BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16452_g1_i2 len=673 path=[1:0-496 2256:497-594 2178:595-607
2401:608-672]

Length=673
                                                                      Score     E

dbj|BAD18094.1|  NBS-LRR protein                                      62.4    2e-08   Ipomoea batatas [batate]
emb|CDP16515.1|  unnamed protein product                              62.4    5e-08   
emb|CDP16510.1|  unnamed protein product                              62.0    8e-08   
emb|CDP11186.1|  unnamed protein product                              59.7    4e-07   
emb|CDP19728.1|  unnamed protein product                              59.7    5e-07   
ref|XP_009777085.1|  PREDICTED: putative late blight resistance p...  57.8    2e-06   
gb|EYU17666.1|  hypothetical protein MIMGU_mgv1a021453mg              57.8    2e-06   
emb|CDP19794.1|  unnamed protein product                              57.8    2e-06   
ref|XP_009608888.1|  PREDICTED: putative late blight resistance p...  57.4    2e-06   
ref|XP_009777084.1|  PREDICTED: putative late blight resistance p...  57.0    3e-06   
ref|XP_011071841.1|  PREDICTED: putative late blight resistance p...  57.0    3e-06   
ref|XP_011072119.1|  PREDICTED: putative late blight resistance p...  57.0    3e-06   
ref|XP_009777083.1|  PREDICTED: putative late blight resistance p...  57.0    3e-06   
ref|XP_010914530.1|  PREDICTED: LOW QUALITY PROTEIN: putative dis...  57.0    3e-06   
emb|CDP16512.1|  unnamed protein product                              57.0    4e-06   
ref|XP_009608887.1|  PREDICTED: putative late blight resistance p...  56.6    4e-06   
ref|XP_011072647.1|  PREDICTED: putative late blight resistance p...  55.8    6e-06   
ref|XP_006367915.1|  PREDICTED: putative disease resistance RPP13...  55.5    8e-06   
ref|XP_011087330.1|  PREDICTED: putative late blight resistance p...  55.5    9e-06   
ref|XP_006367243.1|  PREDICTED: putative late blight resistance p...  55.5    1e-05   
ref|XP_009606087.1|  PREDICTED: putative late blight resistance p...  55.5    1e-05   
ref|XP_009606086.1|  PREDICTED: putative late blight resistance p...  55.5    1e-05   
ref|XP_006367920.1|  PREDICTED: putative late blight resistance p...  55.1    1e-05   
emb|CDP20153.1|  unnamed protein product                              55.1    1e-05   
ref|XP_010914720.1|  PREDICTED: putative disease resistance prote...  55.1    1e-05   
ref|XP_006367916.1|  PREDICTED: putative late blight resistance p...  54.7    1e-05   
ref|XP_009761395.1|  PREDICTED: putative late blight resistance p...  54.7    2e-05   
gb|AGX27504.1|  NBS-LRR class resistance protein Fy8-Ry8              54.7    2e-05   
ref|XP_009767436.1|  PREDICTED: putative late blight resistance p...  54.7    2e-05   
emb|CDP10346.1|  unnamed protein product                              54.7    2e-05   
ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...  54.7    2e-05   
ref|XP_011083958.1|  PREDICTED: putative late blight resistance p...  54.7    2e-05   
ref|XP_009615718.1|  PREDICTED: putative late blight resistance p...  54.3    2e-05   
ref|XP_011075016.1|  PREDICTED: putative late blight resistance p...  54.3    2e-05   
ref|XP_011089745.1|  PREDICTED: putative late blight resistance p...  54.3    2e-05   
emb|CDP10344.1|  unnamed protein product                              54.3    3e-05   
ref|XP_006364074.1|  PREDICTED: putative late blight resistance p...  54.3    3e-05   
emb|CDP10261.1|  unnamed protein product                              54.3    3e-05   
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...  54.3    3e-05   
ref|XP_011072560.1|  PREDICTED: putative late blight resistance p...  53.9    3e-05   
gb|AGW28125.1|  NBS-LRR class resistance protein Fy8-Ry8              53.9    3e-05   
ref|XP_011083930.1|  PREDICTED: putative late blight resistance p...  53.9    3e-05   
ref|XP_002524239.1|  conserved hypothetical protein                   53.9    4e-05   Ricinus communis
emb|CDP10671.1|  unnamed protein product                              53.9    4e-05   
ref|XP_009759467.1|  PREDICTED: putative late blight resistance p...  51.6    4e-05   
emb|CDP22106.1|  unnamed protein product                              53.1    4e-05   
gb|ACE79413.1|  NBS-coding resistance gene analog                     53.1    4e-05   Nicotiana tabacum [American tobacco]
ref|XP_006356564.1|  PREDICTED: putative late blight resistance p...  53.5    5e-05   
gb|EYU25639.1|  hypothetical protein MIMGU_mgv1a022176mg              53.1    5e-05   
ref|XP_009618211.1|  PREDICTED: disease resistance protein RPP13-...  53.5    5e-05   
ref|XP_009596966.1|  PREDICTED: putative late blight resistance p...  51.2    5e-05   
gb|EPS67493.1|  hypothetical protein M569_07282                       52.8    5e-05   
ref|XP_009773239.1|  PREDICTED: putative late blight resistance p...  53.5    5e-05   
emb|CDP15579.1|  unnamed protein product                              53.5    6e-05   
ref|XP_006351974.1|  PREDICTED: putative late blight resistance p...  53.1    6e-05   
ref|XP_011088087.1|  PREDICTED: putative late blight resistance p...  53.1    6e-05   
emb|CDP08423.1|  unnamed protein product                              53.5    6e-05   
gb|EYU19026.1|  hypothetical protein MIMGU_mgv1a020094mg              53.1    6e-05   
emb|CDP10338.1|  unnamed protein product                              53.1    6e-05   
gb|AGW23829.1|  NBS-LRR class resistance protein Fy8-Ry8              53.1    6e-05   
ref|XP_009763644.1|  PREDICTED: putative late blight resistance p...  52.8    6e-05   
ref|XP_009613202.1|  PREDICTED: putative late blight resistance p...  53.1    6e-05   
ref|XP_009622003.1|  PREDICTED: putative late blight resistance p...  53.1    7e-05   
ref|XP_002442615.1|  hypothetical protein SORBIDRAFT_08g023030        53.1    7e-05   Sorghum bicolor [broomcorn]
emb|CDP10349.1|  unnamed protein product                              53.1    7e-05   
ref|XP_006356562.1|  PREDICTED: putative late blight resistance p...  52.4    9e-05   
ref|XP_009773240.1|  PREDICTED: putative late blight resistance p...  52.8    9e-05   
ref|XP_010319327.1|  PREDICTED: disease resistance protein RPP13-...  52.4    1e-04   
emb|CDP10265.1|  unnamed protein product                              52.4    1e-04   
ref|XP_011083960.1|  PREDICTED: putative late blight resistance p...  52.4    1e-04   
emb|CDP15591.1|  unnamed protein product                              52.4    1e-04   
ref|XP_011073066.1|  PREDICTED: putative late blight resistance p...  52.4    1e-04   
ref|XP_010661778.1|  PREDICTED: putative disease resistance prote...  52.4    1e-04   
ref|XP_008811538.1|  PREDICTED: putative disease resistance RPP13...  52.4    1e-04   
ref|XP_006362543.1|  PREDICTED: putative late blight resistance p...  52.4    1e-04   
ref|XP_010914752.1|  PREDICTED: putative disease resistance RPP13...  52.4    1e-04   
ref|XP_010319326.1|  PREDICTED: disease resistance protein RPP13-...  52.4    1e-04   
ref|XP_009774731.1|  PREDICTED: putative late blight resistance p...  52.0    1e-04   
ref|XP_009596953.1|  PREDICTED: putative late blight resistance p...  52.0    1e-04   
ref|XP_011072557.1|  PREDICTED: putative late blight resistance p...  52.0    1e-04   
gb|ACE79400.1|  NBS-coding resistance gene analog                     51.6    1e-04   Nicotiana tabacum [American tobacco]
ref|XP_006360876.1|  PREDICTED: disease resistance protein RPP13-...  52.0    1e-04   
dbj|BAB89656.1|  putative disease resistance protein                  52.0    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009589053.1|  PREDICTED: putative late blight resistance p...  52.0    2e-04   
ref|XP_009774730.1|  PREDICTED: putative late blight resistance p...  52.0    2e-04   
ref|XP_009772626.1|  PREDICTED: putative late blight resistance p...  52.0    2e-04   
ref|XP_009624584.1|  PREDICTED: putative late blight resistance p...  52.0    2e-04   
emb|CDP10353.1|  unnamed protein product                              51.6    2e-04   
emb|CDP10113.1|  unnamed protein product                              52.0    2e-04   
ref|XP_009800005.1|  PREDICTED: putative late blight resistance p...  51.6    2e-04   
emb|CDP15268.1|  unnamed protein product                              52.0    2e-04   
gb|EYU21177.1|  hypothetical protein MIMGU_mgv1a018978mg              51.6    2e-04   
gb|ACE79429.1|  NBS-coding resistance gene analog                     51.2    2e-04   Nicotiana tabacum [American tobacco]
ref|XP_009624582.1|  PREDICTED: putative late blight resistance p...  51.6    2e-04   
gb|EYU24354.1|  hypothetical protein MIMGU_mgv1a019328mg              51.6    2e-04   
ref|XP_006350138.1|  PREDICTED: putative late blight resistance p...  51.6    2e-04   
gb|ACE79448.1|  NBS-coding resistance gene analog                     51.2    2e-04   Nicotiana tabacum [American tobacco]
ref|XP_009794857.1|  PREDICTED: disease resistance protein RPP13-...  51.6    2e-04   
ref|XP_008777037.1|  PREDICTED: putative disease resistance prote...  51.2    2e-04   
ref|XP_009768089.1|  PREDICTED: putative late blight resistance p...  51.6    2e-04   
gb|ACE79508.1|  NBS-coding resistance gene analog                     50.8    2e-04   Nicotiana tabacum [American tobacco]
gb|ACE79510.1|  NBS-coding resistance gene analog                     50.8    2e-04   Nicotiana tabacum [American tobacco]
emb|CDP11163.1|  unnamed protein product                              51.6    2e-04   
ref|XP_009631207.1|  PREDICTED: putative late blight resistance p...  51.6    2e-04   
ref|XP_010319547.1|  PREDICTED: disease resistance protein RPP13-...  51.2    2e-04   
gb|ACE79513.1|  NBS-coding resistance gene analog                     50.8    2e-04   Nicotiana tabacum [American tobacco]
gb|ACE79512.1|  NBS-coding resistance gene analog                     50.8    2e-04   Nicotiana tabacum [American tobacco]
ref|XP_008797616.1|  PREDICTED: putative disease resistance prote...  51.2    3e-04   
ref|XP_009797471.1|  PREDICTED: putative late blight resistance p...  51.2    3e-04   
ref|XP_004242251.1|  PREDICTED: putative late blight resistance p...  51.2    3e-04   
emb|CDP11161.1|  unnamed protein product                              51.2    3e-04   
ref|XP_011093987.1|  PREDICTED: putative late blight resistance p...  51.2    3e-04   
ref|XP_009624579.1|  PREDICTED: putative late blight resistance p...  51.2    3e-04   
gb|ACE79509.1|  NBS-coding resistance gene analog                     50.4    3e-04   Nicotiana tabacum [American tobacco]
ref|XP_011093989.1|  PREDICTED: putative late blight resistance p...  51.2    3e-04   
emb|CDP15593.1|  unnamed protein product                              51.2    3e-04   
emb|CDP05514.1|  unnamed protein product                              51.2    3e-04   
gb|ACE79511.1|  NBS-coding resistance gene analog                     50.4    3e-04   Nicotiana tabacum [American tobacco]
emb|CDP04885.1|  unnamed protein product                              51.2    3e-04   
ref|XP_011091064.1|  PREDICTED: putative late blight resistance p...  51.2    3e-04   
emb|CDP05441.1|  unnamed protein product                              51.2    3e-04   
gb|ACF22006.1|  NBS-coding resistance gene protein                    49.7    3e-04   Nicotiana tabacum [American tobacco]
ref|XP_004252037.1|  PREDICTED: putative late blight resistance p...  51.2    3e-04   
gb|ACE79434.1|  NBS-coding resistance gene analog                     50.4    3e-04   Nicotiana tabacum [American tobacco]
emb|CDP21430.1|  unnamed protein product                              50.8    3e-04   
gb|EYU24163.1|  hypothetical protein MIMGU_mgv1a019941mg              51.2    3e-04   
gb|ACE79422.1|  NBS-coding resistance gene analog                     50.4    3e-04   Nicotiana tabacum [American tobacco]
emb|CDP04878.1|  unnamed protein product                              51.2    3e-04   
ref|XP_009603187.1|  PREDICTED: putative late blight resistance p...  50.8    3e-04   
ref|XP_008812968.1|  PREDICTED: putative disease resistance RPP13...  50.8    4e-04   
gb|ACE79399.1|  NBS-coding resistance gene analog                     50.4    4e-04   Nicotiana tabacum [American tobacco]
ref|XP_010324491.1|  PREDICTED: putative late blight resistance p...  50.8    4e-04   
gb|EYU28481.1|  hypothetical protein MIMGU_mgv1a018543mg              50.8    4e-04   
ref|XP_011072558.1|  PREDICTED: putative late blight resistance p...  50.8    4e-04   
emb|CDP11642.1|  unnamed protein product                              50.8    4e-04   
gb|EYU23518.1|  hypothetical protein MIMGU_mgv1a019595mg              50.8    4e-04   
ref|XP_006365680.1|  PREDICTED: putative late blight resistance p...  50.8    4e-04   
ref|XP_011070551.1|  PREDICTED: putative late blight resistance p...  50.8    4e-04   
emb|CDP13418.1|  unnamed protein product                              50.8    4e-04   
emb|CDP11974.1|  unnamed protein product                              50.8    4e-04   
ref|XP_004240304.1|  PREDICTED: putative late blight resistance p...  50.8    4e-04   
gb|ACE79449.1|  NBS-coding resistance gene analog                     50.1    4e-04   Nicotiana tabacum [American tobacco]
emb|CDP12800.1|  unnamed protein product                              50.8    5e-04   
gb|ADL59404.1|  R2 late blight resistance protein                     50.4    5e-04   
emb|CDP06250.1|  unnamed protein product                              50.4    5e-04   
ref|XP_009797439.1|  PREDICTED: putative late blight resistance p...  50.4    5e-04   
emb|CDP12966.1|  unnamed protein product                              50.4    5e-04   
emb|CDP04756.1|  unnamed protein product                              50.4    5e-04   
gb|ACE79438.1|  NBS-coding resistance gene analog                     50.1    5e-04   Nicotiana tabacum [American tobacco]
emb|CDP12974.1|  unnamed protein product                              50.4    5e-04   
gb|ACU65457.1|  Rpi protein                                           50.4    5e-04   Solanum bulbocastanum [ornamental nightshade]
ref|XP_009762700.1|  PREDICTED: putative late blight resistance p...  50.4    5e-04   
ref|XP_006356561.1|  PREDICTED: putative late blight resistance p...  50.4    6e-04   
emb|CDP05557.1|  unnamed protein product                              50.1    6e-04   
ref|XP_004242250.1|  PREDICTED: putative late blight resistance p...  50.4    6e-04   
ref|XP_009762697.1|  PREDICTED: putative late blight resistance p...  50.4    6e-04   
gb|EYU39515.1|  hypothetical protein MIMGU_mgv1a023519mg              50.4    6e-04   
emb|CDP13419.1|  unnamed protein product                              50.1    6e-04   
emb|CDX82995.1|  BnaA01g19950D                                        49.7    6e-04   
emb|CDP05558.1|  unnamed protein product                              50.1    7e-04   
dbj|BAJ89397.1|  predicted protein                                    50.1    7e-04   
gb|EYU31287.1|  hypothetical protein MIMGU_mgv1a022746mg              49.7    7e-04   
ref|XP_009781183.1|  PREDICTED: putative late blight resistance p...  50.1    7e-04   
emb|CDP20204.1|  unnamed protein product                              50.1    8e-04   
gb|ADL59402.1|  R2 late blight resistance protein                     50.1    8e-04   
gb|ADL59400.1|  R2 late blight resistance protein                     50.1    8e-04   
emb|CDP00736.1|  unnamed protein product                              50.1    8e-04   
gb|EYU21828.1|  hypothetical protein MIMGU_mgv1a019841mg              50.1    8e-04   
gb|ADL59399.1|  HJTR2GH1 protein                                      50.1    8e-04   
gb|EYU24168.1|  hypothetical protein MIMGU_mgv1a022184mg              49.7    8e-04   
ref|XP_009622812.1|  PREDICTED: putative late blight resistance p...  50.1    8e-04   
ref|XP_011070550.1|  PREDICTED: putative late blight resistance p...  49.7    8e-04   
ref|XP_009764753.1|  PREDICTED: putative late blight resistance p...  49.7    9e-04   
ref|XP_009761073.1|  PREDICTED: putative late blight resistance p...  49.7    9e-04   
gb|EYU26873.1|  hypothetical protein MIMGU_mgv1a025130mg              49.7    9e-04   
emb|CDP13422.1|  unnamed protein product                              49.7    0.001   
tpg|DAA47701.1|  TPA: hypothetical protein ZEAMMB73_492727            49.7    0.001   
ref|XP_009764756.1|  PREDICTED: putative late blight resistance p...  49.7    0.001   
ref|XP_008662632.1|  PREDICTED: disease resistance protein RPP13-...  49.7    0.001   
emb|CDP21622.1|  unnamed protein product                              49.7    0.001   
emb|CDP21812.1|  unnamed protein product                              49.7    0.001   



>dbj|BAD18094.1| NBS-LRR protein [Ipomoea batatas]
Length=255

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 49/78 (63%), Gaps = 4/78 (5%)
 Frame = -3

Query  323  IGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTT  144
            +G +D F     K++    SK   VISIVG   I  T+L +R+YE+ SIV HF ++AWTT
Sbjct  29   VGCDDEFETIGHKLIS--HSKKLEVISIVGMGGIGKTTLVQRVYENTSIVSHFDVRAWTT  86

Query  143  VSPLREFNERQLLFQLLG  90
            VS  +E+N  ++L  LLG
Sbjct  87   VS--QEYNLEEMLLDLLG  102



>emb|CDP16515.1| unnamed protein product [Coffea canephora]
Length=815

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = -3

Query  254  AVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLG  90
             V S+VG + +  T+LARR+Y DPS+ YHF ++AW  +S  + + +R+LL Q+LG
Sbjct  165  GVFSVVGMAGLGKTTLARRVYNDPSVTYHFHVRAWCCIS--QTYQKRELLLQILG  217



>emb|CDP16510.1| unnamed protein product [Coffea canephora]
Length=1418

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLG  90
            V+SIVG + +  T+LA ++Y DPSI YHF +QAW  VS  + + +R+LL Q+LG
Sbjct  750  VVSIVGMAGLGKTTLAWKVYNDPSITYHFHVQAWCCVS--QAYQKRELLLQILG  801



>emb|CDP11186.1| unnamed protein product [Coffea canephora]
Length=1466

 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = -3

Query  272  WRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            W S  + V+S+VG + I  T+LA++LY DP+IVYHF  +AW +VS +  + +R LL  +L
Sbjct  751  WGSSKRDVVSLVGMAGIGKTTLAKKLYNDPNIVYHFHCRAWCSVSQV--YLKRNLLLNIL  808



>emb|CDP19728.1| unnamed protein product [Coffea canephora]
Length=1099

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLG  90
            V+S+VG + +  T+L RR+Y+DPS+ +HF ++AW  VS  + + +R+LL Q+LG
Sbjct  412  VVSVVGMAGLGKTTLVRRVYKDPSVTHHFHVRAWCCVS--QAYQKRELLLQILG  463



>ref|XP_009777085.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X3 [Nicotiana sylvestris]
Length=547

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 93/184 (51%), Gaps = 25/184 (14%)
 Frame = -3

Query  620  EAVKRLDEVFRNIRYVAIKAEDEIESKLSDVYLG-VGED-------LHQTLQQVVKDIES  465
            E +KRL++  R++ Y   K E  ++S+L +V +   G+D        ++ LQ+V K+++S
Sbjct  59   ETLKRLEKRLRDVVY---KVEYRVDSRLRNVIVADCGDDRERACKAFNEELQEVEKEVDS  115

Query  464  IEVRISDLQITHTaasssasssssldsddaspSLRLEKFLEHDDFKRIGAEDAFFMKIRK  285
            ++  +  ++     + S+  +++S             +    +    +G ED F   + +
Sbjct  116  LKKEVMQIEFNKRGSKSAELATTSSS----------SRRYASEQNTVVGMEDDFNAILDR  165

Query  284  VLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLL  105
            +    ++    VI +VG   I  T+LAR+ Y+D SI Y F I +W TVS    +NERQ+L
Sbjct  166  LTA--QTHELTVIPVVGMGGIGKTTLARKAYDDSSIRYRFDIHSWVTVS--ENYNERQVL  221

Query  104  FQLL  93
              ++
Sbjct  222  LDVI  225



>gb|EYU17666.1| hypothetical protein MIMGU_mgv1a021453mg, partial [Erythranthe 
guttata]
Length=690

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 49/86 (57%), Gaps = 4/86 (5%)
 Frame = -3

Query  350  FLEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVY  171
            F+  +  K +G ED     + ++    R   + +I IVG   I  T+LAR +YE+P IV 
Sbjct  164  FMGAEKSKMVGFEDDLLQLMERL--TGRQPNRQIIPIVGMGGIGKTTLARNVYENPLIVQ  221

Query  170  HFPIQAWTTVSPLREFNERQLLFQLL  93
            HF I  W TVS  +E++ R++L +LL
Sbjct  222  HFDICCWVTVS--QEYSVRKVLLELL  245



>emb|CDP19794.1| unnamed protein product [Coffea canephora]
Length=1049

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 2/54 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLG  90
            V+++VG + +  T+L RR+Y DP + YHF IQAW  VS  + + +R+LL Q+L 
Sbjct  715  VVAVVGMAGLGKTTLVRRVYNDPLVTYHFHIQAWCCVS--QAYQKRELLLQILS  766



>ref|XP_009608888.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana tomentosiformis]
Length=538

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 97/203 (48%), Gaps = 22/203 (11%)
 Frame = -3

Query  590  RNIRYVAIKAEDEIESKLSDVYLG-VGED-------LHQTLQQVVKDIESIEVRISDLQI  435
            + IR V  K E  ++S+L  V +   G+D        ++ LQ+V K+++S++  +  +QI
Sbjct  66   KRIRDVVYKVEYRVDSRLRSVIVADCGDDRERACKAFNEELQEVEKEVDSLKKEV--IQI  123

Query  434  THTaasssasssssldsddaspSLRLEKFLEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQ  255
                  S ++  ++  S     ++        + +  +G ED F   + ++    ++   
Sbjct  124  EFNKHGSKSAELATTSSSSRRYAI--------EQYTVVGMEDDFINILDRLTA--QTHDL  173

Query  254  AVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLGsidss  75
             VIS+VG   I  T+LAR+ Y+D SI Y F   AW TVS    +NERQ+L  ++ SI   
Sbjct  174  TVISVVGMGGIGKTTLARKAYDDSSIRYRFDTHAWVTVS--ENYNERQVLLDVIISISRD  231

Query  74   lltsmssDEDADHLGKLLCQKLK  6
                       D L +++ + LK
Sbjct  232  RTDESYETMSTDQLAEIVYKGLK  254



>ref|XP_009777084.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=838

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 93/184 (51%), Gaps = 25/184 (14%)
 Frame = -3

Query  620  EAVKRLDEVFRNIRYVAIKAEDEIESKLSDVYLG-VGED-------LHQTLQQVVKDIES  465
            E +KRL++  R++ Y   K E  ++S+L +V +   G+D        ++ LQ+V K+++S
Sbjct  59   ETLKRLEKRLRDVVY---KVEYRVDSRLRNVIVADCGDDRERACKAFNEELQEVEKEVDS  115

Query  464  IEVRISDLQITHTaasssasssssldsddaspSLRLEKFLEHDDFKRIGAEDAFFMKIRK  285
            ++  +  ++     + S+  +++S             +    +    +G ED F   + +
Sbjct  116  LKKEVMQIEFNKRGSKSAELATTSSS----------SRRYASEQNTVVGMEDDFNAILDR  165

Query  284  VLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLL  105
            +    ++    VI +VG   I  T+LAR+ Y+D SI Y F I +W TVS    +NERQ+L
Sbjct  166  LTA--QTHELTVIPVVGMGGIGKTTLARKAYDDSSIRYRFDIHSWVTVS--ENYNERQVL  221

Query  104  FQLL  93
              ++
Sbjct  222  LDVI  225



>ref|XP_011071841.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=1095

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +ISIVG   I  T+LAR++Y+DPSI YHF  + W  VS  +E++ RQ+L  LL
Sbjct  386  IISIVGMGGIGKTTLARQVYDDPSIFYHFDTRGWVAVS--QEYSLRQVLLGLL  436



>ref|XP_011072119.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=996

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +ISIVG   I  T+LAR++Y+DPSI YHF  + W  VS  +E++ RQ+L  LL
Sbjct  288  IISIVGMGGIGKTTLARQIYDDPSIFYHFDTRGWVAVS--QEYSLRQVLLGLL  338



>ref|XP_009777083.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=868

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 93/184 (51%), Gaps = 25/184 (14%)
 Frame = -3

Query  620  EAVKRLDEVFRNIRYVAIKAEDEIESKLSDVYLG-VGED-------LHQTLQQVVKDIES  465
            E +KRL++  R++ Y   K E  ++S+L +V +   G+D        ++ LQ+V K+++S
Sbjct  59   ETLKRLEKRLRDVVY---KVEYRVDSRLRNVIVADCGDDRERACKAFNEELQEVEKEVDS  115

Query  464  IEVRISDLQITHTaasssasssssldsddaspSLRLEKFLEHDDFKRIGAEDAFFMKIRK  285
            ++  +  ++     + S+  +++S             +    +    +G ED F   + +
Sbjct  116  LKKEVMQIEFNKRGSKSAELATTSSS----------SRRYASEQNTVVGMEDDFNAILDR  165

Query  284  VLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLL  105
            +    ++    VI +VG   I  T+LAR+ Y+D SI Y F I +W TVS    +NERQ+L
Sbjct  166  LTA--QTHELTVIPVVGMGGIGKTTLARKAYDDSSIRYRFDIHSWVTVS--ENYNERQVL  221

Query  104  FQLL  93
              ++
Sbjct  222  LDVI  225



>ref|XP_010914530.1| PREDICTED: LOW QUALITY PROTEIN: putative disease resistance protein 
At1g50180 [Elaeis guineensis]
Length=932

 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = -3

Query  359  LEKFLEH--DDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYED  186
            L +F  H  DD   IG ED    K+ K LVD  +K ++VISIVG   +  T+LAR+++ D
Sbjct  154  LRQFSPHFYDDADVIGLEDDR-GKLVKRLVDPENKNRSVISIVGMGGLGKTTLARKVHND  212

Query  185  PSIVYHFPIQAWTTVS  138
            P+I+ HF   AW +VS
Sbjct  213  PAIIXHFDTIAWVSVS  228



>emb|CDP16512.1| unnamed protein product [Coffea canephora]
Length=907

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLG  90
            V+SI+G + +  T+LA ++Y DPS+ YHF I+AW  +S  + +++ +LL Q+LG
Sbjct  191  VVSIIGMAGLGKTTLAWKVYNDPSVTYHFHIRAWCCIS--QAYHKGELLLQILG  242



>ref|XP_009608887.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=838

 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 97/203 (48%), Gaps = 22/203 (11%)
 Frame = -3

Query  590  RNIRYVAIKAEDEIESKLSDVYLG-VGED-------LHQTLQQVVKDIESIEVRISDLQI  435
            + IR V  K E  ++S+L  V +   G+D        ++ LQ+V K+++S++  +  +QI
Sbjct  66   KRIRDVVYKVEYRVDSRLRSVIVADCGDDRERACKAFNEELQEVEKEVDSLKKEV--IQI  123

Query  434  THTaasssasssssldsddaspSLRLEKFLEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQ  255
                  S ++  ++  S     ++        + +  +G ED F   + ++    ++   
Sbjct  124  EFNKHGSKSAELATTSSSSRRYAI--------EQYTVVGMEDDFINILDRLTA--QTHDL  173

Query  254  AVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLGsidss  75
             VIS+VG   I  T+LAR+ Y+D SI Y F   AW TVS    +NERQ+L  ++ SI   
Sbjct  174  TVISVVGMGGIGKTTLARKAYDDSSIRYRFDTHAWVTVS--ENYNERQVLLDVIISISRD  231

Query  74   lltsmssDEDADHLGKLLCQKLK  6
                       D L +++ + LK
Sbjct  232  RTDESYETMSTDQLAEIVYKGLK  254



>ref|XP_011072647.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=541

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +I IVG   I  T+LAR +YE+P IV +F I+AW TVS  +E+N R++L +L+
Sbjct  183  IIPIVGMGGIGKTTLARNVYENPLIVEYFDIRAWVTVS--QEYNTREILLELV  233



>ref|XP_006367915.1| PREDICTED: putative disease resistance RPP13-like protein 3-like 
[Solanum tuberosum]
Length=383

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  311  DAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPL  132
            D   +KI+  L+   S+ + V+ I+G   I  T+LARR+Y+D  I YHF ++AWT VS  
Sbjct  155  DEDLLKIKDRLIVQSSRLE-VVPIIGMGGIGKTTLARRVYDDSLIAYHFYVRAWTNVS--  211

Query  131  REFNERQLLFQLL  93
            +EF+ R++   +L
Sbjct  212  QEFDTREIFLGIL  224



>ref|XP_011087330.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
 ref|XP_011087331.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
 ref|XP_011087332.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Sesamum indicum]
Length=837

 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 52/97 (54%), Gaps = 8/97 (8%)
 Frame = -3

Query  281  LVDWRSKPQ-----AVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNE  117
            L DW +  Q      V+ IVG   I  ++LAR LY+D  I+ HF  +AW+TVS  + +N 
Sbjct  147  LRDWLTNLQDTGARKVVPIVGMGGIGKSTLARHLYDDSFIISHFDTRAWSTVS--QNYNV  204

Query  116  RQLLFQLLGsidsslltsmssDEDADHLGKLLCQKLK  6
             ++L  LLG +       M  +ED D LG  L Q LK
Sbjct  205  HKILLDLLGCVTGKPTDEMLGEED-DQLGLRLHQNLK  240



>ref|XP_006367243.1| PREDICTED: putative late blight resistance protein homolog R1B-8-like 
[Solanum tuberosum]
Length=1322

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 87/187 (47%), Gaps = 17/187 (9%)
 Frame = -3

Query  638  TSDRQSEAVKRLDEVFRNIRYVAIKAEDEIESKLSDVYLGVGEDLHQ-TLQQVVKDIESI  462
            T+ +  E +K +++  RN+ Y   KAED I+S L  + +   ED  Q       +++  +
Sbjct  50   TTTKDIETLKVIEKRIRNVVY---KAEDRIDSSLRSIIVADHEDKRQKACTSFYEELLKV  106

Query  461  EVRISDLQITHTaasssasssssldsddaspSLRLEKFLEHDDFKR---IGAEDAFFMKI  291
            E      Q  +           +     ++   R+   LE    +    +G ED F + +
Sbjct  107  E------QQVYFLNKEVMLIEFNNHGSKSAELARISSSLEKSTIEENTIVGMEDDFNIIL  160

Query  290  RKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQ  111
             +V    ++    VI I G   I  T+LAR++Y+D  I   F  QAW T+S  +E+NERQ
Sbjct  161  DRVTT--QTDELTVIPIFGMGGIGKTTLARKVYDDSYIRSRFDKQAWVTIS--QEYNERQ  216

Query  110  LLFQLLG  90
            +L +L+ 
Sbjct  217  MLLELVS  223



>ref|XP_009606087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=975

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +I+IVG + I  T+LA+R + DPS+VY F ++AWTT+S  +E+ ER  L  L 
Sbjct  215  IITIVGMAGIGKTTLAKRAFNDPSVVYRFDVRAWTTIS--QEYRERDTLHDLF  265



>ref|XP_009606086.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=990

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +I+IVG + I  T+LA+R + DPS+VY F ++AWTT+S  +E+ ER  L  L 
Sbjct  230  IITIVGMAGIGKTTLAKRAFNDPSVVYRFDVRAWTTIS--QEYRERDTLHDLF  280



>ref|XP_006367920.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X5 [Solanum tuberosum]
Length=476

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            V+ I+G   I  T+LARR+Y+D  I YHF ++AWT VS  +EF+ R++   +L
Sbjct  170  VVPIIGMGGIGKTTLARRVYDDSLIAYHFYVRAWTNVS--QEFDTREIFLGIL  220



>emb|CDP20153.1| unnamed protein product [Coffea canephora]
Length=1449

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            V+SIVG   +  T+LA+++Y DPSI YHF I+AW  +S +  + +R+LL  +L
Sbjct  742  VVSIVGMPGLGKTTLAKKVYNDPSITYHFHIRAWCYISQV--YRKRELLLNIL  792



>ref|XP_010914720.1| PREDICTED: putative disease resistance protein At1g50180 [Elaeis 
guineensis]
Length=913

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = -3

Query  341  HDDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFP  162
            HDD   IG ED    K+ K+LVD  +K   VISIVG   +  T+LAR+++ DP+I  HF 
Sbjct  162  HDDNDVIGFEDDK-EKLVKLLVDPENKNCGVISIVGMGGLGKTTLARKVHNDPAIRKHFD  220

Query  161  IQAWTTVS  138
              AW +VS
Sbjct  221  NFAWVSVS  228



>ref|XP_006367916.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006367917.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006367918.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X3 [Solanum tuberosum]
 ref|XP_006367919.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X4 [Solanum tuberosum]
Length=493

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            V+ I+G   I  T+LARR+Y+D  I YHF ++AWT VS  +EF+ R++   +L
Sbjct  170  VVPIIGMGGIGKTTLARRVYDDSLIAYHFYVRAWTNVS--QEFDTREIFLGIL  220



>ref|XP_009761395.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=350

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 7/85 (8%)
 Frame = -3

Query  335  DFKRIGAEDAFFMK----IRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYH  168
            DF  I  E   F K    I K L   RSK   VISI G + +  T+LAR++Y + SI+ H
Sbjct  16   DFPSINDEVVGFAKDAEYIMKKLTG-RSKELDVISIFGMAGLGKTTLARKVYNNTSIINH  74

Query  167  FPIQAWTTVSPLREFNERQLLFQLL  93
            F ++AW TVS  + ++ R LL  +L
Sbjct  75   FDVKAWCTVS--QTYDMRTLLVDIL  97



>gb|AGX27504.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
Length=373

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/177 (30%), Positives = 85/177 (48%), Gaps = 26/177 (15%)
 Frame = -3

Query  584  IRYVAIKAEDEIESKLSD-----------VYLGVGEDLHQTLQQVVKDIESIEVRISDLQ  438
            IR +A +AED IES +SD           + L   E     L+ V+++I SI  R+ ++Q
Sbjct  62   IRDLAYRAEDIIESHVSDQISSEHERYMDLELQNSEKKEADLRMVMEEINSIVERVMNIQ  121

Query  437  ITHTaasssasssssldsddaspSLRLEKFLEHDDFKRIG-AEDAFFMKIRKVLVDWRSK  261
                      + +        + ++       +D  K +G  ED   +K R  L    SK
Sbjct  122  ---------NNCAVEDVQCSYTSAVPSSGGAPNDGNKMVGFNEDLLELKAR--LCGESSK  170

Query  260  PQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLG  90
             Q +ISIVG   I  T+LA  ++ D  + YHF ++ WTTVS  ++++ RQ+L  L+ 
Sbjct  171  LQ-IISIVGMGGIGKTTLATNIFNDSLVAYHFHVRVWTTVS--QDYHLRQVLLDLVA  224



>ref|XP_009767436.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=930

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +I+IVG + I  T+LA+R Y  PS+VY F ++AWTT+S  +E+ ER  L  L 
Sbjct  179  IITIVGMAGIGKTTLAKRAYNHPSVVYRFDVRAWTTIS--QEYRERDTLLDLF  229



>emb|CDP10346.1| unnamed protein product [Coffea canephora]
Length=623

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 41/60 (68%), Gaps = 2/60 (3%)
 Frame = -3

Query  272  WRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            W S+   ++ IVG + +  T+LA+++Y D SI+Y+F I+ W TVS  +E+N++  L Q+L
Sbjct  528  WGSEQVEIVPIVGMAGLGKTTLAKKVYNDNSIIYNFHIRLWCTVS--QEYNKKSWLTQIL  585



>ref|XP_011075746.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=967

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = -3

Query  266  SKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            S  + ++SIVG   I  T+LAR+ Y+D  IVYHF  +AW TVS  +E++ RQ+L  LL
Sbjct  244  SSKRDIVSIVGMGGIGKTTLARQAYDDSYIVYHFDTRAWVTVS--QEYSLRQVLIGLL  299



>ref|XP_011083958.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Sesamum indicum]
Length=877

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 97/189 (51%), Gaps = 24/189 (13%)
 Frame = -3

Query  635  SDRQSEAVKRLDEVFRNIRYVAIKAEDEIESKLSDVYLGVGED--------LHQTLQQVV  480
            S + S+ VK L+     IR  A  A++ I+S +S+  L + E           + LQ+VV
Sbjct  47   SQKNSKEVKELET---QIRDAAYAAQNMIDSYISNQLLSMCECCVDRSYTVFCEELQRVV  103

Query  479  KDIESIEVRISDLQITHTaasssasssssldsddaspSLRLEKFLEHDDFKRIGAEDAFF  300
            ++ +S ++++ + +       +  S + +  +  ++ SLRL    ++     +G  D   
Sbjct  104  ENFDSAKLQVMEFR-------NMGSKNLAPKNSFSAGSLRLASGGKN---SMVGFVDEM-  152

Query  299  MKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFN  120
            ++I+  L    S    VISIVG      T+LAR +Y+D  IVYHF  +AW T+S  +E++
Sbjct  153  LQIKDRLTGQPSYKLDVISIVGMGGSGKTTLARSMYDDAFIVYHFYTRAWVTIS--QEYH  210

Query  119  ERQLLFQLL  93
             R++L  LL
Sbjct  211  LREILLGLL  219



>ref|XP_009615718.1| PREDICTED: putative late blight resistance protein homolog R1B-12, 
partial [Nicotiana tomentosiformis]
Length=469

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 50/90 (56%), Gaps = 2/90 (2%)
 Frame = -3

Query  293  IRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNER  114
            ++  L+   S  +  ++I G   I  T+ AR++Y+DP I  HF I AW TVS  +E+  R
Sbjct  330  VKCKLMKISSDERETMAITGMGGIGKTTFARKIYDDPEIKSHFDILAWVTVS--KEYCVR  387

Query  113  QLLFQLLGsidsslltsmssDEDADHLGKL  24
            ++L QLL  I S+      + +D +  GKL
Sbjct  388  KMLLQLLHCIPSTEEVRREARDDGELAGKL  417



>ref|XP_011075016.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Sesamum indicum]
Length=860

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 5/67 (7%)
 Frame = -3

Query  281  LVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNE---RQ  111
            LV   SK   VI IVG   I  T+LAR LY+DPS++ HF   AW T+S  +++N    + 
Sbjct  162  LVGQPSKALQVIPIVGMGGIGKTTLARHLYDDPSVISHFDTHAWATIS--QDYNRGKVQD  219

Query  110  LLFQLLG  90
            +L  LLG
Sbjct  220  VLTSLLG  226



>ref|XP_011089745.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=894

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 58/129 (45%), Gaps = 29/129 (22%)
 Frame = -3

Query  503  HQTLQQVVKDIESIEVRISDLQITHTaasssasssssldsddaspSLRLEKFLEHDDFKR  324
            HQ+  Q+V++I+SI+  +  L                        S+   KF    DF  
Sbjct  105  HQSFSQIVEEIKSIKSEVVQL--------------------FEKKSISDRKFTMPSDFTP  144

Query  323  IGAED--------AFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYH  168
            I  ED        A+ +K+   L  +    Q VI IVG   I  T+LA R+Y DP I+YH
Sbjct  145  IAEEDSNKLVGLDAYILKLLHQLSGFPLDRQ-VIPIVGMGGIGKTTLAERIYNDPFIIYH  203

Query  167  FPIQAWTTV  141
            F ++AW T+
Sbjct  204  FYVRAWITI  212



>emb|CDP10344.1| unnamed protein product [Coffea canephora]
Length=1163

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 41/58 (71%), Gaps = 2/58 (3%)
 Frame = -3

Query  266  SKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            SK   ++ IVG + +  T+LA+++Y D SI+Y+F I+ W TVS  +E+N++ LL Q+L
Sbjct  460  SKQVEIVPIVGMAGLGKTTLAKKVYNDNSIIYNFHIRLWCTVS--QEYNKKSLLTQIL  515



>ref|XP_006364074.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=761

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 38/59 (64%), Gaps = 2/59 (3%)
 Frame = -3

Query  269  RSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +S    V+ I+G   I  T+LARR+Y+D  I YHF ++AWT VS  +EF+ R++   +L
Sbjct  136  QSSSLEVVPIIGMGGIGKTTLARRVYDDSLIAYHFYVRAWTNVS--QEFDTREIFLGIL  192



>emb|CDP10261.1| unnamed protein product [Coffea canephora]
Length=706

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 39/53 (74%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            ++ IVG + +  T+LA+++Y D SI+Y+F I+ W TVS  +EFN ++LL Q+L
Sbjct  37   IVPIVGMAGLGKTTLAKKVYNDNSIIYNFHIRFWCTVS--QEFNVKKLLLQIL  87



>ref|XP_011075662.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=738

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            ++SIVG   I  T+LAR+ Y+D  IVYHF  +AW TVS  +E++ RQ+L  LL
Sbjct  47   IVSIVGMGGIGKTTLARQAYDDSYIVYHFDTRAWVTVS--QEYSLRQVLVGLL  97



>ref|XP_011072560.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Sesamum indicum]
Length=903

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLG  90
            ++ I+G   I  T+LAR +YE+P IV +F  +AW TVS  RE+N R++L  L+ 
Sbjct  182  IVPIIGMGGIGKTTLARHVYENPLIVEYFDFRAWVTVS--REYNTREILLNLVS  233



>gb|AGW28125.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
Length=732

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 85/177 (48%), Gaps = 26/177 (15%)
 Frame = -3

Query  584  IRYVAIKAEDEIESKLSD-----------VYLGVGEDLHQTLQQVVKDIESIEVRISDLQ  438
            IR +A +AED IES +SD           + L   E     LQ V+++ +SI  ++  +Q
Sbjct  67   IRDLAYRAEDIIESHVSDQISSEQERYVDLELQNSEKKEVDLQMVMEETDSIIEQVMSIQ  126

Query  437  ITHTaasssasssssldsddaspSLRLEKFLEHDDFKRIGA-EDAFFMKIRKVLVDWRSK  261
             + T      S +S+         L       +D  K +G  ED   +K R   +   S 
Sbjct  127  NSCTVEDVQCSYASA---------LPSSGGAPNDGNKMVGFDEDLLELKAR---LCGESS  174

Query  260  PQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLG  90
               +ISIVG   I  T+LA  ++ D  +VYHF I+ WTTVS  ++++ RQ+L  L+ 
Sbjct  175  TLQIISIVGMGGIGKTTLATNIFNDSLVVYHFHIRVWTTVS--QDYHLRQVLLALVA  229



>ref|XP_011083930.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
 gb|AGW23830.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
 gb|AGX27501.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
 gb|AGX27503.1| NBS-LRR class resistance protein Fy8-Ry8 [Sesamum indicum]
Length=732

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 85/177 (48%), Gaps = 26/177 (15%)
 Frame = -3

Query  584  IRYVAIKAEDEIESKLSD-----------VYLGVGEDLHQTLQQVVKDIESIEVRISDLQ  438
            IR +A +AED IES +SD           + L   E     LQ V+++ +SI  ++  +Q
Sbjct  67   IRDLAYRAEDIIESHVSDQISSEQERYVDLELQNSEKKEVDLQMVMEETDSIIEQVMSIQ  126

Query  437  ITHTaasssasssssldsddaspSLRLEKFLEHDDFKRIGA-EDAFFMKIRKVLVDWRSK  261
             + T      S +S+         L       +D  K +G  ED   +K R   +   S 
Sbjct  127  NSCTVEDVQCSYASA---------LPSSGGAPNDGNKMVGFDEDLLELKAR---LCGESS  174

Query  260  PQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLG  90
               +ISIVG   I  T+LA  ++ D  +VYHF I+ WTTVS  ++++ RQ+L  L+ 
Sbjct  175  TLQIISIVGMGGIGKTTLATNIFNDSLVVYHFHIRVWTTVS--QDYHLRQVLLALVA  229



>ref|XP_002524239.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38163.1| conserved hypothetical protein [Ricinus communis]
Length=985

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 49/194 (25%), Positives = 89/194 (46%), Gaps = 16/194 (8%)
 Frame = -3

Query  635  SDRQSEAVKRLDEVFRNIRYVAIKAEDEIESKLSDVYLGVGEDLHQTLQ-----------  489
            +DR+ +  +R+      IR VA  AED IE+ + +   G GE     ++           
Sbjct  48   ADRRQDQDERVRNWVAEIRGVAYDAEDVIETFILEAATGRGEGASGIMKRFTSIIKKVPH  107

Query  488  --QVVKDIESIEVRISDLQITHTaasssasssssldsddaspSLRLEKFLEHDDFKRIGA  315
              ++   IESI  +I D+  +         +     S  +    RL +   HD+ + + +
Sbjct  108  IHEIRNQIESIRTKICDISSSLQTYDIKFVAKREWSSSASEMQQRLRRSYPHDEDEHVIS  167

Query  314  EDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSP  135
             DA    ++  L+    + + V+SIVG   +  T+LA+++Y D  +  HF   AW  +S 
Sbjct  168  FDAVIRDLKAQLMIEEERLR-VVSIVGIGGLGKTTLAKKVYNDNRVKQHFDCYAWAFMS-  225

Query  134  LREFNERQLLFQLL  93
             ++F+ R LL ++L
Sbjct  226  -QQFSVRDLLVRIL  238



>emb|CDP10671.1| unnamed protein product [Coffea canephora]
Length=776

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLL  105
             I IVG   +  T+LARRLYEDPSIV HF ++ W TVS  ++F  R LL
Sbjct  174  TIPIVGMGGVGKTTLARRLYEDPSIVLHFHVRLWVTVS--QDFQIRILL  220



>ref|XP_009759467.1| PREDICTED: putative late blight resistance protein homolog R1A-3, 
partial [Nicotiana sylvestris]
Length=161

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (66%), Gaps = 2/58 (3%)
 Frame = -3

Query  266  SKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            SK   VISI G + +  T+LAR++Y + SI+ HF ++AW TVS  + ++ R LL  +L
Sbjct  81   SKELDVISIFGMAGLGKTTLARKVYNNTSIINHFDVKAWCTVS--QTYDMRTLLVDIL  136



>emb|CDP22106.1| unnamed protein product, partial [Coffea canephora]
Length=306

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 38/54 (70%), Gaps = 2/54 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNE--RQLLFQL  96
            VIS+VG + +  T+L ++++EDP +  HFP++AW TVS   +F +  R L++QL
Sbjct  193  VISVVGMAGLGKTTLVKKVHEDPDVRKHFPVRAWVTVSQTCDFPKLLRDLIWQL  246



>gb|ACE79413.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=270

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/106 (39%), Positives = 56/106 (53%), Gaps = 7/106 (7%)
 Frame = -3

Query  329  KRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAW  150
            K IG E+ F M   ++     ++   V+S+VG   I  T+LA +LY DP I+ HF I+A 
Sbjct  33   KMIGLENEFEMMQDQL--SRGARELEVVSVVGMGGIGKTTLANKLYSDPFIMSHFDIRAK  90

Query  149  TTVSPLREFNERQLLFQLLGsidsslltsmssDED---ADHLGKLL  21
             TVS  +E+  R +L +LL SI           ED   AD L KLL
Sbjct  91   ATVS--QEYCARNVLLRLLSSISGKTNEFQEQQEDDQLADRLQKLL  134



>ref|XP_006356564.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=758

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 50/83 (60%), Gaps = 4/83 (5%)
 Frame = -3

Query  341  HDDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFP  162
            +DD + +G E    + ++K+     +K + VISI G   +  T+LAR++Y +PSIV HF 
Sbjct  20   YDDDEVVGFEKHAEIMMKKLTQG--TKERDVISIYGMPGLGKTTLARKVYYNPSIVSHFD  77

Query  161  IQAWTTVSPLREFNERQLLFQLL  93
            ++AW  VS  + +N R LL ++ 
Sbjct  78   VKAWCAVS--QAYNRRTLLVEIF  98



>gb|EYU25639.1| hypothetical protein MIMGU_mgv1a022176mg, partial [Erythranthe 
guttata]
Length=432

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VI IVG   I  T+LA+  YE   I++HF I+ W T+SP  ++N ++LL QLL
Sbjct  140  VIPIVGMGGIGKTTLAKNTYEHSLIMHHFDIRTWVTISP--KYNVKELLLQLL  190



>ref|XP_009618211.1| PREDICTED: disease resistance protein RPP13-like [Nicotiana tomentosiformis]
Length=882

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 32/51 (63%), Gaps = 2/51 (4%)
 Frame = -3

Query  257  QAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLL  105
            Q+VISI G   I  T+LAR LY  PS++  FP +AW  VS  +EFN   LL
Sbjct  196  QSVISIYGMGGIGKTTLARNLYNSPSLITSFPTRAWICVS--QEFNTPDLL  244



>ref|XP_009596966.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=145

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 2/52 (4%)
 Frame = -3

Query  248  ISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            ISI G + +  T+LAR++Y +PS+  HF I+ W TVS  + +N + LL ++L
Sbjct  40   ISIFGMAGLGKTTLARKVYNNPSVANHFDIKVWCTVS--QTYNVKTLLAEIL  89



>gb|EPS67493.1| hypothetical protein M569_07282, partial [Genlisea aurea]
Length=237

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 3/81 (4%)
 Frame = -3

Query  335  DFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQ  156
            D K +G EDA    I K L    S P  VISI+G   +  T++A +++ DP I Y FPI+
Sbjct  50   DKKIVGFEDAIDDLIGK-LEQPSSDPVGVISIIGMGGLGKTTVASKIFNDPGIEYLFPIR  108

Query  155  AWTTVSPLREFNERQLLFQLL  93
             W T+S    +N + +   +L
Sbjct  109  IWITIS--ESYNPKDIYMAIL  127



>ref|XP_009773239.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=908

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 44/76 (58%), Gaps = 2/76 (3%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLGsidssl  72
             ++I G   I  T+ AR++Y+DP I  HF I AW TVS  +E+  R++L QLL  I S+ 
Sbjct  183  TMAITGMGGIGKTTFARKIYDDPEIKSHFDILAWVTVS--KEYCVRKMLLQLLHCIPSTE  240

Query  71   ltsmssDEDADHLGKL  24
                 + +D +  GKL
Sbjct  241  EVRREARDDGELAGKL  256



>emb|CDP15579.1| unnamed protein product [Coffea canephora]
Length=1338

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 47/81 (58%), Gaps = 15/81 (19%)
 Frame = -3

Query  293  IRKVLVDWRSKPQAVI-------------SIVGASRISNTSLARRLYEDPSIVYHFPIQA  153
            I +V+VD + + QA+I             SIVG   I  T+LA+++Y DPSI+ HF I A
Sbjct  613  INEVVVDLKDQEQAIIDQLIGGSKQFNIVSIVGMPGIGKTTLAQKVYHDPSIISHFHILA  672

Query  152  WTTVSPLREFNERQLLFQLLG  90
            W  +S +  ++++ LL ++L 
Sbjct  673  WCCISQV--YSKKDLLLEILA  691



>ref|XP_006351974.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=926

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +I+IVG + I  T+LA+R Y DPS+V  F ++AW TVS  +E+ E  +LF L 
Sbjct  176  IITIVGMAGIGKTTLAKRAYNDPSVVNRFDVRAWITVS--QEYKETDILFGLF  226



>ref|XP_011088087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=853

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 85/156 (54%), Gaps = 22/156 (14%)
 Frame = -3

Query  584  IRYVAIKAEDEIESKLSDVYLGV--GEDL---HQTLQQVVKDIESIEVRI-SDLQITHTa  423
            IR  A  AED +ESKL++++L +  GE        L++V++++++I+  + + +   H A
Sbjct  67   IRDAAQGAEDILESKLTELFLSIREGESFIFSPPDLEKVIEEVDTIKKEMMTMMDGNHKA  126

Query  422  asssasssssldsddaspSLRLEKFLEHDDFKRIG-AEDAFFMKIRKVLVDWRSKPQAVI  246
             +SSA+ SSS    + +  +             +G A+D   +K R  L    SK   VI
Sbjct  127  DTSSAALSSSRQDPNPNNII-------------VGVAQDLIQLKDR--LFGQPSKALQVI  171

Query  245  SIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVS  138
            +IVG   I  T+LAR LY+DPS++ HF   AW T+S
Sbjct  172  AIVGMGGIGKTALARNLYDDPSVISHFDACAWATIS  207



>emb|CDP08423.1| unnamed protein product [Coffea canephora]
Length=1114

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            V++IVG + +  T+LA+ +Y DPSI +HF I AW TVS +  +++  LL Q+L
Sbjct  451  VVAIVGMAGLGKTTLAKNVYSDPSIKFHFHICAWCTVSQV--YSKHNLLLQIL  501



>gb|EYU19026.1| hypothetical protein MIMGU_mgv1a020094mg [Erythranthe guttata]
Length=770

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 58/184 (32%), Positives = 92/184 (50%), Gaps = 24/184 (13%)
 Frame = -3

Query  620  EAVKRLDEVFRNIRYVAIKAEDEIESKLSDVYLGVGE-----DLHQTLQQVVKDIESIE-  459
            EAV  L+   +N    A+ AED IE+++ D  L VGE     D HQ L+ V++D+  I+ 
Sbjct  58   EAVDVLESRIKN---AALAAEDLIETRVVDQIL-VGERVSSSDFHQDLEMVIQDMVFIKK  113

Query  458  --VRISDLQITHTaasssasssssldsddaspSLRLEKFLEHDDFKRIGAEDAFFMKIRK  285
              + I +  I         SS+       +SPS R    +  DD           +++  
Sbjct  114  DVMEIKENNIGIEDHLHINSSTLGGAGSSSSPSTRQNAMVGFDDL---------LIEVMD  164

Query  284  VLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLL  105
             L + +S  + +I IVG   I  T+LAR +Y  P I++HF I+AW TVS  + +N + +L
Sbjct  165  KLSEQQSNLR-IIPIVGMGGIGKTTLARNVYAKPLIMHHFDIRAWVTVS--QNYNVQDIL  221

Query  104  FQLL  93
             ++L
Sbjct  222  IEIL  225



>emb|CDP10338.1| unnamed protein product [Coffea canephora]
Length=990

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 47/77 (61%), Gaps = 4/77 (5%)
 Frame = -3

Query  323  IGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTT  144
            +G +D     IR++   W S+   ++ IVG + +  T+LA+++Y D S+  +F I+ W T
Sbjct  451  VGLDDEAAKVIRRL--RWGSEQVEIVPIVGMAGLGKTTLAKKVYNDSSVTCYFHIRLWCT  508

Query  143  VSPLREFNERQLLFQLL  93
            VS  +EFN + +L Q+L
Sbjct  509  VS--QEFNMKNVLLQIL  523



>gb|AGW23829.1| NBS-LRR class resistance protein Fy8-Ry8, partial [Sesamum indicum]
 gb|AGX27502.1| NBS-LRR class resistance protein Fy8-Ry8, partial [Sesamum indicum]
Length=768

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 57/193 (30%), Positives = 90/193 (47%), Gaps = 26/193 (13%)
 Frame = -3

Query  632  DRQSEAVKRLDEVFRNIRYVAIKAEDEIESKLSD-----------VYLGVGEDLHQTLQQ  486
            D     V+ ++ +   IR +A +AED IES +SD           + L   E     LQ 
Sbjct  51   DNAQIGVETVEGLEGRIRDLAYRAEDIIESHVSDQISSEQERYVDLELQNSEKKEVDLQL  110

Query  485  VVKDIESIEVRISDLQITHTaasssasssssldsddaspSLRLEKFLEHDDFKRIGA-ED  309
            V+++ +SI  ++  +Q + T      S +S+         L       +D  K +G  ED
Sbjct  111  VMEETDSIVEQVMSIQNSCTVEDVQCSYASA---------LPSSGGAPNDGNKMVGFDED  161

Query  308  AFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLR  129
               +K R   +   S    +ISIVG   I  T+LA  ++ D  +VYHF I+ WTTVS  +
Sbjct  162  ILELKAR---LCGESSTLQIISIVGMGGIGKTTLATNIFNDSLVVYHFHIRVWTTVS--Q  216

Query  128  EFNERQLLFQLLG  90
             ++ RQ+L  L+ 
Sbjct  217  NYHLRQVLLALVA  229



>ref|XP_009763644.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Nicotiana sylvestris]
Length=353

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 49/90 (54%), Gaps = 2/90 (2%)
 Frame = -3

Query  293  IRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNER  114
            I+  L+   S  +  ++I G   I  T+ AR++Y+DP I  HF I AW T S  +E+  R
Sbjct  170  IKCKLMKISSDERETMAITGMGGIGKTTFARKIYDDPEIKSHFDILAWATAS--KEYCVR  227

Query  113  QLLFQLLGsidsslltsmssDEDADHLGKL  24
            ++L QLL  I S+      + +D +  GKL
Sbjct  228  KMLLQLLHCIPSTEEVRREARDDGELSGKL  257



>ref|XP_009613202.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
 ref|XP_009613212.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
 ref|XP_009613219.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana tomentosiformis]
Length=758

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 56/83 (67%), Gaps = 4/83 (5%)
 Frame = -3

Query  341  HDDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFP  162
            ++DF  +G E+     I+K+      K + +ISIVG   +  T+LA+++Y++P I++HF 
Sbjct  23   NEDF--VGFEEDVNQIIQKLTGFGGPKQRDIISIVGMPGLGKTTLAKKVYDNPLIIHHFN  80

Query  161  IQAWTTVSPLREFNERQLLFQLL  93
            ++A+ TVS  ++++ER+LL ++L
Sbjct  81   VRAFCTVS--QKYDERKLLVEIL  101



>ref|XP_009622003.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
 ref|XP_009622004.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
 ref|XP_009622005.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
Length=771

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 2/58 (3%)
 Frame = -3

Query  266  SKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            SK   VISI G + +  T+LAR++Y + SI+ HF +QAW TVS  + +N R LL  +L
Sbjct  48   SKELDVISIFGMAGLGKTTLARKVYNNTSIINHFDVQAWCTVS--QTYNMRTLLVDIL  103



>ref|XP_002442615.1| hypothetical protein SORBIDRAFT_08g023030 [Sorghum bicolor]
 gb|EES16453.1| hypothetical protein SORBIDRAFT_08g023030 [Sorghum bicolor]
Length=1000

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 45/77 (58%), Gaps = 2/77 (3%)
 Frame = -3

Query  341  HDDFKRIGAEDAFFMKIRKVLVDWRS--KPQAVISIVGASRISNTSLARRLYEDPSIVYH  168
            ++D   IG+ ++ F  ++ ++++       +AVISI+G   I  T+LA++LY DP I+ H
Sbjct  195  YEDKYVIGSRESEFAILKDLIINKEGDISHRAVISILGERGIGKTTLAKKLYNDPDIIKH  254

Query  167  FPIQAWTTVSPLREFNE  117
            F + AW  + P   F E
Sbjct  255  FEVHAWVCLPPHIRFRE  271



>emb|CDP10349.1| unnamed protein product [Coffea canephora]
Length=731

 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 41/60 (68%), Gaps = 4/60 (7%)
 Frame = -3

Query  266  SKPQAV--ISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            S P+ V  + IVG + +  T+LA+ +Y D SI+Y+F I+ W TVS  +E+N++ LL Q+L
Sbjct  30   SGPEQVEIVPIVGMAGLGKTTLAKNIYNDNSIIYNFHIRLWCTVS--QEYNKKSLLTQIL  87



>ref|XP_006356562.1| PREDICTED: putative late blight resistance protein homolog R1A-3-like 
[Solanum tuberosum]
Length=278

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = -3

Query  266  SKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLGs  87
            +K + VI+I G   +  T+LA+++Y +PSIV +F ++AW TVS  + +N R LL ++   
Sbjct  49   TKERDVITIYGMPGLGKTTLAKKVYNNPSIVNYFDVKAWCTVS--QAYNRRTLLVEIFKQ  106

Query  86   idsslltsmssDEDADHLGKLLCQK  12
              +  +     D+ AD L K+L  K
Sbjct  107  ATNDKIKIKEDDDVADMLRKVLIGK  131



>ref|XP_009773240.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana sylvestris]
Length=675

 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 46/81 (57%), Gaps = 3/81 (4%)
 Frame = -3

Query  335  DFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQ  156
            D   +G E+     ++  L++  S    V++IVG   I  T+ ARR+Y+D  I  HF I 
Sbjct  74   DNNMVGHENEL-EDMKSTLMETSSDETQVVAIVGMGGIGKTTFARRIYDDLEIKSHFDIL  132

Query  155  AWTTVSPLREFNERQLLFQLL  93
            AW T+S  +E+  R++L QLL
Sbjct  133  AWVTMS--KEYGVRKMLLQLL  151



>ref|XP_010319327.1| PREDICTED: disease resistance protein RPP13-like isoform X2 [Solanum 
lycopersicum]
Length=479

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 69/134 (51%), Gaps = 6/134 (4%)
 Frame = -3

Query  503  HQTLQQVVKDIESIEVRISDLQITHTaasssasssssldsddaspSLRLEKFLEHDDFKR  324
             + L  V ++I+S++ RI D+         +  +S    S+      R   +++  D   
Sbjct  105  EKKLYNVAEEIQSLKQRIMDISRKRETYGITNINSGEGTSNQVRTMRRTTSYVDEQDNIF  164

Query  323  IGAEDAFFMKIRKVLVDWRSKPQ-AVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWT  147
            +G +D     + ++L   +++P+ +VISI G   +  T+LAR LY +P+IV  FP +AW 
Sbjct  165  VGLQDVVEKLLAQLL---KAEPRRSVISIHGMGGLGKTTLARNLYNNPNIVSSFPTRAWI  221

Query  146  TVSPLREFNERQLL  105
             VS  +E+N   LL
Sbjct  222  CVS--QEYNTMDLL  233



>emb|CDP10265.1| unnamed protein product [Coffea canephora]
Length=693

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 42/60 (70%), Gaps = 4/60 (7%)
 Frame = -3

Query  266  SKPQAV--ISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            S P+ V  + IVG + +  T+LA+++Y D SI+Y+F I+ W T+S  +E+N++ LL Q+L
Sbjct  30   SGPEHVEIVPIVGMAGLGKTTLAKKVYNDNSIIYNFHIRLWCTIS--QEYNKKSLLTQIL  87



>ref|XP_011083960.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Sesamum indicum]
Length=805

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VISIVG      T+LAR +Y+D  IVYHF  +AW T+S  +E++ R++L  LL
Sbjct  97   VISIVGMGGSGKTTLARSMYDDAFIVYHFYTRAWVTIS--QEYHLREILLGLL  147



>emb|CDP15591.1| unnamed protein product [Coffea canephora]
Length=792

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 36/54 (67%), Gaps = 2/54 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLG  90
            VISIVG + +  T LA+R+Y DP I  HF IQAW+ +S  + + ++ LL Q+L 
Sbjct  67   VISIVGVAGLGKTFLAQRVYRDPRITSHFHIQAWSYIS--QTYCKKDLLLQILA  118



>ref|XP_011073066.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=777

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 49/80 (61%), Gaps = 4/80 (5%)
 Frame = -3

Query  329  KRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAW  150
            + +G +D   M+I+  L    S+ Q  ISIVG   I  T+LA+ +++D S+ Y+F I+AW
Sbjct  163  RMVGLDDDL-MQIKARLCGGSSQLQT-ISIVGMGGIGKTTLAKNIFDDASLGYYFDIRAW  220

Query  149  TTVSPLREFNERQLLFQLLG  90
             TVS  + ++ R +L  LLG
Sbjct  221  MTVS--QNYHVRDILLGLLG  238



>ref|XP_010661778.1| PREDICTED: putative disease resistance protein At1g50180 [Vitis 
vinifera]
Length=816

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/59 (41%), Positives = 37/59 (63%), Gaps = 2/59 (3%)
 Frame = -3

Query  269  RSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            R +P+AV+SIVG   +  T+LA+++Y    +  HF  QAW  VS  +EF  R+LL  ++
Sbjct  188  RMRPRAVMSIVGMGGLGKTTLAKKVYNHNDVKQHFHCQAWVYVS--QEFKPRELLLSII  244



>ref|XP_008811538.1| PREDICTED: putative disease resistance RPP13-like protein 3 [Phoenix 
dactylifera]
Length=929

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = -3

Query  338  DDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPI  159
            DD   IG E+    KI   L+D   K + VISIVG   +  T+LAR++Y DP+I  HF  
Sbjct  166  DDIDVIGFENDK-KKIVSQLLDENKKARCVISIVGMGGLGKTTLARKVYNDPAIKKHFDT  224

Query  158  QAWTTVS  138
             AW +VS
Sbjct  225  FAWVSVS  231



>ref|XP_006362543.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006362544.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006362545.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X3 [Solanum tuberosum]
Length=698

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 38/53 (72%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            ++SIVG + +  T+LAR++Y   SI+ HF ++AW +VS  + +N R+LL Q+L
Sbjct  43   IVSIVGMAGLGKTALARKIYNSRSIIDHFDVRAWCSVS--QTYNMRELLLQIL  93



>ref|XP_010914752.1| PREDICTED: putative disease resistance RPP13-like protein 3 [Elaeis 
guineensis]
Length=925

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = -3

Query  359  LEKFLEH--DDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYED  186
            L +F  H  DD   IG ED    K+ K+LVD  +K ++VISIVG   +  T+LAR+++ D
Sbjct  152  LRQFPPHFYDDTDVIGFEDDK-EKLVKLLVDPENKNRSVISIVGMGGLGKTTLARKVHND  210

Query  185  PSIVYHFPIQAWTTVS  138
            P+I   F   AW +VS
Sbjct  211  PAIRERFGTFAWVSVS  226



>ref|XP_010319326.1| PREDICTED: disease resistance protein RPP13-like isoform X1 [Solanum 
lycopersicum]
Length=843

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 69/133 (52%), Gaps = 6/133 (5%)
 Frame = -3

Query  500  QTLQQVVKDIESIEVRISDLQITHTaasssasssssldsddaspSLRLEKFLEHDDFKRI  321
            + L  V ++I+S++ RI D+         +  +S    S+      R   +++  D   +
Sbjct  106  KKLYNVAEEIQSLKQRIMDISRKRETYGITNINSGEGTSNQVRTMRRTTSYVDEQDNIFV  165

Query  320  GAEDAFFMKIRKVLVDWRSKPQ-AVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTT  144
            G +D     + ++L   +++P+ +VISI G   +  T+LAR LY +P+IV  FP +AW  
Sbjct  166  GLQDVVEKLLAQLL---KAEPRRSVISIHGMGGLGKTTLARNLYNNPNIVSSFPTRAWIC  222

Query  143  VSPLREFNERQLL  105
            VS  +E+N   LL
Sbjct  223  VS--QEYNTMDLL  233



>ref|XP_009774731.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009774733.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=787

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 50/91 (55%), Gaps = 4/91 (4%)
 Frame = -3

Query  293  IRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNER  114
            ++K++V   +K   VISI G   +  T+LAR++Y +PSIV +F ++AW +VS  + +N R
Sbjct  41   MKKLIVG--TKELDVISIFGMPGLGKTTLARKVYNNPSIVNYFDVKAWCSVS--QAYNRR  96

Query  113  QLLFQLLGsidsslltsmssDEDADHLGKLL  21
             LL ++               + AD L K L
Sbjct  97   TLLLEIFKQATRDKSEIKEDVDIADKLQKTL  127



>ref|XP_009596953.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
 ref|XP_009596954.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
 ref|XP_009596956.1| PREDICTED: putative late blight resistance protein homolog R1C-3 
[Nicotiana tomentosiformis]
Length=787

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 44/77 (57%), Gaps = 2/77 (3%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLGsidssl  72
            VISI G   +  T+LAR++Y++PSIV +F ++AW +VS  + +N R LL ++        
Sbjct  53   VISIFGMPGLGKTTLARKVYDNPSIVNYFDVKAWCSVS--QAYNRRTLLIEIFKQATRDK  110

Query  71   ltsmssDEDADHLGKLL  21
                 + + AD L K L
Sbjct  111  SEIDEAVDIADKLQKTL  127



>ref|XP_011072557.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=891

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 36/52 (69%), Gaps = 2/52 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQL  96
            +I IVG   I  T+LAR + ++P IV +F I+AW TVS  +E+N RQ+L +L
Sbjct  180  IIPIVGMGGIGKTTLARNVCQNPLIVQYFDIRAWVTVS--QEYNTRQILLEL  229



>gb|ACE79400.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=261

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 58/112 (52%), Gaps = 8/112 (7%)
 Frame = -3

Query  347  LEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYH  168
            LE +D K +G E+ F M   ++    R     V+SIVG   I  T+LA ++Y DP I+ H
Sbjct  28   LEPED-KMVGLENEFEMMQDQLARGARE--LEVVSIVGMGGIGKTTLANKIYSDPFIMSH  84

Query  167  FPIQAWTTVSPLREFNERQLLFQLLGsidsslltsmssDED---ADHLGKLL  21
            F I+A  TVS  +E+  R +L  LL SI           +D   AD L KLL
Sbjct  85   FDIRAKATVS--QEYCARNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLL  134



>ref|XP_006360876.1| PREDICTED: disease resistance protein RPP13-like [Solanum tuberosum]
Length=850

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 71/132 (54%), Gaps = 9/132 (7%)
 Frame = -3

Query  488  QVVKDIESIEVRISDLQI---THTaasssasssssldsddaspSLRLEKFLEHDDFKRIG  318
             V K+I+S++ R+ D+ +   T+   ++   ++    S+      R   +++  D+  +G
Sbjct  103  NVAKEIQSLKQRVMDISVKRETYDITNTINYNAGKGTSNKVRTLRRTTSYVDDQDYIFVG  162

Query  317  AEDAFFMKIRKVLVDWRSKPQ-AVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTV  141
             +D     + ++L   +++P+ +V+SI G   +  T+LAR+LY +P+I   FP  AW  V
Sbjct  163  LQDVVQTLVYELL---KAEPRRSVLSIYGMGGLGKTTLARKLYINPNIASSFPTCAWICV  219

Query  140  SPLREFNERQLL  105
            S  +E+N   LL
Sbjct  220  S--QEYNTMDLL  229



>dbj|BAB89656.1| putative disease resistance protein [Oryza sativa Japonica Group]
Length=985

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 43/74 (58%), Gaps = 1/74 (1%)
 Frame = -3

Query  353  KFLEHDDFKRIGAE-DAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSI  177
            +F+  DDF+      D +   +++ L+D     +A++SIVG S I  T+L R++Y+ P +
Sbjct  195  EFVGRDDFEEYTVGFDKYSNMLKEQLIDDAVTGRAIVSIVGESSIGKTTLGRKVYQSPEV  254

Query  176  VYHFPIQAWTTVSP  135
              HF I+ WT + P
Sbjct  255  RNHFEIRTWTVLPP  268



>ref|XP_009589053.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009589054.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=635

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 2/55 (4%)
 Frame = -3

Query  254  AVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLG  90
             VI +VG   I  T+LAR++Y+D +I Y F   AW T+S +  +NERQ+L +L+ 
Sbjct  172  TVIPVVGMGGIGKTTLARKVYDDSTIRYRFDKHAWVTISQV--YNERQILLELVS  224



>ref|XP_009774730.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009774732.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=787

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (55%), Gaps = 2/77 (3%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLGsidssl  72
            VISI G   +  T+LAR++Y +PSIV +F ++AW +VS  + +N R LL ++        
Sbjct  53   VISIYGMPGLGKTTLARKVYNNPSIVNYFDVKAWCSVS--QAYNRRTLLLEIFKQATRDK  110

Query  71   ltsmssDEDADHLGKLL  21
                   + AD L K L
Sbjct  111  SEIKEDVDIADKLQKTL  127



>ref|XP_009772626.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772627.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772628.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=791

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 50/91 (55%), Gaps = 4/91 (4%)
 Frame = -3

Query  293  IRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNER  114
            ++K++V   +K   VISI G   +  T+LAR++Y +PSIV +F ++AW +VS  + +N R
Sbjct  41   MKKLIVG--TKELDVISIFGMPGLGKTTLARKVYNNPSIVNYFDVKAWCSVS--QAYNRR  96

Query  113  QLLFQLLGsidsslltsmssDEDADHLGKLL  21
             LL ++               + AD L K L
Sbjct  97   TLLLEIFKQATRDKSEIKEDVDIADKLQKTL  127



>ref|XP_009624584.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X3 [Nicotiana tomentosiformis]
Length=723

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VISI G   I  ++ A+R++ DPSIV  F ++ W TVS  +++N R++L  LL
Sbjct  181  VISIAGMGGIGKSTFAKRMFNDPSIVSFFDVRGWVTVS--KDYNLRKMLLSLL  231



>emb|CDP10353.1| unnamed protein product [Coffea canephora]
Length=370

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 47/77 (61%), Gaps = 4/77 (5%)
 Frame = -3

Query  323  IGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTT  144
            +G +D     IR+++    SK   ++ IVG + +  T+LA+++Y D S+  +F I+ W T
Sbjct  58   VGLDDEAAKVIRRLVRG--SKQVEIVPIVGMAGLGKTTLAKKVYNDSSVTCYFHIRLWCT  115

Query  143  VSPLREFNERQLLFQLL  93
            VS  +EFN + +L Q+L
Sbjct  116  VS--QEFNMKNVLLQIL  130



>emb|CDP10113.1| unnamed protein product [Coffea canephora]
Length=949

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNE  117
            V+S+VG + +  T+L ++++EDP ++ HFP++AW TVS   +F +
Sbjct  194  VVSVVGMAGLGKTTLVKKVHEDPDVISHFPVRAWVTVSQTCDFQD  238



>ref|XP_009800005.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
Length=731

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VISI G   +  T+LAR++Y +PSIV HF  +AW +VS  + ++ R LL ++L
Sbjct  13   VISIFGMPGLGKTTLARKVYNNPSIVNHFDAKAWCSVS--QAYDRRMLLIEML  63



>emb|CDP15268.1| unnamed protein product [Coffea canephora]
Length=1484

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = -3

Query  260  PQA-VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLG  90
            PQ  V+SIVG   +  T+LA + Y DPS+ Y F  +AW  VS    +  R+LL Q+LG
Sbjct  781  PQLDVVSIVGMPGLGKTTLALKAYNDPSVTYQFHARAWCYVS--HTYRRRELLLQILG  836



>gb|EYU21177.1| hypothetical protein MIMGU_mgv1a018978mg [Erythranthe guttata]
Length=745

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLG  90
            +I IVG   I  T+LA+  YE   IV+HF I+ W TVS  +++N +QLL QLL 
Sbjct  62   IIPIVGMGGIGKTTLAQNAYEHSLIVHHFDIRTWVTVS--QKYNVKQLLLQLLS  113



>gb|ACE79429.1| NBS-coding resistance gene analog [Nicotiana tabacum]
 gb|ACF22013.1| NBS-coding resistance gene protein [Nicotiana tabacum]
 gb|ACF22015.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=271

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 58/112 (52%), Gaps = 8/112 (7%)
 Frame = -3

Query  347  LEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYH  168
            LE +D K +G E+ F M   ++    R     V+SIVG   I  T+LA ++Y DP I+ H
Sbjct  28   LEPED-KMVGLENEFEMMQDQLARGARE--LEVVSIVGMGGIGKTTLANKIYSDPFIMSH  84

Query  167  FPIQAWTTVSPLREFNERQLLFQLLGsidsslltsmssDED---ADHLGKLL  21
            F I+A  TVS  +E+  R +L  LL SI           +D   AD L KLL
Sbjct  85   FDIRAKATVS--QEYCARNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLL  134



>ref|XP_009624582.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana tomentosiformis]
Length=843

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VISI G   I  ++ A+R++ DPSIV  F ++ W TVS  +++N R++L  LL
Sbjct  181  VISIAGMGGIGKSTFAKRMFNDPSIVSFFDVRGWVTVS--KDYNLRKMLLSLL  231



>gb|EYU24354.1| hypothetical protein MIMGU_mgv1a019328mg [Erythranthe guttata]
Length=815

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 38/59 (64%), Gaps = 3/59 (5%)
 Frame = -3

Query  269  RSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            RS  Q +I IVG   I  T+LA+  YE   IV+HF I+ W T+S  +++N +QLL QLL
Sbjct  127  RSNRQ-IIPIVGMGGIGKTTLAKNSYEHSLIVHHFDIRTWVTIS--QKYNVKQLLLQLL  182



>ref|XP_006350138.1| PREDICTED: putative late blight resistance protein homolog R1C-3-like, 
partial [Solanum tuberosum]
Length=911

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/115 (34%), Positives = 61/115 (53%), Gaps = 10/115 (9%)
 Frame = -3

Query  356  EKFLEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQ---AVISIVGASRISNTSLARRLYED  186
            E+ +E  +   +G E+ F     K+++D  ++ +   AV+SIVG   I  T+LA +LY D
Sbjct  135  ERAVERSEDIMVGYENEF-----KMMLDQLARGERELAVVSIVGMGGIGKTTLATKLYND  189

Query  185  PSIVYHFPIQAWTTVSPLREFNERQLLFQLLGsidsslltsmssDEDADHLGKLL  21
            P ++Y F I+A  TVS  +E+  R +   LL  I       +   + AD L KLL
Sbjct  190  PCMMYRFDIRAKATVS--QEYCVRNVFLDLLSCISDKPYDQLHDGQLADRLQKLL  242



>gb|ACE79448.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=270

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 58/112 (52%), Gaps = 8/112 (7%)
 Frame = -3

Query  347  LEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYH  168
            LE +D K +G E+ F M   ++    R     V+SIVG   I  T+LA ++Y DP I+ H
Sbjct  28   LEPED-KMVGLENEFEMMQDQLARGARE--LEVVSIVGMGGIGKTTLANKIYSDPFIMSH  84

Query  167  FPIQAWTTVSPLREFNERQLLFQLLGsidsslltsmssDED---ADHLGKLL  21
            F I+A  TVS  +E+  R +L  LL SI           +D   AD L KLL
Sbjct  85   FDIRAKATVS--QEYCARNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLL  134



>ref|XP_009794857.1| PREDICTED: disease resistance protein RPP13-like, partial [Nicotiana 
sylvestris]
Length=495

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 32/51 (63%), Gaps = 2/51 (4%)
 Frame = -3

Query  257  QAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLL  105
            ++VISI G   I  T+LAR LY  PS++  FP +AW  VS  +EFN   LL
Sbjct  197  RSVISIYGMGGIGKTTLARNLYNSPSLITSFPTRAWICVS--QEFNTPDLL  245



>ref|XP_008777037.1| PREDICTED: putative disease resistance protein At1g50180 [Phoenix 
dactylifera]
Length=481

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = -3

Query  338  DDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPI  159
            DD   IG E+    KI   L+D   K + VISIVG   +  T+LAR++Y DP+I  HF  
Sbjct  161  DDIDVIGFENDK-KKIVSQLLDRNKKARCVISIVGMGGLGKTTLARKVYNDPAIREHFNT  219

Query  158  QAWTTVS  138
             AW +VS
Sbjct  220  FAWVSVS  226



>ref|XP_009768089.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=842

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/77 (34%), Positives = 49/77 (64%), Gaps = 4/77 (5%)
 Frame = -3

Query  323  IGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTT  144
            IG ED F   IR  L+  +++   ++SIVG   +  T+LAR+++ +PS+++ F + +W T
Sbjct  115  IGMEDDF-NDIRDRLIG-QARELNIVSIVGMGGMGKTTLARQVFSNPSVLFRFDVSSWVT  172

Query  143  VSPLREFNERQLLFQLL  93
            +S  +E+  R++L  +L
Sbjct  173  IS--QEYEAREILINVL  187



>gb|ACE79508.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=254

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VISI G   +  T+LAR++Y +PSIV HF  + W +VS  + + ER LL ++L
Sbjct  57   VISIFGMPGLGKTTLARKVYNNPSIVNHFDARVWCSVS--QTYIERTLLIEIL  107



>gb|ACE79510.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=250

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VISI G   +  T+LAR++Y +PSIV HF  + W +VS  + + ER LL ++L
Sbjct  57   VISIFGMPGLGKTTLARKVYNNPSIVNHFDARVWCSVS--QTYIERTLLIEIL  107



>emb|CDP11163.1| unnamed protein product [Coffea canephora]
Length=2495

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = -3

Query  266  SKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            S  +AVI I G   I  T++AR++Y +  ++YHF  +AW TVS L E  +R LL Q+L
Sbjct  700  SSHRAVICIFGMPGIGKTTMARKVYNNQKVMYHFHRRAWCTVSQLYE--KRDLLLQIL  755



>ref|XP_009631207.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=933

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VISI G   I  ++ A+R++ DPSIV  F ++ W TVS  +++N R++L  LL
Sbjct  181  VISIAGMGGIGKSTFAKRMFNDPSIVSFFDVRGWVTVS--KDYNLRKMLLSLL  231



>ref|XP_010319547.1| PREDICTED: disease resistance protein RPP13-like [Solanum lycopersicum]
Length=541

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 49/87 (56%), Gaps = 6/87 (7%)
 Frame = -3

Query  362  RLEKFLEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQ-AVISIVGASRISNTSLARRLYED  186
            R   +++  D+  +G +D     + ++L   R +P+ +V+SI G   +  T+LAR LY  
Sbjct  152  RTTSYVDDQDYIFVGFQDVVQTLLAQLL---RPEPRRSVVSIYGMGGLGKTTLARNLYTS  208

Query  185  PSIVYHFPIQAWTTVSPLREFNERQLL  105
            P+IV  FP +AW  VS  +E+N   LL
Sbjct  209  PNIVSSFPKRAWICVS--QEYNTTDLL  233



>gb|ACE79513.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=252

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VISI G   +  T+LAR++Y +PSIV HF  + W +VS  + + ER LL ++L
Sbjct  57   VISIFGMPGLGKTTLARKVYNNPSIVNHFDARVWCSVS--QTYIERTLLIEIL  107



>gb|ACE79512.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=249

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VISI G   +  T+LAR++Y +PSIV HF  + W +VS  + + ER LL ++L
Sbjct  57   VISIFGMPGLGKTTLARKVYNNPSIVNHFDARVWCSVS--QTYIERTLLIEIL  107



>ref|XP_008797616.1| PREDICTED: putative disease resistance protein At1g50180 [Phoenix 
dactylifera]
Length=924

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (58%), Gaps = 3/83 (4%)
 Frame = -3

Query  338  DDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPI  159
            D+ + IG E+    +I   L+D   K + VISIVG   +  T+LAR++Y DP+I  HF  
Sbjct  164  DNIEVIGFENDK-KEIMSQLLDGNEKTRCVISIVGMGGLGKTTLARKVYNDPAIGKHFDT  222

Query  158  QAWTTVSPLREFNERQLLFQLLG  90
             AW +VS  + +   +LL  ++G
Sbjct  223  FAWVSVS--QSYRGIELLKDIMG  243



>ref|XP_009797471.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
Length=761

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 54/83 (65%), Gaps = 4/83 (5%)
 Frame = -3

Query  341  HDDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFP  162
            ++DF  +G E+     I+K+      K + +ISIVG   +  T+LA ++Y +P +++HF 
Sbjct  23   NEDF--VGFEEDVNQIIQKLTGFGGPKQRDIISIVGMPGLGKTTLANKVYNNPLVIHHFN  80

Query  161  IQAWTTVSPLREFNERQLLFQLL  93
            ++A+ TVS  ++++ER+LL ++L
Sbjct  81   VRAFCTVS--QKYDERKLLVEIL  101



>ref|XP_004242251.1| PREDICTED: putative late blight resistance protein homolog R1B-17 
[Solanum lycopersicum]
Length=763

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 50/85 (59%), Gaps = 2/85 (2%)
 Frame = -3

Query  266  SKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLGs  87
            +K + VISI G   +  T+LAR++Y +PSI+ +F ++AW  VS  + +N R LL ++   
Sbjct  52   TKERNVISIYGMPGLGKTTLARKVYNNPSILNYFDVKAWCAVS--QAYNRRTLLVEIFKQ  109

Query  86   idsslltsmssDEDADHLGKLLCQK  12
              S+ +     D+ AD L K+L  K
Sbjct  110  ATSNKIKIKEDDDVADMLRKVLIGK  134



>emb|CDP11161.1| unnamed protein product [Coffea canephora]
Length=871

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 43/69 (62%), Gaps = 5/69 (7%)
 Frame = -3

Query  287  KVLVDWRSKPQA---VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNE  117
            +V+ D  +K  A   ++SIVG   I  T++A +L+  P ++ HF  +AW TVS  +E+ +
Sbjct  208  QVITDQLTKGSARLGIVSIVGMPGIGKTTMAWKLFNCPKVLSHFHCRAWCTVS--QEYEK  265

Query  116  RQLLFQLLG  90
            R LL ++LG
Sbjct  266  RDLLLEILG  274



>ref|XP_011093987.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=821

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 44/69 (64%), Gaps = 3/69 (4%)
 Frame = -3

Query  299  MKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFN  120
            M ++  L+  +S+ + VI IVG   I  T+LAR LY DPS++ HF ++ W T+S  ++++
Sbjct  126  MHLKYRLIGGKSELE-VIPIVGMGGIGKTTLARNLYHDPSVISHFDVRIWATIS--QDYS  182

Query  119  ERQLLFQLL  93
            E  +L  LL
Sbjct  183  EGGILNGLL  191



>ref|XP_009624579.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624580.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009624581.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana tomentosiformis]
Length=935

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VISI G   I  ++ A+R++ DPSIV  F ++ W TVS  +++N R++L  LL
Sbjct  181  VISIAGMGGIGKSTFAKRMFNDPSIVSFFDVRGWVTVS--KDYNLRKMLLSLL  231



>gb|ACE79509.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=252

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VISI G   +  T+LAR++Y +PSIV HF  + W +VS  + + ER LL ++L
Sbjct  58   VISIFGMPGLGKTTLARKVYNNPSIVNHFDARVWCSVS--QTYIERTLLIEIL  108



>ref|XP_011093989.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=701

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VI IVG   I  T+LAR LY DPS++ HF ++ W T+S  ++++E  +L  LL
Sbjct  25   VIPIVGMGGIGKTTLARNLYHDPSVISHFDVRIWATIS--QDYSEGGILNGLL  75



>emb|CDP15593.1| unnamed protein product [Coffea canephora]
Length=1711

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 44/82 (54%), Gaps = 5/82 (6%)
 Frame = -3

Query  251   VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLGsidssl  72
             +ISIVG   +  T LA+R+Y DPSI  HF I AW  +S +  + ++ LL  +LG ID   
Sbjct  977   IISIVGMPGLGKTFLAQRVYHDPSIASHFHILAWCCISQV--YCKKDLLLGILGCIDPKA  1034

Query  71    ltsmssDEDADHLGKLLCQKLK  6
               S     D D L   LC  L+
Sbjct  1035  QYSEM---DEDDLAHKLCNHLR  1053



>emb|CDP05514.1| unnamed protein product [Coffea canephora]
Length=875

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVS  138
            VISIVG + I  T LA+RLY DP +V+HF ++ W T S
Sbjct  186  VISIVGMAGIGKTKLAKRLYNDPVVVHHFHVRGWATTS  223



>gb|ACE79511.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=245

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VISI G   +  T+LAR++Y +PSIV HF  + W +VS  + + ER LL ++L
Sbjct  50   VISIFGMPGLGKTTLARKVYNNPSIVNHFDARVWCSVS--QTYIERTLLIEIL  100



>emb|CDP04885.1| unnamed protein product [Coffea canephora]
Length=989

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = -3

Query  257  QAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            Q ++S+VG   I  T+LA++LY D  + YHF I+AW  +S +  +++RQ+L  +L
Sbjct  295  QDMVSLVGMPGIGKTTLAKKLYNDSRVTYHFHIRAWCCISQV--YSKRQVLLDIL  347



>ref|XP_011091064.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=856

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 34/54 (63%), Gaps = 2/54 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLG  90
            +I IVG   I  T+LAR LY DP +V HF  +AW  +S  ++++ R +L  LLG
Sbjct  170  IIPIVGMGGIGKTTLARNLYNDPLVVSHFDTRAWIVIS--QDYDVRAILLGLLG  221



>emb|CDP05441.1| unnamed protein product [Coffea canephora]
Length=803

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VI IVG   +  T+LARRLY D S+VYHF  +AW + S +  F  R LL ++L
Sbjct  86   VIYIVGMPGMGKTTLARRLYNDLSVVYHFHTRAWVSTSQV--FQMRNLLCRIL  136



>gb|ACF22006.1| NBS-coding resistance gene protein [Nicotiana tabacum]
Length=186

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 48/85 (56%), Gaps = 5/85 (6%)
 Frame = -3

Query  347  LEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYH  168
            LE +D K +G E+ F M   ++    R     V+SIVG   I  T+LA ++Y DP I+ H
Sbjct  6    LEPED-KMVGLENEFEMMQDQLARGARE--LEVVSIVGMGGIGKTTLANKIYSDPFIMSH  62

Query  167  FPIQAWTTVSPLREFNERQLLFQLL  93
            F I+A  TVS  +E+  R +L  LL
Sbjct  63   FDIRAKATVS--QEYCARNVLLGLL  85



>ref|XP_004252037.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010313675.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=934

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +I IVG + I  T+LA+R Y D S+V  F ++AW TVS  +E+ ER +LF L 
Sbjct  176  IICIVGMAGIGKTTLAKRAYNDISVVNRFDVRAWVTVS--QEYRERDILFDLF  226



>gb|ACE79434.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 57/106 (54%), Gaps = 7/106 (7%)
 Frame = -3

Query  329  KRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAW  150
            K +G E+ F M   ++     +K   V+SIVG   I  T+LA ++Y DP I+ HF I+A 
Sbjct  33   KMVGLENEFEMMQDQLARG--AKELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFGIRAK  90

Query  149  TTVSPLREFNERQLLFQLLGsidsslltsmssDED---ADHLGKLL  21
             TVS  +E+  R +L +LL SI   +       +D   AD L KLL
Sbjct  91   ATVS--QEYCARYVLLRLLSSISGKIEEFHEHQDDDQLADRLQKLL  134



>emb|CDP21430.1| unnamed protein product [Coffea canephora]
Length=735

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/88 (33%), Positives = 48/88 (55%), Gaps = 2/88 (2%)
 Frame = -3

Query  272  WRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            W S+   ++ IVG + +  T+LA+++Y + S+  HF I+ W TVS  +EFN + +L Q+L
Sbjct  30   WGSEQVEIVPIVGMAGLGKTTLAKKVYNNSSVTCHFHIRLWCTVS--QEFNMKNVLLQIL  87

Query  92   GsidsslltsmssDEDADHLGKLLCQKL  9
                         + D D L + L +KL
Sbjct  88   CPDGKHSRKDEFQNLDEDDLVQKLRKKL  115



>gb|EYU24163.1| hypothetical protein MIMGU_mgv1a019941mg, partial [Erythranthe 
guttata]
Length=843

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (56%), Gaps = 2/81 (2%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLGsidssl  72
            +I IVG   I  T+LA  +Y +P IV HF ++AW TVS  +E+ ++++L  LL  I++  
Sbjct  180  IIPIVGMGGIGKTTLATHVYTNPFIVQHFHVRAWFTVS--QEYTKKEILLGLLHKINNKN  237

Query  71   ltsmssDEDADHLGKLLCQKL  9
                    D D LG  L + L
Sbjct  238  SNDAHDMNDEDELGDKLHKTL  258



>gb|ACE79422.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=271

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 57/106 (54%), Gaps = 7/106 (7%)
 Frame = -3

Query  329  KRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAW  150
            K +G E+ F M   ++     +K   V+SIVG   I  T+LA ++Y DP I+ HF I+A 
Sbjct  33   KMVGLENEFEMMQDQLARG--AKELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFGIRAK  90

Query  149  TTVSPLREFNERQLLFQLLGsidsslltsmssDED---ADHLGKLL  21
             TVS  +E+  R +L +LL SI   +       +D   AD L KLL
Sbjct  91   ATVS--QEYCARYVLLRLLSSISGKIEEFHEHQDDDQLADRLQKLL  134



>emb|CDP04878.1| unnamed protein product [Coffea canephora]
Length=1428

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/55 (42%), Positives = 37/55 (67%), Gaps = 2/55 (4%)
 Frame = -3

Query  257  QAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            Q ++S+VG   I  T+LA++LY D  I YHF I+AW  +S +  +++RQ+L  +L
Sbjct  776  QDMVSLVGMPVIGKTTLAKKLYNDSRITYHFHIRAWCCISQV--YSKRQVLLDIL  828



>ref|XP_009603187.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=677

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 46/77 (60%), Gaps = 3/77 (4%)
 Frame = -3

Query  323  IGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTT  144
            +G E+ F  K+   L+   ++   V+S+VG   I  ++LA  ++ + S+ YHF + +W T
Sbjct  152  VGMENVF-NKVLNQLIGGNARELNVVSVVGMGGIGKSTLAGSIFRNTSVFYHFDVSSWVT  210

Query  143  VSPLREFNERQLLFQLL  93
            VS  +E++ R++L  +L
Sbjct  211  VS--QEYDVREMLLDVL  225



>ref|XP_008812968.1| PREDICTED: putative disease resistance RPP13-like protein 3 [Phoenix 
dactylifera]
Length=1061

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 38/67 (57%), Gaps = 1/67 (1%)
 Frame = -3

Query  338  DDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPI  159
            DD   IG E+    KI   L+D   K + VISIVG   +  T+LA ++Y DP+I  HF  
Sbjct  273  DDIDVIGFENDK-KKIVSRLLDKNKKARCVISIVGMGGLGKTTLASKVYNDPAIKKHFDT  331

Query  158  QAWTTVS  138
             AW +VS
Sbjct  332  SAWVSVS  338



>gb|ACE79399.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=261

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 40/106 (38%), Positives = 57/106 (54%), Gaps = 7/106 (7%)
 Frame = -3

Query  329  KRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAW  150
            K +G E+ F M   ++     +K   V+SIVG   I  T+LA ++Y DP I+ HF I+A 
Sbjct  33   KMVGLENEFEMMQDQLARG--AKELEVVSIVGMGGIGKTTLANKIYSDPFIMSHFGIRAK  90

Query  149  TTVSPLREFNERQLLFQLLGsidsslltsmssDED---ADHLGKLL  21
             TVS  +E+  R +L +LL SI   +       +D   AD L KLL
Sbjct  91   ATVS--QEYCARYVLLRLLSSISGKIEEFHEHQDDDQLADRLQKLL  134



>ref|XP_010324491.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=875

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = -3

Query  296  KIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNE  117
             +R+ L+   S    VISI G   I  ++ A++L+ DPS+V  F ++ W TVS  ++++ 
Sbjct  155  NMRRRLITGHSSQLEVISIAGMGGIGKSTFAKKLFSDPSVVGFFDVRGWITVS--KDYSS  212

Query  116  RQLLFQLL  93
            R++L  LL
Sbjct  213  RKMLISLL  220



>gb|EYU28481.1| hypothetical protein MIMGU_mgv1a018543mg [Erythranthe guttata]
Length=940

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 11/87 (13%)
 Frame = -3

Query  269  RSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLG  90
            RS  Q +I IVG   I  T+LA+  YE   I +HF I+ W T+S  +++N ++LL QLL 
Sbjct  204  RSNRQ-IIPIVGMGGIGKTTLAKNAYEHSLIAHHFDIRTWVTIS--QKYNVKELLLQLLS  260

Query  89   sidsslltsmssDEDADHLGKLLCQKL  9
             I S +        D++H  +LL QKL
Sbjct  261  MISSEI--------DSEHDEQLLGQKL  279



>ref|XP_011072558.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=742

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            ++ IVG   I  T+LAR +YE+P IV +F   AW TVS  +E+N R++L +L+
Sbjct  30   IVPIVGMGGIGKTALARNVYENPLIVQYFDTCAWVTVS--QEYNIREILLELV  80



>emb|CDP11642.1| unnamed protein product [Coffea canephora]
Length=1450

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = -3

Query  266  SKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            S  + ++SIVG   I  T+LA ++Y DP +VY+F I+AW  VS  + + +R LL  +L
Sbjct  739  SSQREIVSIVGMPGIGKTTLANQVYYDPKVVYYFHIRAWCCVS--QAYAKRDLLLGIL  794



>gb|EYU23518.1| hypothetical protein MIMGU_mgv1a019595mg [Erythranthe guttata]
Length=901

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 36/62 (58%), Gaps = 2/62 (3%)
 Frame = -3

Query  323  IGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTT  144
            +G E+  F  + K+ V  +   + VI IVG   I  T+LA+  YEDP IV HF I+ W T
Sbjct  154  VGFEEHLFQLLDKLTV--QQSNRQVIPIVGMGGIGKTTLAQNAYEDPLIVQHFDIRTWVT  211

Query  143  VS  138
            VS
Sbjct  212  VS  213



>ref|XP_006365680.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
isoform X1 [Solanum tuberosum]
Length=881

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/203 (27%), Positives = 91/203 (45%), Gaps = 37/203 (18%)
 Frame = -3

Query  671  QAYLDKPKLTITSDRQSEAVKRLDEVFRNIRYVAIKAEDEIESKLSDVYLGVGED-----  507
            Q +LD       + +  E VK L++  RNI Y   KAED ++S L  + L   ED     
Sbjct  44   QVFLD------NTTKDIETVKVLEKRIRNIVY---KAEDRVDSCLRKIILADREDKRQKA  94

Query  506  ---LHQTLQQVVKDIESIEVRISDLQITHTaasssasssssldsddaspSLRLEKFLEHD  336
                +Q L +V + +  +   +  ++  +  + S+  +             R+   LE  
Sbjct  95   CTSFYQELLKVEEQVYFLNKEVMQIEFNNHGSKSAELA-------------RISSSLEKS  141

Query  335  DFKR---IGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHF  165
              +    +G ED F   + +V    ++    VI I G   I  T+LAR+ Y+D  I   F
Sbjct  142  TIEENTVVGMEDDFNTILDRVTA--QTDELTVIPIFGMGGIGKTTLARKAYDDSYIQSRF  199

Query  164  PIQAWTTVSPLREFNERQLLFQL  96
               AW T+S  +++NERQ+L ++
Sbjct  200  DKHAWVTIS--QKYNERQMLLEV  220



>ref|XP_011070551.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=891

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 51/83 (61%), Gaps = 4/83 (5%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLGsidssl  72
            V+S++G   +  T+LAR++Y DPSI YHF ++AW  VS  +E++ R++   +L S+    
Sbjct  179  VVSVIGMGGLGKTTLARKVYVDPSIEYHFYLRAWVYVS--QEYSRREVFRGILESLGLMN  236

Query  71   ltsmssDEDADHLGKLLCQKLKD  3
               ++  +D   L + LC+ L++
Sbjct  237  NQMLNMSDDW--LAEELCRHLRN  257



>emb|CDP13418.1| unnamed protein product [Coffea canephora]
Length=958

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREF  123
            V+S+VG   +  T+L +R++EDP +  HFP++AW TVS   +F
Sbjct  194  VVSVVGMGGLGKTTLVKRVHEDPEVRKHFPVRAWVTVSQTCDF  236



>emb|CDP11974.1| unnamed protein product [Coffea canephora]
Length=1481

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +ISIVG   +  T+LA+++Y  PS+  HF ++AW  +S  +++  RQLL  +L
Sbjct  766  IISIVGMPGLGKTTLAKKVYNSPSVASHFHVRAWCCIS--QKYQRRQLLLDIL  816



>ref|XP_004240304.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Solanum lycopersicum]
Length=1320

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLL  105
            VISIVG   +  T+LA R+Y D SIV HF + AW TV   +E NE++LL
Sbjct  595  VISIVGMPGLGKTTLAYRVYNDKSIVDHFDVCAWCTVD--QECNEKKLL  641



>gb|ACE79449.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=270

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 57/112 (51%), Gaps = 8/112 (7%)
 Frame = -3

Query  347  LEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYH  168
            LE +D K +G E+ F M   ++    R     V+SIVG   I  T+LA ++Y DP I+ H
Sbjct  28   LEPED-KMVGLENEFEMMQDQLARGARE--LEVVSIVGMGGIGKTTLANKIYSDPFIMSH  84

Query  167  FPIQAWTTVSPLREFNERQLLFQLLGsidsslltsmssDED---ADHLGKLL  21
            F I+A  TVS  +E+  R +L  LL SI            D   AD L KLL
Sbjct  85   FDIRAKATVS--QEYCARNVLLGLLSSISGKTNEFHEQQGDDQLADQLQKLL  134



>emb|CDP12800.1| unnamed protein product [Coffea canephora]
Length=1162

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            ++ +VG + +  T+LA  +Y DPS++ HFPI+ W TVS  + + +R L+ Q+L
Sbjct  504  IVPVVGMAGLGKTTLADTVYCDPSVIIHFPIRVWCTVS--QAYIKRNLIAQIL  554



>gb|ADL59404.1| R2 late blight resistance protein [Solanum schenckii]
Length=847

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 50/87 (57%), Gaps = 6/87 (7%)
 Frame = -3

Query  362  RLEKFLEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQ-AVISIVGASRISNTSLARRLYED  186
            R   +++  D+  +G +D     + ++L   +++P+ +V+SI G   +  T+LAR+LY  
Sbjct  149  RTTSYVDEQDYIFVGFQDVVQTLLAQLL---KAEPRRSVLSIYGMGGLGKTTLARKLYTS  205

Query  185  PSIVYHFPIQAWTTVSPLREFNERQLL  105
            P I+  FP +AW  VS  +E+N   LL
Sbjct  206  PDILNSFPTRAWICVS--QEYNTMDLL  230



>emb|CDP06250.1| unnamed protein product [Coffea canephora]
Length=843

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREF  123
            V+S+VG   +  T+L +R++EDP +  HFP++AW TVS   +F
Sbjct  175  VVSVVGMGGLGKTTLVKRVHEDPEVRRHFPVRAWVTVSQTCDF  217



>ref|XP_009797439.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009797446.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009797452.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
 ref|XP_009797461.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Nicotiana sylvestris]
Length=726

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VISIVG    S T+L RRLY +PSIV HF ++AW +    + +N  +LL ++L
Sbjct  53   VISIVGMPGQSKTTLVRRLYNNPSIVAHFDVRAWCSFP--QTYNVGKLLLEIL  103



>emb|CDP12966.1| unnamed protein product [Coffea canephora]
Length=965

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREF  123
            V+S+VG   +  T+L +R++EDP +  HFP++AW TVS   +F
Sbjct  194  VVSVVGMGGLGKTTLVKRVHEDPEVRRHFPVRAWVTVSQTCDF  236



>emb|CDP04756.1| unnamed protein product [Coffea canephora]
Length=1312

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 48/87 (55%), Gaps = 3/87 (3%)
 Frame = -3

Query  266  SKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLGs  87
            SK    +SIVG   +  T+LA R+Y DP I+ HF I AW  VS  + ++ R LL QLL S
Sbjct  553  SKLLDFVSIVGMGGLGKTTLANRIYNDPLILRHFHIIAWCAVS--QAYSIRSLLVQLLCS  610

Query  86   idsslltsmssDEDADHLGKLLCQKLK  6
            I S         + AD L  +L ++LK
Sbjct  611  ICSESPDRYLEMDKAD-LAHMLYKRLK  636



>gb|ACE79438.1| NBS-coding resistance gene analog [Nicotiana tabacum]
Length=272

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 58/112 (52%), Gaps = 8/112 (7%)
 Frame = -3

Query  347  LEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYH  168
            LE +D K +G ED F M   ++    R     V+SIVG   I  T+LA ++Y DP ++ H
Sbjct  28   LEPED-KMVGLEDEFEMMQDQLARGARE--LEVVSIVGMGGIGKTTLANKIYSDPFMMSH  84

Query  167  FPIQAWTTVSPLREFNERQLLFQLLGsidsslltsmssDED---ADHLGKLL  21
            F I+A  TVS  +E+  R +L  LL SI           +D   AD L KLL
Sbjct  85   FGIRAKATVS--QEYCARYVLLGLLSSISGKFDEFHEHQDDDQLADQLQKLL  134



>emb|CDP12974.1| unnamed protein product [Coffea canephora]
Length=1032

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREF  123
            V+S+VG   +  T+L +R++EDP +  HFP++AW TVS   +F
Sbjct  194  VVSVVGMGGLGKTTLVKRVHEDPEVRRHFPVRAWVTVSQTCDF  236



>gb|ACU65457.1| Rpi protein [Solanum bulbocastanum]
Length=847

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 50/87 (57%), Gaps = 6/87 (7%)
 Frame = -3

Query  362  RLEKFLEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQ-AVISIVGASRISNTSLARRLYED  186
            R   +++  D+  +G +D     + ++L   +++P+ +V+SI G   +  T+LAR+LY  
Sbjct  149  RTTSYVDEQDYIFVGFQDVVQTLLAQLL---KAEPRRSVLSIYGMGGLGKTTLARKLYTS  205

Query  185  PSIVYHFPIQAWTTVSPLREFNERQLL  105
            P I+  FP +AW  VS  +E+N   LL
Sbjct  206  PDILNSFPTRAWICVS--QEYNTMDLL  230



>ref|XP_009762700.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana sylvestris]
Length=890

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (60%), Gaps = 4/77 (5%)
 Frame = -3

Query  323  IGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTT  144
            +G  D     +R++  D  S+   VISIVG   I  ++ A+R++ DPS+V  F ++ W T
Sbjct  145  VGYNDEQASMLRQLTGD--SRQLEVISIVGMGGIGKSTFAKRVFSDPSVVGFFDVRGWVT  202

Query  143  VSPLREFNERQLLFQLL  93
            VS  ++++ R++L  LL
Sbjct  203  VS--KDYSIRKMLLSLL  217



>ref|XP_006356561.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=767

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/54 (44%), Positives = 35/54 (65%), Gaps = 2/54 (4%)
 Frame = -3

Query  266  SKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLL  105
            +K + VISI G   +  T+LAR++Y +P IV HF ++AW  VS  + +N R LL
Sbjct  50   TKERDVISIYGMPGLGKTTLARKVYNNPYIVNHFDVKAWCAVS--QAYNRRTLL  101



>emb|CDP05557.1| unnamed protein product [Coffea canephora]
Length=424

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +++IVG   I  T+LAR+++ DP I YHF ++AW TVS  +++  R +L  LL
Sbjct  178  ILTIVGMGGIGKTTLARKVFNDPLIEYHFYVRAWVTVS--QKYVLRDVLLGLL  228



>ref|XP_004242250.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=762

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 50/83 (60%), Gaps = 4/83 (5%)
 Frame = -3

Query  341  HDDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFP  162
            +DD + +G E+   + + K++    +K + VISI G   +  T+LAR++Y +PSI  +F 
Sbjct  27   YDDDEVVGFENDAEVIMMKLIRG--TKERDVISIYGMPGLGKTTLARKVYNNPSIANYFD  84

Query  161  IQAWTTVSPLREFNERQLLFQLL  93
            ++AW  VS  + +N R LL ++ 
Sbjct  85   VKAWCAVS--QAYNRRTLLVEIF  105



>ref|XP_009762697.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009762698.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009762699.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=900

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 46/77 (60%), Gaps = 4/77 (5%)
 Frame = -3

Query  323  IGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTT  144
            +G  D     +R++  D  S+   VISIVG   I  ++ A+R++ DPS+V  F ++ W T
Sbjct  155  VGYNDEQASMLRQLTGD--SRQLEVISIVGMGGIGKSTFAKRVFSDPSVVGFFDVRGWVT  212

Query  143  VSPLREFNERQLLFQLL  93
            VS  ++++ R++L  LL
Sbjct  213  VS--KDYSIRKMLLSLL  227



>gb|EYU39515.1| hypothetical protein MIMGU_mgv1a023519mg [Erythranthe guttata]
Length=817

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 48/86 (56%), Gaps = 9/86 (10%)
 Frame = -3

Query  332  FKRIGAEDAFF------MKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVY  171
            FK   A D+ F      + I++ L    SK Q VI IVG   I  T+LAR  Y DP I+ 
Sbjct  147  FKDTRAVDSVFGFHGDLLAIKERLCGEPSKLQ-VIPIVGMGGIGKTTLARNAYLDPLIIE  205

Query  170  HFPIQAWTTVSPLREFNERQLLFQLL  93
             F ++AW TVS  ++++E Q+L  LL
Sbjct  206  CFDVRAWVTVS--QDYSEEQILLGLL  229



>emb|CDP13419.1| unnamed protein product [Coffea canephora]
Length=824

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREF  123
            V+S+VG   I  T+L ++++EDP +  HFP++AW TVS   +F
Sbjct  194  VVSVVGMGGIGKTTLVKKVHEDPEVRRHFPVRAWVTVSETCDF  236



>emb|CDX82995.1| BnaA01g19950D [Brassica napus]
Length=312

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 45/77 (58%), Gaps = 2/77 (3%)
 Frame = -3

Query  323  IGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTT  144
            +G ED F   + K+L D   + + +ISI G   +  T+LAR+LY   ++   F  +AWT+
Sbjct  148  VGLEDDFKFLLAKLLEDNGDQNRYMISIFGMGGLGKTALARKLYNADNVKTRFAYRAWTS  207

Query  143  VSPLREFNERQLLFQLL  93
            VS +  +  R++L +++
Sbjct  208  VSQV--YKTREMLLRII  222



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VIS+VG   +  T+LA+++Y DPSI YHF I+AW  +S  +++  R++   +L
Sbjct  179  VISVVGMGGLGKTTLAKKVYSDPSIEYHFYIRAWVYMS--QQYCRREVFLGIL  229



>dbj|BAJ89397.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=942

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/54 (41%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = -3

Query  293  IRKVLVDWRSKP-QAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSP  135
            +++ L+D  + P +A++SIVG S I  T+LAR++Y+ P +  HF I+ WT + P
Sbjct  190  LKEQLLDVDTVPGRALVSIVGESSIGKTTLARKVYQSPEVRNHFAIRTWTVLPP  243



>gb|EYU31287.1| hypothetical protein MIMGU_mgv1a022746mg, partial [Erythranthe 
guttata]
Length=472

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +ISIVG   I  T+L   +Y  P IV HF ++AW TVS  +E+ E+++L  LL
Sbjct  63   IISIVGMGGIGKTTLTTHVYNKPFIVQHFHVRAWFTVS--QEYTEKEILLGLL  113



>ref|XP_009781183.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=711

 Score = 50.1 bits (118),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 22/70 (31%), Positives = 43/70 (61%), Gaps = 2/70 (3%)
 Frame = -3

Query  302  FMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREF  123
            F K+   L+   ++   V+S+VG   I  ++LA  ++ +PS+ YHF + +W TVS  +++
Sbjct  5    FNKVLNQLIGGNARELNVVSVVGMGGIGKSTLAGSIFRNPSVFYHFDVSSWVTVS--QKY  62

Query  122  NERQLLFQLL  93
            + R++L  +L
Sbjct  63   DVREMLLDVL  72



>emb|CDP20204.1| unnamed protein product [Coffea canephora]
Length=1166

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = -3

Query  266  SKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +K   ++SIVG      T+LA+ +Y  P++V HF I+AW TVS +  +  R+L F++L
Sbjct  847  TKRTLIMSIVGMGGQGKTTLAQTVYNHPAVVQHFQIRAWCTVSQV--YQTRELFFEIL  902



>gb|ADL59402.1| R2 late blight resistance protein [Solanum hjertingii]
Length=847

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 49/87 (56%), Gaps = 6/87 (7%)
 Frame = -3

Query  362  RLEKFLEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQ-AVISIVGASRISNTSLARRLYED  186
            R   +++  D+  +G +D     + ++L   +++P+ +V+SI G   +  T+LAR LY  
Sbjct  149  RTTSYVDEQDYIFVGLQDVVQKLLAQLL---KAEPRRSVLSIYGMGGLGKTTLARNLYNS  205

Query  185  PSIVYHFPIQAWTTVSPLREFNERQLL  105
            P I+  FP +AW  VS  +E+N   LL
Sbjct  206  PDILNSFPTRAWICVS--QEYNTMDLL  230



>gb|ADL59400.1| R2 late blight resistance protein [Solanum hjertingii]
Length=847

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 49/87 (56%), Gaps = 6/87 (7%)
 Frame = -3

Query  362  RLEKFLEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQ-AVISIVGASRISNTSLARRLYED  186
            R   +++  D+  +G +D     + ++L   +++P+ +V+SI G   +  T+LAR LY  
Sbjct  149  RTTSYVDEQDYIFVGLQDVVQKLLAQLL---KAEPRRSVLSIYGMGGLGKTTLARNLYNS  205

Query  185  PSIVYHFPIQAWTTVSPLREFNERQLL  105
            P I+  FP +AW  VS  +E+N   LL
Sbjct  206  PDILNSFPTRAWICVS--QEYNTMDLL  230



>emb|CDP00736.1| unnamed protein product [Coffea canephora]
Length=822

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 37/53 (70%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +++IVG   I  T+LARR+++D S VY+F ++AW TVS  + F +R +L  LL
Sbjct  120  IVAIVGMGGIGKTTLARRVFDDLSTVYNFHVRAWATVS--QVFRQRDVLLALL  170



>gb|EYU21828.1| hypothetical protein MIMGU_mgv1a019841mg [Erythranthe guttata]
Length=784

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +I IVG   I  T+LAR +Y  P I+ HF I+AW TVS  + +N +++L ++L
Sbjct  206  IIPIVGMGGIGKTTLARNVYAKPLIMQHFDIRAWVTVS--QNYNVQEILLEIL  256



>gb|ADL59399.1| HJTR2GH1 protein [Solanum hjertingii]
Length=852

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/87 (32%), Positives = 49/87 (56%), Gaps = 6/87 (7%)
 Frame = -3

Query  362  RLEKFLEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQ-AVISIVGASRISNTSLARRLYED  186
            R   +++  D+  +G +D     + ++L   +++P+ +V+SI G   +  T+LAR LY  
Sbjct  154  RTTSYVDEQDYIFVGLQDVVQKLLAQLL---KAEPRRSVLSIYGMGGLGKTTLARNLYNS  210

Query  185  PSIVYHFPIQAWTTVSPLREFNERQLL  105
            P I+  FP +AW  VS  +E+N   LL
Sbjct  211  PDILNSFPTRAWICVS--QEYNTMDLL  235



>gb|EYU24168.1| hypothetical protein MIMGU_mgv1a022184mg, partial [Erythranthe 
guttata]
Length=802

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLGsidssl  72
            +ISIVG   I  T+LA  ++ +P IV HF ++AW TVS  +E+ ++++L  LL  I+++ 
Sbjct  182  IISIVGMGGIGKTTLATNVFNNPFIVEHFQLRAWFTVS--QEYTDKKILLGLLHQINNTY  239

Query  71   ltsmssDEDADHLGKLLCQKL  9
              +    +D D +G  L + L
Sbjct  240  RNAHEIVDDDDAIGDRLHKTL  260



>ref|XP_009622812.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
[Nicotiana tomentosiformis]
Length=932

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 58/112 (52%), Gaps = 8/112 (7%)
 Frame = -3

Query  347  LEHDDFKRIGAEDAFFMKIRKVLVDWRSKPQAVISIVGASRISNTSLARRLYEDPSIVYH  168
            LE +D K +G E+ F M   ++    R     V+SIVG   I  T+LA ++Y DP I+ H
Sbjct  138  LEPED-KMVGLENEFEMMQDQLARGARE--LEVVSIVGMGGIGKTTLANKIYSDPFIMSH  194

Query  167  FPIQAWTTVSPLREFNERQLLFQLLGsidsslltsmssDED---ADHLGKLL  21
            F I+A  TVS  +E+  R +L  LL SI           +D   AD L KLL
Sbjct  195  FDIRAKATVS--QEYCARNVLLGLLSSISGKTNEFQEQQDDDQLADRLQKLL  244



>ref|XP_011070550.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=910

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 38/53 (72%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +++IVG + I  ++LA+ +Y+DP IVYHF ++AW TVS  +E+  + +L  L+
Sbjct  175  ILTIVGMAGIGKSTLAKIVYDDPLIVYHFYVRAWITVS--QEYEVKNILIGLI  225



>ref|XP_009764753.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009764754.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009764755.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009764757.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009764758.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=771

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLGsidssl  72
            VI IVG +    T+ AR+LY + +IVYHF ++AW  +S  + +N +QLL ++   +  S 
Sbjct  56   VIPIVGMAGQGKTTFARKLYNNDNIVYHFDVRAWCVIS--QTYNRQQLLQEIFNQVTGSK  113

Query  71   ltsmssDEDADHLGKLL  21
                   E AD L K L
Sbjct  114  GKVDKVGELADMLRKRL  130



>ref|XP_009761073.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009761075.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
 ref|XP_009761076.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana sylvestris]
Length=764

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 35/53 (66%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            VISI G   +  T+LAR++Y +PSIV HF  + W +VS  + + ER LL ++L
Sbjct  53   VISIFGMPGLGKTTLARKVYNNPSIVNHFDARVWCSVS--QTYIERTLLIEIL  103



>gb|EYU26873.1| hypothetical protein MIMGU_mgv1a025130mg [Erythranthe guttata]
Length=811

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/53 (45%), Positives = 34/53 (64%), Gaps = 2/53 (4%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            +ISIVG   I  T+L   +Y  P IV HF ++AW TVS  +E+ E+++L  LL
Sbjct  178  IISIVGMGGIGKTTLTTHVYNKPFIVQHFHVRAWFTVS--QEYTEKEILLGLL  228



>emb|CDP13422.1| unnamed protein product [Coffea canephora]
Length=960

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNE  117
            V+S+VG   +  T+L ++++EDP +  HFP++AW TVS   +F +
Sbjct  194  VVSVVGMGGLGKTTLVKKVHEDPEVRRHFPVRAWATVSQTCDFQD  238



>tpg|DAA47701.1| TPA: hypothetical protein ZEAMMB73_492727 [Zea mays]
Length=1042

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 2/75 (3%)
 Frame = -3

Query  341  HDDFKRIGAEDAFFMKIRKVLVDWRS--KPQAVISIVGASRISNTSLARRLYEDPSIVYH  168
            ++D   IG+ +  F  ++ ++++       +AVISI G   I  T+LA++LY DP I+ H
Sbjct  205  YEDKYVIGSREREFAILKDLIINKEGDMPHRAVISIFGERGIGKTTLAKQLYNDPDIIKH  264

Query  167  FPIQAWTTVSPLREF  123
            F + AW  + P   F
Sbjct  265  FEVHAWVCLPPHVRF  279



>ref|XP_009764756.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009764759.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=771

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 29/77 (38%), Positives = 43/77 (56%), Gaps = 2/77 (3%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLLGsidssl  72
            VI IVG +    T+ AR+LY + +IVYHF ++AW  +S  + +N +QLL ++   +  S 
Sbjct  56   VIPIVGMAGQGKTTFARKLYNNDNIVYHFDVRAWCVIS--QTYNRQQLLQEIFNQVTGSK  113

Query  71   ltsmssDEDADHLGKLL  21
                   E AD L K L
Sbjct  114  GKVDKVGELADMLRKRL  130



>ref|XP_008662632.1| PREDICTED: disease resistance protein RPP13-like [Zea mays]
Length=1005

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 2/75 (3%)
 Frame = -3

Query  341  HDDFKRIGAEDAFFMKIRKVLVDWRS--KPQAVISIVGASRISNTSLARRLYEDPSIVYH  168
            ++D   IG+ +  F  ++ ++++       +AVISI G   I  T+LA++LY DP I+ H
Sbjct  168  YEDKYVIGSREREFAILKDLIINKEGDMPHRAVISIFGERGIGKTTLAKQLYNDPDIIKH  227

Query  167  FPIQAWTTVSPLREF  123
            F + AW  + P   F
Sbjct  228  FEVHAWVCLPPHVRF  242



>emb|CDP21622.1| unnamed protein product, partial [Coffea canephora]
Length=935

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 2/58 (3%)
 Frame = -3

Query  266  SKPQAVISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREFNERQLLFQLL  93
            SK    +SIVG + +  T+LA R+Y DP I+ HF I+AW TVS +  ++   LL +LL
Sbjct  355  SKLLDFVSIVGMAGLGKTTLANRVYNDPLILSHFYIRAWCTVSQV--YSMHSLLVELL  410



>emb|CDP21812.1| unnamed protein product, partial [Coffea canephora]
Length=751

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 18/43 (42%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  251  VISIVGASRISNTSLARRLYEDPSIVYHFPIQAWTTVSPLREF  123
            V+S+VG   +  T+L ++++EDP +  HFP++AW TVS   +F
Sbjct  182  VVSVVGMGGLGKTTLVKKVHEDPEVRRHFPVRAWVTVSETCDF  224



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1009851894054