervvprrvRS---------SGIHMSAEARLESLMLARSKSVSDISFMKSP  672
             LV  P  P E     R   +         SGIH+ A+ RLE LML+R ++VSD++  +S 
Sbjct  72    LVELPKLPPETTAAERDDSNNKLPYRRVMSGIHVGAKERLEMLMLSR-RTVSDVTIGRS-  129

Query  671   ESGGGGVR-----LKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
               GG G R     ++LRLP++++ KL+++SKD    E+A+KI+ + M
Sbjct  130   -DGGDGFRPGQTSVRLRLPRSQITKLMEESKD--ASEIADKILGIYM  173



>ref|XP_008454773.1| PREDICTED: uncharacterized protein At1g66480 isoform X2 [Cucumis 
melo]
Length=212

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 104/163 (64%), Gaps = 20/163 (12%)
 Frame = -2

Query  1001  KVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFL  822
             KVM++ G+T +   PV  G+VVK  PG +L++SEAVK++G RAKPL   Q+L  KR+YFL
Sbjct  12    KVMKISGETLKLNTPVQVGDVVKDYPGFVLLESEAVKHYGVRAKPLELHQKLSTKRLYFL  71

Query  821   VAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPES--------  666
             V     P+  +    R   S I+MSA+ RLESLMLAR +S SD++ MK P+S        
Sbjct  72    V---DLPKLPKEQAPRRVRSAINMSAKDRLESLMLAR-RSASDLTIMK-PKSVLTEEGGG  126

Query  665   -----GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRL  552
                  G G  R+K+RLPKAEVE+L+K+ KD    E AE+IM L
Sbjct  127   ESEGSGSGATRVKVRLPKAEVERLLKECKD--EAEAAERIMGL  167



>ref|XP_008454771.1| PREDICTED: uncharacterized protein At1g66480 isoform X1 [Cucumis 
melo]
Length=213

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 104/163 (64%), Gaps = 20/163 (12%)
 Frame = -2

Query  1001  KVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFL  822
             KVM++ G+T +   PV  G+VVK  PG +L++SEAVK++G RAKPL   Q+L  KR+YFL
Sbjct  12    KVMKISGETLKLNTPVQVGDVVKDYPGFVLLESEAVKHYGVRAKPLELHQKLSTKRLYFL  71

Query  821   VAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPES--------  666
             V     P+  +    R   S I+MSA+ RLESLMLAR +S SD++ MK P+S        
Sbjct  72    V---DLPKLPKEQAPRRVRSAINMSAKDRLESLMLAR-RSASDLTIMK-PKSVLTEEGGG  126

Query  665   -----GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRL  552
                  G G  R+K+RLPKAEVE+L+K+ KD    E AE+IM L
Sbjct  127   ESEGSGSGATRVKVRLPKAEVERLLKECKD--EAEAAERIMGL  167



>gb|EEC80354.1| hypothetical protein OsI_22441 [Oryza sativa Indica Group]
Length=281

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 77/170 (45%), Positives = 99/170 (58%), Gaps = 21/170 (12%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG     K P  AG V++ +PG  L++SE VK  G RA+PLA +  L+P R+YF
Sbjct  12    AKVMQLDGTAFRVKPPAFAGTVLRDHPGFQLLESEEVKLLGVRARPLAHDAPLRPGRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS----------  675
             LVA           PRR  S  +H+ A  RLESLML R +S SD+S   S          
Sbjct  72    LVA----LPRPTAPPRRAWSGALHVGARERLESLMLTR-RSTSDLSLPASAAVGTAPPSP  126

Query  674   ----PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
                  E GGG VRL++RLPKA+VEKL+ +S+D    E A KIM+LC   N
Sbjct  127   MSTASEPGGGPVRLRMRLPKAQVEKLMGESRD--SAEAAAKIMQLCAAAN  174



>ref|XP_010553900.1| PREDICTED: uncharacterized protein At1g66480-like [Tarenaya hassleriana]
Length=254

 Score =   118 bits (296),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 105/170 (62%), Gaps = 17/170 (10%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T + K P  A +V K  PG +L+DS+ VKNFG RA PL   Q L+PK+ YF
Sbjct  42    AKVMKIDGETFQLKTPATASDVTKEYPGFMLLDSDDVKNFGVRADPLDPNQILKPKKTYF  101

Query  824   LV---------AeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS-  675
             LV         A     +E      R   SGIH+ A+ RLE +ML+R ++VSD++  +S 
Sbjct  102   LVDLPKLPPERAAAKAAEESSKFLYRRVMSGIHIGAKERLELMMLSR-RTVSDVTIARSG  160

Query  674   ----PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
                 PE      R+KLRLP+A+V KL+++S+D    E+AE+I+ L +GN+
Sbjct  161   FGDGPEPEPETTRVKLRLPRAQVTKLVEESRD--ASEMAERIVGLYVGNS  208



>ref|NP_001140541.1| hypothetical protein [Zea mays]
 gb|ACF84045.1| unknown [Zea mays]
 gb|AFW86286.1| hypothetical protein ZEAMMB73_407213 [Zea mays]
Length=286

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 102/172 (59%), Gaps = 20/172 (12%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG     K P  AG V++ +PG  L++SE VK  G RA+PLA + +L+P R+YF
Sbjct  12    AKVMQLDGTAFRVKPPASAGAVLRDHPGFQLLESEEVKLLGVRARPLAHDAQLRPGRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP---------  672
             LV          V PRR  S  + + A  RLESLML R +S SD+S   S          
Sbjct  72    LVV----LPRPSVPPRRAWSGALQVGARERLESLMLTR-RSTSDLSLPASAATATATAPP  126

Query  671   ----ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAA  528
                 ES GG VRL++RLPKA+VE+L+ +S+D  G E A +IM+LC   NN A
Sbjct  127   SPLSESEGGPVRLRMRLPKAQVERLMAESRD--GAEAAARIMQLCAAANNPA  176



>ref|XP_003578092.1| PREDICTED: uncharacterized protein At1g66480-like [Brachypodium 
distachyon]
Length=229

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/227 (36%), Positives = 121/227 (53%), Gaps = 41/227 (18%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM VDG T  +K P  AG  ++ +PGH L++S+ V+  G RA+PL  +  L+P ++Y
Sbjct  11    AAKVMTVDGATFRYKTPATAGAALRGHPGHQLLESDEVRRLGVRARPLDRDAALKPGKLY  70

Query  827   FLV---------AeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFM--  681
             FLV               +++   PR+  S  +H+ A  RLESLML+R ++VSD++ M  
Sbjct  71    FLVQLPRGPARFDADAGAEDDARAPRKTWSGALHVGARERLESLMLSR-RTVSDVASMMP  129

Query  680   ------------KSPESGGGG----VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLC  549
                          S E+GGG     VRL++RLPKAEV +L+K+SKD    E AE+IM+LC
Sbjct  130   RGAVPGSGGGRASSVEAGGGDDGAPVRLRMRLPKAEVARLMKESKD--PAEAAERIMQLC  187

Query  548   MGNNNAAVLNKSTRSRPTAPIPGIIKKDLKSS---QKRVGFREIQQE  417
             +  +  A           AP+P     +  ++   +KR  F  +  E
Sbjct  188   VARDQGA--------HHAAPMPSATAANRNTAVKKEKRTRFMTVPDE  226



>ref|XP_010528525.1| PREDICTED: uncharacterized protein At1g66480 isoform X1 [Tarenaya 
hassleriana]
Length=225

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 82/200 (41%), Positives = 114/200 (57%), Gaps = 13/200 (7%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T   K P  A E  K  PG +L+DS+AVK+FG RAKPL   Q L+PK+ YF
Sbjct  12    AKVMKIDGETFRLKTPATASEATKEYPGFVLLDSDAVKSFGVRAKPLDPNQILKPKKTYF  71

Query  824   LVAeplppqeervvprrvRS--------SGIHMSAEARLESLMLARSKSVSDISFMKSPE  669
             LV  P  P E   V     S        SGIH+SA+ RLE LML+R ++VSD++  +   
Sbjct  72    LVELPKRPPETTAVAAEEGSGLPYRRVMSGIHISAKERLEMLMLSR-RTVSDVTIDRRGG  130

Query  668   SGGGG-VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTA  492
               G G VR++LRLP+++V KL+++S D    E+AE+I+ L   N            R   
Sbjct  131   GDGAGPVRVRLRLPRSQVTKLVEESHD--ASEIAERIIGLYAKNPGDINGGDGGDFRRKL  188

Query  491   PIPGII-KKDLKSSQKRVGF  435
              I G+    + KS ++ V F
Sbjct  189   GIGGVSGNSNFKSQERHVTF  208



>gb|KCW69333.1| hypothetical protein EUGRSUZ_F02820 [Eucalyptus grandis]
Length=221

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 104/161 (65%), Gaps = 13/161 (8%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++ G+T + + PV A +VV  +PGH+L+DSE+VK+FG RA+PL    EL+PK++YF
Sbjct  13    AKVMKITGETLKLRTPVRACQVVDGHPGHVLLDSESVKHFGIRARPLEPHHELKPKKIYF  72

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDI------SFMKSPESG  663
             LV       +      R   SG+ M A+ RLE LML+R ++ SD+      SF   PES 
Sbjct  73    LVE-LPKFPDGHEKAFRRVRSGLQMGAKDRLECLMLSR-RAASDMVRPTEASF--QPES-  127

Query  662   GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
                V++K+R+P+A+++KL+++S D    EVA +I+ L MG 
Sbjct  128   AAPVQMKMRIPRAQLDKLMEESSD--DAEVARRIVDLYMGQ  166



>ref|XP_010528526.1| PREDICTED: uncharacterized protein At1g66480 isoform X2 [Tarenaya 
hassleriana]
Length=214

 Score =   116 bits (290),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 103/164 (63%), Gaps = 12/164 (7%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T   K P  A E  K  PG +L+DS+AVK+FG RAKPL   Q L+PK+ YF
Sbjct  12    AKVMKIDGETFRLKTPATASEATKEYPGFVLLDSDAVKSFGVRAKPLDPNQILKPKKTYF  71

Query  824   LVAeplppqeervvprrvRS--------SGIHMSAEARLESLMLARSKSVSDISFMKSPE  669
             LV  P  P E   V     S        SGIH+SA+ RLE LML+R ++VSD++  +   
Sbjct  72    LVELPKRPPETTAVAAEEGSGLPYRRVMSGIHISAKERLEMLMLSR-RTVSDVTIDRRGG  130

Query  668   SGGGG-VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
               G G VR++LRLP+++V KL+++S D    E+AE+I+ L   N
Sbjct  131   GDGAGPVRVRLRLPRSQVTKLVEESHD--ASEIAERIIGLYAKN  172



>ref|XP_010062234.1| PREDICTED: uncharacterized protein At1g66480-like [Eucalyptus 
grandis]
 gb|KCW69332.1| hypothetical protein EUGRSUZ_F02820 [Eucalyptus grandis]
Length=228

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 105/161 (65%), Gaps = 13/161 (8%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++ G+T + + PV A +VV  +PGH+L+DSE+VK+FG RA+PL    EL+PK++YF
Sbjct  13    AKVMKITGETLKLRTPVRACQVVDGHPGHVLLDSESVKHFGIRARPLEPHHELKPKKIYF  72

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDI------SFMKSPESG  663
             LV E     +      R   SG+ M A+ RLE LML+R ++ SD+      SF   PES 
Sbjct  73    LV-ELPKFPDGHEKAFRRVRSGLQMGAKDRLECLMLSR-RAASDMVRPTEASF--QPES-  127

Query  662   GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
                V++K+R+P+A+++KL+++S D    EVA +I+ L MG 
Sbjct  128   AAPVQMKMRIPRAQLDKLMEESSD--DAEVARRIVDLYMGQ  166



>dbj|BAJ94681.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   117 bits (294),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 106/183 (58%), Gaps = 20/183 (11%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG     K P  AG V++ +PG  L++SE VK  G RA+PL  +  L+P R+YF
Sbjct  12    AKVMQLDGTAFRVKPPAQAGAVLRDHPGFQLLESEQVKLLGVRARPLDHDAPLRPGRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESG------  663
             LVA         V PRR  S  +H+ A  RLESLML R +S SD++F  S  +G      
Sbjct  72    LVA----LPRPTVPPRRAWSGALHVGARERLESLMLTR-RSTSDLTFPTSAGAGTAPSSP  126

Query  662   ------GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSR  501
                   GG V+L++RLPKA+V KL+ +S+D    E A KIM+LC   N A    +S R  
Sbjct  127   MSSASEGGPVQLRMRLPKAQVAKLMGESRD--AAEAAAKIMQLCAA-NGAVTPERSPRFL  183

Query  500   PTA  492
             PTA
Sbjct  184   PTA  186



>dbj|BAD46205.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD54158.1| hypothetical protein [Oryza sativa Japonica Group]
Length=279

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 98/166 (59%), Gaps = 21/166 (13%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG     K P  AG V++ +PG  L++SE VK  G RA+PLA +  L+P R+YF
Sbjct  12    AKVMQLDGTAFRVKPPAFAGTVLRDHPGFQLLESEEVKLLGVRARPLAHDAPLRPGRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS----------  675
             LVA           PRR  S  +H+ A  RLESLML R +S SD+S   S          
Sbjct  72    LVA----LPRPTAPPRRAWSGALHVGARERLESLMLTR-RSTSDLSLPASAAVGTAPPSP  126

Query  674   ----PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLC  549
                  E GGG VRL++RLPKA+VEKL+ +S+D    E A KIM+LC
Sbjct  127   MSTASEPGGGPVRLRMRLPKAQVEKLMGESRD--SAEAAAKIMQLC  170



>ref|XP_006838369.1| hypothetical protein AMTR_s00002p00035620 [Amborella trichopoda]
 gb|ERN00938.1| hypothetical protein AMTR_s00002p00035620 [Amborella trichopoda]
Length=219

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 97/154 (63%), Gaps = 6/154 (4%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AK+MRVDG+T + K PV   +V+  +PGH+L+D   V+  G RA+PL  +  L P+RVY
Sbjct  10    TAKIMRVDGETLKLKAPVRVEDVLADHPGHVLIDYALVRELGIRAQPLGPDSLLMPRRVY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGVR  648
             FLV +   P        R        SA+ RL+ L+LAR ++VSD+S M      GGG+R
Sbjct  70    FLVQKSELPPTRPTRRVRSAVPVAAGSAKERLDGLLLAR-RTVSDLSPMVGE---GGGMR  125

Query  647   LKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
             +++RLPKA+V +L+++S D  G E AE+I+ LCM
Sbjct  126   VRMRLPKAQVVRLMEESAD--GSEAAERILELCM  157



>ref|NP_001057325.2| Os06g0260000 [Oryza sativa Japonica Group]
 dbj|BAF19239.2| Os06g0260000 [Oryza sativa Japonica Group]
Length=294

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 98/166 (59%), Gaps = 21/166 (13%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG     K P  AG V++ +PG  L++SE VK  G RA+PLA +  L+P R+YF
Sbjct  12    AKVMQLDGTAFRVKPPAFAGTVLRDHPGFQLLESEEVKLLGVRARPLAHDAPLRPGRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS----------  675
             LVA           PRR  S  +H+ A  RLESLML R +S SD+S   S          
Sbjct  72    LVA----LPRPTAPPRRAWSGALHVGARERLESLMLTR-RSTSDLSLPASAAVGTAPPSP  126

Query  674   ----PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLC  549
                  E GGG VRL++RLPKA+VEKL+ +S+D    E A KIM+LC
Sbjct  127   MSTASEPGGGPVRLRMRLPKAQVEKLMGESRD--SAEAAAKIMQLC  170



>emb|CDY25937.1| BnaC09g20500D [Brassica napus]
Length=217

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 110/178 (62%), Gaps = 20/178 (11%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               +VM++DG+T + K PV A EV+K  PGH+L++SE+VK++G RAKPL A+Q L  KR+Y
Sbjct  10    TTRVMKIDGETLKLKTPVTAEEVLKDFPGHVLLESESVKHYGARAKPLEAKQGLVAKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK---------S  675
             F+V      +  +  P R   SGI MSA+ RLE+LMLAR +S SD+S +K          
Sbjct  70    FVV------EPVKECPPRRVRSGIQMSAKDRLENLMLAR-RSSSDLSILKPAGRWTTKEE  122

Query  674   PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMG--NNNAAVLNKSTR  507
              E  GG VR+KLR+PKAE+E+LIK+       E  +KI  L M    N+ A  NK  R
Sbjct  123   EEKEGGAVRVKLRIPKAELERLIKEG--ATEAEATQKIAALFMAKQKNDEARQNKLQR  178



>ref|NP_001144982.1| uncharacterized protein LOC100278137 [Zea mays]
 gb|ACG44200.1| hypothetical protein [Zea mays]
 gb|ACG47990.1| hypothetical protein [Zea mays]
Length=281

 Score =   117 bits (292),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 102/172 (59%), Gaps = 20/172 (12%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG     K P  AG V++ +PG  L++SE VK  G RA+PLA + +L+P R+YF
Sbjct  12    AKVMQLDGTAFRVKPPASAGAVLRDHPGFQLLESEEVKLLGVRARPLAHDAQLRPGRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP---------  672
             LV          V PRR  S  + + A  RLESLML R +S SD+S   S          
Sbjct  72    LVV----LPRPSVPPRRAWSGALQVGARERLESLMLTR-RSTSDLSLPASAVTATATAPA  126

Query  671   ----ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAA  528
                 ES GG VRL++RLPKA+VE+L+ +S+D  G E A +I++LC   NN A
Sbjct  127   SPLSESEGGPVRLRMRLPKAQVERLMAESRD--GAEAAARIVQLCAAANNPA  176



>ref|XP_003563985.1| PREDICTED: uncharacterized protein At1g66480-like [Brachypodium 
distachyon]
Length=292

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 100/175 (57%), Gaps = 14/175 (8%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG     K P  AG V+  +PG  L++SE VK  G RA+PL  +  L+P R+YF
Sbjct  12    AKVMQLDGTAFRVKPPAFAGTVLNEHPGFQLLESEQVKLLGVRARPLEPDAPLRPGRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK-------SPES  666
             LVA           PRR  S  +H+ A  RLESLML R +S SD++F         S  S
Sbjct  72    LVA----LPRPTAPPRRAWSGALHVGARERLESLMLTR-RSTSDLTFPTTAPASPLSTAS  126

Query  665   GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSR  501
              GG V+L++RLPKA+V KL+ +S+D    E A KIM+LC  N   A   + T  R
Sbjct  127   EGGPVQLRMRLPKAQVAKLMGESRD--AAEAAAKIMQLCAANGALATPERRTPER  179



>dbj|BAJ95074.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=313

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 106/183 (58%), Gaps = 20/183 (11%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG     K P  AG V++ +PG  L++SE VK  G RA+PL  +  L+P R+YF
Sbjct  12    AKVMQLDGTAFRVKPPAQAGAVLRDHPGFQLLESEQVKLLGVRARPLDHDAPLRPGRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESG------  663
             LVA         V PRR  S  +H+ A  RLESLML R +S SD++F  S  +G      
Sbjct  72    LVA----LPRPTVPPRRAWSGALHVGARERLESLMLTR-RSTSDLTFPTSAGAGTAPSSP  126

Query  662   ------GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSR  501
                   GG V+L++RLPKA+V KL+ +S+D    E A KIM+LC   N A    +S R  
Sbjct  127   MSSASEGGPVQLRMRLPKAQVAKLMGESRD--AAEAAAKIMQLCAA-NGAVTPERSPRFL  183

Query  500   PTA  492
             PTA
Sbjct  184   PTA  186



>ref|XP_002462356.1| hypothetical protein SORBIDRAFT_02g024320 [Sorghum bicolor]
 gb|EER98877.1| hypothetical protein SORBIDRAFT_02g024320 [Sorghum bicolor]
Length=212

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 103/176 (59%), Gaps = 22/176 (13%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM VDG T  +K P  AG  ++ +PGH L++SE V+  G RA+P+  +  L+P ++YF
Sbjct  12    AKVMTVDGGTFRYKTPAAAGAALRGHPGHQLLESEEVRRLGVRARPMDRDAPLKPGKLYF  71

Query  824   LVAepl--ppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG---  660
             LV  P      ++   PR+  S  +H+ A  RLESLML+R ++VSD++    P S     
Sbjct  72    LVQIPRGGGDDDDPRAPRKTWSGALHVGARERLESLMLSR-RTVSDVAASIVPSSAARLA  130

Query  659   --------------GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN  534
                           G VRL++RLPKAEV +L+K+SKD    E AE+IM+LC+  + 
Sbjct  131   AMSKPPSSVEVGVDGAVRLRMRLPKAEVARLMKESKD--PAEAAERIMQLCVARDQ  184



>dbj|BAE99768.1| hypothetical protein [Arabidopsis thaliana]
Length=210

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 104/166 (63%), Gaps = 15/166 (9%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T   K PV A EV    PG++L+DS+AVK+FG R+KPL   Q L+PK+ YF
Sbjct  12    AKVMKIDGETFRIKTPVTAREVTADYPGYVLLDSQAVKHFGVRSKPLEPNQTLKPKKTYF  71

Query  824   LVA------eplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS----  675
             LV       E      E  +P R   SGIH+ A+ RL+ LML+R ++VSD++  +S    
Sbjct  72    LVELPKLPPETTAVDTENKLPYRRVLSGIHVGAKERLDMLMLSR-RTVSDVTIGRSDGGD  130

Query  674   ---PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
                PE G G   ++LRLP++++ KL++++ +     +AEKI+ + M
Sbjct  131   GFGPELGPGHTSVRLRLPRSQITKLMEENNNDASA-IAEKILGIYM  175



>gb|AAG51153.1|AC074025_3 hypothetical protein [Arabidopsis thaliana]
Length=223

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 104/166 (63%), Gaps = 15/166 (9%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T   K PV A EV    PG++L+DS+AVK+FG R+KPL   Q L+PK+ YF
Sbjct  12    AKVMKIDGETFRIKTPVTAREVTADYPGYVLLDSQAVKHFGVRSKPLEPNQTLKPKKTYF  71

Query  824   LVA------eplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS----  675
             LV       E      E  +P R   SGIH+ A+ RL+ LML+R ++VSD++  +S    
Sbjct  72    LVELPKLPPETTAVDTENKLPYRRVMSGIHVGAKERLDMLMLSR-RTVSDVTIGRSDGGD  130

Query  674   ---PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
                PE G G   ++LRLP++++ KL++++ +     +AEKI+ + M
Sbjct  131   GFGPELGPGHTSVRLRLPRSQITKLMEENNNDASA-IAEKILGIYM  175



>ref|NP_176821.2| plastid movement impaired 2 protein [Arabidopsis thaliana]
 sp|Q6NLC8.1|Y1648_ARATH RecName: Full=Uncharacterized protein At1g66480 [Arabidopsis 
thaliana]
 gb|AAS65946.1| At1g66480 [Arabidopsis thaliana]
 gb|AAS92322.1| At1g66480 [Arabidopsis thaliana]
 gb|AEE34514.1| plastid movement impaired 2 protein [Arabidopsis thaliana]
Length=225

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 104/166 (63%), Gaps = 15/166 (9%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T   K PV A EV    PG++L+DS+AVK+FG R+KPL   Q L+PK+ YF
Sbjct  12    AKVMKIDGETFRIKTPVTAREVTADYPGYVLLDSQAVKHFGVRSKPLEPNQTLKPKKTYF  71

Query  824   LVA------eplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS----  675
             LV       E      E  +P R   SGIH+ A+ RL+ LML+R ++VSD++  +S    
Sbjct  72    LVELPKLPPETTAVDTENKLPYRRVMSGIHVGAKERLDMLMLSR-RTVSDVTIGRSDGGD  130

Query  674   ---PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
                PE G G   ++LRLP++++ KL++++ +     +AEKI+ + M
Sbjct  131   GFGPELGPGHTSVRLRLPRSQITKLMEENNNDASA-IAEKILGIYM  175



>ref|XP_010554976.1| PREDICTED: uncharacterized protein At1g66480-like [Tarenaya hassleriana]
Length=209

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 96/141 (68%), Gaps = 12/141 (9%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM+++G+T + K P+ A EV+K  PG +L+DSE+VK++G R+KPL A Q L+ KR+Y
Sbjct  10    TTKVMKINGETMKLKTPIMAEEVLKGYPGFVLLDSESVKHYGVRSKPLQAGQRLEAKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK------SPES  666
             FLV           VP R   SGI MSA+ RL+SLMLAR +S SD+S +       + ++
Sbjct  70    FLV-----EPPRESVPPRRVRSGIQMSAKERLDSLMLAR-RSASDLSILNPSGGWTAEDA  123

Query  665   GGGGVRLKLRLPKAEVEKLIK  603
              GG +R+K+R+PKAE+++L++
Sbjct  124   DGGALRVKVRVPKAEMQRLVR  144



>gb|EAZ07066.1| hypothetical protein OsI_29313 [Oryza sativa Indica Group]
Length=214

 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 108/165 (65%), Gaps = 10/165 (6%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              A+VM VDG T +++ P  A   ++ +PG+ +++SE V+  G RA+PL A+  L+P ++Y
Sbjct  12    TARVMTVDGTTYKYRPPASAAAALRDHPGYQVLESEEVRRLGMRARPLDADAPLKPGKLY  71

Query  827   FLVAeplppqeervvprrvRSSGIHM-SAEARLESLMLARSKSVSDI--SFMKSPESG-G  660
             FLV     P+  R   R    + +H+  A  RLES+ML+R +S SD+  S + S E+G G
Sbjct  72    FLV---KLPRLARAPRRTWSGALVHVGGAGERLESMMLSR-RSASDVAASPVSSVEAGEG  127

Query  659   GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAV  525
             G VRL++RLPKAEV +L+K+S+D    E AEKIM+LC+  ++++ 
Sbjct  128   GAVRLRMRLPKAEVARLVKESRD--AAEAAEKIMQLCVDRDHSSA  170



>ref|NP_001175592.1| Os08g0429250 [Oryza sativa Japonica Group]
 dbj|BAC24939.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAH94320.1| Os08g0429250 [Oryza sativa Japonica Group]
Length=216

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/165 (42%), Positives = 108/165 (65%), Gaps = 10/165 (6%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              A+VM VDG T +++ P  A   ++ +PG+ +++SE V+  G RA+PL A+  L+P ++Y
Sbjct  12    TARVMTVDGTTYKYRPPASAAAALRDHPGYQVLESEEVRRLGMRARPLDADAPLKPGKLY  71

Query  827   FLVAeplppqeervvprrvRSSGIHM-SAEARLESLMLARSKSVSDI--SFMKSPESG-G  660
             FLV     P+  R   R    + +H+  A  RLES+ML+R +S SD+  S + S E+G G
Sbjct  72    FLV---ELPRLARAPRRTWSGALVHVGGAGERLESMMLSR-RSASDVAASPVSSVEAGEG  127

Query  659   GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAV  525
             G VRL++RLPKAEV +L+K+S+D    E AEKIM+LC+  ++++ 
Sbjct  128   GAVRLRMRLPKAEVARLVKESRD--AAEAAEKIMQLCVDRDHSSA  170



>ref|XP_004956774.1| PREDICTED: uncharacterized protein At1g66480-like [Setaria italica]
Length=236

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/185 (39%), Positives = 105/185 (57%), Gaps = 31/185 (17%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM VDG T  +K P  AG  ++ +PGH L++SE V+  G RA+PL  +  L+P ++YF
Sbjct  12    AKVMTVDGATFRYKTPAAAGAALRGHPGHQLLESEEVRRLGVRARPLDRDAPLKPGKLYF  71

Query  824   LV------AeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFM------  681
             LV      A      ++   PR+  S  +H+ A  RLESLML+R ++VSD++ +      
Sbjct  72    LVQIPRGAAVGCAGDDDPRAPRKTWSGALHVGARERLESLMLSR-RTVSDVASIMPSSAA  130

Query  680   ------------KSPES----GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLC  549
                         K P S      G VRL++RLPKAEV +L+K+S+D    E AE+IM+LC
Sbjct  131   RLAAVGAGGSPNKPPSSVEVGADGAVRLRMRLPKAEVARLMKESRD--PAEAAERIMQLC  188

Query  548   MGNNN  534
             +  + 
Sbjct  189   VARDQ  193



>dbj|BAJ97523.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=294

 Score =   114 bits (286),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 80/183 (44%), Positives = 105/183 (57%), Gaps = 20/183 (11%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG     K P  AG V+  +PG  L++SE VK  G RA+PL  +  L+P R+YF
Sbjct  12    AKVMQLDGTAFRVKPPAYAGAVLGDHPGFQLLESEQVKLLGVRARPLDHDALLRPGRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESG------  663
             LVA         V PRR  S  +H+ A  RLESLML R +S SD++F  S  +G      
Sbjct  72    LVA----LPHPTVPPRRAWSGALHVGARERLESLMLTR-RSTSDLTFPTSAGAGTAPSSP  126

Query  662   ------GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSR  501
                   GG V+L++RLPKA+V KL+ +S+D    E A KIM+LC   N A    +S R  
Sbjct  127   MSSASEGGPVQLRMRLPKAQVAKLMGESRD--AAEAAAKIMQLC-AANGAVTPERSPRFL  183

Query  500   PTA  492
             PTA
Sbjct  184   PTA  186



>ref|XP_010471107.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=211

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 100/161 (62%), Gaps = 11/161 (7%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM ++G++ + K P+ AG VVK  PG++L++SEAVK FG RAKPL   Q L+ KR+Y
Sbjct  10    TAKVMNINGESFKLKTPLKAGTVVKDFPGYVLLESEAVKQFGIRAKPLEPHQNLESKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGVR  648
             F+V  P   +E      R   SGI +SA+ RLE+L L+R +S+SD+S MK  E       
Sbjct  70    FMVELPRTWKERTPRRVR---SGIQISAKERLENLKLSR-RSLSDLSVMKKNEEFDHDTE  125

Query  647   -----LKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
                  + L+LPK +VEKL K+S+   G + + KI  LC+ N
Sbjct  126   RQVSSVTLKLPKWKVEKLRKESE--SGSDFSNKIAALCLLN  164



>ref|XP_010511478.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=211

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 103/160 (64%), Gaps = 10/160 (6%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T   K PV A EV    PG++L+DS+AVK+FG RAKPL   Q L+PK+ YF
Sbjct  12    AKVMKIDGETFRIKTPVTAREVTAEYPGYVLLDSQAVKHFGVRAKPLEPNQLLKPKKTYF  71

Query  824   LVAeplp--pqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP-----ES  666
             LV  P      +   +P R   SGIH+ A+ RLE LML+R ++VSD++  +S        
Sbjct  72    LVELPKLPPETDNNKLPYRRVMSGIHVGAKERLEMLMLSR-RTVSDVTIGRSDGGDGFGV  130

Query  665   GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
             G G   ++LRLP++++ KL+++S D    E+A+KI+ + M
Sbjct  131   GPGHTSVRLRLPRSQITKLMEESND--DSEIADKILGIYM  168



>ref|XP_010046540.1| PREDICTED: uncharacterized protein At1g66480-like [Eucalyptus 
grandis]
 gb|KCW86208.1| hypothetical protein EUGRSUZ_B02897 [Eucalyptus grandis]
Length=192

 Score =   110 bits (274),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 107/180 (59%), Gaps = 10/180 (6%)
 Frame = -2

Query  1001  KVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFL  822
             K+M+  G+T +  +PV AG+VVK  PG++L++S++VK+ G +++PL   QEL+ +R+YFL
Sbjct  12    KIMKETGETLKLSMPVRAGDVVKDYPGYVLLESQSVKSLGIKSRPLEPHQELEHERLYFL  71

Query  821   VAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPE------SGG  660
             V E            R    G   SA+ RL+ ++LAR + VSD S M          +G 
Sbjct  72    V-ELPKEAVNDDEAGRGFQLGNKPSAKDRLDGVVLAR-RLVSDPSTMSRATILSKEGNGH  129

Query  659   GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAPIPG  480
             GG+RLKLRLPKAEVEKLIK+SKD    EV +KIM L +   +A   N+    R    + G
Sbjct  130   GGLRLKLRLPKAEVEKLIKESKD--DAEVTDKIMELYVALASANDTNEGLVGRRVIAMDG  187



>ref|XP_004140307.1| PREDICTED: uncharacterized protein At1g66480-like isoform 2 [Cucumis 
sativus]
 ref|XP_004162640.1| PREDICTED: uncharacterized protein At1g66480-like isoform 2 [Cucumis 
sativus]
Length=237

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 110/169 (65%), Gaps = 18/169 (11%)
 Frame = -2

Query  1001  KVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFL  822
             KVM+VDG+  + K+P+   EV+K  P H+L++SEAVK++G +AKPL  +Q+L  K++YFL
Sbjct  12    KVMKVDGEILKLKLPIRVSEVLKDYPDHVLMESEAVKHYGVKAKPLEPQQDLNRKKIYFL  71

Query  821   VA----eplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK--------  678
             +               +PRRVRSSG+HMSA+ RL+ LML+R +++S+I+  +        
Sbjct  72    LQLPKIAADNRPPPDRIPRRVRSSGVHMSAKDRLDLLMLSR-RTMSEIAITRPSTTSATD  130

Query  677   ---SPESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
                 P    G +++K+++P+++V KL+++S     GE+AEKI+++ + N
Sbjct  131   SSAQPRFHSGPMQVKMKIPRSQVAKLMEES--ASEGEIAEKIIKMYLKN  177



>gb|KGN51042.1| hypothetical protein Csa_5G418770 [Cucumis sativus]
Length=243

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 110/169 (65%), Gaps = 18/169 (11%)
 Frame = -2

Query  1001  KVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFL  822
             KVM+VDG+  + K+P+   EV+K  P H+L++SEAVK++G +AKPL  +Q+L  K++YFL
Sbjct  12    KVMKVDGEILKLKLPIRVSEVLKDYPDHVLMESEAVKHYGVKAKPLEPQQDLNRKKIYFL  71

Query  821   VA----eplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK--------  678
             +               +PRRVRSSG+HMSA+ RL+ LML+R +++S+I+  +        
Sbjct  72    LQLPKIAADNRPPPDRIPRRVRSSGVHMSAKDRLDLLMLSR-RTMSEIAITRPSTTSATD  130

Query  677   ---SPESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
                 P    G +++K+++P+++V KL+++S     GE+AEKI+++ + N
Sbjct  131   SSAQPRFHSGPMQVKMKIPRSQVAKLMEES--ASEGEIAEKIIKMYLKN  177



>ref|XP_002870572.1| hypothetical protein ARALYDRAFT_493762 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46831.1| hypothetical protein ARALYDRAFT_493762 [Arabidopsis lyrata subsp. 
lyrata]
Length=211

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 96/156 (62%), Gaps = 6/156 (4%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG     K PV A +  K  PG +L+DSE VK  G  AKPL   Q L+P + YF
Sbjct  10    AKVMKIDGDIFRLKTPVTASDATKEYPGFVLLDSETVKRLGVHAKPLEPNQNLKPNKTYF  69

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG---GG  654
             LV  P   ++ ++  RRV S  IH+ A+ RLE LML+R ++VSD+   +S E+ G   G 
Sbjct  70    LVDLPPVDKKNKLPYRRVMSGNIHIGAKERLEMLMLSR-RTVSDVGAARSTEADGPELGQ  128

Query  653   VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
              R++LRLP++++ KL+ +S D    EVA +I+   M
Sbjct  129   RRVRLRLPRSQITKLMGESHD--ASEVAARIINAYM  162



>ref|XP_004953825.1| PREDICTED: uncharacterized protein At1g66480-like [Setaria italica]
Length=258

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 87/219 (40%), Positives = 118/219 (54%), Gaps = 37/219 (17%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG +   K P  A +V++ +PG  L++SE VK  G RA+PLA +  L+  R+YF
Sbjct  12    AKVMQLDGTSFRVKPPAAAADVLRDHPGFQLLESEEVKLLGARARPLAPDAPLRRGRLYF  71

Query  824   LVAeplppqeervvprrvRSSG-IHMSAEARLESLMLARSKSVSDISFMKS---------  675
             LVA P           R   SG + + A  RLESLMLAR +S SD+S + +         
Sbjct  72    LVALPRRAPAGAAGRMRRAWSGNLRVGARERLESLMLAR-RSTSDLSSLPAHASASAPTS  130

Query  674   ----------PESGGGG----VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLC---M  546
                       P +G GG    VRLK+RLP+A+VEKL+ +SKD    E A KIM LC   M
Sbjct  131   PLPSGATSPLPAAGAGGGTTPVRLKMRLPRAQVEKLMGESKD--PAEAAAKIMELCGAAM  188

Query  545   GNNNAAVLNKSTRSRPTAPIPGIIK--KDLKSSQKRVGF  435
             G +  A    S R  P  P PGI++  +  K+ +   GF
Sbjct  189   GGDAHA----SARVTPERP-PGILRSPRFAKTPEWGAGF  222



>ref|XP_010470524.1| PREDICTED: uncharacterized protein At1g66480 [Camelina sativa]
Length=217

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 101/159 (64%), Gaps = 9/159 (6%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T   K PV A EV    PG++L+DS+AVK+FG RAKPL   Q L+PK+ YF
Sbjct  12    AKVMKIDGETFRIKTPVTAREVTAEYPGYVLLDSQAVKHFGVRAKPLEPNQVLKPKKTYF  71

Query  824   LVAeplp--pqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISF----MKSPESG  663
             LV  P      +   +P R   SGIH+ A+ RLE LML+R ++VSD++           G
Sbjct  72    LVELPKLPPETDNNKLPYRRVMSGIHVGAKERLEMLMLSR-RTVSDVTIGRSDGGGDGFG  130

Query  662   GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
              G   ++LRLP++++ KL+++S D    E+A+KI+ + M
Sbjct  131   PGHTSVRLRLPRSQITKLMEESND--DSEIADKILGIYM  167



>ref|NP_001183195.1| hypothetical protein [Zea mays]
 gb|ACR36022.1| unknown [Zea mays]
 gb|AFW76937.1| hypothetical protein ZEAMMB73_270962 [Zea mays]
Length=263

 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 79/181 (44%), Positives = 108/181 (60%), Gaps = 22/181 (12%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG     K P  AG V++ +PG  L++SE VK  G RA+PLA + +L+P R+YF
Sbjct  12    AKVMQLDGTAFRVKPPASAGTVLRDHPGFQLLESEEVKLLGVRARPLAHDAQLRPGRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS----PES---  666
             LVA           PRR  S  +H+ A  RLESLML R +S SD+S   S    P S   
Sbjct  72    LVA----LPRPAAPPRRAWSGALHVGARERLESLMLTR-RSTSDLSLAASAGTAPPSPLS  126

Query  665   ----GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRP  498
                 GGG VRL++RLPKAEV++L+ +S+D    + A +IM+LC     AA  +++ R  P
Sbjct  127   TASEGGGPVRLRMRLPKAEVDRLMAESRD--AADAAARIMQLC----AAATPDRTPRFVP  180

Query  497   T  495
             T
Sbjct  181   T  181



>gb|ABK23762.1| unknown [Picea sitchensis]
Length=247

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 99/179 (55%), Gaps = 28/179 (16%)
 Frame = -2

Query  1001  KVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFL  822
             K+M++DGQ  +FK P+   E++K  P H ++DSEAV++ G RAKPL    +L+PKR+YFL
Sbjct  14    KIMKLDGQEIKFKAPMTVDEIMKKYPNHSVLDSEAVRHLGIRAKPLHESTQLEPKRLYFL  73

Query  821   VAe-plppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDI---------------  690
             V                   S I  SA++RLES++LAR +SVSDI               
Sbjct  74    VEWPKTKIINNIYRAPTRVRSEISTSAKSRLESMLLAR-RSVSDISAIGASNGNRAGSLQ  132

Query  689   --SFMKSP-----ESGG--GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
               S   SP     ++GG  G VRLK+RL KA++ K + +S+   G E AEKI+   + N
Sbjct  133   YPSLTNSPSAQLDQTGGEDGAVRLKIRLTKAQLSKFMSESQT--GSETAEKILDAYLTN  189



>ref|XP_004140306.1| PREDICTED: uncharacterized protein At1g66480-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162639.1| PREDICTED: uncharacterized protein At1g66480-like isoform 1 [Cucumis 
sativus]
Length=263

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 110/169 (65%), Gaps = 18/169 (11%)
 Frame = -2

Query  1001  KVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFL  822
             KVM+VDG+  + K+P+   EV+K  P H+L++SEAVK++G +AKPL  +Q+L  K++YFL
Sbjct  12    KVMKVDGEILKLKLPIRVSEVLKDYPDHVLMESEAVKHYGVKAKPLEPQQDLNRKKIYFL  71

Query  821   VA----eplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK--------  678
             +               +PRRVRSSG+HMSA+ RL+ LML+R +++S+I+  +        
Sbjct  72    LQLPKIAADNRPPPDRIPRRVRSSGVHMSAKDRLDLLMLSR-RTMSEIAITRPSTTSATD  130

Query  677   ---SPESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
                 P    G +++K+++P+++V KL+++S     GE+AEKI+++ + N
Sbjct  131   SSAQPRFHSGPMQVKMKIPRSQVAKLMEES--ASEGEIAEKIIKMYLKN  177



>dbj|BAK00399.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=247

 Score =   109 bits (273),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 111/189 (59%), Gaps = 20/189 (11%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAG-EVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
             AKVM++DG +   K P  A  +V++ +PG  L+++E VK  G RA+PLA +  L+  R+Y
Sbjct  12    AKVMQLDGTSFRVKTPAAAASDVLRDHPGFQLLEAEEVKLLGARARPLAPDAPLRRGRLY  71

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK---------S  675
             FLVA  LP +     PRR  S  + + A  RLESLMLAR +S SD+S  +         S
Sbjct  72    FLVA--LPRRPAAGPPRRAWSGNLRVGARERLESLMLAR-RSTSDLSSFQGVASASAPAS  128

Query  674   PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMG-NNNAAVLNKSTRSRP  498
             P  GG  VRL++RLPKA+VEKL+ +S+D    E A KIM LC    +  A   K T  RP
Sbjct  129   PLPGGTPVRLRMRLPKAQVEKLMGESRD--AAEAAAKIMELCAAVGDGGACSAKVTPERP  186

Query  497   TAPIPGIIK  471
                 PGI++
Sbjct  187   ----PGILR  191



>ref|XP_009401428.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=197

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 102/163 (63%), Gaps = 11/163 (7%)
 Frame = -2

Query  998  VMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFLV  819
            VM++DG T + K PV A ++++   G+ L++SEAVK  G  A+PLA +  L P ++YFLV
Sbjct  14   VMKIDGTTLKLKAPVQAEDLLRDYRGYDLLESEAVKQLGVGARPLAPDAPLHPGKLYFLV  73

Query  818  AeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP------ESGGG  657
               LP   E+  PRR  S G+ +SA  RLE+L   R +++SD+S    P      E   G
Sbjct  74   --QLPRAPEQRAPRRAWSGGLPVSARERLENLAFTR-RTMSDVSVAGRPSRVEAEEGSDG  130

Query  656  GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAA  528
             VRL+LR+PKAE+EKL+++SK+    E AEKIM LC+  N  A
Sbjct  131  TVRLRLRIPKAEMEKLLQESKN--DTEAAEKIMVLCVAKNGGA  171



>ref|XP_009388226.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=204

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 107/169 (63%), Gaps = 13/169 (8%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
             + KVM+VDG T + K PV+A  V++  PG+ L++SE VK  G +A+PLA +  L+  ++Y
Sbjct  11    IIKVMKVDGTTLKLKPPVNAESVLRDFPGYDLLESEEVKRVGVQARPLARDAPLRSGKLY  70

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDI--------SFMKSP  672
             FLV   LP   ++  PRR  S  +H+SA+ RLESLML R +++SDI        + +++ 
Sbjct  71    FLV--ELPRVPDQRAPRRAWSGPMHLSAKERLESLMLTR-RTMSDILVTGNTTSAAVEAE  127

Query  671   ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAV  525
             E   G +RLK+RLPKAE+EKL+++SK     E A KI  LCM  +  A 
Sbjct  128   EGKDGTIRLKMRLPKAEMEKLMRESKT--ATEAAAKIAELCMVKDGGAT  174



>gb|KDO63111.1| hypothetical protein CISIN_1g0323941mg [Citrus sinensis]
 gb|KDO63112.1| hypothetical protein CISIN_1g0323941mg [Citrus sinensis]
Length=141

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 81/118 (69%), Gaps = 3/118 (3%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T + K P+ A EVVK  PG++L+DSEAVK+FG RAKPL   Q+L+PK+VYF
Sbjct  11    AKVMKIDGETIKLKTPIQASEVVKDYPGYVLLDSEAVKHFGIRAKPLEPRQQLKPKKVYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGV  651
             LV   LP   +     R   SGI MSA+ RLE LML+R ++VSD++ +    S G  V
Sbjct  71    LV--ELPKLPDEEKITRRVRSGIQMSAKDRLECLMLSR-RAVSDLTAVNVRSSHGSEV  125



>ref|XP_009417656.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=199

 Score =   107 bits (268),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 101/157 (64%), Gaps = 12/157 (8%)
 Frame = -2

Query  986  DGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFLVAepl  807
            DG T + K P    + ++ +PGH L+D+E VK  G RA+PL  +  L+P ++YF+V   L
Sbjct  18   DGTTVKLKPPAQTTQALRDHPGHTLLDAEEVKRLGLRARPLDPDAALKPGKLYFMV--EL  75

Query  806  ppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISF-------MKSPESGGGGVR  648
            P   +R  PRR  S  + +SA+ RLESL LAR +S+SD++        +++ E+  G VR
Sbjct  76   PRLPDRRAPRRASSGALRVSAKERLESLRLAR-RSMSDLAIATPAPPSVEAEEAMDGTVR  134

Query  647  LKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
            LK+RLPKA+V++L+++SKD    + A+KIM LC G +
Sbjct  135  LKMRLPKAQVQRLMRESKD--ATDAAQKIMHLCAGKD  169



>ref|XP_010415191.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=217

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 101/159 (64%), Gaps = 9/159 (6%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T   K PV A EV    PG++L+DS+AVK+FG RAKPL   Q L+PK+ YF
Sbjct  12    AKVMKIDGETFRIKTPVTAREVTAEYPGYVLLDSQAVKHFGVRAKPLEPNQVLKPKKTYF  71

Query  824   LVAeplp--pqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISF----MKSPESG  663
             LV  P      +   +P R   SGIH+ A+ RLE LML+R ++VSD++           G
Sbjct  72    LVELPKLPPETDNNKLPCRRVMSGIHVGAKERLEMLMLSR-RTVSDVTIGRSDGGGDGFG  130

Query  662   GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
              G   ++LRLP++++ KL+++S D    ++A+KI+ + M
Sbjct  131   PGHTSVRLRLPRSQITKLMEESND--DSQIADKILGIFM  167



>ref|XP_002445525.1| hypothetical protein SORBIDRAFT_07g020936 [Sorghum bicolor]
 gb|EES15020.1| hypothetical protein SORBIDRAFT_07g020936 [Sorghum bicolor]
Length=227

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 106/166 (64%), Gaps = 15/166 (9%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHI-LVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
             A+VM VDG T +++ P  AG+ ++ +PGH  L++SE V+  G RA+PL  +  L+P ++Y
Sbjct  67    ARVMTVDGATYKYRPPAAAGDALRDHPGHHHLLESEEVRRLGVRARPLDPDAPLKPGKLY  126

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEA--RLESLMLARSKSVSDISFMKSPES----  666
             FLV   LP  + R  P+R  S  +H  A A  RLESLMLAR +S SD++   S  +    
Sbjct  127   FLV--DLPRLQRRRPPQRTWSGALHYGAGAGERLESLMLAR-RSASDVAMSSSVLAASSV  183

Query  665   ---GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
                G G VRL++RLPK +V++L+K+S+D    + AE+IM+LC+  +
Sbjct  184   EAVGDGAVRLRVRLPKTDVQRLVKESRD--AADAAERIMQLCVARD  227



>gb|EEC84556.1| hypothetical protein OsI_31309 [Oryza sativa Indica Group]
Length=235

 Score =   108 bits (269),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 105/183 (57%), Gaps = 28/183 (15%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANP-GHILVDSEAVKNFGFRAKPLAAEQELQPKRV  831
             VAKVM VDG T  ++ P  AG  ++ +P GH L++SE V+  G RA+PL  +  L+P ++
Sbjct  11    VAKVMTVDGATFRYRAPATAGAALRGHPAGHQLLESEEVRRLGVRARPLDRDAPLKPGKL  70

Query  830   YFLV-----AeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFM-----  681
             YFLV     A      ++   PR+  S  +H+ A  RLESLML+R ++VSD++ +     
Sbjct  71    YFLVQLPRGAAGYGGDDDPRAPRKTWSGALHVGARERLESLMLSR-RTVSDMASVVPAAR  129

Query  680   -------------KSPESG-GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMG  543
                           S E G  G VRL++RLPK+EV +L+K SKD    E AE+IM+LC+ 
Sbjct  130   AVAGGGGEPARRPSSVEVGVDGAVRLRMRLPKSEVARLMKDSKD--AAEAAERIMQLCVA  187

Query  542   NNN  534
              + 
Sbjct  188   RDQ  190



>ref|XP_009388031.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=204

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 72/164 (44%), Positives = 107/164 (65%), Gaps = 10/164 (6%)
 Frame = -2

Query  1001  KVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFL  822
             KVM++DG T + K P  A +V++  PG+ L++SE VK  G RA+PL +  +L+  ++YFL
Sbjct  13    KVMKIDGTTLKPKPPARAADVLRDYPGYNLLESEEVKRLGHRARPLDSHAQLETGKLYFL  72

Query  821   VAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISF------MKSPESGG  660
             V E     + +  PRRV S  + +SA+ RLESLMLAR +++SD+S       +++ E+  
Sbjct  73    V-ELPRAPDHQRGPRRVWSGELQVSAKERLESLMLAR-RAMSDLSSVGRSSNVEAEENMD  130

Query  659   GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAA  528
             G +RLK+RLPKAEVEKL++ S++    E AEKIM LC   +  A
Sbjct  131   GSIRLKMRLPKAEVEKLMQDSRN--AIEAAEKIMNLCAVTDGGA  172



>ref|XP_009409256.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=205

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 100/166 (60%), Gaps = 14/166 (8%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM++DG T + K P  A  V++ + GH L++S  V   G RA+PL  +  L+P ++Y
Sbjct  11    TAKVMKIDGTTFKVKPPARAINVLRDHRGHDLLESGEVSRLGLRARPLDPDAPLKPGKLY  70

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISF------MKSPES  666
             FLV         R  PRR  S  + +SA+ RLESL L R +S+SD+S           E+
Sbjct  71    FLV-----ELPTRRAPRRAWSGKLQVSAKERLESLRLTR-RSMSDLSLAGRSFAADVEEA  124

Query  665   GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAA  528
               G VRL++RLPK +VEKL+++S+D    E A+KIMRLC+  + AA
Sbjct  125   KDGAVRLRMRLPKVQVEKLMQESRD--AAEAAQKIMRLCVEKDGAA  168



>dbj|BAD36318.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG98963.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 105/183 (57%), Gaps = 28/183 (15%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANP-GHILVDSEAVKNFGFRAKPLAAEQELQPKRV  831
             VAKVM VDG T  ++ P  AG  ++ +P GH L++SE V+  G RA+PL  +  L+P ++
Sbjct  11    VAKVMTVDGATFRYRAPATAGAALRGHPAGHQLLESEEVRRLGVRARPLDRDAPLKPGKL  70

Query  830   YFLV-----AeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFM-----  681
             YFLV     A      ++   PR+  S  +H+ A  RLESLML+R ++VSD++ +     
Sbjct  71    YFLVQLPRGAAGYGGDDDPRAPRKTWSGALHVGARERLESLMLSR-RTVSDMASVVPAAR  129

Query  680   -------------KSPESG-GGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMG  543
                           S E G  G VRL++RLPK+EV +L+K SKD    E AE+IM+LC+ 
Sbjct  130   AVAGGGGEPARRPSSVEVGVDGAVRLRMRLPKSEVARLMKDSKD--AAEAAERIMQLCVA  187

Query  542   NNN  534
              + 
Sbjct  188   RDQ  190



>ref|NP_001182953.1| uncharacterized protein LOC100501255 [Zea mays]
 gb|ACR35257.1| unknown [Zea mays]
 gb|AFW63817.1| hypothetical protein ZEAMMB73_946324 [Zea mays]
Length=252

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 111/193 (58%), Gaps = 20/193 (10%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAG-EVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
             AKVM++DG +   K P  A  +V++ +PG  L++SE VK  G RA+PLA +  L+  R+Y
Sbjct  12    AKVMQLDGTSFRVKPPAAAAADVLRDHPGFQLLESEEVKLLGARARPLAPDAPLRRGRLY  71

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFM-----------  681
             FLVA            RR  S  +++ A  RLESL LAR +S SD+S +           
Sbjct  72    FLVA-LPRRAPAGGPMRRAWSGNLNVGARERLESLKLAR-RSTSDLSSLPAPAHASASAP  129

Query  680   KSPESGGGG---VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKST  510
              SP  GGGG   VRLK+RLP+A+VEKL+ +SKD    E A KIM LC G   A   + S 
Sbjct  130   ASPLPGGGGATPVRLKMRLPRAQVEKLMGESKD--PAEAAAKIMELC-GAAVAGDAHASA  186

Query  509   RSRPTAPIPGIIK  471
             R+ P  P PGI++
Sbjct  187   RATPDRPRPGILR  199



>dbj|BAB10363.1| unnamed protein product [Arabidopsis thaliana]
Length=219

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 93/157 (59%), Gaps = 7/157 (4%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
              KVM++DG     K PV A +  K  PG +L+DSE VK  G RAKPL   Q L+P   YF
Sbjct  12    VKVMKIDGDIFRLKTPVTASDATKEYPGFVLLDSETVKRLGVRAKPLEPNQILKPNHTYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG----G  657
             LV  P   +  ++  RRV S  IH+ A+ RLE LML+R ++VSD+   +S   G     G
Sbjct  72    LVDLPPVDKRNKLPYRRVMSGNIHVGAKERLEMLMLSR-RTVSDVGAARSDVVGDGPELG  130

Query  656   GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
               R++LRLP++++ KL+++S D    EVA KI+   M
Sbjct  131   HTRVRLRLPRSQITKLMEESHD--ASEVAAKIISAYM  165



>ref|NP_198600.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAS99674.1| At5g37840 [Arabidopsis thaliana]
 gb|AAT41812.1| At5g37840 [Arabidopsis thaliana]
 gb|AED94238.1| uncharacterized protein AT5G37840 [Arabidopsis thaliana]
Length=214

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 79/200 (40%), Positives = 107/200 (54%), Gaps = 17/200 (9%)
 Frame = -2

Query  1001  KVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFL  822
             KVM++DG     K PV A +  K  PG +L+DSE VK  G RAKPL   Q L+P   YFL
Sbjct  13    KVMKIDGDIFRLKTPVTASDATKEYPGFVLLDSETVKRLGVRAKPLEPNQILKPNHTYFL  72

Query  821   VAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG----GG  654
             V  P   +  ++  RRV S  IH+ A+ RLE LML+R ++VSD+   +S   G     G 
Sbjct  73    VDLPPVDKRNKLPYRRVMSGNIHVGAKERLEMLMLSR-RTVSDVGAARSDVVGDGPELGH  131

Query  653   VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM---GNNNAAVLNKSTRSRPTAPIP  483
              R++LRLP++++ KL+++S D    EVA KI+   M   G       N   R R      
Sbjct  132   TRVRLRLPRSQITKLMEESHD--ASEVAAKIISAYMESSGGIQGGRDNDGLRQR-----L  184

Query  482   GI--IKKDLKSSQKRVGFRE  429
             GI  I    K+ +K V F E
Sbjct  185   GIAEINNHYKAREKHVSFAE  204



>ref|XP_009419115.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=197

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 99/161 (61%), Gaps = 10/161 (6%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AK+M++DG T + K P  A  V++ +PGH L++S+ VK    RA+PL  + +LQ  ++YF
Sbjct  12    AKIMKIDGTTFKVKPPAQAITVLRDHPGHALLESDEVKRLALRARPLDPDAQLQRGKLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISF-----MKSPESGG  660
             LV   L     R  PRR  S  + + A+ RLESL L R +SVSD+S      +   E+  
Sbjct  72    LV--ELTQLRGRGAPRRAWSGQLQVGAKERLESLRLTR-RSVSDLSLAGRCSVDVEEAKD  128

Query  659   GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
             G VRL++RLPK +VEKL++ S+D    E A KIM+LC+  +
Sbjct  129   GAVRLRVRLPKVQVEKLMQDSRD--AAEAANKIMQLCVEKD  167



>ref|XP_006391401.1| hypothetical protein EUTSA_v10019620mg, partial [Eutrema salsugineum]
 gb|ESQ28687.1| hypothetical protein EUTSA_v10019620mg, partial [Eutrema salsugineum]
Length=198

 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 99/167 (59%), Gaps = 20/167 (12%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+    K P  A E+    PG++L+DSEAVK+FG RAKPL   Q L+PK+ YF
Sbjct  12    AKVMKIDGEIFRIKTPATAREITADYPGYVLLDSEAVKHFGVRAKPLEPSQILKPKKTYF  71

Query  824   LVAe-----plppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS-----  675
             LV         PP+    +P R   SGIH+ A+ RLE LML+R ++VSD++  +S     
Sbjct  72    LVELPKLPPENPPETNNKLPYRRVMSGIHVGAKERLEMLMLSR-RTVSDVAIARSDGGGD  130

Query  674   -----PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLC  549
                   E     VR  LRLP++++ K +++S D    E+AEKI+ L 
Sbjct  131   GPGLGLEPSQTSVR--LRLPRSQITKFMEESHD--TSEIAEKILSLY  173



>ref|XP_002888502.1| hypothetical protein ARALYDRAFT_475748 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64761.1| hypothetical protein ARALYDRAFT_475748 [Arabidopsis lyrata subsp. 
lyrata]
Length=225

 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 103/166 (62%), Gaps = 15/166 (9%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T   K PV A EV    PG++L+DS+AVK+FG R+KPL   Q L+PK+ YF
Sbjct  12    AKVMKIDGETFRIKTPVTAREVTADYPGYVLLDSQAVKHFGVRSKPLEPSQILKPKKTYF  71

Query  824   LVA------eplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS----  675
             LV       E      +  +P R   SGIH+ A+ RLE LML+R ++VSD++  +S    
Sbjct  72    LVELPKLPPETTATDSDNKLPYRRVMSGIHVGAKERLEMLMLSR-RTVSDVTIGRSDGGD  130

Query  674   ---PESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
                P  G G   ++LRLP++++ KL++++ +     +AEKI+ + M
Sbjct  131   GFGPGLGPGHTSVRLRLPRSQITKLMEENNNDASA-IAEKILGIYM  175



>ref|XP_006390815.1| hypothetical protein EUTSA_v10019172mg [Eutrema salsugineum]
 gb|ESQ28101.1| hypothetical protein EUTSA_v10019172mg [Eutrema salsugineum]
Length=196

 Score =   104 bits (259),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 94/159 (59%), Gaps = 8/159 (5%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AK+M++DG++ + K PV AG VVK  PGH+L +SE+VK+FG RAKPL   Q L+ KR+Y
Sbjct  10    TAKIMKIDGESFKLKTPVKAGTVVKDYPGHVLFESESVKHFGIRAKPLDPHQNLESKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGVR  648
             FLV  P   +E      R   SGI MSA+ RLE+L L+R  S       K          
Sbjct  70    FLVELPRTWKERGPRRVR---SGIQMSAKERLENLKLSRRSSSDLSVMKKEEVDDEEREV  126

Query  647   L---KLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
             L   KL+LPK +VEKL K+S+   G + + KI  LC+ N
Sbjct  127   LSSVKLKLPKWKVEKLRKESES--GSDFSNKITALCLLN  163



>ref|XP_010450546.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=213

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 96/158 (61%), Gaps = 9/158 (6%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
              KVM++DG     K PV A +  K  PGH+L+D E V+  G RAKPL  +Q L+P + YF
Sbjct  12    VKVMKIDGDIFRLKSPVTASDATKEYPGHVLLDPETVRRLGVRAKPLEPDQILRPNKTYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESG-----G  660
             LV  PL  +  ++  RRV S  IH+ A+ RLE LML+R ++VSDI  + S +SG      
Sbjct  72    LVDLPLVDKRNKLPYRRVMSGNIHVGAKERLEMLMLSR-RTVSDIG-VGSLDSGDGPGPA  129

Query  659   GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
             G  R+ LRLP++ + KL+ + +D    EVA +I R+ +
Sbjct  130   GQTRVTLRLPRSHITKLMGECQD--ASEVAARIARVYL  165



>ref|XP_010435694.1| PREDICTED: uncharacterized protein At1g66480 isoform X1 [Camelina 
sativa]
Length=212

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 92/156 (59%), Gaps = 6/156 (4%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
              KVM+++G   + K PV A +  K  PGH+L+D E VK  G RAKPL   + L+P + YF
Sbjct  12    VKVMKINGDIFQLKTPVTASDATKEYPGHVLLDPETVKRLGVRAKPLEPNKILRPNKTYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDI---SFMKSPESGGGG  654
             LV   L  +  ++  RRV S  IH+ A+ RLE LML+R ++VSDI   S       G G 
Sbjct  72    LVELSLVDKRNKLPYRRVMSGNIHVGAKERLEMLMLSR-RTVSDIGVGSLECGDGPGPGP  130

Query  653   VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
              R+ LRLP++ + KL+ + +D    EVA +I R+ +
Sbjct  131   TRVTLRLPRSHITKLMGECQD--ASEVAARIARVHL  164



>ref|XP_010435695.1| PREDICTED: uncharacterized protein At1g66480 isoform X2 [Camelina 
sativa]
Length=200

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 92/155 (59%), Gaps = 6/155 (4%)
 Frame = -2

Query  1001  KVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFL  822
             KVM+++G   + K PV A +  K  PGH+L+D E VK  G RAKPL   + L+P + YFL
Sbjct  13    KVMKINGDIFQLKTPVTASDATKEYPGHVLLDPETVKRLGVRAKPLEPNKILRPNKTYFL  72

Query  821   VAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDI---SFMKSPESGGGGV  651
             V   L  +  ++  RRV S  IH+ A+ RLE LML+R ++VSDI   S       G G  
Sbjct  73    VELSLVDKRNKLPYRRVMSGNIHVGAKERLEMLMLSR-RTVSDIGVGSLECGDGPGPGPT  131

Query  650   RLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
             R+ LRLP++ + KL+ + +D    EVA +I R+ +
Sbjct  132   RVTLRLPRSHITKLMGECQD--ASEVAARIARVHL  164



>ref|XP_010440894.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=212

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 90/156 (58%), Gaps = 6/156 (4%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
              KVM++DG     K PV A +  K  PGH+L+D E VK  G RAKPL   + L+P + YF
Sbjct  12    VKVMKIDGDIFRLKTPVTASDATKEYPGHVLLDPETVKWLGVRAKPLEPNKILRPNKTYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDI---SFMKSPESGGGG  654
             LV   L  +  ++  RRV S  IH+ A+ RLE LML+R ++VSDI   S       G G 
Sbjct  72    LVDLLLVDKRNKLPYRRVMSGNIHVGAKERLEMLMLSR-RTVSDIGVGSLECGDGPGPGR  130

Query  653   VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
              R+ LRLP++ + KL+   +D    EVA +I R+ +
Sbjct  131   TRVTLRLPRSHITKLMGDCQD--ASEVAARIARVHL  164



>ref|XP_002454333.1| hypothetical protein SORBIDRAFT_04g028880 [Sorghum bicolor]
 gb|EES07309.1| hypothetical protein SORBIDRAFT_04g028880 [Sorghum bicolor]
Length=248

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 86/214 (40%), Positives = 118/214 (55%), Gaps = 37/214 (17%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG +   K P  A +V++ +PG  L++SE VK  G RA+PLA +  L+  R+YF
Sbjct  12    AKVMQLDGTSFRVKPPAAAADVLRDHPGFQLLESEEVKLLGARARPLAPDAPLRRGRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK-----------  678
             LVA  LP +      RR  S  +++ A  RLESL LAR +S SD+S +            
Sbjct  72    LVA--LPRRAPAGPMRRAWSGNLNVGARERLESLKLAR-RSTSDLSSLPAHAASASAPTS  128

Query  677   --------SPESGGGG---VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNA  531
                     SP  G GG   VRLK+RLP+A+VEKL+ +SKD    E A KIM LC  + +A
Sbjct  129   PLPGRGAASPLPGAGGATPVRLKMRLPRAQVEKLMGESKD--PAEAAAKIMELCGAHASA  186

Query  530   AVLNKSTRSRPTAPIPGIIK--KDLKSSQKRVGF  435
              V    T  RP    PGI++  +  K+ +   GF
Sbjct  187   RV----TPERP----PGILRSPRFAKTPEWGAGF  212



>ref|XP_002888813.1| hypothetical protein ARALYDRAFT_894932 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65072.1| hypothetical protein ARALYDRAFT_894932 [Arabidopsis lyrata subsp. 
lyrata]
Length=197

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 95/158 (60%), Gaps = 9/158 (6%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AK+M ++G++ + K PV AG VVK  PGHIL++SEAVK FG RAKPL   Q L+ KR+Y
Sbjct  10    TAKIMNINGESFKLKTPVKAGTVVKDFPGHILLESEAVKRFGIRAKPLEPHQNLESKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGVR  648
             F+V     P+  +    R   SGI MSA+ RLE+L L+R  S       K  E      R
Sbjct  70    FMVE---LPRTWKERTPRRVRSGIQMSAKERLENLKLSRRSSSDLSVMKKKTEEVDDEER  126

Query  647   ----LKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
                 +KL+LPK ++EKL K+S+   G + + KI +LC+
Sbjct  127   EVSSVKLKLPKWKIEKLRKESES--GSDFSNKITQLCL  162



>emb|CDX96144.1| BnaA07g25870D [Brassica napus]
Length=223

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 96/159 (60%), Gaps = 13/159 (8%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+    K P  A EV    PG++L+DSEAVK+FG R+KPL   Q L+PK+ YF
Sbjct  12    AKVMKIDGEVFRIKTPATAREVTADYPGYVLLDSEAVKHFGVRSKPLEPSQLLKPKKTYF  71

Query  824   LVAe-----plppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG  660
             LV             +  +P R   SGIH+ A+ RLE LML+R ++VSD++  +S    G
Sbjct  72    LVELPKLPPETTSGTDNKLPLRRVMSGIHVGAKERLEMLMLSR-RTVSDVAVGRSDGGDG  130

Query  659   GG-----VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIM  558
              G       ++ RLP++++ K +++S D    E+A+KI+
Sbjct  131   LGLGPGQTSVRFRLPRSQITKFMEESND--DSEIADKIL  167



>ref|XP_009105210.1| PREDICTED: uncharacterized protein At1g66480 isoform X2 [Brassica 
rapa]
Length=220

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 96/159 (60%), Gaps = 13/159 (8%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+    K P  A EV    PG++L+DSEAVK+FG R+KPL   Q L+PK+ YF
Sbjct  12    AKVMKIDGEVFRIKTPATAREVTADYPGYVLLDSEAVKHFGVRSKPLEPSQLLKPKKTYF  71

Query  824   LVAe-----plppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG  660
             LV             +  +P R   SGIH+ A+ RLE LML+R ++VSD++  +S    G
Sbjct  72    LVELPKLPPETTSGTDNKLPLRRVMSGIHVGAKERLEMLMLSR-RTVSDVAVGRSDGGDG  130

Query  659   GG-----VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIM  558
              G       ++ RLP++++ K +++S D    E+A+KI+
Sbjct  131   LGLGPGQTSVRFRLPRSQITKFMEESND--DSEIADKIL  167



>ref|XP_009105209.1| PREDICTED: uncharacterized protein At1g66480 isoform X1 [Brassica 
rapa]
Length=223

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 96/159 (60%), Gaps = 13/159 (8%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+    K P  A EV    PG++L+DSEAVK+FG R+KPL   Q L+PK+ YF
Sbjct  12    AKVMKIDGEVFRIKTPATAREVTADYPGYVLLDSEAVKHFGVRSKPLEPSQLLKPKKTYF  71

Query  824   LVAe-----plppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG  660
             LV             +  +P R   SGIH+ A+ RLE LML+R ++VSD++  +S    G
Sbjct  72    LVELPKLPPETTSGTDNKLPLRRVMSGIHVGAKERLEMLMLSR-RTVSDVAVGRSDGGDG  130

Query  659   GG-----VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIM  558
              G       ++ RLP++++ K +++S D    E+A+KI+
Sbjct  131   LGLGPGQTSVRFRLPRSQITKFMEESND--DSEIADKIL  167



>gb|ACN25188.1| unknown [Zea mays]
 tpg|DAA61372.1| TPA: hypothetical protein ZEAMMB73_422493 [Zea mays]
Length=232

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 103/183 (56%), Gaps = 26/183 (14%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM VDG T  +K P  A   ++ +PGH L++SE V+  G RA+PL  +  L+P ++YF
Sbjct  12    AKVMTVDGATFRYKTPAAACAALRGHPGHQLLESEEVRRLGVRARPLDRDAPLKPGKLYF  71

Query  824   LVAeplppq---eervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP------  672
             LV  P       ++   PR+  S  + + A  RLE LML+R ++VSD+S +  P      
Sbjct  72    LVQIPRGGAGDGDDPRAPRKTWSGALRVGARERLEGLMLSR-RTVSDVSSILPPPAAARL  130

Query  671   -------------ESGG-GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN  534
                          E G  G VRL++RLPKA+V +L+++S+D    E AE+IM+LC+  + 
Sbjct  131   AAASPSPSPPSSVEVGADGAVRLRMRLPKADVARLMQESRD--PAEAAERIMQLCVARDQ  188

Query  533   AAV  525
               V
Sbjct  189   GVV  191



>gb|EEC73945.1| hypothetical protein OsI_08817 [Oryza sativa Indica Group]
Length=246

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 110/194 (57%), Gaps = 27/194 (14%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG +   K P  A +V++ +PG  L++SE VK  G RA+PLA +  L+  R+YF
Sbjct  12    AKVMQLDGTSFRVKPPAVAADVLRDHPGFQLLESEEVKLLGARARPLAPDAPLRRGRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKS----------  675
             LVA  LP +     PRR  S  + + A  RLESLMLAR +S SD+S   +          
Sbjct  72    LVA--LPRRPAAGPPRRAWSGNLRVGARERLESLMLAR-RSTSDLSSFPAAQASASAPTS  128

Query  674   --PESGGGG----VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKS  513
               P S   G    VRLK+RLP+A+VEKL+ +SKD    E A KIM LC     AA   KS
Sbjct  129   PLPGSACSGAATPVRLKMRLPRAQVEKLMGESKD--ASEAAAKIMELC-----AAAGAKS  181

Query  512   TRSRPTAPIPGIIK  471
                 P  P PGI++
Sbjct  182   ASVTPERP-PGILR  194



>emb|CDX72768.1| BnaC06g32160D [Brassica napus]
Length=195

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 102/160 (64%), Gaps = 10/160 (6%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AK+M++ G++ + + PV AG VVK  PGH+L++SE+VK+FG RAKPL   Q L+ KR+Y
Sbjct  10    TAKIMKITGESFKMQTPVRAGTVVKDFPGHVLLESESVKHFGIRAKPLDPNQNLESKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGG--  654
             F+V     P+  +    R   SGI MSA+ RLE+L L+  +S SD+S MK+ E       
Sbjct  70    FMVE---LPRTWKERAPRRVRSGIQMSAKERLENLKLS-RRSSSDLSVMKNKEVDEEERE  125

Query  653   --VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
                 +KLRLPK +VEKL K+S+   G + ++KI  LC+ N
Sbjct  126   VMTSVKLRLPKWKVEKLRKESE--SGSDFSDKITALCLLN  163



>tpg|DAA61371.1| TPA: hypothetical protein ZEAMMB73_422493 [Zea mays]
Length=256

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 103/183 (56%), Gaps = 26/183 (14%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM VDG T  +K P  A   ++ +PGH L++SE V+  G RA+PL  +  L+P ++YF
Sbjct  12    AKVMTVDGATFRYKTPAAACAALRGHPGHQLLESEEVRRLGVRARPLDRDAPLKPGKLYF  71

Query  824   LVAeplppq---eervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSP------  672
             LV  P       ++   PR+  S  + + A  RLE LML+R ++VSD+S +  P      
Sbjct  72    LVQIPRGGAGDGDDPRAPRKTWSGALRVGARERLEGLMLSR-RTVSDVSSILPPPAAARL  130

Query  671   -------------ESGG-GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN  534
                          E G  G VRL++RLPKA+V +L+++S+D    E AE+IM+LC+  + 
Sbjct  131   AAASPSPSPPSSVEVGADGAVRLRMRLPKADVARLMQESRD--PAEAAERIMQLCVARDQ  188

Query  533   AAV  525
               V
Sbjct  189   GVV  191



>emb|CDY01698.1| BnaC04g30540D [Brassica napus]
Length=212

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/197 (36%), Positives = 108/197 (55%), Gaps = 11/197 (6%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             A VM++DG T   + P    +  K  PG +L DSE+VK +G R KPL     L P + YF
Sbjct  12    ATVMKIDGDTFRLQTPARVSDATKEYPGFVLFDSESVKRYGVRVKPLEPNHILAPNKTYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGV--  651
             LV  P      ++  RRV  SGIH+SA+ RLE LML+R ++VSD++  +S   GG G+  
Sbjct  72    LVELPNLANRNKLPFRRVM-SGIHVSAKERLEMLMLSR-RAVSDVALARS--DGGNGIGS  127

Query  650   ---RLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAPIPG  480
                R+ L+LP++++ +L+ +S D    EV E+I+ L   ++      + +         G
Sbjct  128   GQTRVSLKLPRSQIMRLMGESHD--ASEVTERIISLYRESSGEIQGGQDSNDICWELGAG  185

Query  479   IIKKDLKSSQKRVGFRE  429
              +K + K+ +K V F E
Sbjct  186   DLKNNYKAREKHVSFAE  202



>emb|CDY36204.1| BnaC06g27480D [Brassica napus]
Length=223

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/159 (41%), Positives = 97/159 (61%), Gaps = 13/159 (8%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+    K P  A EV    PG++L+DSEAVK+FG R+KPL   Q L+PK+ YF
Sbjct  12    AKVMKIDGEVFRIKTPATAREVTADYPGYVLLDSEAVKHFGVRSKPLEPSQLLKPKKTYF  71

Query  824   LVAe-----plppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG  660
             LV         P   +  +P R   SGIH+ A+ RLE LML+R ++VSD++  +S    G
Sbjct  72    LVELPKLPPETPSGTDNKLPLRRVMSGIHVGAKERLEMLMLSR-RTVSDVAVGRSDGGDG  130

Query  659   GG-----VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIM  558
              G       ++ RLP++++ K +++S D    E+A+KI+
Sbjct  131   LGLGPGQTSVRFRLPRSQITKFMEESND--DSEIADKIL  167



>ref|XP_006285147.1| hypothetical protein CARUB_v10006491mg [Capsella rubella]
 gb|EOA18045.1| hypothetical protein CARUB_v10006491mg [Capsella rubella]
Length=206

 Score = 99.8 bits (247),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 98/168 (58%), Gaps = 14/168 (8%)
 Frame = -2

Query  1001  KVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFL  822
             KVM++DG     K PV A +  K  PG  L+D+E VK  G RAKPL     L+P + YFL
Sbjct  13    KVMKIDGDIFRLKTPVTASDATKEYPGFALLDAETVKRLGVRAKPLEPNHILRPNKTYFL  72

Query  821   VAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGG---GGV  651
             V  P+  ++ ++  RRV S  IH+ A+ RLE LML+R ++VSDI    S    G   G  
Sbjct  73    VDLPMVDKKNKLPYRRVMSGNIHVGAKERLEMLMLSR-RTVSDIGIASSNNGDGPGPGQT  131

Query  650   RLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM--------GNNNA  531
             R+ L+LP+++++KL+ +S+D    EVA K++ + +        G+NN 
Sbjct  132   RVTLKLPRSQIKKLMGESQD--VSEVAAKLISVYLESSGEIQAGDNNG  177



>ref|NP_683488.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAD55501.1|AC008148_11 Hypothetical protein [Arabidopsis thaliana]
 gb|AAS76267.1| At1g71015 [Arabidopsis thaliana]
 dbj|BAD94951.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD93955.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE35151.1| uncharacterized protein AT1G71015 [Arabidopsis thaliana]
Length=195

 Score = 99.4 bits (246),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 93/157 (59%), Gaps = 8/157 (5%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              A +M ++G++ + K PV+AG VVK  PGH+L++SEAVK  G RAKPL   Q L+ KR+Y
Sbjct  10    TATIMNINGESFKLKTPVEAGTVVKDFPGHVLLESEAVKRLGIRAKPLEPHQNLESKRIY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGVR  648
             F+V     P+  +    R   SGI MSA+ RLE+L L+R  S       K  E       
Sbjct  70    FMVE---LPRTWKERTPRRVRSGIQMSAKERLENLKLSRRSSSDLSVMKKKTEVNDEERE  126

Query  647   ---LKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
                +KL+LPK ++EKL K+S+   G + + KI +LC+
Sbjct  127   VSSVKLKLPKWKIEKLRKESES--GSDFSNKITQLCL  161



>ref|XP_010415796.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=209

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 94/160 (59%), Gaps = 10/160 (6%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM ++G++ + K PV AG VVK  PG++L++SEAVK FG RAKPL   Q L+ KR+Y
Sbjct  10    TAKVMNINGESFKLKTPVKAGTVVKDFPGYVLLESEAVKQFGIRAKPLEPHQNLESKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGVR  648
             F+V  P   +E      R   SGI +SA+ RLE+L L+R  S       K+ E      R
Sbjct  70    FMVELPRTWKERTPRRVR---SGIQISAKERLENLKLSRRSSSDLSVMKKNEEVDHDEER  126

Query  647   ----LKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
                 + L+LPK +VEKL K S   GG + + KI  LC+ N
Sbjct  127   QVSSVTLKLPKWKVEKLRKAS---GGSDFSNKIAALCLLN  163



>ref|XP_009139753.1| PREDICTED: uncharacterized protein At1g66480 [Brassica rapa]
Length=213

 Score = 99.4 bits (246),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 93/156 (60%), Gaps = 11/156 (7%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             A VM++DG T   + P    +  K  PG +L DSE+VK +G R KPL     L P + YF
Sbjct  12    ATVMKIDGDTFRLQTPARVSDATKEYPGFVLFDSESVKRYGVRVKPLEPNHILAPNKTYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGV--  651
             LV  P      ++  RRV  SGIH+SA+ RLE LML+R ++VSD++  +S   GG G+  
Sbjct  72    LVELPNLANRNKLPFRRVM-SGIHVSAKERLEMLMLSR-RAVSDVALARS--DGGNGIGS  127

Query  650   ---RLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRL  552
                R+ L+LP++++ KL+ +S D    EV E+I+ L
Sbjct  128   GQTRVSLKLPRSQIMKLMGESHD--ASEVTERIIAL  161



>ref|XP_008646204.1| PREDICTED: uncharacterized protein At1g66480-like [Zea mays]
 gb|AFW73273.1| hypothetical protein ZEAMMB73_726247 [Zea mays]
Length=253

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 86/215 (40%), Positives = 119/215 (55%), Gaps = 35/215 (16%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG +   K P  A +V++ +PG  L++SE VK  G RA+PLA++  L+  R+YF
Sbjct  12    AKVMQLDGTSFRVKPPAAAADVLRDHPGFQLLESEEVKLLGARARPLASDAPLRRGRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFM---------KSP  672
             LVA  LP +      RR  S  +++ A  RLESL LAR +S SD+S +          SP
Sbjct  72    LVA--LPRRAPAGPMRRAWSGNLNVGARERLESLKLAR-RSTSDLSSLSAHASASAPTSP  128

Query  671   ESGGGG------------VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAA  528
               GG              VR+K+RLP+A+VEKL+ +SKD    EVA KIM LC     AA
Sbjct  129   LPGGAASPLPPTGSGATPVRVKMRLPRAQVEKLMGESKD--PAEVAAKIMELC----GAA  182

Query  527   VLNKSTRSR--PTAPIPGIIKKD--LKSSQKRVGF  435
             V +    +R  P  P PGI++     K+ +   GF
Sbjct  183   VCDAHASARVIPERP-PGILRSQRFAKTPEWGAGF  216



>ref|XP_010427914.1| PREDICTED: uncharacterized protein At1g66480-like [Camelina sativa]
Length=211

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 102/175 (58%), Gaps = 9/175 (5%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AKVM ++G++ + K PV AG VVK  PG++L++SEAV+ FG RAKPL   Q L+ KR+Y
Sbjct  10    TAKVMNINGESFKLKTPVKAGTVVKDFPGYVLLESEAVRQFGIRAKPLEPHQNLESKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGVR  648
             F+V  P   +E      R   SGI +SA+ RLE+L L+R  S       K+ E      R
Sbjct  70    FMVELPRTWKERTPRRVR---SGIQISAKERLENLKLSRRSSSDLSVMKKNEEVDHDEER  126

Query  647   ----LKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPT  495
                 + L+LPK +VEKL K+S++  G + + KI  LC+ N  + ++++     P 
Sbjct  127   QVSSVTLKLPKWKVEKLRKESEN--GSDFSNKIAALCLLNIPSGLIHQRQHLLPN  179



>ref|XP_009105768.1| PREDICTED: uncharacterized protein At1g66480 [Brassica rapa]
 emb|CDX96294.1| BnaA07g29050D [Brassica napus]
Length=195

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 94/159 (59%), Gaps = 8/159 (5%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              AK+M++ G++ + + PV AG VVK  PGH+L++SE+VK+FG RAKPL   Q L  KR+Y
Sbjct  10    TAKIMKITGESFKMQTPVRAGTVVKDFPGHVLLESESVKHFGIRAKPLDPNQNLVSKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGVR  648
             F+V     P+  +    R   SGI MSA+ RLE+L L+R  S       K          
Sbjct  70    FMVE---LPRTWKERAPRRVRSGIQMSAKERLENLKLSRRSSSDLSVMKKEEVDEEEREV  126

Query  647   L---KLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
             +   KLRLPK +VEKL K+S+   G + ++KI  LC+ N
Sbjct  127   MTSVKLRLPKWKVEKLRKESES--GSDFSDKITALCLLN  163



>ref|XP_008457131.1| PREDICTED: uncharacterized protein At1g66480-like [Cucumis melo]
Length=164

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/156 (37%), Positives = 91/156 (58%), Gaps = 12/156 (8%)
 Frame = -2

Query  995  MRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFLVA  816
            M+++G+T +  +P  A EV    P H+L +S+++  FG RAKPL    +L+PK +YFL+ 
Sbjct  1    MKINGETFKITLPTTAYEVTSHYPNHLLYESKSLNQFGLRAKPLDPHCQLRPKTLYFLLQ  60

Query  815  eplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMK-SPES------GGG  657
              LP         R   S +H+SA  RLE L+L+R +SVSD+  ++  P+          
Sbjct  61   --LPTLYGVDRSLRRTCSDLHLSASDRLECLLLSR-RSVSDLQTLRFDPQRSLIHDGAAK  117

Query  656  GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLC  549
             V++K +LP+AE E+L+K+ K+    EV +KI+  C
Sbjct  118  SVQVKFQLPRAEFERLMKECKN--NVEVTKKIVDFC  151



>ref|XP_003570504.1| PREDICTED: uncharacterized protein At1g66480-like [Brachypodium 
distachyon]
Length=260

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 80/205 (39%), Positives = 107/205 (52%), Gaps = 36/205 (18%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG +   K P  A +V++ +PG  L++SE VK  G RA+PLA +  L+  ++YF
Sbjct  12    AKVMQLDGTSFRVKPPAAAADVLRDHPGFQLLESEEVKLLGARARPLAHDAPLRRGKLYF  71

Query  824   LVAeplppq--eervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGG--  657
             LVA P  P        PRR  S  + + A  RLESLML R +S SD+S  +   S     
Sbjct  72    LVALPRRPSGGGRAGPPRRAWSGNLRVGARERLESLMLTR-RSTSDLSSFQGGASASAPT  130

Query  656   -----------------------GVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCM  546
                                     VRLK+RLPKA+VEKL+ +S+D    E A KIM LC 
Sbjct  131   SPLPGGIGIGIGIGGGGGGGGGTPVRLKMRLPKAQVEKLMGESRD--AAEAAAKIMELC-  187

Query  545   GNNNAAVLNKSTRSRPTAPIPGIIK  471
                 AAV +   R  P  P PGI++
Sbjct  188   ----AAVGDGGARVTPERP-PGILR  207



>ref|XP_009390356.1| PREDICTED: uncharacterized protein At1g66480-like [Musa acuminata 
subsp. malaccensis]
Length=195

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 88/155 (57%), Gaps = 4/155 (3%)
 Frame = -2

Query  998  VMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFLV  819
            VM +DG     K P  AG+V++ +PGH +++++ VK  G RA PL + Q L+P ++YFL 
Sbjct  17   VMTLDGAVIRLKPPAAAGDVLRDHPGHSVLEADEVKRLGVRATPLDSTQPLEPGKLYFLA  76

Query  818  AeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGVRLKL  639
              P P     +       +    SA  RLE+L L+R +  + ++   +   GGG VR+++
Sbjct  77   ELPRPLDRRGLRRASSVVAAARGSATDRLENLRLSRPRRSASLAVETA--EGGGAVRVRV  134

Query  638  RLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN  534
            RLP A V KL+++S D  G E AE+I+ L +   +
Sbjct  135  RLPAARVAKLLQESAD--GTEAAERIVELYLAEKS  167



>ref|XP_006302856.1| hypothetical protein CARUB_v10020986mg [Capsella rubella]
 gb|EOA35754.1| hypothetical protein CARUB_v10020986mg [Capsella rubella]
Length=193

 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 96/159 (60%), Gaps = 9/159 (6%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               K+M ++G++ + K PV AG V+K  PGH+L++SEAV+ FG RAKPL   Q L+ KR+Y
Sbjct  10    TTKIMNINGESFKLKTPVKAGTVIKDFPGHVLLESEAVRQFGVRAKPLEPHQNLESKRLY  69

Query  827   FLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGVR  648
             F+V  P   +E      R   SGI +SA+ RLE+L     +S SD+S MK+ E       
Sbjct  70    FMVELPRTWKERTPRRVR---SGIQISAKERLENLK-LSRRSSSDLSVMKTEEVDDKERE  125

Query  647   LK---LRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
             +    L+LPK +VEKL K+S+   G + + K+  LC+ N
Sbjct  126   VSSVTLKLPKWKVEKLRKESE--SGSDFSNKMAALCLLN  162



>gb|KGN57888.1| hypothetical protein Csa_3G368690 [Cucumis sativus]
Length=198

 Score = 93.2 bits (230),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 59/161 (37%), Positives = 94/161 (58%), Gaps = 13/161 (8%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               KVM+++G+T +  +P  A EV    P H+L +S+++K FG RAKPL     L+PK +Y
Sbjct  15    TTKVMKINGETIKITLPTTAYEVTSHYPSHLLYESKSLKLFGLRAKPLDPHCHLEPKTLY  74

Query  827   FLVAeplppqeervvprrvRSSGIH-MSAEARLESLMLARSKSVSDISFMK------SPE  669
             FL+   LP         R   S +H +SA  RLE L+L+R +S+SD+  ++      S +
Sbjct  75    FLL--QLPTLPRDHCSLRRTCSDLHNLSASDRLECLLLSR-RSLSDLQTLRFDPQRSSTD  131

Query  668   SGGGG-VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLC  549
              G    V++K +LP+AE E+L+K+ K+    EV ++I+  C
Sbjct  132   DGAAKPVQVKFQLPRAEFERLMKECKN--KVEVTKRIVDYC  170



>gb|KFK41526.1| hypothetical protein AALP_AA2G141000 [Arabis alpina]
Length=199

 Score = 93.2 bits (230),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 94/156 (60%), Gaps = 6/156 (4%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
              K+M+++G++ + K PV A  VVK  PGH++ +SE+VK+FG RAKPL   Q L+ KR+YF
Sbjct  11    VKIMKINGESFKLKTPVKASTVVKDFPGHVVFESESVKHFGIRAKPLDPHQNLESKRLYF  70

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGV-R  648
             +V     P+  +    R   SGI MSA+ RLE+L L+R  S       K  E     +  
Sbjct  71    MVE---LPRTCKERGPRRVRSGIEMSAKERLENLKLSRRSSSDLSVMKKDEEREVMMMSS  127

Query  647   LKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
             +KL+LPK +VEKL K+S+     + + KI +LC+ N
Sbjct  128   VKLKLPKWKVEKLRKESE--SVSDFSNKITKLCLLN  161



>ref|XP_003572217.1| PREDICTED: uncharacterized protein At1g66480-like [Brachypodium 
distachyon]
Length=260

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 67/186 (36%), Positives = 96/186 (52%), Gaps = 30/186 (16%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              A+VM VDG T +++ P  A   ++ +PGH L++SE V+  G RA+PL A+  L+P ++Y
Sbjct  13    TARVMTVDGTTYKYRPPAAACAALREHPGHQLLESEDVRRLGVRARPLDADAPLKPGKLY  72

Query  827   FLVAeplppqeervvprrvRSS---GIHMSAEARLESLMLA-------------------  714
             FLVA P      R   R    +   G    A  RLE LML+                   
Sbjct  73    FLVALPRLAARARAPQRTWSGALLGGSGSCAGERLERLMLSSSSRRSASDVAAAVASPMW  132

Query  713   RSKSVSDISFMKSPESGG------GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRL  552
             R  +    + + SP S        G VRL++RLPKAEV +L+++SKD    E AE+IMRL
Sbjct  133   RRSASDVAAAVASPLSASVEAAADGAVRLRMRLPKAEVARLLEESKD--ADEAAERIMRL  190

Query  551   CMGNNN  534
             C+  + 
Sbjct  191   CVDRDQ  196



>ref|XP_009127841.1| PREDICTED: uncharacterized protein At1g66480-like [Brassica rapa]
Length=202

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 97/172 (56%), Gaps = 10/172 (6%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               K+M+++G++ + K PV AG VVK  PGH+L +SE+VK FG RAKPL  +Q LQ KR+Y
Sbjct  10    TVKIMKINGKSFKLKTPVKAGTVVKDFPGHVLFESESVKRFGIRAKPLDPKQYLQSKRIY  69

Query  827   FLVAeplppqeervvprrvRSS-------GIHMSAEARLESL-MLARSKSVSDISFMKSP  672
             F+V  P    +     RR +         GI M A+ RLE+L +  RS S   +    + 
Sbjct  70    FMVELPSTGSDRNPRGRRWKKRTPRRVRLGIRMGAKERLENLKLSRRSSSDLSVIKEVAE  129

Query  671   ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNK  516
             E       +KL+LPK +VEKL K+S+     +   KI  LC+ N ++ + ++
Sbjct  130   EEKEVVTSVKLKLPKWKVEKLWKESES--VSDFYNKITALCLLNVSSGLFHQ  179



>ref|XP_004151549.1| PREDICTED: uncharacterized protein At1g66480-like [Cucumis sativus]
Length=180

 Score = 89.7 bits (221),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 92/157 (59%), Gaps = 13/157 (8%)
 Frame = -2

Query  995  MRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFLVA  816
            M+++G+T +  +P  A EV    P H+L +S+++K FG RAKPL     L+PK +YFL+ 
Sbjct  1    MKINGETIKITLPTTAYEVTSHYPSHLLYESKSLKLFGLRAKPLDPHCHLEPKTLYFLLQ  60

Query  815  eplppqeervvprrvRSSGIH-MSAEARLESLMLARSKSVSDISFMK------SPESGGG  657
              LP         R   S +H +SA  RLE L+L+R +S+SD+  ++      S + G  
Sbjct  61   --LPTLPRDHCSLRRTCSDLHNLSASDRLECLLLSR-RSLSDLQTLRFDPQRSSTDDGAA  117

Query  656  G-VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLC  549
              V++K +LP+AE E+L+K+ K+    EV ++I+  C
Sbjct  118  KPVQVKFQLPRAEFERLMKECKN--KVEVTKRIVDYC  152



>ref|XP_004169622.1| PREDICTED: uncharacterized protein At1g66480-like [Cucumis sativus]
Length=180

 Score = 89.7 bits (221),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 57/157 (36%), Positives = 92/157 (59%), Gaps = 13/157 (8%)
 Frame = -2

Query  995  MRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFLVA  816
            M+++G+T +  +P  A EV    P H+L +S+++K FG RAKPL     L+PK +YFL+ 
Sbjct  1    MKINGETIKITLPTTAYEVTSHYPSHLLYESKSLKLFGLRAKPLDPHCHLEPKTLYFLL-  59

Query  815  eplppqeervvprrvRSSGIH-MSAEARLESLMLARSKSVSDISFMK------SPESGGG  657
              LP         R   S +H +SA  RLE L+L+R +S+SD+  ++      S + G  
Sbjct  60   -QLPALPRDHCSLRRTCSDLHNLSASDRLECLLLSR-RSLSDLQTLRFDPQRSSTDDGAA  117

Query  656  G-VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLC  549
              V++K +LP+AE E+L+K+ K+    EV ++I+  C
Sbjct  118  KPVQVKFQLPRAEFERLMKECKN--KVEVTKRIVDYC  152



>emb|CDY09510.1| BnaC02g20520D [Brassica napus]
Length=202

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 97/172 (56%), Gaps = 10/172 (6%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               K+M+++G++ + K PV AG VVK  PGH+L +SE+VK FG RAKPL  +Q LQ KR+Y
Sbjct  10    TVKIMKINGKSFKLKTPVKAGTVVKDFPGHVLFESESVKRFGIRAKPLDPKQYLQSKRIY  69

Query  827   FLVAeplppqeervvprrvRSS-------GIHMSAEARLESL-MLARSKSVSDISFMKSP  672
             F+V  P    +     RR +         GI M A+ RLE+L +  RS S   +    + 
Sbjct  70    FMVELPSTGSDRNPRGRRWKERTPRRVRLGIKMGAKERLENLKLSRRSSSDLSVIKEVAE  129

Query  671   ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNK  516
             E       +KL+LPK +VEKL K+S+     +   KI  LC+ N  + ++++
Sbjct  130   EEKEVVTSVKLKLPKWKVEKLWKESES--VSDFYNKITALCLLNVPSGLIHQ  179



>gb|EYU44582.1| hypothetical protein MIMGU_mgv1a025559mg [Erythranthe guttata]
Length=181

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 101/166 (61%), Gaps = 13/166 (8%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANP-GHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
             AK+M+V+G+T + K+P  A +V+K  P G++L++S+ VK +G RA  L   +E++P + Y
Sbjct  12    AKIMKVNGETFKLKVPATATDVLKDYPAGYVLLESKTVKRYGVRAPELEPGEEIRPGKTY  71

Query  827   FLVAeplppqeervvprrvRSSGIHMS-AEARLESLMLARSKS-----VSDISFMKSPES  666
             FL+  P  P+      R    S ++ S AE RL+ LML R KS     VS         +
Sbjct  72    FLLEMPKFPEPRTRRSR----SVVYRSGAEERLDGLMLRRQKSSALEMVSGSGLGLGSGT  127

Query  665   GGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAA  528
             G   VR++LR+PKA++ K++++SKD   GEV E+I+ LC+  + ++
Sbjct  128   GSDSVRVRLRIPKAQMVKMMRESKD--EGEVTERIVDLCLQKSRSS  171



>emb|CDY03707.1| BnaA02g15300D [Brassica napus]
Length=202

 Score = 87.4 bits (215),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 91/164 (55%), Gaps = 10/164 (6%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               K+M+++G++ + K PV AG V+K  PGH+L +SE+VK FG RAKPL  +Q LQ KR+Y
Sbjct  10    TVKIMKINGKSFKLKTPVKAGTVIKDFPGHVLFESESVKRFGIRAKPLDPKQYLQSKRIY  69

Query  827   FLVAeplppqeervvprrvRSS-------GIHMSAEARLESL-MLARSKSVSDISFMKSP  672
             F+V  P    +     RR +         G  M A+ RLE+L +  RS S   +    + 
Sbjct  70    FMVELPSTGSDRNPRGRRWKERTPRRVRLGTRMGAKERLENLKLSRRSSSDLSVIKEVAE  129

Query  671   ESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGN  540
             E       +KL+LPK +VEKL K+S+     +   KI  LC+ N
Sbjct  130   EEKEVVTSVKLKLPKWKVEKLWKESES--VSDFYNKITALCLLN  171



>ref|XP_008664670.1| PREDICTED: uncharacterized protein At1g66480-like isoform X2 
[Zea mays]
Length=271

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 97/168 (58%), Gaps = 15/168 (9%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPG--HILVDSEAVKNFGFRAKPLAAEQELQPKRV  831
             A+VM VDG T +++ P  AG+ ++ +PG  + L++SE V+  G RA+PL  +  L+P ++
Sbjct  56    ARVMTVDGTTYKYRAPAAAGDALREHPGKGNHLLESEEVRRLGLRARPLDPDAPLKPGKL  115

Query  830   YFLV-----AeplppqeervvprrvRSSGIHMSAEA----RLESLMLARSKSVSDISFMK  678
             YFLV     +           P+R  S  +H  A A    RLESLMLAR  +    +   
Sbjct  116   YFLVELPPPSSAAHHHRRARAPQRTWSGALHYGAVAGAGERLESLMLARRSASDVAASSS  175

Query  677   SPESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN  534
               +  GG +RL++RLPKA+V++L+  S+D    + AE+IM+LC+  + 
Sbjct  176   VGD--GGALRLRVRLPKADVQRLVDDSRD--AADAAERIMQLCVARDQ  219



>ref|XP_008664669.1| PREDICTED: uncharacterized protein At1g66480-like isoform X1 
[Zea mays]
Length=284

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 97/168 (58%), Gaps = 15/168 (9%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPG--HILVDSEAVKNFGFRAKPLAAEQELQPKRV  831
             A+VM VDG T +++ P  AG+ ++ +PG  + L++SE V+  G RA+PL  +  L+P ++
Sbjct  56    ARVMTVDGTTYKYRAPAAAGDALREHPGKGNHLLESEEVRRLGLRARPLDPDAPLKPGKL  115

Query  830   YFLV-----AeplppqeervvprrvRSSGIHMSAEA----RLESLMLARSKSVSDISFMK  678
             YFLV     +           P+R  S  +H  A A    RLESLMLAR  +    +   
Sbjct  116   YFLVELPPPSSAAHHHRRARAPQRTWSGALHYGAVAGAGERLESLMLARRSASDVAASSS  175

Query  677   SPESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN  534
               +  GG +RL++RLPKA+V++L+  S+D    + AE+IM+LC+  + 
Sbjct  176   VGD--GGALRLRVRLPKADVQRLVDDSRD--AADAAERIMQLCVARDQ  219



>tpg|DAA49037.1| TPA: hypothetical protein ZEAMMB73_148814 [Zea mays]
Length=286

 Score = 87.8 bits (216),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 61/167 (37%), Positives = 97/167 (58%), Gaps = 15/167 (9%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPG--HILVDSEAVKNFGFRAKPLAAEQELQPKRV  831
             A+VM VDG T +++ P  AG+ ++ +PG  + L++SE V+  G RA+PL  +  L+P ++
Sbjct  56    ARVMTVDGTTYKYRAPAAAGDALREHPGKGNHLLESEEVRRLGLRARPLDPDAPLKPGKL  115

Query  830   YFLV-----AeplppqeervvprrvRSSGIHMSAEA----RLESLMLARSKSVSDISFMK  678
             YFLV     +           P+R  S  +H  A A    RLESLMLAR  +    +   
Sbjct  116   YFLVELPPPSSAAHHHRRARAPQRTWSGALHYGAVAGAGERLESLMLARRSASDVAASSS  175

Query  677   SPESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNN  537
               +  GG +RL++RLPKA+V++L+  S+D    + AE+IM+LC+  +
Sbjct  176   VGD--GGALRLRVRLPKADVQRLVDDSRD--AADAAERIMQLCVARD  218



>ref|XP_010693823.1| PREDICTED: uncharacterized protein At1g66480-like [Beta vulgaris 
subsp. vulgaris]
Length=216

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/168 (32%), Positives = 85/168 (51%), Gaps = 12/168 (7%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM+++G+  +F  P    ++ K  P HIL+DSE    F  RAKPL  E +L+P+++Y 
Sbjct  13    AKVMKINGEFFKFNTPAKVIDITKDYPDHILLDSEEFLRFNLRAKPLNPEYQLKPRKIYL  72

Query  824   LV---AeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGG  654
             LV     P              +    +S  +  + L +    +V   SF    +  GG 
Sbjct  73    LVDLPKFPNNNLRRVQSSVLANTVTTRVSRRSVSDDLTIKTRSTVDMRSFDDDDDENGGS  132

Query  653   -------VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNA  531
                     R+K+RL K +VEK++++S D    EVA+KI+RLC+  + A
Sbjct  133   HSPVVGPTRVKMRLRKTQVEKIMEESSD--DVEVAKKIVRLCLEQSTA  178



>ref|XP_006656858.1| PREDICTED: uncharacterized protein LOC102699696 [Oryza brachyantha]
Length=218

 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 75/160 (47%), Gaps = 52/160 (33%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG     K P  AG V++ +PG  L++SE VK  G RA+PLA +  L+P R+YF
Sbjct  12    AKVMQLDGTAFRVKPPAFAGTVLRDHPGFQLLESEEVKLLGVRARPLAHDAPLRPGRLYF  71

Query  824   LVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPESGGGGVRL  645
             L                                                   S GG VRL
Sbjct  72    LA--------------------------------------------------SEGGPVRL  81

Query  644   KLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAV  525
             ++RLPKA+VE+L+ +S+D    E A KIM+LC   N  AV
Sbjct  82    RMRLPKAQVERLMGESRD--SAEAAAKIMQLCAAANGGAV  119



>gb|EAZ36542.1| hypothetical protein OsJ_20883 [Oryza sativa Japonica Group]
Length=277

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 89/164 (54%), Gaps = 16/164 (10%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG     K P  AG V++ +PG  L++SE VK  G RA+PLA +  L+P R+YF
Sbjct  12    AKVMQLDGTAFRVKPPAFAGTVLRDHPGFQLLESEEVKLLGVRARPLAHDAPLRPGRLYF  71

Query  824   LVAeplp---------pqeervvprrvRSSGIHMSAEARLESLMLARSK---SVSDISFM  681
             LVA P P             R      R +  H     R     L   +   +V D+  +
Sbjct  72    LVALPRPRAPPRAALVRGATRRRAGAARVADAHPPVHLRPLPPGLGGGRDRAAVPDVHRL  131

Query  680   KSPESGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLC  549
             ++    GG VRL++RLPKA+VEKL+ +S+D    E A KIM+LC
Sbjct  132   RA--RAGGPVRLRMRLPKAQVEKLMGESRD--SAEAAAKIMQLC  171



>ref|XP_010497880.1| PREDICTED: uncharacterized protein At1g66480-like, partial [Camelina 
sativa]
Length=87

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKVM++DG+T   K PV A EV    PG++L+DS+AVK+FG RAKPL   Q L+PK+ YF
Sbjct  12    AKVMKIDGETFRIKTPVTAREVTAEYPGYVLLDSQAVKHFGVRAKPLEPNQVLKPKKTYF  71

Query  824   LV  819
             LV
Sbjct  72    LV  73



>emb|CDX75954.1| BnaC03g40370D [Brassica napus]
Length=124

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
               K+M+++G++ + K PV AG V+K  PGH+L +SE+VK FG RAKPL  +Q LQ KR+Y
Sbjct  10    TVKIMKINGKSFKLKTPVKAGTVIKDFPGHVLFESESVKRFGIRAKPLDPKQYLQSKRIY  69

Query  827   FLV  819
             F+V
Sbjct  70    FMV  72



>ref|XP_011099483.1| PREDICTED: uncharacterized protein At1g66480-like [Sesamum indicum]
Length=147

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 95/167 (57%), Gaps = 32/167 (19%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANP-GHILVDSEAVKNFGFRAKPLAAEQELQPKRV  831
              AK+M++DGQT + K P  A +V+K  P  ++L++ E+VK FG RA  L   +EL+P ++
Sbjct  11    TAKIMKIDGQTFKLKAPAIAMDVLKDYPPTYVLLEHESVKRFGIRAPELQPGEELKPGKI  70

Query  830   YFLVAeplppqeervvprrvRSSGIHMSAEARLESLMLARSKSVSDISFMKSPE-SGGGG  654
             YFLV  P                          E    ARS+    ++ M+S   SG G 
Sbjct  71    YFLVEMP--------------------------EFPEAARSRRARSVARMRSGMGSGAGR  104

Query  653   VRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKS  513
             VR+K+++P+A++EK++++S+D    EV E+I+ LC+   N+AV+++ 
Sbjct  105   VRVKIKVPRAQIEKVMEESRD--DAEVGERIVELCL--KNSAVVSRD  147



>gb|EAZ42812.1| hypothetical protein OsJ_27397 [Oryza sativa Japonica Group]
Length=145

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 80/135 (59%), Gaps = 10/135 (7%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
              A+VM VDG T +++ P  A   ++ +PG+ +++SE V+  G RA+PL A+  L+P ++Y
Sbjct  12    TARVMTVDGTTYKYRPPASAAAALRDHPGYQVLESEEVRRLGMRARPLDADAPLKPGKLY  71

Query  827   FLVAeplppqeervvprrvRSSGIHM-SAEARLESLMLARSKSVSDI--SFMKSPESGGG  657
             FLV     P+  R   R    + +H+  A  RLES+ML+R +S SD+  S + S E+G G
Sbjct  72    FLV---ELPRLARAPRRTWSGALVHVGGAGERLESMMLSR-RSASDVAASPVSSVEAGEG  127

Query  656   GVRLKLRLPKAEVEK  612
             G    +RLP A   +
Sbjct  128   GA---VRLPDAAAPR  139



>gb|AAL16667.1|AF419849_1 unknown [Musa acuminata AAA Group]
Length=96

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVY  828
             +AKVM+VDG T + K PV A  V++ +PG+ L+D++ V   G RA PL  +  L+P ++Y
Sbjct  11    IAKVMKVDGTTFKLKPPVQAVSVLRDHPGYNLLDADEVTRLGVRAMPLEPDTSLKPGKLY  70

Query  827   FLV  819
             FLV
Sbjct  71    FLV  73



>dbj|BAK00045.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=226

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 58/102 (57%), Gaps = 16/102 (16%)
 Frame = -2

Query  761  GIHMSAEARLESLMLARSKSVSDISFMKSPESG------------GGGVRLKLRLPKAEV  618
            G   + + RLESLML R +S SD++F  S  +G            GG V+L++RLPKA+V
Sbjct  21   GEEAAKDKRLESLMLTR-RSTSDLTFPTSAGAGTAPSSPMSSASEGGPVQLRMRLPKAQV  79

Query  617  EKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTA  492
             KL+ +S+D    E A KIM+LC   N A    +S R  PTA
Sbjct  80   AKLMGESRD--AAEAAAKIMQLCAA-NGAVTPERSPRFLPTA  118



>emb|CDX74556.1| BnaA04g08330D [Brassica napus]
Length=123

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 65/115 (57%), Gaps = 6/115 (5%)
 Frame = -2

Query  764  SGIHMSAEARLESLMLARSKSVSDISFMKSPESGG---GGVRLKLRLPKAEVEKLIKQSK  594
            SGIH+SA+ RLE LML+R ++VSD++  +S    G   G  R+ L+LP++++ +L+ +S 
Sbjct  2    SGIHVSAKERLEMLMLSR-RAVSDVALARSDGGNGIGSGQTRVSLKLPRSQIMRLMGESH  60

Query  593  DGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTAPIPGIIKKDLKSSQKRVGFRE  429
            D    EV E+I+ L   ++      + +         G +K + K+ +K V F E
Sbjct  61   D--ASEVTERIISLYRESSGEIQGGQDSNDICWELGAGDLKNNYKAREKHVSFAE  113



>ref|XP_008241872.1| PREDICTED: uncharacterized protein LOC103340255 [Prunus mume]
Length=130

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = -2

Query  998  VMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFLV  819
            V+ VDG+  E K+P  A  +   NP H L +SE + + G     +  E+ELQP ++YFL+
Sbjct  33   VIHVDGRMQELKLPTQAKHITSQNPNHFLCNSETM-SVGTCVPHVPEEEELQPGQIYFLL  91



>ref|XP_007203096.1| hypothetical protein PRUPE_ppa023721mg [Prunus persica]
 gb|EMJ04295.1| hypothetical protein PRUPE_ppa023721mg [Prunus persica]
Length=130

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 35/60 (58%), Gaps = 1/60 (2%)
 Frame = -2

Query  998  VMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYFLV  819
            V+ VDG+  E K+P  A  +   NP H L +SE + + G     +  E+ELQP ++YFL+
Sbjct  33   VIHVDGRMQELKLPTQAKHITSQNPNHFLCNSETM-SVGTCVPNVPEEEELQPGQIYFLL  91



>ref|XP_007047087.1| Uncharacterized protein TCM_000492 [Theobroma cacao]
 gb|EOX91244.1| Uncharacterized protein TCM_000492 [Theobroma cacao]
Length=138

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 37/62 (60%), Gaps = 1/62 (2%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKV+ +DG+  EF+ P+ A  VV  NP   L  SE + + G     L  ++ELQP ++YF
Sbjct  36    AKVVHIDGRVQEFRQPIQAKGVVSQNPNCFLCSSECM-SVGTCVPRLPDDEELQPGQIYF  94

Query  824   LV  819
             L+
Sbjct  95    LL  96



>ref|XP_006660146.1| PREDICTED: uncharacterized protein LOC102701652 [Oryza brachyantha]
Length=152

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/59 (39%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  1007  VAKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRV  831
              A+VM VDG T +++ P  AG  ++ +PG+ L++SE V+  G RA+PL A+ + +  R+
Sbjct  11    TARVMTVDGATYKYRPPAVAGAALRDHPGYQLLESEEVRRLGMRARPLDADPKAEVARL  69



>gb|EMS56085.1| hypothetical protein TRIUR3_29230 [Triticum urartu]
Length=150

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 3/59 (5%)
 Frame = -2

Query  668  SGGGGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNNAAVLNKSTRSRPTA  492
            S GG V+L++RLPKA+V KL+ +S+D    E A KIM+LC   N A    +S R  PTA
Sbjct  5    SEGGPVQLRMRLPKAQVAKLMGESRD--AAEAAAKIMQLCAA-NGAVTPERSPRFLPTA  60



>ref|XP_010942043.1| PREDICTED: uncharacterized protein LOC105060128 [Elaeis guineensis]
Length=142

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = -2

Query  1004  AKVMRVDGQTTEFKIPVDAGEVVKANPGHILVDSEAVKNFGFRAKPLAAEQELQPKRVYF  825
             AKV+ +DG   E++  V AG+VV  NPG+ +   EA++  G   + +A  +ELQP ++YF
Sbjct  22    AKVIHLDGSLEEYQGTVRAGQVVARNPGYYVCAGEAME-VGDHPQEVAEAEELQPGQLYF  80

Query  824   LV  819
             L+
Sbjct  81    LL  82



>ref|NP_001063126.2| Os09g0403000 [Oryza sativa Japonica Group]
 dbj|BAD36317.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25040.2| Os09g0403000 [Oryza sativa Japonica Group]
Length=124

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 2/42 (5%)
 Frame = -2

Query  659  GGVRLKLRLPKAEVEKLIKQSKDGGGGEVAEKIMRLCMGNNN  534
            G VRL++RLPK+EV +L+K SKD    E AE+IM+LC+  + 
Sbjct  40   GAVRLRMRLPKSEVARLMKDSKD--AAEAAERIMQLCVARDQ  79



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2557218196608