BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16448_g1_i1 len=238 path=[493:0-237]

Length=238
                                                                      Score     E

ref|XP_006356169.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    138   1e-35   
ref|XP_004241722.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    135   1e-34   
ref|XP_009619829.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    130   4e-33   
ref|XP_009778993.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    129   3e-32   
ref|XP_009802987.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    128   4e-32   
gb|KHN44136.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    127   5e-32   
ref|XP_003543657.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    127   6e-32   
ref|XP_009623793.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    127   1e-31   
ref|XP_011072284.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    127   1e-31   
ref|XP_003546283.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    126   2e-31   
gb|KHM98779.1|  N-alpha-acetyltransferase 15, NatA auxiliary subunit    126   2e-31   
ref|XP_010417709.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    125   4e-31   
ref|XP_010654709.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    124   6e-31   
ref|XP_002284882.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    124   8e-31   Vitis vinifera
emb|CDO98079.1|  unnamed protein product                                124   8e-31   
ref|XP_010654708.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    124   8e-31   
ref|XP_010539518.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    124   9e-31   
ref|XP_009106751.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    124   1e-30   
ref|XP_004235695.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    124   1e-30   
ref|XP_006343105.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    124   1e-30   
ref|XP_009106749.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    124   1e-30   
ref|XP_009106750.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    124   1e-30   
ref|XP_010539517.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    124   1e-30   
ref|XP_010429971.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    124   1e-30   
emb|CDX87308.1|  BnaA07g35650D                                          124   1e-30   
ref|XP_010474516.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    124   2e-30   
ref|XP_010110300.1|  N-alpha-acetyltransferase 15, NatA auxiliary...    123   2e-30   
ref|XP_003597797.1|  NMDA receptor-regulated protein                    123   3e-30   
ref|XP_007024040.1|  Tetratricopeptide repeat-containing protein ...    122   4e-30   
ref|XP_010532133.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    122   4e-30   
ref|XP_009128424.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    122   4e-30   
emb|CDY38667.1|  BnaC02g23120D                                          122   4e-30   
emb|CDY37595.1|  BnaA02g19750D                                          122   4e-30   
gb|KEH28765.1|  amino-terminal acetyltransferase, putative              122   4e-30   
ref|XP_002887831.1|  EMB2753                                            122   4e-30   
ref|XP_007024039.1|  Tetratricopeptide repeat (TPR)-containing pr...    122   5e-30   
ref|XP_010537937.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    122   5e-30   
ref|XP_008342751.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    119   6e-30   
ref|XP_003531689.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    121   8e-30   
ref|XP_006465444.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    121   8e-30   
gb|KHN47800.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    121   8e-30   
gb|AAF27136.1|AC018849_24  putative N-terminal acetyltransferase;...    120   9e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009339003.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    121   9e-30   
ref|XP_006427097.1|  hypothetical protein CICLE_v10024839mg             121   9e-30   
ref|XP_004506868.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    121   9e-30   
ref|XP_006427096.1|  hypothetical protein CICLE_v10024839mg             121   9e-30   
ref|XP_006427095.1|  hypothetical protein CICLE_v10024839mg             121   1e-29   
ref|XP_009104460.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    121   1e-29   
ref|NP_178157.2|  protein EMBRYO DEFECTIVE 2753                         121   1e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CDX79387.1|  BnaC06g19160D                                          121   1e-29   
ref|XP_010691269.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    121   1e-29   
ref|NP_001185448.1|  protein EMBRYO DEFECTIVE 2753                      121   1e-29   
ref|XP_007135709.1|  hypothetical protein PHAVU_010G151600g             120   1e-29   
gb|EYU21564.1|  hypothetical protein MIMGU_mgv1a001105mg                120   2e-29   
emb|CDY39981.1|  BnaC06g40590D                                          120   2e-29   
ref|XP_006301121.1|  hypothetical protein CARUB_v10021530mg             120   2e-29   
ref|XP_010249876.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    120   2e-29   
ref|XP_007217132.1|  hypothetical protein PRUPE_ppa001163m1g            119   3e-29   
ref|XP_008228606.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    120   3e-29   
gb|KFK42434.1|  hypothetical protein AALP_AA2G256000                    120   3e-29   
emb|CDX67946.1|  BnaA07g19860D                                          119   4e-29   
ref|XP_002517521.1|  NMDA receptor-regulated protein, putative          119   5e-29   Ricinus communis
gb|KHG18219.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    119   6e-29   
ref|XP_007150682.1|  hypothetical protein PHAVU_005G172700g             119   7e-29   
ref|XP_004302931.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    118   1e-28   
gb|KDP37181.1|  hypothetical protein JCGZ_06237                         118   1e-28   
ref|XP_011002722.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    117   3e-28   
gb|KHN01367.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    117   3e-28   
ref|XP_006583136.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    117   4e-28   
ref|XP_003528376.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    117   4e-28   
ref|XP_006389790.1|  hypothetical protein EUTSA_v10018100mg             117   4e-28   
gb|KEH39579.1|  amino-terminal acetyltransferase, putative              116   6e-28   
ref|XP_010254211.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    116   6e-28   
ref|XP_006844401.1|  hypothetical protein AMTR_s00142p00102260          116   6e-28   
ref|XP_010254212.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    116   6e-28   
gb|KEH39578.1|  amino-terminal acetyltransferase, putative              116   6e-28   
ref|XP_009416095.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    115   1e-27   
ref|XP_011000818.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    115   2e-27   
ref|XP_008373494.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    115   2e-27   
ref|XP_009358220.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    114   2e-27   
ref|XP_009358213.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    114   2e-27   
ref|XP_009358212.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    114   2e-27   
ref|XP_006644372.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    114   2e-27   
ref|XP_009385623.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    114   2e-27   
ref|XP_002299630.2|  acetyltransferase-related family protein           114   3e-27   Populus trichocarpa [western balsam poplar]
ref|XP_009385624.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    114   3e-27   
ref|XP_004135824.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    114   3e-27   
ref|XP_003569365.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    114   3e-27   
ref|XP_010232026.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    114   4e-27   
ref|XP_010912607.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    114   5e-27   
ref|NP_001043582.1|  Os01g0617500                                       113   5e-27   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71092.1|  hypothetical protein OsI_02873                          113   5e-27   Oryza sativa Indica Group [Indian rice]
gb|KHG11825.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit    113   5e-27   
gb|EEE54991.1|  hypothetical protein OsJ_02617                          113   6e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008792977.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    112   1e-26   
ref|XP_008343614.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    108   2e-26   
ref|XP_010925104.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    112   2e-26   
ref|XP_010925105.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    112   2e-26   
ref|XP_010062441.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    111   3e-26   
ref|XP_002458160.1|  hypothetical protein SORBIDRAFT_03g027980          111   4e-26   Sorghum bicolor [broomcorn]
ref|XP_008672545.1|  PREDICTED: uncharacterized protein LOC100274...    110   9e-26   
emb|CDM83394.1|  unnamed protein product                                110   9e-26   
ref|XP_008809145.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...    110   1e-25   
ref|XP_008672544.1|  PREDICTED: uncharacterized protein LOC100274...    110   1e-25   
gb|EMT02816.1|  NMDA receptor-regulated 1-like protein                  109   2e-25   
ref|XP_004172689.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...    103   7e-25   
ref|XP_004969173.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...    106   2e-24   
gb|KGN45336.1|  hypothetical protein Csa_7G440577                       103   2e-24   
gb|EMS52083.1|  N-alpha-acetyltransferase 15, NatA auxiliary subunit    104   1e-23   
gb|EAY82679.1|  hypothetical protein OsI_37895                        99.0    2e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_001764313.1|  predicted protein                                92.8    1e-19   
ref|XP_001783197.1|  predicted protein                                90.5    7e-19   
ref|XP_001776114.1|  predicted protein                                89.7    1e-18   
ref|XP_005652238.1|  N-terminal acetyltransferase A, auxiliary su...  83.6    2e-16   
ref|XP_009619830.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  75.5    1e-13   
ref|XP_005827391.1|  hypothetical protein GUITHDRAFT_158303           73.6    4e-13   
ref|XP_009778994.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  73.2    7e-13   
ref|XP_008461048.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...  72.4    2e-12   
gb|KFM28253.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  70.9    4e-12   
gb|KDO58184.1|  hypothetical protein CISIN_1g0453552mg                67.0    3e-11   
ref|XP_002961540.1|  hypothetical protein SELMODRAFT_164833           68.9    3e-11   
ref|XP_002971274.1|  hypothetical protein SELMODRAFT_94950            68.6    3e-11   
ref|XP_661232.1|  hypothetical protein AN3628.2                       64.7    6e-10   Aspergillus nidulans FGSC A4
ref|XP_007776702.1|  hypothetical protein W97_00599                   63.5    1e-09   
dbj|GAM41610.1|  N-acetyltransferase complex subunit                  62.8    3e-09   
gb|KFH65851.1|  hypothetical protein MVEG_07954                       62.0    6e-09   
ref|XP_003300018.1|  hypothetical protein PTT_11155                   61.2    1e-08   
gb|EYE92694.1|  putative N-terminal acetyltransferase catalytic s...  60.8    1e-08   
emb|CCG84078.1|  protein of unknown function                          60.8    1e-08   
ref|XP_007581597.1|  putative n-terminal acetyltransferase cataly...  60.8    2e-08   
gb|EMD91535.1|  hypothetical protein COCHEDRAFT_1136173               60.5    2e-08   
ref|XP_002151347.1|  acetyltransferase catalytic subunit (NAT1), ...  60.1    3e-08   Talaromyces marneffei ATCC 18224
gb|KFX47578.1|  N-terminal acetyltransferase A complex subunit nat1   60.1    3e-08   
ref|XP_003856861.1|  hypothetical protein MYCGRDRAFT_67635            59.7    3e-08   
gb|KEQ64006.1|  N-terminal acetyltransferase A, auxiliary subunit     59.7    3e-08   
gb|EUN23538.1|  hypothetical protein COCVIDRAFT_108560                59.7    3e-08   
ref|XP_007715320.1|  hypothetical protein COCCADRAFT_104114           59.7    3e-08   
ref|XP_007702905.1|  hypothetical protein COCSADRAFT_173919           59.7    3e-08   
gb|ENI08708.1|  hypothetical protein COCC4DRAFT_128211                59.7    4e-08   
ref|XP_002341635.1|  acetyltransferase catalytic subunit (NAT1), ...  59.7    4e-08   Talaromyces stipitatus ATCC 10500
ref|XP_001272049.1|  N-terminal acetyltransferase catalytic subun...  59.3    5e-08   Aspergillus clavatus NRRL 1
gb|KDO58185.1|  hypothetical protein CISIN_1g0453551mg                58.9    5e-08   
ref|XP_002946235.1|  hypothetical protein VOLCADRAFT_55571            58.9    5e-08   
ref|XP_008030371.1|  hypothetical protein SETTUDRAFT_156902           59.3    5e-08   
gb|KFH72316.1|  hypothetical protein MVEG_02607                       58.9    6e-08   
ref|XP_001931274.1|  NMDA receptor-regulated protein 1                58.9    7e-08   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_751639.1|  N-terminal acetyltransferase catalytic subunit ...  58.9    7e-08   Aspergillus fumigatus Af293
ref|XP_008768346.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  57.8    7e-08   
gb|KGO37925.1|  N-terminal acetyltransferase A, auxiliary subunit     58.5    8e-08   
ref|XP_007687953.1|  hypothetical protein COCMIDRAFT_95248            58.9    8e-08   
ref|XP_006989621.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  58.5    8e-08   
ref|XP_008768342.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  58.2    9e-08   
emb|CCE28363.1|  related to acetyltransferase 1                       58.2    1e-07   
ref|XP_001073064.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  58.2    1e-07   Rattus norvegicus [brown rat]
gb|KGO64590.1|  N-terminal acetyltransferase A, auxiliary subunit     57.8    1e-07   
gb|EME49545.1|  hypothetical protein DOTSEDRAFT_68353                 57.8    2e-07   
gb|EMF17187.1|  N-terminal acetyltransferase A, auxiliary subunit     57.4    2e-07   
gb|EKV07373.1|  NH2-terminal acetyltransferase catalytic subunit ...  57.4    2e-07   
gb|KFX99908.1|  hypothetical protein O988_03603                       57.4    2e-07   
ref|XP_001389144.1|  N-terminal acetyltransferase A complex subun...  57.4    2e-07   Aspergillus niger CBS 513.88
ref|XP_001266841.1|  N-terminal acetyltransferase catalytic subun...  57.4    2e-07   Aspergillus fischeri NRRL 181
gb|EHA26605.1|  hypothetical protein ASPNIDRAFT_51888                 57.4    2e-07   
gb|EKG19312.1|  Tetratricopeptide TPR-1                               56.6    4e-07   
dbj|BAE58130.1|  unnamed protein product                              56.2    5e-07   Aspergillus oryzae
ref|XP_003388065.1|  PREDICTED: n-alpha-acetyltransferase 16, Nat...  56.2    5e-07   
ref|XP_002374303.1|  N-terminal acetyltransferase catalytic subun...  56.2    5e-07   Aspergillus flavus NRRL3357
gb|KFY43335.1|  hypothetical protein V495_03997                       56.2    5e-07   
gb|EFX02154.1|  n-terminal acetyltransferase catalytic subunit        55.8    6e-07   
ref|XP_007671886.1|  hypothetical protein BAUCODRAFT_29060            55.8    6e-07   
ref|XP_002622317.1|  N-terminal acetyltransferase catalytic subunit   55.8    7e-07   Blastomyces gilchristii SLH14081
gb|EGE82618.1|  N-terminal acetyltransferase catalytic subunit        55.8    7e-07   
gb|KFX91531.1|  hypothetical protein V490_05862                       55.8    7e-07   
gb|KFG86638.1|  putative acetyltransferase catalytic subunit (NAT1)   55.5    8e-07   
gb|KID62786.1|  Alpha-acetyltransferase 15, NatA                      55.5    9e-07   
emb|CDM36831.1|  N-terminal acetyltransferase A, auxiliary subunit    55.5    1e-06   
ref|XP_007816465.1|  acetyltransferase catalytic subunit (NAT1), ...  55.1    1e-06   
dbj|GAA83625.1|  N-terminal acetyltransferase catalytic subunit Nat1  55.1    1e-06   
ref|XP_003836201.1|  similar to N-alpha-acetyltransferase 15          55.1    1e-06   
gb|EXV01123.1|  N-terminal acetyltransferase A, auxiliary subunit     55.1    1e-06   
gb|KID99476.1|  Alpha-acetyltransferase 15, NatA                      55.1    1e-06   
ref|XP_003349438.1|  hypothetical protein SMAC_03026                  55.1    1e-06   
ref|XP_008592012.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  52.8    1e-06   
gb|EPS33590.1|  hypothetical protein PDE_08552                        55.1    1e-06   
gb|KEQ75459.1|  N-terminal acetyltransferase A, auxiliary subunit     54.7    1e-06   
gb|KID86385.1|  Alpha-acetyltransferase 15, NatA                      54.7    1e-06   
gb|KID74644.1|  Alpha-acetyltransferase 15, NatA                      54.7    1e-06   
ref|XP_006519462.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  54.7    1e-06   
ref|NP_080108.1|  N-alpha-acetyltransferase 16, NatA auxiliary su...  54.7    2e-06   Mus musculus [mouse]
gb|EDL35769.1|  NMDA receptor regulated 1-like                        54.7    2e-06   
dbj|GAE00264.1|  acetyltransferase catalytic subunit (NAT1), puta...  54.7    2e-06   
ref|XP_001558387.1|  hypothetical protein BC1G_03236                  54.7    2e-06   Botrytis cinerea B05.10
emb|CCD34605.1|  similar to N-alpha-acetyltransferase 15              54.7    2e-06   
ref|XP_002564541.1|  Pc22g05050                                       54.7    2e-06   Penicillium rubens Wisconsin 54-1255
gb|KFY12057.1|  hypothetical protein V492_04122                       54.7    2e-06   
gb|KFY36377.1|  hypothetical protein V494_05059                       54.7    2e-06   
ref|XP_002838318.1|  hypothetical protein                             54.7    2e-06   Tuber melanosporum Mel28
ref|XP_001544452.1|  conserved hypothetical protein                   54.3    2e-06   Histoplasma capsulatum NAm1
gb|KEQ84541.1|  N-terminal acetyltransferase A, auxiliary subunit     54.3    2e-06   
gb|KFY77612.1|  hypothetical protein V499_03057                       54.3    2e-06   
gb|ELR07815.1|  hypothetical protein GMDG_00436                       54.3    2e-06   
gb|KFZ05559.1|  hypothetical protein V501_08258                       54.3    3e-06   
gb|EHK26941.1|  hypothetical protein TRIVIDRAFT_55208                 54.3    3e-06   
ref|XP_001797369.1|  hypothetical protein SNOG_07014                  54.3    3e-06   Parastagonospora nodorum SN15
ref|XP_002795283.1|  NMDA receptor-regulated protein                  53.9    4e-06   Paracoccidioides lutzii Pb01
ref|XP_008721451.1|  hypothetical protein HMPREF1541_08911            53.5    4e-06   
ref|XP_006676834.1|  hypothetical protein BATDEDRAFT_34518            53.9    4e-06   
ref|XP_003503139.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  53.5    4e-06   
ref|XP_962452.1|  hypothetical protein NCU11379                       53.5    4e-06   Neurospora crassa OR74A
ref|XP_005847916.1|  hypothetical protein CHLNCDRAFT_35269            53.5    4e-06   
gb|KFZ15643.1|  hypothetical protein V502_05476                       53.5    4e-06   
ref|XP_009849123.1|  hypothetical protein NEUTE1DRAFT_59572           53.5    4e-06   
ref|XP_002508463.1|  predicted protein                                53.5    4e-06   Micromonas commoda
gb|EHK44818.1|  hypothetical protein TRIATDRAFT_131899                53.5    4e-06   
gb|KFY64827.1|  hypothetical protein V496_03018                       53.5    4e-06   
ref|XP_001213051.1|  conserved hypothetical protein                   53.5    4e-06   Aspergillus terreus NIH2624
ref|XP_007920186.1|  hypothetical protein MYCFIDRAFT_55822            53.5    4e-06   
gb|KHN98615.1|  Alpha-acetyltransferase 15, NatA                      53.5    4e-06   
ref|XP_005366096.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  53.5    4e-06   
ref|XP_007827482.1|  hypothetical protein PFICI_00710                 53.5    5e-06   
gb|EEH21001.2|  hypothetical protein PABG_03232                       53.5    5e-06   Paracoccidioides brasiliensis Pb03
gb|EEH08073.1|  NMDA receptor-regulated gene 1 protein                53.5    5e-06   Histoplasma capsulatum G186AR
gb|EGC43116.1|  NMDA receptor-regulated protein 1                     53.1    5e-06   
gb|KHJ32748.1|  putative subunit of the n-terminal acetyltransferase  53.1    5e-06   
ref|XP_010757576.1|  hypothetical protein PADG_01786                  53.1    6e-06   
ref|XP_010590884.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  53.1    7e-06   
gb|KFY99662.1|  hypothetical protein V500_01320                       52.8    7e-06   
dbj|BAC79753.1|  N-terminal acetyltransferase-like protein            50.1    7e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006003551.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  52.4    8e-06   
ref|XP_008075963.1|  TPR-like protein                                 52.8    8e-06   
ref|XP_643789.1|  tetratricopeptide-like helical domain-containin...  52.8    9e-06   Dictyostelium discoideum AX4
ref|XP_003218678.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  52.4    1e-05   
ref|XP_006003550.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  52.4    1e-05   
ref|XP_008852913.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  52.0    1e-05   
gb|KFY11380.1|  hypothetical protein V491_07228                       52.4    1e-05   
ref|XP_001596993.1|  hypothetical protein SS1G_01186                  52.4    1e-05   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_006003549.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  52.4    1e-05   
dbj|GAM21819.1|  hypothetical protein SAMD00019534_049940             52.4    1e-05   
gb|ESZ93612.1|  N-terminal acetyltransferase-like protein             52.0    1e-05   
ref|XP_008258238.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  52.0    1e-05   
ref|XP_008852912.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  52.0    1e-05   
ref|XP_008705024.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  52.0    1e-05   
ref|XP_008258237.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  52.0    1e-05   
ref|XP_007296468.1|  tetratricopeptide                                52.0    2e-05   
ref|XP_006693595.1|  N-terminal acetyltransferase-like protein        51.6    2e-05   
ref|XP_006083565.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  51.6    2e-05   
ref|XP_006083562.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  51.6    2e-05   
ref|XP_006083561.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  51.6    2e-05   
ref|XP_006083563.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  51.6    2e-05   
ref|XP_005878697.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  51.6    2e-05   
gb|KFY21921.1|  hypothetical protein V493_06976                       51.6    2e-05   
ref|XP_006083564.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  51.2    2e-05   
ref|XP_005878696.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  51.2    2e-05   
ref|XP_005878695.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  51.2    2e-05   
ref|XP_007085483.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  51.2    3e-05   
gb|EER39847.1|  NMDA receptor-regulated protein                       50.8    3e-05   Histoplasma capsulatum H143
emb|CEJ83054.1|  Putative Protein prenyltransferase                   50.8    3e-05   
gb|EJT52109.1|  hypothetical protein A1Q1_06647                       50.8    3e-05   
gb|EKD02407.1|  hypothetical protein A1Q2_03299                       50.8    4e-05   
gb|KEQ91889.1|  hypothetical protein AUEXF2481DRAFT_43576             50.4    4e-05   
ref|XP_004900602.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...  50.4    4e-05   
ref|XP_004844316.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...  50.4    4e-05   
gb|KFH42810.1|  N-alpha-acetyltransferase 15, NatA auxiliary subu...  50.4    4e-05   
gb|KDN72209.1|  putative tetratricopeptide                            50.4    5e-05   
gb|KEZ46770.1|  hypothetical protein SAPIO_CDS0060                    50.4    5e-05   
ref|XP_008601549.1|  tetratricopeptide-like protein                   50.4    5e-05   
ref|XP_010989491.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  50.1    5e-05   
ref|XP_010971585.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  50.1    5e-05   
gb|EQB45053.1|  tetratricopeptide                                     50.1    5e-05   
gb|EKC36364.1|  NMDA receptor-regulated protein 1                     50.4    5e-05   
ref|XP_010971583.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  50.1    5e-05   
ref|XP_006176341.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  50.1    6e-05   
ref|XP_006639086.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  50.1    6e-05   
ref|XP_010989488.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  50.1    6e-05   
ref|XP_006215641.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  50.1    6e-05   
gb|EPQ67399.1|  Subunit of the N-terminal acetyltransferase NatA      50.1    6e-05   
ref|XP_002844337.1|  NMDA receptor-regulated protein 1                50.1    7e-05   Microsporum canis CBS 113480
ref|XP_001493223.2|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  50.1    7e-05   Equus caballus [domestic horse]
ref|XP_010590885.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  50.1    7e-05   
gb|EQK98895.1|  Protein prenyltransferase                             50.1    7e-05   
gb|ERT01038.1|  hypothetical protein HMPREF1624_02275                 49.7    7e-05   
gb|EXK39956.1|  acetyltransferase                                     49.7    7e-05   
ref|XP_008532764.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  49.7    7e-05   
gb|EGU85111.1|  hypothetical protein FOXB_04390                       49.7    8e-05   
gb|EWZ37895.1|  acetyltransferase                                     49.7    8e-05   
ref|XP_010727145.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    8e-05   
ref|XP_006665962.1|  acetyltransferase catalytic subunit (NAT1), ...  49.7    8e-05   
ref|XP_007282360.1|  acetyltransferase catalytic subunit              49.7    8e-05   
ref|XP_006968778.1|  predicted protein                                49.7    8e-05   
gb|EXM22712.1|  acetyltransferase                                     49.7    8e-05   
gb|ETR98090.1|  N-terminal acetyltransferase A, auxiliary subunit     49.7    8e-05   
gb|EWY91276.1|  acetyltransferase                                     49.7    8e-05   
gb|ENH85489.1|  n-terminal acetyltransferase catalytic subunit        49.7    8e-05   
emb|CCF36048.1|  tetratricopeptide                                    49.7    8e-05   
gb|EXL96850.1|  acetyltransferase                                     49.7    8e-05   
gb|KIH92486.1|  peptide alpha-N-acetyltransferase                     49.7    8e-05   
ref|XP_004462843.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  49.3    9e-05   
emb|CBN77876.1|  acetyltransferase 1-like                             49.7    9e-05   
ref|XP_798164.3|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acetylt...  49.7    9e-05   
ref|XP_008052706.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  49.7    9e-05   
ref|XP_004433675.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  49.3    9e-05   
emb|CCU81886.1|  NMDA receptor-regulated protein                      49.7    9e-05   
ref|XP_007468672.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    9e-05   
ref|XP_005983157.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  49.3    1e-04   
gb|EFQ35686.1|  tetratricopeptide                                     49.3    1e-04   
ref|XP_009261706.1|  hypothetical protein FPSE_10314                  49.3    1e-04   
ref|XP_002584656.1|  conserved hypothetical protein                   49.3    1e-04   
ref|XP_007186856.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    1e-04   
ref|XP_011115257.1|  hypothetical protein H072_9699                   49.3    1e-04   
ref|XP_004708028.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  49.3    1e-04   
ref|XP_008631362.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  49.3    1e-04   
ref|XP_007468671.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  49.3    1e-04   
ref|XP_004462840.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  49.3    1e-04   
gb|EXL57363.1|  acetyltransferase                                     49.3    1e-04   
ref|XP_004433674.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  49.3    1e-04   
ref|XP_382950.1|  hypothetical protein FG02774.1                      48.9    1e-04   
gb|KFO58681.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  48.9    1e-04   
ref|XP_004462842.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    1e-04   
ref|XP_010574846.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    1e-04   
ref|XP_007946370.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    1e-04   
ref|XP_004012300.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  49.3    1e-04   
ref|XP_002713015.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    1e-04   
ref|XP_004322470.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...  48.9    1e-04   
ref|XP_007186855.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    1e-04   
emb|CCX13545.1|  Similar to N-terminal acetyltransferase A comple...  48.9    1e-04   
ref|XP_003790194.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    2e-04   
ref|XP_005687638.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    2e-04   
ref|XP_007112383.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    2e-04   
gb|ENH62967.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  48.9    2e-04   
ref|XP_004604653.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    2e-04   
ref|XP_009556072.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    2e-04   
ref|XP_007112380.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    2e-04   
ref|XP_007186850.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    2e-04   
ref|XP_007186851.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    2e-04   
ref|XP_007186853.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    2e-04   
ref|XP_010574839.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    2e-04   
ref|XP_007112382.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.5    2e-04   
ref|XP_004274601.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    2e-04   
ref|XP_004376673.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.9    2e-04   
emb|CCT68810.1|  related to acetyltransferase 1                       48.5    2e-04   
ref|XP_007112379.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.5    2e-04   
ref|XP_009926146.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.5    2e-04   
ref|XP_010153970.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    2e-04   
ref|XP_007501585.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.1    2e-04   
gb|KFO08377.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  48.5    2e-04   
ref|XP_010311840.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.5    2e-04   
gb|KFQ11201.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  48.5    2e-04   
ref|XP_001632534.1|  predicted protein                                48.5    2e-04   
ref|XP_010179562.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    2e-04   
ref|XP_006915010.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.5    2e-04   
ref|XP_006915011.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.1    2e-04   
ref|XP_006076575.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.1    2e-04   
ref|XP_010200989.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    2e-04   
ref|XP_007501584.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.1    2e-04   
ref|XP_005102206.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...  48.1    2e-04   
ref|XP_004812491.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.1    3e-04   
ref|WP_028831651.1|  hypothetical protein                             48.1    3e-04   
ref|XP_009977164.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    3e-04   
ref|XP_009950298.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    3e-04   
ref|XP_003062812.1|  predicted protein                                48.1    3e-04   
ref|XP_007501583.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.1    3e-04   
ref|XP_010844467.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    3e-04   
ref|XP_010844469.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    3e-04   
ref|XP_006076576.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    3e-04   
ref|XP_001368680.3|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.1    3e-04   
ref|XP_003482946.1|  PREDICTED: LOW QUALITY PROTEIN: N-alpha-acet...  48.1    3e-04   
ref|XP_007501582.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.1    3e-04   
ref|XP_007501581.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.1    3e-04   
ref|XP_001247851.1|  hypothetical protein CIMG_01622                  48.1    3e-04   
ref|XP_010844470.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    3e-04   
ref|XP_003712683.1|  NMDA receptor-regulated protein 1                48.1    3e-04   
ref|XP_008932859.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  48.1    3e-04   
ref|XP_009864488.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.0    3e-04   
ref|XP_006076574.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    3e-04   
ref|NP_001096570.1|  N-alpha-acetyltransferase 16, NatA auxiliary...  47.4    3e-04   
gb|EPY52093.1|  NatA N-acetyltransferase complex subunit              47.8    3e-04   
ref|XP_006076573.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    3e-04   
gb|KGL91174.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.8    3e-04   
gb|KFW76883.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.8    3e-04   
ref|XP_010844468.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    3e-04   
ref|XP_005891905.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
ref|XP_009880737.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    4e-04   
ref|XP_002196302.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
ref|XP_004759344.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
ref|XP_006076570.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
ref|XP_005516456.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
ref|XP_009101228.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
ref|XP_003285167.1|  hypothetical protein DICPUDRAFT_149048           47.8    4e-04   
ref|XP_004405381.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
ref|XP_006155573.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
ref|XP_005420799.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
emb|CDP26672.1|  Putative NMDA receptor-regulated protein 1           47.8    4e-04   
gb|ELW57302.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.8    4e-04   
ref|XP_009069300.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
ref|XP_005487359.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
gb|EFB24683.1|  hypothetical protein PANDA_003949                     47.8    4e-04   
ref|XP_005037896.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
ref|XP_005634143.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
gb|KFP71864.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.8    4e-04   
ref|XP_003232458.1|  N-terminal acetyltransferase catalytic subunit   47.8    4e-04   
ref|XP_010844461.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
ref|XP_004812489.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
ref|XP_002915916.1|  PREDICTED: n-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
gb|EZG09556.1|  hypothetical protein H106_01439                       47.8    4e-04   
gb|EZF26134.1|  hypothetical protein H100_01668                       47.8    4e-04   
ref|XP_003980476.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.8    4e-04   
gb|EGD99700.1|  N-terminal acetyltransferase catalytic subunit        47.8    4e-04   
ref|XP_006264092.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    4e-04   
emb|CDK24687.1|  unnamed protein product                              47.4    4e-04   
ref|XP_005230744.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    4e-04   
ref|XP_009699959.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    4e-04   
ref|XP_008943151.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    4e-04   
ref|XP_005230745.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    4e-04   
ref|XP_008490685.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    5e-04   
ref|XP_010844464.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    5e-04   
gb|KFR17220.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.4    5e-04   
gb|KFP58855.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.4    5e-04   
ref|XP_009969175.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    5e-04   
ref|XP_009273919.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    5e-04   
gb|KFZ60739.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.4    5e-04   
gb|KGQ08160.1|  N-alpha-acetyltransferase 16, NatA auxiliary subu...  47.4    5e-04   
gb|KFO99813.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.4    5e-04   
ref|XP_009321118.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    5e-04   
ref|XP_003065629.1|  TPR Domain containing protein                    47.4    5e-04   
gb|KFV56331.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.4    5e-04   
gb|ELR59178.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.4    5e-04   
gb|KFQ22720.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.4    5e-04   
ref|XP_009941113.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    5e-04   
gb|KFM05071.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.4    5e-04   
gb|KFZ48166.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.4    5e-04   
gb|KFW66266.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.4    5e-04   
ref|XP_006017396.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    5e-04   
ref|XP_009273920.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    5e-04   
ref|XP_009321119.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    5e-04   
ref|XP_010171773.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    5e-04   
ref|XP_009905882.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    5e-04   
ref|XP_417028.2|  PREDICTED: N-alpha-acetyltransferase 16, NatA a...  47.4    5e-04   
ref|XP_004938719.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    5e-04   
ref|XP_009645011.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    5e-04   
gb|KFP22483.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.4    5e-04   
ref|XP_010219071.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    5e-04   
ref|XP_003041077.1|  predicted protein                                47.4    5e-04   
gb|KGL81534.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.4    5e-04   
gb|KFU92023.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.4    5e-04   
ref|XP_010142869.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    5e-04   
ref|XP_005102207.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...  47.4    6e-04   
ref|XP_003021204.1|  hypothetical protein TRV_04636                   47.4    6e-04   
ref|XP_009999161.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.4    6e-04   
ref|XP_009905883.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.0    6e-04   
ref|XP_005018871.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.0    6e-04   
ref|XP_010023158.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.0    6e-04   
gb|KFQ45707.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.0    6e-04   
ref|XP_005145707.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.0    6e-04   
gb|EWG49365.1|  acetyltransferase                                     47.0    6e-04   
gb|KFV79939.1|  N-alpha-acetyltransferase 16, NatA auxiliary subunit  47.0    6e-04   
ref|XP_009670757.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  47.0    6e-04   
ref|XP_009511437.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  46.2    7e-04   
ref|XP_003170755.1|  NMDA receptor-regulated protein 1                47.0    7e-04   
ref|XP_007895872.1|  PREDICTED: N-alpha-acetyltransferase 15, Nat...  47.0    7e-04   
ref|XP_009483188.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  46.2    7e-04   
gb|EWC48415.1|  hypothetical protein DRE_02184                        47.0    7e-04   
ref|XP_006124451.1|  PREDICTED: N-alpha-acetyltransferase 16, Nat...  46.2    7e-04   
gb|EPE10554.1|  nmda receptor-regulated protein 1                     46.6    0.001   
ref|XP_002611320.1|  hypothetical protein BRAFLDRAFT_120339           46.6    0.001   



>ref|XP_006356169.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Solanum tuberosum]
Length=903

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQRC+ LYS++  YSSDEID L ALY SL+QQY+RSSAVKRIPLDFLKD+KF
Sbjct  255  DNYRYYEGLQRCLGLYSENGQYSSDEIDRLEALYKSLAQQYNRSSAVKRIPLDFLKDDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAAENYIRPLLTKGVPSL
Sbjct  315  REAAENYIRPLLTKGVPSL  333



>ref|XP_004241722.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Solanum lycopersicum]
Length=903

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQRC+ LYS++  YSSDEID L ALY SL+QQY+RSSAVKRIPLDFLKD KF
Sbjct  255  DNYRYYEGLQRCLGLYSENGQYSSDEIDRLEALYRSLAQQYNRSSAVKRIPLDFLKDGKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AAENYIRPLLTKGVPSL
Sbjct  315  RDAAENYIRPLLTKGVPSL  333



>ref|XP_009619829.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Nicotiana tomentosiformis]
Length=901

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQRC+ LYS++  Y++DEID L  LY +L+QQY+RSSAVKRIPLDFL+D+KF
Sbjct  255  DNYRYYEGLQRCLGLYSENGLYTADEIDRLETLYRALAQQYNRSSAVKRIPLDFLRDDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAAENYIRPLLTKGVPSL
Sbjct  315  REAAENYIRPLLTKGVPSL  333



>ref|XP_009778993.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Nicotiana sylvestris]
Length=902

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQRC+ L S++  Y++DEID L  LY +L+QQY+RSSAVKRIPLDFL+D+KF
Sbjct  255  DNYRYYEGLQRCLGLCSENGQYTADEIDRLETLYRALAQQYNRSSAVKRIPLDFLRDDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAAENYIRPLLTKGVPSL
Sbjct  315  REAAENYIRPLLTKGVPSL  333



>ref|XP_009802987.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Nicotiana sylvestris]
Length=899

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQRC+ L+S+   YSSDEID L +LY SL+QQY RSSAVKRIPLDFL+D+KF
Sbjct  255  DNYRYYEGLQRCLGLHSEKGQYSSDEIDKLESLYKSLAQQYSRSSAVKRIPLDFLRDDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAAE+YIRPLL KGVPSL
Sbjct  315  REAAESYIRPLLAKGVPSL  333



>gb|KHN44136.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Glycine 
soja]
Length=893

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV LYSK+ +YS DEID L ALY +L QQY  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYYEGLQKCVGLYSKNGHYSPDEIDRLDALYKTLGQQYKWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
             EAA+NYIRPLLTKGVPSL
Sbjct  315  HEAADNYIRPLLTKGVPSL  333



>ref|XP_003543657.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Glycine max]
Length=900

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV LYSK+ +YS DEID L ALY +L QQY  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYYEGLQKCVGLYSKNGHYSPDEIDRLDALYKTLGQQYKWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
             EAA+NYIRPLLTKGVPSL
Sbjct  315  HEAADNYIRPLLTKGVPSL  333



>ref|XP_009623793.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Nicotiana tomentosiformis]
Length=899

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQRC+ L+S+   YSSDEID L +LY SL+QQY RSSAVKRIPLDFL+D+KF
Sbjct  255  DNYRYYEGLQRCLGLHSEKGQYSSDEIDKLESLYKSLAQQYSRSSAVKRIPLDFLRDDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA NYIRPL+ KGVPSL
Sbjct  315  REAAANYIRPLVAKGVPSL  333



>ref|XP_011072284.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Sesamum indicum]
Length=899

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQRC+ LYS +  YS DEID L ALY SLS+QY RSSAVKRIPLDFL  EKF
Sbjct  255  DNYRYYEGLQRCMGLYSANGQYSPDEIDRLEALYVSLSKQYSRSSAVKRIPLDFLSAEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            + AAENYIRP LTKGVPSL
Sbjct  315  RLAAENYIRPFLTKGVPSL  333



>ref|XP_003546283.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Glycine max]
Length=901

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV LYS++ +YS DEID L ALY +L QQY  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYYEGLQKCVGLYSENGHYSLDEIDQLDALYRTLGQQYKWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            QEAA NYIRPLLTKG+PSL
Sbjct  315  QEAANNYIRPLLTKGIPSL  333



>gb|KHM98779.1| N-alpha-acetyltransferase 15, NatA auxiliary subunit [Glycine 
soja]
Length=901

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV LYS++ +YS DEID L ALY +L QQY  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYYEGLQKCVGLYSENGHYSLDEIDQLDALYRTLGQQYKWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            QEAA NYIRPLLTKG+PSL
Sbjct  315  QEAANNYIRPLLTKGIPSL  333



>ref|XP_010417709.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Camelina sativa]
Length=896

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C+ LYS+   YSSD+I+ L ALY SLS+QY RSSAVKRIPLDFL+DE F
Sbjct  255  DNYRYYEGLQKCLGLYSESGQYSSDQIEKLNALYQSLSEQYTRSSAVKRIPLDFLQDENF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA  NYI+PLLTKGVPSL
Sbjct  315  KEAVANYIKPLLTKGVPSL  333



>ref|XP_010654709.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X3 [Vitis vinifera]
Length=801

 Score =   124 bits (312),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV L+S++  YS DEID L ALY SL Q+Y  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYRYYEGLQKCVGLFSENGLYSPDEIDRLDALYKSLGQEYRWSSAVKRIPLDFLQGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>ref|XP_002284882.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X1 [Vitis vinifera]
 emb|CBI36188.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =   124 bits (312),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV L+S++  YS DEID L ALY SL Q+Y  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYRYYEGLQKCVGLFSENGLYSPDEIDRLDALYKSLGQEYRWSSAVKRIPLDFLQGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>emb|CDO98079.1| unnamed protein product [Coffea canephora]
Length=909

 Score =   124 bits (312),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQRC+ L+S+  +YSSDEI  L  LY SL+QQY++SSAVKRIPLDFL+ EKF
Sbjct  255  DNYRYYEGLQRCLGLFSEKGHYSSDEIGQLEELYESLAQQYNKSSAVKRIPLDFLEGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            Q+A E+YIRPLLTKGVPSL
Sbjct  315  QKAVESYIRPLLTKGVPSL  333



>ref|XP_010654708.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Vitis vinifera]
Length=899

 Score =   124 bits (311),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV L+S++  YS DEID L ALY SL Q+Y  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYRYYEGLQKCVGLFSENGLYSPDEIDRLDALYKSLGQEYRWSSAVKRIPLDFLQGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>ref|XP_010539518.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Tarenaya hassleriana]
Length=769

 Score =   124 bits (310),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C+ LYS+   +SSDE + L ALY SLSQQ+  SSAVKRIPLDFL+DEKF
Sbjct  132  DNYRYYEGLQKCLGLYSESGQFSSDETEQLNALYQSLSQQFTWSSAVKRIPLDFLQDEKF  191

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA NYI+PLLTKGVPSL
Sbjct  192  KEAAVNYIKPLLTKGVPSL  210



>ref|XP_009106751.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X3 [Brassica rapa]
Length=774

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C++LYS++  YSSD+I+ L ALY SLS+QY RSSAVKRIPLDFL+DE F
Sbjct  132  DNYRYYEGLQKCLELYSENGQYSSDQIEKLNALYQSLSEQYTRSSAVKRIPLDFLQDESF  191

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA   YI+PLLTKGVPSL
Sbjct  192  KEAVGKYIKPLLTKGVPSL  210



>ref|XP_004235695.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Solanum lycopersicum]
Length=897

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYY+GLQRC+ LYS+   Y++DEID L  LY  L+ QY RSSAVKRIPLDFL+D+KF
Sbjct  255  DNYRYYDGLQRCLGLYSEKGQYTADEIDRLENLYRVLAHQYSRSSAVKRIPLDFLQDDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>ref|XP_006343105.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Solanum tuberosum]
Length=897

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYY+GLQRC+ LYS+   Y++DEID L  LY  L+ QY RSSAVKRIPLDFL+D+KF
Sbjct  255  DNYRYYDGLQRCLGLYSEKGQYTADEIDRLENLYRVLAHQYSRSSAVKRIPLDFLQDDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>ref|XP_009106749.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Brassica rapa]
Length=922

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C++LYS++  YSSD+I+ L ALY SLS+QY RSSAVKRIPLDFL+DE F
Sbjct  280  DNYRYYEGLQKCLELYSENGQYSSDQIEKLNALYQSLSEQYTRSSAVKRIPLDFLQDESF  339

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA   YI+PLLTKGVPSL
Sbjct  340  KEAVGKYIKPLLTKGVPSL  358



>ref|XP_009106750.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Brassica rapa]
Length=897

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C++LYS++  YSSD+I+ L ALY SLS+QY RSSAVKRIPLDFL+DE F
Sbjct  255  DNYRYYEGLQKCLELYSENGQYSSDQIEKLNALYQSLSEQYTRSSAVKRIPLDFLQDESF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA   YI+PLLTKGVPSL
Sbjct  315  KEAVGKYIKPLLTKGVPSL  333



>ref|XP_010539517.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X1 [Tarenaya hassleriana]
Length=892

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C+ LYS+   +SSDE + L ALY SLSQQ+  SSAVKRIPLDFL+DEKF
Sbjct  255  DNYRYYEGLQKCLGLYSESGQFSSDETEQLNALYQSLSQQFTWSSAVKRIPLDFLQDEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA NYI+PLLTKGVPSL
Sbjct  315  KEAAVNYIKPLLTKGVPSL  333



>ref|XP_010429971.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Camelina sativa]
Length=896

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C+ LYS+   YSSD+I+ L ALY SLS+QY RSSAVKRIPLDFL+DE F
Sbjct  255  DNYRYYEGLQKCLGLYSECGQYSSDQIEKLNALYQSLSEQYTRSSAVKRIPLDFLQDENF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA  NYI+PLLTKGVPSL
Sbjct  315  KEAVANYIKPLLTKGVPSL  333



>emb|CDX87308.1| BnaA07g35650D [Brassica napus]
Length=910

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C++LYS++  YSSD+I+ L ALY SLS+QY RSSAVKRIPLDFL+DE F
Sbjct  255  DNYRYYEGLQKCLELYSENGQYSSDQIEKLNALYQSLSEQYTRSSAVKRIPLDFLQDESF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA   YI+PLLTKGVPSL
Sbjct  315  KEAVGKYIKPLLTKGVPSL  333



>ref|XP_010474516.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Camelina sativa]
Length=995

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C+ LYS+   YSSD+I+ L ALY SLS+QY RSSAVKRIPLDFL+DE F
Sbjct  354  DNYRYYEGLQKCLGLYSECGQYSSDQIEKLNALYQSLSEQYTRSSAVKRIPLDFLQDENF  413

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA  NYI+PLLTKGVPSL
Sbjct  414  KEAVANYIKPLLTKGVPSL  432



>ref|XP_010110300.1| N-alpha-acetyltransferase 15, NatA auxiliary subunit [Morus notabilis]
 gb|EXC25820.1| N-alpha-acetyltransferase 15, NatA auxiliary subunit [Morus notabilis]
Length=901

 Score =   123 bits (308),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV LYS++  YSSD+I+ L  LY SL QQY+ SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYYEGLQKCVGLYSENSQYSSDQIELLDKLYKSLRQQYNWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>ref|XP_003597797.1| NMDA receptor-regulated protein [Medicago truncatula]
Length=952

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQRCV LYS++  +S DEID L  LY +L QQ+ RSSAVKRIPLDFL+ ++F
Sbjct  255  DNYRYYEGLQRCVGLYSENGQFSPDEIDRLDTLYKTLGQQFKRSSAVKRIPLDFLQGDRF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA++YIRPLLTKGVPSL
Sbjct  315  REAADSYIRPLLTKGVPSL  333



>ref|XP_007024040.1| Tetratricopeptide repeat-containing protein isoform 2 [Theobroma 
cacao]
 gb|EOY26662.1| Tetratricopeptide repeat-containing protein isoform 2 [Theobroma 
cacao]
Length=775

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C  LY+++  YSSDEID L ALY SL+QQY  SSAVKRIPLDFL+  KF
Sbjct  132  DNYRYYEGLQKCFGLYTENGKYSSDEIDQLDALYKSLAQQYTWSSAVKRIPLDFLQGGKF  191

Query  181  QEAAENYIRPLLTKGVPSL  237
             EAA NYI+PLLTKGVPSL
Sbjct  192  HEAAVNYIKPLLTKGVPSL  210



>ref|XP_010532133.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Tarenaya hassleriana]
Length=894

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYY+GLQ+C+ LY +   +SSDEI+ L ALY SLSQQY  SSAVKRIPLDFL+DEKF
Sbjct  255  DNYRYYDGLQKCLGLYPESGQFSSDEIEQLNALYQSLSQQYTWSSAVKRIPLDFLQDEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA+ NYI+PLLTKGVPSL
Sbjct  315  KEASANYIKPLLTKGVPSL  333



>ref|XP_009128424.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Brassica rapa]
Length=898

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C+ LYS+   YSSD I+ L ALY SLS+QY RSSAVKRIPLDFL+DE+F
Sbjct  255  DNYRYYEGLQKCLGLYSESGQYSSDRIEKLNALYQSLSEQYTRSSAVKRIPLDFLQDERF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA   YI+PLLTKGVPSL
Sbjct  315  KEAVAKYIKPLLTKGVPSL  333



>emb|CDY38667.1| BnaC02g23120D [Brassica napus]
Length=898

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C+ LYS+   YSSD I+ L ALY SLS+QY RSSAVKRIPLDFL+DE+F
Sbjct  255  DNYRYYEGLQKCLGLYSESGQYSSDRIEKLNALYQSLSEQYTRSSAVKRIPLDFLQDERF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA   YI+PLLTKGVPSL
Sbjct  315  KEAVAKYIKPLLTKGVPSL  333



>emb|CDY37595.1| BnaA02g19750D [Brassica napus]
Length=898

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C+ LYS+   YSSD I+ L ALY SLS+QY RSSAVKRIPLDFL+DE+F
Sbjct  255  DNYRYYEGLQKCLGLYSESGQYSSDRIEKLNALYQSLSEQYTRSSAVKRIPLDFLQDERF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA   YI+PLLTKGVPSL
Sbjct  315  KEAVAKYIKPLLTKGVPSL  333



>gb|KEH28765.1| amino-terminal acetyltransferase, putative [Medicago truncatula]
Length=900

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY YYEGLQ+CV LY +D  YS+D+ID L  LY +L QQY  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYSYYEGLQKCVGLYLEDGKYSADQIDQLVLLYETLGQQYKWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAAENYIRPLLTKGVPSL
Sbjct  315  REAAENYIRPLLTKGVPSL  333



>ref|XP_002887831.1| EMB2753 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64090.1| EMB2753 [Arabidopsis lyrata subsp. lyrata]
Length=897

 Score =   122 bits (306),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C+ LYS+   YSSD+I+ L ALY SLS+QY RSSAVKRIPLDFL+DE F
Sbjct  255  DNYRYYEGLQKCLGLYSESGQYSSDQIEKLNALYLSLSEQYTRSSAVKRIPLDFLQDENF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA   YI+PLLTKGVPSL
Sbjct  315  KEAVAKYIKPLLTKGVPSL  333



>ref|XP_007024039.1| Tetratricopeptide repeat (TPR)-containing protein isoform 1 [Theobroma 
cacao]
 gb|EOY26661.1| Tetratricopeptide repeat (TPR)-containing protein isoform 1 [Theobroma 
cacao]
Length=898

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C  LY+++  YSSDEID L ALY SL+QQY  SSAVKRIPLDFL+  KF
Sbjct  255  DNYRYYEGLQKCFGLYTENGKYSSDEIDQLDALYKSLAQQYTWSSAVKRIPLDFLQGGKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
             EAA NYI+PLLTKGVPSL
Sbjct  315  HEAAVNYIKPLLTKGVPSL  333



>ref|XP_010537937.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Tarenaya hassleriana]
Length=895

 Score =   122 bits (306),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C+ L+S++  +SSDEI+ L ALY SLSQQY  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYRYYEGLQKCLGLHSENGQFSSDEIERLNALYQSLSQQYTWSSAVKRIPLDFLQHEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E+A NYI+PLLTKGVPSL
Sbjct  315  KESAGNYIKPLLTKGVPSL  333



>ref|XP_008342751.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Malus domestica]
Length=398

 Score =   119 bits (297),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYY+GLQ+C+ LY+++  YS DEI+ L ALY SL+Q+Y  SSAVKRIPLDFL+ +KF
Sbjct  208  DNYRYYQGLQKCLGLYAENAQYSLDEIEHLDALYKSLAQKYSWSSAVKRIPLDFLQGDKF  267

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  268  REAADNYIRPLLTKGVPSL  286



>ref|XP_003531689.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Glycine max]
Length=901

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV LY +D  YS D+ID L +LY +L QQY  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYYEGLQKCVGLYLEDGQYSPDQIDRLDSLYKTLVQQYKWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>ref|XP_006465444.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Citrus sinensis]
Length=900

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY YYEGLQ+C+ LY  + NYSS EID L ALY SL+QQY  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYSYYEGLQKCLGLYRDNGNYSSGEIDELDALYKSLAQQYTWSSAVKRIPLDFLQGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA NY+RPLLTKGVPSL
Sbjct  315  REAAFNYVRPLLTKGVPSL  333



>gb|KHN47800.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Glycine 
soja]
Length=901

 Score =   121 bits (304),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV LY +D  YS D+ID L +LY +L QQY  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYYEGLQKCVGLYLEDGQYSPDQIDRLDSLYKTLVQQYKWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>gb|AAF27136.1|AC018849_24 putative N-terminal acetyltransferase; 84330-89402 [Arabidopsis 
thaliana]
Length=683

 Score =   120 bits (302),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRY+EGLQ+C+ LYS+   YSSD+I+ L ALY SLS+QY RSSAVKRIPLDFL+DE F
Sbjct  240  DNYRYHEGLQKCLGLYSESGQYSSDQIEKLNALYQSLSEQYTRSSAVKRIPLDFLQDENF  299

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA   YI+PLLTKGVPSL
Sbjct  300  KEAVAKYIKPLLTKGVPSL  318



>ref|XP_009339003.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Pyrus x bretschneideri]
Length=899

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYY+GLQ+C+ LY+++  YS DEI+ L ALY SL+Q+Y  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYYQGLQKCLGLYAENAQYSLDEIERLDALYKSLAQKYSWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            QEAA+NYIRPLLTKGVPSL
Sbjct  315  QEAADNYIRPLLTKGVPSL  333



>ref|XP_006427097.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
 gb|ESR40337.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
Length=900

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY YYEGLQ+C+ LY  + NYSS EID L ALY SL+QQY  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYSYYEGLQKCLGLYRDNGNYSSGEIDELDALYKSLAQQYTWSSAVKRIPLDFLQGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA NY+RPLLTKGVPSL
Sbjct  315  REAAFNYVRPLLTKGVPSL  333



>ref|XP_004506868.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Cicer arietinum]
Length=899

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV LY +D  YS D+ID L +LY +L +QY  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYYEGLQKCVGLYLEDGKYSPDQIDRLVSLYETLGRQYKWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>ref|XP_006427096.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
 gb|ESR40336.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
Length=842

 Score =   121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY YYEGLQ+C+ LY  + NYSS EID L ALY SL+QQY  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYSYYEGLQKCLGLYRDNGNYSSGEIDELDALYKSLAQQYTWSSAVKRIPLDFLQGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA NY+RPLLTKGVPSL
Sbjct  315  REAAFNYVRPLLTKGVPSL  333



>ref|XP_006427095.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
 gb|ESR40335.1| hypothetical protein CICLE_v10024839mg [Citrus clementina]
Length=851

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY YYEGLQ+C+ LY  + NYSS EID L ALY SL+QQY  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYSYYEGLQKCLGLYRDNGNYSSGEIDELDALYKSLAQQYTWSSAVKRIPLDFLQGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA NY+RPLLTKGVPSL
Sbjct  315  REAAFNYVRPLLTKGVPSL  333



>ref|XP_009104460.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Brassica rapa]
Length=894

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C  LYS+   YSSD+I+ L ALY SLS+QY RSSAVKRIPLDFL+DE F
Sbjct  255  DNYRYYEGLQKCFGLYSESGQYSSDKIEKLNALYQSLSEQYTRSSAVKRIPLDFLQDESF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA   YI+PLLTKGVPSL
Sbjct  315  KEAVAKYIKPLLTKGVPSL  333



>ref|NP_178157.2| protein EMBRYO DEFECTIVE 2753 [Arabidopsis thaliana]
 gb|AAL36371.1| putative N-terminal acetyltransferase [Arabidopsis thaliana]
 gb|AAM14358.1| putative N-terminal acetyltransferase [Arabidopsis thaliana]
 dbj|BAC42757.1| putative N-terminal acetyltransferase [Arabidopsis thaliana]
 gb|AEE36399.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=897

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRY+EGLQ+C+ LYS+   YSSD+I+ L ALY SLS+QY RSSAVKRIPLDFL+DE F
Sbjct  255  DNYRYHEGLQKCLGLYSESGQYSSDQIEKLNALYQSLSEQYTRSSAVKRIPLDFLQDENF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA   YI+PLLTKGVPSL
Sbjct  315  KEAVAKYIKPLLTKGVPSL  333



>emb|CDX79387.1| BnaC06g19160D [Brassica napus]
Length=908

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C  LYS+   YSSD+I+ L ALY SLS+QY RSSAVKRIPLDFL+DE F
Sbjct  253  DNYRYYEGLQKCFGLYSESGQYSSDKIEKLNALYQSLSEQYTRSSAVKRIPLDFLQDESF  312

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA   YI+PLLTKGVPSL
Sbjct  313  KEAVAKYIKPLLTKGVPSL  331



>ref|XP_010691269.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Beta vulgaris subsp. vulgaris]
Length=895

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQRC+ LYS+   YS+DEI  L ALY SL Q+Y  SSA KRIPLDFL+ +KF
Sbjct  255  DNYRYYEGLQRCLGLYSEIGQYSADEIVQLDALYQSLQQEYKWSSAAKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            QEAA+NYIRPLLTKGVPSL
Sbjct  315  QEAADNYIRPLLTKGVPSL  333



>ref|NP_001185448.1| protein EMBRYO DEFECTIVE 2753 [Arabidopsis thaliana]
 gb|AEE36400.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana]
Length=911

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRY+EGLQ+C+ LYS+   YSSD+I+ L ALY SLS+QY RSSAVKRIPLDFL+DE F
Sbjct  255  DNYRYHEGLQKCLGLYSESGQYSSDQIEKLNALYQSLSEQYTRSSAVKRIPLDFLQDENF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA   YI+PLLTKGVPSL
Sbjct  315  KEAVAKYIKPLLTKGVPSL  333



>ref|XP_007135709.1| hypothetical protein PHAVU_010G151600g [Phaseolus vulgaris]
 gb|ESW07703.1| hypothetical protein PHAVU_010G151600g [Phaseolus vulgaris]
Length=892

 Score =   120 bits (302),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV LY +D  YS D+ID L +LY ++ QQY  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYYEGLQKCVGLYLEDGQYSPDQIDQLDSLYKAIVQQYKWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>gb|EYU21564.1| hypothetical protein MIMGU_mgv1a001105mg [Erythranthe guttata]
Length=888

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQRC+ LYS +  YSSD+ID L ALY SLS+ Y RSSAVKRIPLDFL  EKF
Sbjct  255  DNYRYYEGLQRCMGLYSANGQYSSDDIDRLEALYVSLSKLYSRSSAVKRIPLDFLCAEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            + AAENYI+P LTKG+PSL
Sbjct  315  RLAAENYIQPFLTKGIPSL  333



>emb|CDY39981.1| BnaC06g40590D [Brassica napus]
Length=971

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C++LYS++  YSSD+++ L ALY SLS+QY RSSAVKRIPLDFL+DE F
Sbjct  329  DNYRYYEGLQKCLELYSENGQYSSDQMEKLNALYQSLSEQYTRSSAVKRIPLDFLQDESF  388

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++A   YI+PLLTKGVPSL
Sbjct  389  KKAVGKYIKPLLTKGVPSL  407



>ref|XP_006301121.1| hypothetical protein CARUB_v10021530mg [Capsella rubella]
 gb|EOA34019.1| hypothetical protein CARUB_v10021530mg [Capsella rubella]
Length=907

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C+ LYS+   YSSD+I+ L ALY SLS+QY  SSAVKRIPLDFL+DE F
Sbjct  255  DNYRYYEGLQKCLGLYSESGQYSSDQIEKLNALYQSLSEQYTWSSAVKRIPLDFLQDENF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++A  NYI+PLLTKGVPSL
Sbjct  315  KDAVANYIKPLLTKGVPSL  333



>ref|XP_010249876.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Nelumbo nucifera]
Length=888

 Score =   120 bits (301),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C+ LYS++  YS+++ID L ALY SL +QY  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYRYYEGLQKCLGLYSENGQYSANDIDKLDALYKSLREQYTWSSAVKRIPLDFLQGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA++YIRPLLTKGVPSL
Sbjct  315  REAADHYIRPLLTKGVPSL  333



>ref|XP_007217132.1| hypothetical protein PRUPE_ppa001163m1g, partial [Prunus persica]
 gb|EMJ18331.1| hypothetical protein PRUPE_ppa001163m1g, partial [Prunus persica]
Length=702

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYY+GLQ+C+ LY+++  YS DE++ L ALY SL Q+Y  SSAVKRIPLDFL+ +KF
Sbjct  60   DNYRYYQGLQKCLGLYAENAQYSPDEVERLDALYKSLGQKYSWSSAVKRIPLDFLQGDKF  119

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  120  REAADNYIRPLLTKGVPSL  138



>ref|XP_008228606.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Prunus mume]
Length=897

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYY+GLQ+C+ LY+++  YS DEI+ L ALY SL Q+Y  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYYQGLQKCLGLYAENAQYSPDEIERLDALYKSLGQKYSWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>gb|KFK42434.1| hypothetical protein AALP_AA2G256000 [Arabis alpina]
Length=891

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C+ LYS+   YS+D+I+ L ALY SLS+QY RSSAVKRIPLDFL++E F
Sbjct  255  DNYRYYEGLQKCLGLYSESGQYSADQIEKLNALYQSLSEQYTRSSAVKRIPLDFLQNENF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA   YI+PLLTKGVPSL
Sbjct  315  KEAVAKYIKPLLTKGVPSL  333



>emb|CDX67946.1| BnaA07g19860D [Brassica napus]
Length=894

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C  LYS+   YSS++I+ L ALY SLS+QY RSSAVKRIPLDFL+DE F
Sbjct  255  DNYRYYEGLQKCFGLYSESGQYSSNKIEKLNALYQSLSEQYTRSSAVKRIPLDFLQDESF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA   YI+PLLTKGVPSL
Sbjct  315  KEAVAKYIKPLLTKGVPSL  333



>ref|XP_002517521.1| NMDA receptor-regulated protein, putative [Ricinus communis]
 gb|EEF44685.1| NMDA receptor-regulated protein, putative [Ricinus communis]
Length=901

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV L S++  YS+DEID L +LY  L QQY  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYYEGLQKCVGLDSENGQYSADEIDKLDSLYKLLGQQYTWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NY+RPLLTKGVPSL
Sbjct  315  REAADNYVRPLLTKGVPSL  333



>gb|KHG18219.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Gossypium 
arboreum]
Length=795

 Score =   119 bits (297),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C  LYS++  YSSDEID L ALY SL+QQY  SSAVKRIPLDFL+ +KF
Sbjct  154  DNYRYYEGLQKCFDLYSENGKYSSDEIDRLDALYKSLAQQYTWSSAVKRIPLDFLQGDKF  213

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA +YI+PLL KGVPSL
Sbjct  214  REAAVSYIQPLLIKGVPSL  232



>ref|XP_007150682.1| hypothetical protein PHAVU_005G172700g [Phaseolus vulgaris]
 gb|ESW22676.1| hypothetical protein PHAVU_005G172700g [Phaseolus vulgaris]
Length=893

 Score =   119 bits (297),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV LYS+  ++  DEID L ALY +L QQY  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYYEGLQKCVGLYSETGHFPPDEIDQLDALYKTLEQQYKWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA++YI+PLLTKGVPSL
Sbjct  315  REAADSYIKPLLTKGVPSL  333



>ref|XP_004302931.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Fragaria vesca subsp. vesca]
Length=898

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYY+GLQ+C+ LY+++  YS DEI+ L  LY SL Q+Y  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYRYYQGLQKCLGLYAENSQYSPDEIERLDDLYKSLRQKYSWSSAVKRIPLDFLQGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>gb|KDP37181.1| hypothetical protein JCGZ_06237 [Jatropha curcas]
Length=901

 Score =   118 bits (295),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV LYS++ + S+DEI  L  LY SL QQY  SSAVKRIPLDFL+ ++F
Sbjct  255  DNYRYYEGLQKCVGLYSENGHNSADEIVKLDELYKSLGQQYTWSSAVKRIPLDFLQGDRF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>ref|XP_011002722.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Populus euphratica]
Length=900

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 66/79 (84%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRY+EGLQ+CV LYS++   SS +ID L ALY SL QQY  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYFEGLQKCVGLYSEN-GLSSSDIDQLDALYKSLGQQYTWSSAVKRIPLDFLQGDKF  313

Query  181  QEAAENYIRPLLTKGVPSL  237
             EAA+NYIRPLLTKGVPSL
Sbjct  314  HEAADNYIRPLLTKGVPSL  332



>gb|KHN01367.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Glycine 
soja]
Length=901

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV LY +D  YS D+ID L +LY +L QQY  SSAVKRIPLDFL+  +F
Sbjct  255  DNYRYYEGLQKCVGLYLEDGQYSPDQIDRLDSLYKTLVQQYKWSSAVKRIPLDFLQGGQF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA++YIRPLLTKGVPSL
Sbjct  315  REAADSYIRPLLTKGVPSL  333



>ref|XP_006583136.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Glycine max]
Length=951

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV LY +D  YS D+ID L +LY +L QQY  SSAVKRIPLDFL+  +F
Sbjct  255  DNYRYYEGLQKCVGLYLEDGQYSPDQIDRLDSLYKTLVQQYKWSSAVKRIPLDFLQGGQF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA++YIRPLLTKGVPSL
Sbjct  315  REAADSYIRPLLTKGVPSL  333



>ref|XP_003528376.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Glycine max]
Length=901

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV LY +D  YS D+ID L +LY +L QQY  SSAVKRIPLDFL+  +F
Sbjct  255  DNYRYYEGLQKCVGLYLEDGQYSPDQIDRLDSLYKTLVQQYKWSSAVKRIPLDFLQGGQF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA++YIRPLLTKGVPSL
Sbjct  315  REAADSYIRPLLTKGVPSL  333



>ref|XP_006389790.1| hypothetical protein EUTSA_v10018100mg [Eutrema salsugineum]
 gb|ESQ27076.1| hypothetical protein EUTSA_v10018100mg [Eutrema salsugineum]
Length=897

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C++LYS+   YS D+I+ L ALY SLS+Q+  SSAVKRIPLDFL+DE F
Sbjct  255  DNYRYYEGLQKCLELYSESGQYSLDQIEKLNALYQSLSEQFTWSSAVKRIPLDFLQDENF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA   YI+PLLTKGVPSL
Sbjct  315  KEAVAKYIKPLLTKGVPSL  333



>gb|KEH39579.1| amino-terminal acetyltransferase, putative [Medicago truncatula]
Length=854

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 7/86 (8%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQRCV LYS++  +S DEID L  LY +L QQ+ RSSAVKRIPLDFL+ ++F
Sbjct  255  DNYRYYEGLQRCVGLYSENGQFSPDEIDRLDTLYKTLGQQFKRSSAVKRIPLDFLQGDRF  314

Query  181  QEAAENYIRPLLTK-------GVPSL  237
            +EAA++YIRPLLTK       GVPSL
Sbjct  315  REAADSYIRPLLTKVCTNPLWGVPSL  340



>ref|XP_010254211.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X1 [Nelumbo nucifera]
Length=903

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY+YYEGLQ+C+ LYS+   YS+D+ID L A Y SL QQY  SSAVKRIPLDFL+ E F
Sbjct  255  DNYKYYEGLQKCLGLYSEHGLYSADDIDKLDAFYKSLRQQYTWSSAVKRIPLDFLEGENF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLL KGVPSL
Sbjct  315  REAADNYIRPLLIKGVPSL  333



>ref|XP_006844401.1| hypothetical protein AMTR_s00142p00102260 [Amborella trichopoda]
 gb|ERN06076.1| hypothetical protein AMTR_s00142p00102260 [Amborella trichopoda]
Length=901

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C+ L+  D  Y+SDE++ +  LY SL +QY  SSAVKRIPLDFLK EKF
Sbjct  255  DNYRYYEGLQKCLGLHRDDGEYTSDEVNHMCDLYKSLREQYTWSSAVKRIPLDFLKGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
             E AENYI+PLLTKGVPSL
Sbjct  315  CEEAENYIKPLLTKGVPSL  333



>ref|XP_010254212.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Nelumbo nucifera]
Length=856

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY+YYEGLQ+C+ LYS+   YS+D+ID L A Y SL QQY  SSAVKRIPLDFL+ E F
Sbjct  208  DNYKYYEGLQKCLGLYSEHGLYSADDIDKLDAFYKSLRQQYTWSSAVKRIPLDFLEGENF  267

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLL KGVPSL
Sbjct  268  REAADNYIRPLLIKGVPSL  286



>gb|KEH39578.1| amino-terminal acetyltransferase, putative [Medicago truncatula]
Length=908

 Score =   116 bits (290),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 68/86 (79%), Gaps = 7/86 (8%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQRCV LYS++  +S DEID L  LY +L QQ+ RSSAVKRIPLDFL+ ++F
Sbjct  255  DNYRYYEGLQRCVGLYSENGQFSPDEIDRLDTLYKTLGQQFKRSSAVKRIPLDFLQGDRF  314

Query  181  QEAAENYIRPLLTK-------GVPSL  237
            +EAA++YIRPLLTK       GVPSL
Sbjct  315  REAADSYIRPLLTKVCTNPLWGVPSL  340



>ref|XP_009416095.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Musa acuminata subsp. malaccensis]
Length=903

 Score =   115 bits (288),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRY+ GLQ+C+ LYS    Y+SDEI+ L ALY SL  QY  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYFIGLQKCLGLYSDKGEYTSDEIERLDALYMSLRDQYSWSSAVKRIPLDFLEGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            QEA +NY+RPLLTKGVPSL
Sbjct  315  QEAVDNYVRPLLTKGVPSL  333



>ref|XP_011000818.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Populus euphratica]
Length=900

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 65/79 (82%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+CV L++++   SS +ID L  LY SL QQY  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYRYYEGLQKCVGLHAEN-GLSSSDIDQLDTLYKSLGQQYTWSSAVKRIPLDFLQGEKF  313

Query  181  QEAAENYIRPLLTKGVPSL  237
             EAA+NYIRPLLTKGVPSL
Sbjct  314  HEAADNYIRPLLTKGVPSL  332



>ref|XP_008373494.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Malus domestica]
Length=898

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY YY+GLQ+C+ LY+++  YS DEI  L  LY SL+Q+Y+ SSAVKRIPLDFL+ +KF
Sbjct  255  DNYGYYQGLQKCLGLYAENGQYSPDEIKRLDTLYKSLAQKYNWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>ref|XP_009358220.1| PREDICTED: LOW QUALITY PROTEIN: N-alpha-acetyltransferase 15, 
NatA auxiliary subunit-like [Pyrus x bretschneideri]
Length=897

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY YY+GLQ+C+ LY+++  YS  EI+ L ALY SL+Q+Y+ SSAVKRIPLDFL+ +KF
Sbjct  255  DNYGYYQGLQKCLGLYAENGQYSPAEIERLDALYKSLAQKYNWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>ref|XP_009358213.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X2 [Pyrus x bretschneideri]
Length=897

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY YY+GLQ+C+ LY+++  YS  EI+ L ALY SL+Q+Y+ SSAVKRIPLDFL+ +KF
Sbjct  255  DNYGYYQGLQKCLGLYAENGQYSPAEIERLDALYKSLAQKYNWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>ref|XP_009358212.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
isoform X1 [Pyrus x bretschneideri]
Length=898

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY YY+GLQ+C+ LY+++  YS  EI+ L ALY SL+Q+Y+ SSAVKRIPLDFL+ +KF
Sbjct  255  DNYGYYQGLQKCLGLYAENGQYSPAEIERLDALYKSLAQKYNWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NYIRPLLTKGVPSL
Sbjct  315  REAADNYIRPLLTKGVPSL  333



>ref|XP_006644372.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Oryza brachyantha]
Length=908

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY+Y+  +Q+C+ LYS +  YS+D++D L+ALY SL ++Y  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYKYFIAVQKCLGLYSGNGQYSADDVDRLSALYKSLKEEYGWSSAVKRIPLDFLEGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            QEAA+NY+RPLLTKGVPSL
Sbjct  315  QEAADNYVRPLLTKGVPSL  333



>ref|XP_009385623.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=902

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRY+ GLQ+C+ LYS+   Y+SDEI+ L ALY SL +QY  SSA+KRIPLDFL+  KF
Sbjct  255  DNYRYFIGLQKCLGLYSEKGEYTSDEIERLDALYKSLREQYSWSSAIKRIPLDFLEGVKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NY+RPLLTKGVPSL
Sbjct  315  REAADNYVRPLLTKGVPSL  333



>ref|XP_002299630.2| acetyltransferase-related family protein [Populus trichocarpa]
 gb|EEE84435.2| acetyltransferase-related family protein [Populus trichocarpa]
Length=900

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 65/79 (82%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRY EGLQ+CV LYS++   SS +ID L ALY SL QQY  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYCEGLQKCVGLYSEN-GLSSSDIDQLDALYKSLGQQYTWSSAVKRIPLDFLQGDKF  313

Query  181  QEAAENYIRPLLTKGVPSL  237
             EAA+NYIRPLLTKGVPSL
Sbjct  314  HEAADNYIRPLLTKGVPSL  332



>ref|XP_009385624.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=889

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRY+ GLQ+C+ LYS+   Y+SDEI+ L ALY SL +QY  SSA+KRIPLDFL+  KF
Sbjct  255  DNYRYFIGLQKCLGLYSEKGEYTSDEIERLDALYKSLREQYSWSSAIKRIPLDFLEGVKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NY+RPLLTKGVPSL
Sbjct  315  REAADNYVRPLLTKGVPSL  333



>ref|XP_004135824.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Cucumis sativus]
Length=896

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ CV L+SK+  YS  EI+ L  LY SL QQ   SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYYEGLQVCVGLFSKNSEYSPKEIERLDELYKSLGQQNGWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA+NYIRPLLTKGVPSL
Sbjct  315  KDAADNYIRPLLTKGVPSL  333



>ref|XP_003569365.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Brachypodium distachyon]
Length=907

 Score =   114 bits (285),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY+Y+  +Q+CV LYS++  YS+D+++ L ALY SL ++Y  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYKYFIAVQKCVGLYSENGQYSADDVERLIALYKSLKEEYSWSSAVKRIPLDFLEGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            QEAA+NY+RPLLTKGVPSL
Sbjct  315  QEAADNYVRPLLTKGVPSL  333



>ref|XP_010232026.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Brachypodium distachyon]
Length=914

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY+Y+  +Q+CV LYS++  YS+D+++ L ALY SL ++Y  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYKYFIAVQKCVGLYSENGQYSADDVERLIALYKSLKEEYSWSSAVKRIPLDFLEGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            QEAA+NY+RPLLTKGVPSL
Sbjct  315  QEAADNYVRPLLTKGVPSL  333



>ref|XP_010912607.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Elaeis guineensis]
Length=901

 Score =   114 bits (284),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRY+ GLQ+C+ LYS+   Y+SDE++ L ALY SL +QY  SSAVKRIPLDFL+ ++F
Sbjct  255  DNYRYFMGLQKCLGLYSEKGQYTSDEVERLGALYNSLKEQYSWSSAVKRIPLDFLEGDEF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+ YIRPLLTKGVPSL
Sbjct  315  REAADFYIRPLLTKGVPSL  333



>ref|NP_001043582.1| Os01g0617500 [Oryza sativa Japonica Group]
 dbj|BAD61289.1| acetyltransferase 1-like [Oryza sativa Japonica Group]
 dbj|BAF05496.1| Os01g0617500 [Oryza sativa Japonica Group]
Length=909

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY+Y+  +Q+C+ LYS++  YS+D++D L  LY+SL ++Y  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYKYFIAVQKCLGLYSENGQYSTDDVDRLCELYSSLKEEYGWSSAVKRIPLDFLEGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            QEAA+NY+RPLLTKGVPSL
Sbjct  315  QEAADNYVRPLLTKGVPSL  333



>gb|EEC71092.1| hypothetical protein OsI_02873 [Oryza sativa Indica Group]
Length=909

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY+Y+  +Q+C+ LYS++  YS+D++D L  LY+SL ++Y  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYKYFIAVQKCLGLYSENGQYSTDDVDRLCELYSSLKEEYGWSSAVKRIPLDFLEGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            QEAA+NY+RPLLTKGVPSL
Sbjct  315  QEAADNYVRPLLTKGVPSL  333



>gb|KHG11825.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Gossypium 
arboreum]
Length=897

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRYYEGLQ+C  LYS++  YSSD+ID L ALY  L++Q+  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYYEGLQKCFGLYSENGKYSSDKIDRLDALYKLLAEQFTWSSAVKRIPLDFLQGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
              AA NYI+PLLTKGVPSL
Sbjct  315  CAAATNYIKPLLTKGVPSL  333



>gb|EEE54991.1| hypothetical protein OsJ_02617 [Oryza sativa Japonica Group]
Length=909

 Score =   113 bits (283),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY+Y+  +Q+C+ LYS++  YS+D++D L  LY+SL ++Y  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYKYFIAVQKCLGLYSENGQYSTDDVDRLCELYSSLKEEYGWSSAVKRIPLDFLEGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            QEAA+NY+RPLLTKGVPSL
Sbjct  315  QEAADNYVRPLLTKGVPSL  333



>ref|XP_008792977.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Phoenix dactylifera]
Length=901

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRY+ GLQ+C+ LYS+   Y+SDE++ L ALY SL +QY  SSAVKRIPLDFL+ +KF
Sbjct  255  DNYRYFMGLQKCLGLYSERGQYTSDEVERLDALYKSLKEQYSWSSAVKRIPLDFLEGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
             EAA+ YIRPLLTKGVPSL
Sbjct  315  WEAADFYIRPLLTKGVPSL  333



>ref|XP_008343614.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
[Malus domestica]
Length=300

 Score =   108 bits (270),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY+GLQ+C+ LY+++  YS DEI  L  LY SL+Q+Y+ SSAVKRIPLDFL+ +KF+EAA
Sbjct  114  YYQGLQKCLGLYAENGQYSPDEIKRLDTLYKSLAQKYNWSSAVKRIPLDFLQGDKFREAA  173

Query  193  ENYIRPLLTKGVPSL  237
            +NYIRPLLTKGVPSL
Sbjct  174  DNYIRPLLTKGVPSL  188



>ref|XP_010925104.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X1 [Elaeis guineensis]
Length=902

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRY+ GLQ+C+ LYS++  Y+SDEI+ L ALY SL +QY  SSAVKRIPLD+L+ +KF
Sbjct  255  DNYRYFIGLQKCLGLYSENGQYTSDEIERLDALYKSLKEQYSWSSAVKRIPLDYLEGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
             EAA+ Y+RPLLTKGVPSL
Sbjct  315  WEAADCYVRPLLTKGVPSL  333



>ref|XP_010925105.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X2 [Elaeis guineensis]
Length=901

 Score =   112 bits (279),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRY+ GLQ+C+ LYS++  Y+SDEI+ L ALY SL +QY  SSAVKRIPLD+L+ +KF
Sbjct  255  DNYRYFIGLQKCLGLYSENGQYTSDEIERLDALYKSLKEQYSWSSAVKRIPLDYLEGDKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
             EAA+ Y+RPLLTKGVPSL
Sbjct  315  WEAADCYVRPLLTKGVPSL  333



>ref|XP_010062441.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit 
[Eucalyptus grandis]
 gb|KCW69583.1| hypothetical protein EUGRSUZ_F03005 [Eucalyptus grandis]
Length=900

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY YYEGLQ+C  LY  D  YSSDEI  L +LY SL++Q+  SSAVKRIPLDFL+ +K 
Sbjct  255  DNYSYYEGLQKCAGLYRADGQYSSDEIVQLISLYGSLAEQFAWSSAVKRIPLDFLQGDKL  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA NYI+PLLTKGVPSL
Sbjct  315  REAAINYIKPLLTKGVPSL  333



>ref|XP_002458160.1| hypothetical protein SORBIDRAFT_03g027980 [Sorghum bicolor]
 gb|EES03280.1| hypothetical protein SORBIDRAFT_03g027980 [Sorghum bicolor]
Length=908

 Score =   111 bits (277),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY+Y+  +Q+C+ LYS +  YS+D+++ L+ALY SL ++Y  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYKYFIAVQKCLGLYSDNGQYSADDVERLSALYNSLKEKYAWSSAVKRIPLDFLEGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NY+RPLLTKGVPSL
Sbjct  315  KEAADNYVRPLLTKGVPSL  333



>ref|XP_008672545.1| PREDICTED: uncharacterized protein LOC100274696 isoform X2 [Zea 
mays]
Length=785

 Score =   110 bits (274),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY+Y+  +Q+C+ LYS +  YS+ +++ L+ALY SL ++Y  SSAVKRIPLDFL+ EKF
Sbjct  132  DNYKYFIAVQKCLGLYSDNGQYSAADVERLSALYNSLKEKYAWSSAVKRIPLDFLEGEKF  191

Query  181  QEAAENYIRPLLTKGVPSL  237
            QEAA+NY+RPLLTKGVPSL
Sbjct  192  QEAADNYVRPLLTKGVPSL  210



>emb|CDM83394.1| unnamed protein product [Triticum aestivum]
Length=907

 Score =   110 bits (274),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY+Y   +Q+C+ LYS++  YS+D+++ L+ALY SL ++Y  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYKYLIAVQKCLGLYSENGQYSADDVERLSALYKSLKEEYSWSSAVKRIPLDFLEGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
             EAA+NY+RPLLTKGVPSL
Sbjct  315  HEAADNYVRPLLTKGVPSL  333



>ref|XP_008809145.1| PREDICTED: LOW QUALITY PROTEIN: N-alpha-acetyltransferase 15, 
NatA auxiliary subunit-like [Phoenix dactylifera]
Length=901

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNYRY+ GLQ+C+ LYS+   Y+SDEI+ L A Y SL +QY  SSAVKRIPLDFL+ + F
Sbjct  255  DNYRYFIGLQKCLGLYSEKGQYTSDEIERLDAFYKSLKEQYSWSSAVKRIPLDFLEGDNF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+ Y+RPLLTKGVPSL
Sbjct  315  REAADCYVRPLLTKGVPSL  333



>ref|XP_008672544.1| PREDICTED: uncharacterized protein LOC100274696 isoform X1 [Zea 
mays]
 gb|ACN33851.1| unknown [Zea mays]
 tpg|DAA58577.1| TPA: putative tetratricopeptide repeat (TPR)-containing protein 
[Zea mays]
Length=908

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY+Y+  +Q+C+ LYS +  YS+ +++ L+ALY SL ++Y  SSAVKRIPLDFL+ EKF
Sbjct  255  DNYKYFIAVQKCLGLYSDNGQYSAADVERLSALYNSLKEKYAWSSAVKRIPLDFLEGEKF  314

Query  181  QEAAENYIRPLLTKGVPSL  237
            QEAA+NY+RPLLTKGVPSL
Sbjct  315  QEAADNYVRPLLTKGVPSL  333



>gb|EMT02816.1| NMDA receptor-regulated 1-like protein [Aegilops tauschii]
Length=942

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY+Y   +Q+C+ LYS++  YS+D+++ L+ALY SL ++Y  SSAVKRIPLDFL+ EKF
Sbjct  230  DNYKYLIAVQKCLGLYSENGQYSADDVERLSALYNSLKKEYSWSSAVKRIPLDFLEGEKF  289

Query  181  QEAAENYIRPLLTKGVPSL  237
             EAA+NY+RPLLTKGVPSL
Sbjct  290  LEAADNYVRPLLTKGVPSL  308



>ref|XP_004172689.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like, 
partial [Cucumis sativus]
Length=265

 Score =   103 bits (257),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 64/96 (67%), Gaps = 17/96 (18%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVK------------  144
            DNYRYYEGLQ CV L+SK+  YS  EI+ L  LY SL QQ   SSAVK            
Sbjct  134  DNYRYYEGLQVCVGLFSKNSEYSPKEIERLDELYKSLGQQNGWSSAVKGIPLLMSAPYWH  193

Query  145  -----RIPLDFLKDEKFQEAAENYIRPLLTKGVPSL  237
                 RIPLDFL+ +KF++AA+NYIRPLLTKGVPSL
Sbjct  194  FVDNSRIPLDFLQGDKFKDAADNYIRPLLTKGVPSL  229



>ref|XP_004969173.1| PREDICTED: N-alpha-acetyltransferase 15, NatA auxiliary subunit-like 
[Setaria italica]
Length=905

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY+Y+  +Q+C+ LY+ +  YS+++++ L+ALY SL + Y  SSAVKRIPLDFL+ EKF
Sbjct  252  DNYKYFIAVQKCLGLYADNGQYSAEDVERLSALYDSLKENYAWSSAVKRIPLDFLEGEKF  311

Query  181  QEAAENYIRPLLTKGVPSL  237
             EAA+NY+RPLLTKGVPSL
Sbjct  312  LEAADNYVRPLLTKGVPSL  330



>gb|KGN45336.1| hypothetical protein Csa_7G440577 [Cucumis sativus]
Length=372

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 63/88 (72%), Gaps = 9/88 (10%)
 Frame = +1

Query  1    DNYR---------YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIP  153
            DNYR          YEGLQ CV L+SK+  YS  EI+ L  LY SL QQ   SSAVKRIP
Sbjct  255  DNYRDCIHTSMQTEYEGLQVCVGLFSKNSEYSPKEIERLDELYKSLGQQNGWSSAVKRIP  314

Query  154  LDFLKDEKFQEAAENYIRPLLTKGVPSL  237
            LDFL+ +KF++AA+NYIRPLLTKGVPSL
Sbjct  315  LDFLQGDKFKDAADNYIRPLLTKGVPSL  342



>gb|EMS52083.1| N-alpha-acetyltransferase 15, NatA auxiliary subunit [Triticum 
urartu]
Length=1034

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 68/89 (76%), Gaps = 10/89 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVK----------RI  150
            DNY+Y   +Q+C+ LYS++ +YS+D+++ L+ALY SL ++Y  SSAVK          RI
Sbjct  227  DNYKYLIAVQKCLGLYSENGHYSADDVERLSALYKSLKEEYSWSSAVKLNVIFSFVLTRI  286

Query  151  PLDFLKDEKFQEAAENYIRPLLTKGVPSL  237
            PLDFL+ EKFQEAA+NY+RPLLTKGVPSL
Sbjct  287  PLDFLEGEKFQEAADNYVRPLLTKGVPSL  315



>gb|EAY82679.1| hypothetical protein OsI_37895 [Oryza sativa Indica Group]
Length=210

 Score = 99.0 bits (245),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +1

Query  4    NYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQ  183
             +RY+  +Q+C+ LYS++  Y ++ +D L  LY SL ++Y  SSAVKR+PLDFL  EKFQ
Sbjct  52   TFRYFIAVQKCLGLYSENGQYCTN-VDRLCTLYISLKKEYGWSSAVKRMPLDFLGGEKFQ  110

Query  184  EAAENYIRPLLTKGVPSL  237
            EAA+NY+RPLLTKGVPSL
Sbjct  111  EAADNYVRPLLTKGVPSL  128



>ref|XP_001764313.1| predicted protein [Physcomitrella patens]
 gb|EDQ70867.1| predicted protein [Physcomitrella patens]
Length=920

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY YYEGLQ+C+ L S    Y+S++++ L  LY  L ++Y RS+A KRIPLDFL+++ F
Sbjct  256  DNYHYYEGLQKCLGLISDGKAYTSEQVEKLVKLYDDLREKYPRSAAAKRIPLDFLEEDAF  315

Query  181  QEAAENYIRPLLTKGVPSL  237
            + A   Y+RP L KGVPSL
Sbjct  316  KAAVSLYVRPFLKKGVPSL  334



>ref|XP_001783197.1| predicted protein [Physcomitrella patens]
 gb|EDQ51965.1| predicted protein [Physcomitrella patens]
Length=902

 Score = 90.5 bits (223),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY YYEGLQ+C+ L      Y+S++++ L  LY  L ++Y RS+A KRIPLDFL+++ F
Sbjct  256  DNYLYYEGLQKCLGLTPNGKAYTSEQVEKLVELYDGLRRKYPRSAAAKRIPLDFLEEDSF  315

Query  181  QEAAENYIRPLLTKGVPSL  237
            + A   YIRP L KGVPSL
Sbjct  316  KAAVTLYIRPFLKKGVPSL  334



>ref|XP_001776114.1| predicted protein [Physcomitrella patens]
 gb|EDQ59025.1| predicted protein [Physcomitrella patens]
Length=905

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 57/79 (72%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY YYEG+Q+C+ L      Y+S+++  L  +Y  L ++Y RS+A KRIPLDFL+++ F
Sbjct  256  DNYLYYEGVQKCLGLAPNGGIYTSEQVQKLEQVYNDLCKKYPRSAAAKRIPLDFLEEDAF  315

Query  181  QEAAENYIRPLLTKGVPSL  237
            + A E Y+RP+L KGVPSL
Sbjct  316  KAAFEQYVRPVLKKGVPSL  334



>ref|XP_005652238.1| N-terminal acetyltransferase A, auxiliary subunit [Coccomyxa 
subellipsoidea C-169]
 gb|EIE27694.1| N-terminal acetyltransferase A, auxiliary subunit [Coccomyxa 
subellipsoidea C-169]
Length=873

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLY-SKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEK  177
            DN++Y+EGL+  +KL    +  +S ++++ LA LY  L++QY RS+AV+RIPLDF  D+ 
Sbjct  260  DNHKYHEGLRAALKLAPDAEGQWSDEQLERLAELYDELAKQYPRSTAVQRIPLDFKVDKA  319

Query  178  FQEAAENYIRPLLTKGVPSL  237
            F+EAA+ Y+R  L KG+PSL
Sbjct  320  FEEAADAYVRRFLNKGIPSL  339



>ref|XP_009619830.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X2 [Nicotiana tomentosiformis]
Length=875

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/51 (67%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIP  153
            DNYRYYEGLQRC+ LYS++  Y++DEID L  LY +L+QQY+RSSAVK +P
Sbjct  255  DNYRYYEGLQRCLGLYSENGLYTADEIDRLETLYRALAQQYNRSSAVKGVP  305



>ref|XP_005827391.1| hypothetical protein GUITHDRAFT_158303 [Guillardia theta CCMP2712]
 gb|EKX40411.1| hypothetical protein GUITHDRAFT_158303 [Guillardia theta CCMP2712]
Length=706

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DNY+Y++GL    + Y+ D      + D L ++Y  LSQ + +S+A+KRIPLDFL  ++F
Sbjct  259  DNYQYHKGLLEA-RGYTDDVVAGGVKQDELVSIYRELSQMHPKSNAIKRIPLDFLTGDRF  317

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E+  +Y++P L KGVPSL
Sbjct  318  KESFSSYVKPFLRKGVPSL  336



>ref|XP_009778994.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like 
isoform X2 [Nicotiana sylvestris]
Length=876

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIP  153
            DNYRYYEGLQRC+ L S++  Y++DEID L  LY +L+QQY+RSSAVK +P
Sbjct  255  DNYRYYEGLQRCLGLCSENGQYTADEIDRLETLYRALAQQYNRSSAVKGVP  305



>ref|XP_008461048.1| PREDICTED: LOW QUALITY PROTEIN: N-alpha-acetyltransferase 16, 
NatA auxiliary subunit [Cucumis melo]
Length=887

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +1

Query  100  YTSLSQQYHRSSAVKRIPLDFLKDEKFQEAAENYIRPLLTKGVPSL  237
            + SL QQ   SSAVKRIPLDFL+ +KF++AA+NYIRPLLTKGVPSL
Sbjct  279  HKSLGQQNGWSSAVKRIPLDFLQGDKFKDAADNYIRPLLTKGVPSL  324



>gb|KFM28253.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Auxenochlorella 
protothecoides]
Length=802

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N++Y+ GL+  + L + D   ++++   L+ +Y  L +++ +S+A KRIPLDFL  E F
Sbjct  262  ENHQYHAGLRTALGLDTPDAQLTAEQRQRLSDIYARLQRKFPKSTAAKRIPLDFLTGEDF  321

Query  181  QEAAENYIRPLLTKGVPSL  237
            + A   Y+RP L +GVPSL
Sbjct  322  KTAIGAYVRPYLVRGVPSL  340



>gb|KDO58184.1| hypothetical protein CISIN_1g0453552mg, partial [Citrus sinensis]
Length=302

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVK  144
            DNY YYEGLQ+C+ LY  + NYSS EID L ALY SL+QQY  SSAVK
Sbjct  255  DNYSYYEGLQKCLGLYRDNGNYSSGEIDELDALYKSLAQQYTWSSAVK  302



>ref|XP_002961540.1| hypothetical protein SELMODRAFT_164833 [Selaginella moellendorffii]
 gb|EFJ36800.1| hypothetical protein SELMODRAFT_164833 [Selaginella moellendorffii]
Length=886

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DN  Y+E LQ+C+ +   D     D    L  LY  L  ++  S+  KR+PLDFL+ + F
Sbjct  257  DNTTYHESLQKCIGISQHDARTEEDTA-KLVLLYDDLRTKHPDSAVAKRMPLDFLEGDSF  315

Query  181  QEAAENYIRPLLTKGVPSL  237
            + A + YIRP L KGVPSL
Sbjct  316  RRALDKYIRPFLRKGVPSL  334



>ref|XP_002971274.1| hypothetical protein SELMODRAFT_94950 [Selaginella moellendorffii]
 gb|EFJ27872.1| hypothetical protein SELMODRAFT_94950 [Selaginella moellendorffii]
Length=887

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DN  Y+E LQ+C+ +   D     D    L  LY  L  ++  S+  KR+PLDFL+ + F
Sbjct  257  DNTTYHESLQKCIGISQHDARTEEDTA-KLVLLYDDLRTKHPDSAVAKRMPLDFLEGDSF  315

Query  181  QEAAENYIRPLLTKGVPSL  237
            + A + YIRP L KGVPSL
Sbjct  316  RRALDKYIRPFLRKGVPSL  334



>ref|XP_661232.1| hypothetical protein AN3628.2 [Aspergillus nidulans FGSC A4]
 gb|EAA59836.1| hypothetical protein AN3628.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF75743.1| TPA: N-terminal acetyltransferase catalytic subunit (NAT1), putative 
(AFU_orthologue; AFUA_4G11910) [Aspergillus nidulans 
FGSC A4]
Length=833

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 52/79 (66%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+GL +   +       SSD+  +L ALY S +++Y R  A +RIPLDFL+ + F
Sbjct  253  ENSLYYDGLIKAKGI-------SSDDHKALKALYDSWAEKYPRGDAPRRIPLDFLEGDDF  305

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA+ Y++ +L KGVPSL
Sbjct  306  KQAADAYLQRMLKKGVPSL  324



>ref|XP_007776702.1| hypothetical protein W97_00599 [Coniosporium apollinis CBS 100218]
 gb|EON61385.1| hypothetical protein W97_00599 [Coniosporium apollinis CBS 100218]
Length=843

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 49/79 (62%), Gaps = 5/79 (6%)
 Frame = +1

Query  1    DNYR-YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEK  177
            + YR YYEGL++ + L   D     D I  LA LY S + +  +  A +R+PLDFL+ E 
Sbjct  252  NEYRAYYEGLEKAMGLDRTD----DDSIPKLAELYESYAAKSEKVDAARRVPLDFLQGES  307

Query  178  FQEAAENYIRPLLTKGVPS  234
            F+ AA+ Y+R +L +G+PS
Sbjct  308  FKTAADRYLRSMLKRGIPS  326



>dbj|GAM41610.1| N-acetyltransferase complex subunit [Talaromyces cellulolyticus]
Length=838

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 48/79 (61%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+GL +   L   D         +L A+Y    +++ R  A +RIPLDFL+ + F
Sbjct  253  ENSHYYDGLIKAKGLADTDHQ-------ALKAVYDGFVEKFPRGDAPRRIPLDFLEGDDF  305

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EAA+NY++ +L KGVPSL
Sbjct  306  REAADNYLQRMLRKGVPSL  324



>gb|KFH65851.1| hypothetical protein MVEG_07954 [Mortierella verticillata NRRL 
6337]
Length=821

 Score = 62.0 bits (149),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DN+ Y+ GL++ V L ++D   +++E   +  L+  L  ++ RS+  KR+PL F   E F
Sbjct  242  DNFAYFSGLRKSVGLGNQDL--TAEEETKILELFKDLQTKHRRSNVAKRLPLGFATGETF  299

Query  181  QEAAENYIRPLLTKGVPSL  237
             + A++Y R +L KGVPSL
Sbjct  300  VKVADDYCRVMLRKGVPSL  318



>ref|XP_003300018.1| hypothetical protein PTT_11155 [Pyrenophora teres f. teres 0-1]
 gb|EFQ91876.1| hypothetical protein PTT_11155 [Pyrenophora teres f. teres 0-1]
Length=1323

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 49/74 (66%), Gaps = 4/74 (5%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            Y++GL++ + L   D +  +D I+ L+ LY S +++  R+ A +RIPLDFLK E F+   
Sbjct  257  YFDGLEKALGL---DRSNPAD-IEKLSELYESFAEKNERNDAARRIPLDFLKGEAFKTKV  312

Query  193  ENYIRPLLTKGVPS  234
            + Y+R +L KGVPS
Sbjct  313  DQYLRRMLNKGVPS  326



>gb|EYE92694.1| putative N-terminal acetyltransferase catalytic subunit Nat1 
[Aspergillus ruber CBS 135680]
Length=834

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 48/79 (61%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+ L R   +       S D+  +L A+Y S + +Y R  A +RIPLDFL+ E F
Sbjct  253  ENSIYYDALIRAKGI-------SEDDHKALKAVYDSWANKYPRGDAARRIPLDFLEGEDF  305

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++A + Y++ +L KGVPSL
Sbjct  306  KQAVDAYLQRMLKKGVPSL  324



>emb|CCG84078.1| protein of unknown function [Taphrina deformans PYCC 5710]
Length=827

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            D +RYY GL+  +  Y  D +  +++    +  Y+ L + Y ++SA +R PLD+L  + F
Sbjct  260  DCHRYYAGLEVALG-YRTDSSIKNEQTQQASETYSELQKLYPKASAPRRRPLDWLSGDDF  318

Query  181  QEAAENYIRPLLTKGVPS  234
            Q+AA+ Y+R LL KGVPS
Sbjct  319  QQAADKYLRHLLQKGVPS  336



>ref|XP_007581597.1| putative n-terminal acetyltransferase catalytic subunit protein 
[Neofusicoccum parvum UCRNP2]
 gb|EOD50936.1| putative n-terminal acetyltransferase catalytic subunit protein 
[Neofusicoccum parvum UCRNP2]
Length=813

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 4/74 (5%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY+GL++ + L         ++ D L  LY S +++  R  A  RIPLDFL+ +KF+ AA
Sbjct  257  YYDGLEKSLSL----DRSKPEDADKLVELYKSYAEKNSRHDAPHRIPLDFLEGDKFRTAA  312

Query  193  ENYIRPLLTKGVPS  234
            + Y+R +L+KGVPS
Sbjct  313  DGYLRRMLSKGVPS  326



>gb|EMD91535.1| hypothetical protein COCHEDRAFT_1136173 [Bipolaris maydis C5]
Length=821

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 7/80 (9%)
 Frame = +1

Query  1    DNYR-YYEGLQRCVKLYSKDCNYSSD-EIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDE  174
            + YR Y+EGL++ + L     + S+D +I+ L  LY S + +  R+ A +RIPLDFL+ E
Sbjct  238  NEYRGYFEGLEKALGL-----DRSNDADIEKLNELYQSFASKNERNDAARRIPLDFLQGE  292

Query  175  KFQEAAENYIRPLLTKGVPS  234
             F+   + Y+R +L KGVPS
Sbjct  293  AFKTQVDQYLRRMLNKGVPS  312



>ref|XP_002151347.1| acetyltransferase catalytic subunit (NAT1), putative [Talaromyces 
marneffei ATCC 18224]
 gb|EEA20347.1| acetyltransferase catalytic subunit (NAT1), putative [Talaromyces 
marneffei ATCC 18224]
Length=838

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 49/79 (62%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+GL +   L   D         +L A+Y  L +++ R  A +RIPLDFL+ + F
Sbjct  253  ENSHYYDGLIKAKGLAESDHQ-------ALKAVYDELVEKFPRGDAPRRIPLDFLEGDDF  305

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA++Y++ +L KGVPSL
Sbjct  306  KKAADSYLQRMLRKGVPSL  324



>gb|KFX47578.1| N-terminal acetyltransferase A complex subunit nat1 [Talaromyces 
marneffei PM1]
Length=838

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 49/79 (62%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+GL +   L   D         +L A+Y  L +++ R  A +RIPLDFL+ + F
Sbjct  253  ENSHYYDGLIKAKGLAESDHQ-------ALKAVYDELVEKFPRGDAPRRIPLDFLEGDDF  305

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA++Y++ +L KGVPSL
Sbjct  306  KKAADSYLQRMLRKGVPSL  324



>ref|XP_003856861.1| hypothetical protein MYCGRDRAFT_67635 [Zymoseptoria tritici IPO323]
 gb|EGP91837.1| hypothetical protein MYCGRDRAFT_67635 [Zymoseptoria tritici IPO323]
Length=854

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY+GL++ + L   D   S D+ + L  LY S + +  R  A +RIPLDFL  E F+  A
Sbjct  259  YYQGLEKALSL---DREKSEDQ-EKLKELYQSFADKSQRLDAARRIPLDFLHGEAFRTHA  314

Query  193  ENYIRPLLTKGVPS  234
            + Y+R + TKGVPS
Sbjct  315  DTYLRRMFTKGVPS  328



>gb|KEQ64006.1| N-terminal acetyltransferase A, auxiliary subunit [Aureobasidium 
melanogenum CBS 110374]
Length=724

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 46/74 (62%), Gaps = 4/74 (5%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY+GL++C+ L   D    +  +D    LY S +++  R  A +R+PLDFL+ + F+EAA
Sbjct  257  YYDGLEKCLGLDRNDSTAHTQLLD----LYKSFAEKSERIDAPRRVPLDFLQGDAFREAA  312

Query  193  ENYIRPLLTKGVPS  234
            + Y+  +  KGVPS
Sbjct  313  DAYLTRVFRKGVPS  326



>gb|EUN23538.1| hypothetical protein COCVIDRAFT_108560 [Bipolaris victoriae FI3]
Length=1326

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 7/80 (9%)
 Frame = +1

Query  1    DNYR-YYEGLQRCVKLYSKDCNYSSD-EIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDE  174
            + YR Y+EGL++ + L     + S+D +I+ L  LY S + +  R+ A +RIPLDFL+ E
Sbjct  252  NEYRAYFEGLEKALGL-----DRSNDADIEKLNELYQSFASKNERNDAARRIPLDFLQGE  306

Query  175  KFQEAAENYIRPLLTKGVPS  234
             F+   + Y+R +L KGVPS
Sbjct  307  AFKTQVDQYLRRMLNKGVPS  326



>ref|XP_007715320.1| hypothetical protein COCCADRAFT_104114 [Bipolaris zeicola 26-R-13]
 gb|EUC30373.1| hypothetical protein COCCADRAFT_104114 [Bipolaris zeicola 26-R-13]
Length=1326

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 7/80 (9%)
 Frame = +1

Query  1    DNYR-YYEGLQRCVKLYSKDCNYSSD-EIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDE  174
            + YR Y+EGL++ + L     + S+D +I+ L  LY S + +  R+ A +RIPLDFL+ E
Sbjct  252  NEYRAYFEGLEKALGL-----DRSNDADIEKLNELYQSFASKNERNDAARRIPLDFLQGE  306

Query  175  KFQEAAENYIRPLLTKGVPS  234
             F+   + Y+R +L KGVPS
Sbjct  307  AFKTQVDQYLRRMLNKGVPS  326



>ref|XP_007702905.1| hypothetical protein COCSADRAFT_173919 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD61601.1| hypothetical protein COCSADRAFT_173919 [Bipolaris sorokiniana 
ND90Pr]
Length=1326

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 7/80 (9%)
 Frame = +1

Query  1    DNYR-YYEGLQRCVKLYSKDCNYSSD-EIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDE  174
            + YR Y+EGL++ + L     + S+D +I+ L  LY S + +  R+ A +RIPLDFL+ E
Sbjct  252  NEYRGYFEGLEKALGL-----DRSNDADIEKLNELYQSFASKNERNDAARRIPLDFLQGE  306

Query  175  KFQEAAENYIRPLLTKGVPS  234
             F+   + Y+R +L KGVPS
Sbjct  307  AFKTQVDQYLRRMLNKGVPS  326



>gb|ENI08708.1| hypothetical protein COCC4DRAFT_128211 [Bipolaris maydis ATCC 
48331]
Length=1326

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 7/80 (9%)
 Frame = +1

Query  1    DNYR-YYEGLQRCVKLYSKDCNYSSD-EIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDE  174
            + YR Y+EGL++ + L     + S+D +I+ L  LY S + +  R+ A +RIPLDFL+ E
Sbjct  252  NEYRGYFEGLEKALGL-----DRSNDADIEKLNELYQSFASKNERNDAARRIPLDFLQGE  306

Query  175  KFQEAAENYIRPLLTKGVPS  234
             F+   + Y+R +L KGVPS
Sbjct  307  AFKTQVDQYLRRMLNKGVPS  326



>ref|XP_002341635.1| acetyltransferase catalytic subunit (NAT1), putative [Talaromyces 
stipitatus ATCC 10500]
 gb|EED24248.1| acetyltransferase catalytic subunit (NAT1), putative [Talaromyces 
stipitatus ATCC 10500]
Length=838

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 48/79 (61%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+GL +   L   D         +L A+Y    +++ R  A +RIPLDFL+ ++F
Sbjct  253  ENSHYYDGLIKAKGLVDTDHK-------ALKAVYDGFVEKFPRGDAPRRIPLDFLEGDEF  305

Query  181  QEAAENYIRPLLTKGVPSL  237
            +EA ++Y++ +L KGVPSL
Sbjct  306  REAVDSYLQRMLRKGVPSL  324



>ref|XP_001272049.1| N-terminal acetyltransferase catalytic subunit (NAT1), putative 
[Aspergillus clavatus NRRL 1]
 gb|EAW10623.1| N-terminal acetyltransferase catalytic subunit (NAT1), putative 
[Aspergillus clavatus NRRL 1]
Length=842

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 49/79 (62%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  Y++GL R   +   D         +L A+Y + + ++ R  A +RIPLDFL+ E+F
Sbjct  253  ENSIYFDGLIRAKGISGGDHK-------ALKAVYDTWADKHPRGDASRRIPLDFLEGEEF  305

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA+ Y++ +L KGVPSL
Sbjct  306  KQAADAYLQRMLKKGVPSL  324



>gb|KDO58185.1| hypothetical protein CISIN_1g0453551mg, partial [Citrus sinensis]
Length=598

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  145  RIPLDFLKDEKFQEAAENYIRPLLTKGVPSL  237
            RIPLDFL+ EKF+EAA NY+RPLLTKGVPSL
Sbjct  1    RIPLDFLQGEKFREAAFNYVRPLLTKGVPSL  31



>ref|XP_002946235.1| hypothetical protein VOLCADRAFT_55571 [Volvox carteri f. nagariensis]
 gb|EFJ53230.1| hypothetical protein VOLCADRAFT_55571 [Volvox carteri f. nagariensis]
Length=760

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 35/82 (43%), Positives = 52/82 (63%), Gaps = 3/82 (4%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLY--SKDCNYSSDEID-SLAALYTSLSQQYHRSSAVKRIPLDFLKD  171
            +NY+ ++GL+  ++L   S+     +DE   SL +LY  L  Q+  SSA +RIPLDF   
Sbjct  266  NNYKIHDGLRAAMELVPTSESGGVLTDEQRASLTSLYDELQSQFPGSSACRRIPLDFKVG  325

Query  172  EKFQEAAENYIRPLLTKGVPSL  237
            + F+ AA+ Y+R  LT+GVPSL
Sbjct  326  DAFKAAADMYLRVGLTRGVPSL  347



>ref|XP_008030371.1| hypothetical protein SETTUDRAFT_156902 [Setosphaeria turcica 
Et28A]
 gb|EOA82031.1| hypothetical protein SETTUDRAFT_156902 [Setosphaeria turcica 
Et28A]
Length=1333

 Score = 59.3 bits (142),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 4/74 (5%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            Y+EGL++ + L   D +  +D I+ L  LY S + +  R+ A +RIPLDFL+ E F+   
Sbjct  257  YFEGLEKSLGL---DRSNGAD-IEKLNELYQSFADKNERNDAARRIPLDFLQGEAFKTQV  312

Query  193  ENYIRPLLTKGVPS  234
            + Y+R +L KGVPS
Sbjct  313  DQYLRRMLNKGVPS  326



>gb|KFH72316.1| hypothetical protein MVEG_02607 [Mortierella verticillata NRRL 
6337]
Length=835

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DN+ Y++GL + + L S D     D+I  L  L   L ++Y RS+  KR+PL F   E+F
Sbjct  252  DNFAYFDGLLKSLGL-SADKLSDEDQIKVLDML-KDLQKEYPRSNVAKRLPLKFATGERF  309

Query  181  QEAAENYIRPLLTKGVPSL  237
             + A+ Y+R +L KGVPSL
Sbjct  310  DKIADEYLRNMLRKGVPSL  328



>ref|XP_001931274.1| NMDA receptor-regulated protein 1 [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU40379.1| NMDA receptor-regulated protein 1 [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=832

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 4/74 (5%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            Y++GL++ + L   D +  +D I  L  LY SL+ +  R+ A +RIPLDFL+ E F+   
Sbjct  257  YFDGLEKALGL---DRSNPAD-IGKLNELYKSLADKNERNDAARRIPLDFLEGEAFKTQV  312

Query  193  ENYIRPLLTKGVPS  234
            + Y+R +L KGVPS
Sbjct  313  DQYLRRMLNKGVPS  326



>ref|XP_751639.1| N-terminal acetyltransferase catalytic subunit (NAT1) [Aspergillus 
fumigatus Af293]
 gb|EAL89601.1| N-terminal acetyltransferase catalytic subunit (NAT1), putative 
[Aspergillus fumigatus Af293]
 gb|EDP50554.1| N-terminal acetyltransferase catalytic subunit (NAT1), putative 
[Aspergillus fumigatus A1163]
 gb|KEY82140.1| acetyltransferase catalytic subunit NAT1 [Aspergillus fumigatus 
var. RP-2014]
Length=841

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 48/79 (61%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+GL R   +   D         +L A Y + + ++ R  A +RIPLDFL+ E+F
Sbjct  253  ENSIYYDGLIRAKGISESDHA-------ALKAFYDAWADKHPRGDAPRRIPLDFLEGEEF  305

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA+ Y++ +L KGVPSL
Sbjct  306  KQAADAYLQRMLKKGVPSL  324



>ref|XP_008768346.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Rattus norvegicus]
 ref|XP_008769148.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Rattus norvegicus]
Length=372

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 49/79 (62%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         +D    +Y  +S+Q+ R+ + +R+PL+F+  +KF
Sbjct  256  ENWCYYEGLEKALQLRS---------LDERLQIYEEISKQHPRAVSPRRLPLNFVPGKKF  306

Query  181  QEAAENYIRPLLTKGVPSL  237
            QE  + ++RP  +KG P L
Sbjct  307  QELMDKFLRPNFSKGCPPL  325



>gb|KGO37925.1| N-terminal acetyltransferase A, auxiliary subunit [Penicillium 
expansum]
 gb|KGO49724.1| N-terminal acetyltransferase A, auxiliary subunit [Penicillium 
expansum]
 gb|KGO72621.1| N-terminal acetyltransferase A, auxiliary subunit [Penicillium 
expansum]
Length=834

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 46/79 (58%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DN  YY GL +   +   D         +L ALY    ++  R  A +RIPLDFL+ E+F
Sbjct  254  DNSIYYNGLIKAKAIPESDHK-------ALKALYDEWVEKNPRCDAARRIPLDFLEGEEF  306

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA+ Y++ +L KGVPSL
Sbjct  307  KQAADTYLQRMLKKGVPSL  325



>ref|XP_007687953.1| hypothetical protein COCMIDRAFT_95248 [Bipolaris oryzae ATCC 
44560]
 gb|EUC45560.1| hypothetical protein COCMIDRAFT_95248 [Bipolaris oryzae ATCC 
44560]
Length=1326

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (64%), Gaps = 7/80 (9%)
 Frame = +1

Query  1    DNYR-YYEGLQRCVKLYSKDCNYSSD-EIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDE  174
            + YR Y+EGL++ + L     + S+D +I+ L  LY S + +  R+ A +RIPLDFL+ E
Sbjct  252  NEYRGYFEGLEKSLGL-----DRSNDADIEKLDELYQSFASKNERNDAARRIPLDFLQGE  306

Query  175  KFQEAAENYIRPLLTKGVPS  234
             F+   + Y+R ++ KGVPS
Sbjct  307  AFKTQVDQYLRRMMNKGVPS  326



>ref|XP_006989621.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Peromyscus maniculatus bairdii]
Length=879

 Score = 58.5 bits (140),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 49/79 (62%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+RYYEGL++ ++L S D             +Y  +S+Q+ R+ + +R+PL+F+  +KF
Sbjct  276  ENWRYYEGLEKALQLRSSD---------ERLQIYEEISKQHPRAVSPRRLPLNFVPGKKF  326

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++RP  +KG P L
Sbjct  327  RELMDKFLRPNFSKGCPPL  345



>ref|XP_008768342.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Rattus norvegicus]
 ref|XP_008769147.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Rattus norvegicus]
Length=530

 Score = 58.2 bits (139),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 49/79 (62%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         +D    +Y  +S+Q+ R+ + +R+PL+F+  +KF
Sbjct  256  ENWCYYEGLEKALQLRS---------LDERLQIYEEISKQHPRAVSPRRLPLNFVPGKKF  306

Query  181  QEAAENYIRPLLTKGVPSL  237
            QE  + ++RP  +KG P L
Sbjct  307  QELMDKFLRPNFSKGCPPL  325



>emb|CCE28363.1| related to acetyltransferase 1 [Claviceps purpurea 20.1]
Length=726

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 47/78 (60%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            D+  YYE L   +++  +D       I++  A+Y   ++++ R  A +RIPLDFL  + F
Sbjct  253  DHTEYYEQLAVALQISEQD-------IEARKAMYDEYAKKFPRCDAARRIPLDFLSGDAF  305

Query  181  QEAAENYIRPLLTKGVPS  234
            +EAA+ Y+  +L KGVPS
Sbjct  306  KEAADTYLTSMLNKGVPS  323



>ref|XP_001073064.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Rattus norvegicus]
 ref|XP_003751565.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Rattus norvegicus]
 gb|EDM02352.1| rCG36843 [Rattus norvegicus]
Length=864

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 49/79 (62%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         +D    +Y  +S+Q+ R+ + +R+PL+F+  +KF
Sbjct  256  ENWCYYEGLEKALQLRS---------LDERLQIYEEISKQHPRAVSPRRLPLNFVPGKKF  306

Query  181  QEAAENYIRPLLTKGVPSL  237
            QE  + ++RP  +KG P L
Sbjct  307  QELMDKFLRPNFSKGCPPL  325



>gb|KGO64590.1| N-terminal acetyltransferase A, auxiliary subunit [Penicillium 
italicum]
Length=834

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 46/79 (58%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DN  YY GL +   +   D         +L ALY    ++  R  A +RIPLDFL+ E F
Sbjct  254  DNSIYYNGLIKAKAIPESDHK-------ALKALYDEWVEKNPRCDAARRIPLDFLEGEDF  306

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA++Y++ +L KGVPSL
Sbjct  307  KQAADSYLQRMLKKGVPSL  325



>gb|EME49545.1| hypothetical protein DOTSEDRAFT_68353 [Dothistroma septosporum 
NZE10]
Length=765

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 48/74 (65%), Gaps = 4/74 (5%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            Y+EGL++ + L   D   + D+ + L  +Y S + Q  R+ A +RIPLDFL  E F++ A
Sbjct  257  YFEGLEKTLGL---DREKAEDQ-EKLREIYQSYADQSQRNDAARRIPLDFLHGEAFRKHA  312

Query  193  ENYIRPLLTKGVPS  234
            ++Y+R + ++GVPS
Sbjct  313  DSYLRRMFSRGVPS  326



>gb|EMF17187.1| N-terminal acetyltransferase A, auxiliary subunit [Sphaerulina 
musiva SO2202]
Length=750

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 4/74 (5%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY GL+  + L   D   S D  + L A+Y S + +  R+ A +RIPLDFL+ + F++ A
Sbjct  257  YYHGLEAALGL---DRTKSEDH-EKLLAVYQSFADKSSRTDAARRIPLDFLRGDAFRQHA  312

Query  193  ENYIRPLLTKGVPS  234
            ++Y+R  L KGVPS
Sbjct  313  DSYLRRALAKGVPS  326



>gb|EKV07373.1| NH2-terminal acetyltransferase catalytic subunit (NAT1), putative 
[Penicillium digitatum PHI26]
 gb|EKV14586.1| NH2-terminal acetyltransferase catalytic subunit (NAT1), putative 
[Penicillium digitatum Pd1]
Length=834

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 45/79 (57%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DN  YY GL +   +   D         +L ALY    ++  R  A +RIPLDFL+ E F
Sbjct  254  DNSIYYNGLIKAKGIPDSDHK-------ALKALYDEWVERNPRCDAARRIPLDFLEGEDF  306

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA+ Y++ +L KGVPSL
Sbjct  307  KQAADTYLQRMLKKGVPSL  325



>gb|KFX99908.1| hypothetical protein O988_03603 [Pseudogymnoascus pannorum VKM 
F-3808]
Length=734

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 47/75 (63%), Gaps = 7/75 (9%)
 Frame = +1

Query  10   RYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEA  189
            +YY+GL   +       N  S     L A+Y   +++Y RS + +R+PLDFL+ ++F++A
Sbjct  256  KYYDGLAAAL-------NIESSNHKELKAIYDEYAEKYPRSDSARRLPLDFLEGDEFRKA  308

Query  190  AENYIRPLLTKGVPS  234
            A++Y+  +L KGVPS
Sbjct  309  ADSYVHRMLDKGVPS  323



>ref|XP_001389144.1| N-terminal acetyltransferase A complex subunit nat1 [Aspergillus 
niger CBS 513.88]
 emb|CAK43839.1| unnamed protein product [Aspergillus niger]
Length=833

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 50/79 (63%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+ L R     +KD    SD+  +  A+Y S  +++ R  A +RIPLDFL+ + F
Sbjct  253  ENSLYYDALVR-----AKDI--PSDDHKAKKAVYDSWVEKFPRGDAARRIPLDFLEGDDF  305

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA+ Y++ +L KGVPSL
Sbjct  306  KQAADAYLQRMLKKGVPSL  324



>ref|XP_001266841.1| N-terminal acetyltransferase catalytic subunit (NAT1), putative 
[Neosartorya fischeri NRRL 181]
 gb|EAW24944.1| N-terminal acetyltransferase catalytic subunit (NAT1), putative 
[Neosartorya fischeri NRRL 181]
Length=865

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 47/79 (59%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+GL R   +   D         +L A Y + + +  R  A +RIPLDFL+ E+F
Sbjct  277  ENSIYYDGLIRAKGISESDHA-------ALKAFYDAWADKNPRGDAPRRIPLDFLEGEEF  329

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA+ Y++ +L KGVPSL
Sbjct  330  KQAADAYLQRMLKKGVPSL  348



>gb|EHA26605.1| hypothetical protein ASPNIDRAFT_51888 [Aspergillus niger ATCC 
1015]
Length=833

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 50/79 (63%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+ L R     +KD    SD+  +  A+Y S  +++ R  A +RIPLDFL+ + F
Sbjct  253  ENSLYYDALVR-----AKDI--PSDDHKAKKAVYDSWVEKFPRGDAARRIPLDFLEGDDF  305

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA+ Y++ +L KGVPSL
Sbjct  306  KQAADAYLQRMLKKGVPSL  324



>gb|EKG19312.1| Tetratricopeptide TPR-1 [Macrophomina phaseolina MS6]
Length=766

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 47/74 (64%), Gaps = 4/74 (5%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY+GL++ + L         ++ D L  LY   +++  R  A +RIPLDFL+ +KF+ AA
Sbjct  210  YYDGLEKSLGL----DRSKPEDADKLIELYKIYAEKNPRYDAPRRIPLDFLEGDKFRTAA  265

Query  193  ENYIRPLLTKGVPS  234
            + Y+R +L+KGVPS
Sbjct  266  DGYLRYMLSKGVPS  279



>dbj|BAE58130.1| unnamed protein product [Aspergillus oryzae RIB40]
Length=736

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+ L R   +   D         +L A+Y S  ++  R  A +RIPLDFL+ E F
Sbjct  253  ENSMYYDALIRAKGIPDNDHK-------ALKAVYDSWVEKNPRGDAPRRIPLDFLEGEDF  305

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA+ Y++ +L KGVPSL
Sbjct  306  KQAADAYLQRMLKKGVPSL  324



>ref|XP_003388065.1| PREDICTED: n-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Amphimedon queenslandica]
Length=905

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+ L+ C+       N S+DE  +   LY  L +++ RS   +++PL FLK   F
Sbjct  258  ENLMYYQKLEECL-------NISNDE--NRMELYRVLKEEFPRSHVCRKVPLGFLKGPAF  308

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++  + Y+RP L KGVPSL
Sbjct  309  RDMIDQYLRPPLHKGVPSL  327



>ref|XP_002374303.1| N-terminal acetyltransferase catalytic subunit Nat1, putative 
[Aspergillus flavus NRRL3357]
 ref|XP_001820132.2| N-terminal acetyltransferase A complex subunit nat1 [Aspergillus 
oryzae RIB40]
 gb|EED55521.1| N-terminal acetyltransferase catalytic subunit Nat1, putative 
[Aspergillus flavus NRRL3357]
 gb|EIT80857.1| nitrogen terminal acetyltransferase [Aspergillus oryzae 3.042]
 gb|KDE79314.1| N-terminal acetyltransferase [Aspergillus oryzae 100-8]
Length=834

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+ L R   +   D         +L A+Y S  ++  R  A +RIPLDFL+ E F
Sbjct  253  ENSMYYDALIRAKGIPDNDHK-------ALKAVYDSWVEKNPRGDAPRRIPLDFLEGEDF  305

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA+ Y++ +L KGVPSL
Sbjct  306  KQAADAYLQRMLKKGVPSL  324



>gb|KFY43335.1| hypothetical protein V495_03997 [Pseudogymnoascus pannorum VKM 
F-4514 (FW-929)]
 gb|KFY54322.1| hypothetical protein V497_07815 [Pseudogymnoascus pannorum VKM 
F-4516 (FW-969)]
Length=734

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 45/75 (60%), Gaps = 7/75 (9%)
 Frame = +1

Query  10   RYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEA  189
            +YY+GL   +       N  S     L A+Y   +++Y RS + +R+PLDFL  ++F+ A
Sbjct  256  KYYDGLAAAL-------NIESSNHKELKAIYDEYAEKYPRSDSARRLPLDFLDGDEFRTA  308

Query  190  AENYIRPLLTKGVPS  234
            A++Y+  +L KGVPS
Sbjct  309  ADSYVHRMLDKGVPS  323



>gb|EFX02154.1| n-terminal acetyltransferase catalytic subunit [Grosmannia clavigera 
kw1407]
Length=793

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 46/79 (58%), Gaps = 3/79 (4%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DN +YYEGL + + L     + S +   +  A+    S +Y RS A  R+PL+FL  + F
Sbjct  256  DNSKYYEGLVQTLGLAD---DQSPEATATRLAVLDEYSAKYPRSDAPHRLPLNFLTGDLF  312

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E A  Y+ P+L KG+PSL
Sbjct  313  KERARKYLFPMLDKGIPSL  331



>ref|XP_007671886.1| hypothetical protein BAUCODRAFT_29060 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMD00702.1| hypothetical protein BAUCODRAFT_29060 [Baudoinia compniacensis 
UAMH 10762]
Length=863

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 4/74 (5%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YYEGL+R + L   +     D+ + L  +Y   + Q  R  A +RIPLDF + + F+  A
Sbjct  260  YYEGLERALGLDRSN----GDDHEKLGEMYHGWAMQSDRIDAARRIPLDFKQGDAFRSHA  315

Query  193  ENYIRPLLTKGVPS  234
            + Y+R +  KGVPS
Sbjct  316  DKYLRRMFKKGVPS  329



>ref|XP_002622317.1| N-terminal acetyltransferase catalytic subunit [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ72276.1| N-terminal acetyltransferase catalytic subunit [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ85612.1| N-terminal acetyltransferase catalytic subunit [Blastomyces dermatitidis 
ER-3]
 gb|EQL34471.1| acetyltransferase [Blastomyces dermatitidis ATCC 26199]
Length=845

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 50/78 (64%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YYE L     + +KD + S  +  +L A++   +++  R  A +RIPLDFL+ + F
Sbjct  254  ENSNYYEAL-----IKAKDIDKSDHK--TLKAIFDEWAEKNPRGDAARRIPLDFLEGQDF  306

Query  181  QEAAENYIRPLLTKGVPS  234
            ++AA+NY++ +L +G+PS
Sbjct  307  RDAADNYLQRMLRRGIPS  324



>gb|EGE82618.1| N-terminal acetyltransferase catalytic subunit [Blastomyces dermatitidis 
ATCC 18188]
Length=845

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 50/78 (64%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YYE L     + +KD + S  +  +L A++   +++  R  A +RIPLDFL+ + F
Sbjct  254  ENSNYYEAL-----IKAKDIDKSDHK--TLKAIFDEWAEKNPRGDAARRIPLDFLEGQDF  306

Query  181  QEAAENYIRPLLTKGVPS  234
            ++AA+NY++ +L +G+PS
Sbjct  307  RDAADNYLQRMLRRGIPS  324



>gb|KFX91531.1| hypothetical protein V490_05862 [Pseudogymnoascus pannorum VKM 
F-3557]
Length=734

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 7/75 (9%)
 Frame = +1

Query  10   RYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEA  189
            +YY+GL   +       N  S     L A+Y   +++Y RS + +R+PLDFL+ ++F++A
Sbjct  256  KYYDGLAAAL-------NIESSNHKELKAIYDEYAEKYPRSDSARRLPLDFLEGDEFRKA  308

Query  190  AENYIRPLLTKGVPS  234
            A++Y   +L KGVPS
Sbjct  309  ADSYAHRMLDKGVPS  323



>gb|KFG86638.1| putative acetyltransferase catalytic subunit (NAT1) [Metarhizium 
anisopliae]
Length=673

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            D+  YYE L   +K+       S +   +  ALY   ++++ R  A KRIPLDFL  ++F
Sbjct  253  DHAVYYEKLASALKI-------SQNGSTARKALYDEYAEKFPRCDAAKRIPLDFLSGDEF  305

Query  181  QEAAENYIRPLLTKGVPS  234
             +AAE Y+  +L KGVPS
Sbjct  306  NQAAEAYLTLMLNKGVPS  323



>gb|KID62786.1| Alpha-acetyltransferase 15, NatA, partial [Metarhizium anisopliae 
ARSEF 549]
Length=726

 Score = 55.5 bits (132),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            D+  YYE L   +K+       S +   +  ALY   ++++ R  A KRIPLDFL  ++F
Sbjct  253  DHAVYYEKLASALKI-------SQNGSTARKALYDEYAEKFPRCDAAKRIPLDFLSGDEF  305

Query  181  QEAAENYIRPLLTKGVPS  234
             +AAE Y+  +L KGVPS
Sbjct  306  NQAAEAYLTLMLNKGVPS  323



>emb|CDM36831.1| N-terminal acetyltransferase A, auxiliary subunit [Penicillium 
roqueforti FM164]
Length=834

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 48/79 (61%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DN  YY GL     + +KD   S  +  +L ALY    ++  R  A +RIPLDFL+ + F
Sbjct  254  DNSIYYNGL-----IKAKDIPESDHK--ALKALYDEWVKKNPRCDAARRIPLDFLEGDDF  306

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA+ Y++ +L KGVPSL
Sbjct  307  KQAADIYLQRMLKKGVPSL  325



>ref|XP_007816465.1| acetyltransferase catalytic subunit (NAT1), putative [Metarhizium 
robertsii ARSEF 23]
Length=673

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            D+  YYE L   +K+       S +   +  ALY   ++++ R  A KRIPLDFL  ++F
Sbjct  253  DHAVYYEKLASALKI-------SQNGSRARKALYDEYAEKFPRCDAAKRIPLDFLSGDEF  305

Query  181  QEAAENYIRPLLTKGVPS  234
             +AAE Y+  +L KGVPS
Sbjct  306  NQAAEAYLTLMLNKGVPS  323



>dbj|GAA83625.1| N-terminal acetyltransferase catalytic subunit Nat1 [Aspergillus 
kawachii IFO 4308]
Length=833

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 48/79 (61%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+ L R   +        SD+  +  A+Y S  +++ R  A +RIPL+FL+ + F
Sbjct  253  ENSLYYDALVRAKGI-------PSDDHKAKKAVYDSWVEKFPRGDAARRIPLEFLEGDDF  305

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA+ Y++ +L KGVPSL
Sbjct  306  KQAADAYLQRMLKKGVPSL  324



>ref|XP_003836201.1| similar to N-alpha-acetyltransferase 15 [Leptosphaeria maculans 
JN3]
 emb|CBX92836.1| similar to N-alpha-acetyltransferase 15 [Leptosphaeria maculans 
JN3]
Length=836

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 4/74 (5%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY GL+  + L       +  +++ L  LY S + +  R+ A +RIPLDFLK + F++AA
Sbjct  257  YYHGLEEVLGL----SQSNEADVEKLTELYKSYADKNKRNDAARRIPLDFLKGDAFRQAA  312

Query  193  ENYIRPLLTKGVPS  234
            + Y+R  L KGV S
Sbjct  313  DEYLRAKLNKGVFS  326



>gb|EXV01123.1| N-terminal acetyltransferase A, auxiliary subunit [Metarhizium 
robertsii]
 gb|EFZ03202.2| Protein prenyltransferase [Metarhizium robertsii ARSEF 23]
Length=726

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            D+  YYE L   +K+       S +   +  ALY   ++++ R  A KRIPLDFL  ++F
Sbjct  253  DHAVYYEKLASALKI-------SQNGSRARKALYDEYAEKFPRCDAAKRIPLDFLSGDEF  305

Query  181  QEAAENYIRPLLTKGVPS  234
             +AAE Y+  +L KGVPS
Sbjct  306  NQAAEAYLTLMLNKGVPS  323



>gb|KID99476.1| Alpha-acetyltransferase 15, NatA, partial [Metarhizium majus 
ARSEF 297]
Length=726

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            D+  YYE L   +K+       S +   +  ALY   ++++ R  A KRIPLDFL  ++F
Sbjct  253  DHAVYYEKLASALKI-------SQNGSRARKALYDEYAEKFPRCDAAKRIPLDFLSGDEF  305

Query  181  QEAAENYIRPLLTKGVPS  234
             +AAE Y+  +L KGVPS
Sbjct  306  NQAAEAYLTLMLNKGVPS  323



>ref|XP_003349438.1| hypothetical protein SMAC_03026 [Sordaria macrospora k-hell]
 emb|CCC09148.1| unnamed protein product [Sordaria macrospora k-hell]
Length=734

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 7/75 (9%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YYEGL   +++  KD          L A+Y   + +Y RS A KR+PL+FL  + F+ AA
Sbjct  257  YYEGLIEALEIDEKDEA-------GLKAIYDEYAAKYPRSDAAKRLPLNFLTGDSFKAAA  309

Query  193  ENYIRPLLTKGVPSL  237
            ++Y+  +L +GVPS+
Sbjct  310  KSYLTNMLDRGVPSV  324



>ref|XP_008592012.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit-like, 
partial [Galeopterus variegatus]
Length=220

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         ++    +Y  +S+Q+ R+ + +R+PL+ +  EKF
Sbjct  129  ENWYYYEGLEKALQLSSLGPFLPHGTLEERLQIYEEISKQHPRAISPRRLPLNLVPGEKF  188

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++R   +KG P L
Sbjct  189  RELMDKFLRVNFSKGCPPL  207



>gb|EPS33590.1| hypothetical protein PDE_08552 [Penicillium oxalicum 114-2]
Length=829

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 47/79 (59%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY GL +   +       ++D+  +L +LY    ++  R  A +RIPLDFL+ E F
Sbjct  253  ENSIYYNGLIQAKGI-------AADDHKALKSLYDEWVEKNPRGDAARRIPLDFLEGEDF  305

Query  181  QEAAENYIRPLLTKGVPSL  237
            + AA+ Y++ +L KGVPSL
Sbjct  306  KAAADVYLQRMLKKGVPSL  324



>gb|KEQ75459.1| N-terminal acetyltransferase A, auxiliary subunit [Aureobasidium 
pullulans var. namibiae CBS 147.97]
Length=724

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY+GL++ + L   D    +  +D    LY S +++  R  A +R+PLDFL+ + F+EAA
Sbjct  257  YYDGLEKTLGLDRNDPAAHTQLLD----LYKSFAEKSERIDAPRRVPLDFLQGDAFREAA  312

Query  193  ENYIRPLLTKGVPS  234
            + Y+  +  KGVPS
Sbjct  313  DAYLTRVFRKGVPS  326



>gb|KID86385.1| Alpha-acetyltransferase 15, NatA [Metarhizium guizhouense ARSEF 
977]
Length=726

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            D+  YYE L   +K+       S +   +  ALY   ++++ R  A KRIPLDFL  ++F
Sbjct  253  DHAVYYEELASALKI-------SQNGSRARKALYDEYAEKFPRCDAAKRIPLDFLSGDEF  305

Query  181  QEAAENYIRPLLTKGVPS  234
             +AAE Y+  +L KGVPS
Sbjct  306  NQAAEAYLTLMLNKGVPS  323



>gb|KID74644.1| Alpha-acetyltransferase 15, NatA, partial [Metarhizium brunneum 
ARSEF 3297]
Length=726

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            D+  YYE L   +K+       S +   +  ALY   ++++ R  A KRIPLDFL  ++F
Sbjct  253  DHAVYYEKLASALKI-------SPNGSRARKALYDEYAEKFPRCDAAKRIPLDFLSGDEF  305

Query  181  QEAAENYIRPLLTKGVPS  234
             +AAE Y+  +L KGVPS
Sbjct  306  NQAAEAYLTLMLNKGVPS  323



>ref|XP_006519462.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Mus musculus]
Length=732

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         +D    LY  +S+Q+ R+ + +R+PL F   +KF
Sbjct  124  ENWCYYEGLEKALQLRS---------LDERLQLYEEVSKQHPRAVSPRRLPLSFAPGKKF  174

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++RP  +KG P L
Sbjct  175  RELMDKFLRPNFSKGCPPL  193



>ref|NP_080108.1| N-alpha-acetyltransferase 16, NatA auxiliary subunit [Mus musculus]
 sp|Q9DBB4.1|NAA16_MOUSE RecName: Full=N-alpha-acetyltransferase 16, NatA auxiliary subunit; 
AltName: Full=NMDA receptor-regulated 1-like protein; 
Short=NARG1-like protein [Mus musculus]
 dbj|BAB23782.1| unnamed protein product [Mus musculus]
 gb|AAH52445.1| NMDA receptor regulated 1-like [Mus musculus]
 dbj|BAE31267.1| unnamed protein product [Mus musculus]
Length=864

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         +D    LY  +S+Q+ R+ + +R+PL F   +KF
Sbjct  256  ENWCYYEGLEKALQLRS---------LDERLQLYEEVSKQHPRAVSPRRLPLSFAPGKKF  306

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++RP  +KG P L
Sbjct  307  RELMDKFLRPNFSKGCPPL  325



>gb|EDL35769.1| NMDA receptor regulated 1-like [Mus musculus]
Length=846

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 47/79 (59%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         +D    LY  +S+Q+ R+ + +R+PL F   +KF
Sbjct  238  ENWCYYEGLEKALQLRS---------LDERLQLYEEVSKQHPRAVSPRRLPLSFAPGKKF  288

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++RP  +KG P L
Sbjct  289  RELMDKFLRPNFSKGCPPL  307



>dbj|GAE00264.1| acetyltransferase catalytic subunit (NAT1), putative, partial 
[Byssochlamys spectabilis No. 5]
Length=686

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YYEGL +   +   D +       +L A+Y     +Y R  A +R+PLDFL+ + F
Sbjct  253  ENANYYEGLIKAKGIPETDHS-------ALKAVYDQWVDKYPRGDAPRRMPLDFLEGDDF  305

Query  181  QEAAENYIRPLLTKGVPSL  237
            + AA+ Y++ +L +GVPSL
Sbjct  306  KTAADVYLQRMLRRGVPSL  324



>ref|XP_001558387.1| hypothetical protein BC1G_03236 [Botrytis cinerea B05.10]
 gb|EMR88642.1| putative nmda receptor-regulated protein 1 protein [Botrytis 
cinerea BcDW1]
Length=733

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 46/74 (62%), Gaps = 7/74 (9%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY+ L + +++   D       + +  A+Y   +++Y R  A +R+PLDFL+ E+F+EAA
Sbjct  257  YYDSLIQAMEIDPTD-------LKARKAVYDEYAEKYPRCDAARRLPLDFLEGEEFKEAA  309

Query  193  ENYIRPLLTKGVPS  234
            + YI  +L KGVPS
Sbjct  310  DKYIHRMLDKGVPS  323



>emb|CCD34605.1| similar to N-alpha-acetyltransferase 15 [Botrytis cinerea T4]
Length=733

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 46/74 (62%), Gaps = 7/74 (9%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY+ L + +++   D       + +  A+Y   +++Y R  A +R+PLDFL+ E+F+EAA
Sbjct  257  YYDSLIQAMEIDPTD-------LKARKAVYDEYAEKYPRCDAARRLPLDFLEGEEFKEAA  309

Query  193  ENYIRPLLTKGVPS  234
            + YI  +L KGVPS
Sbjct  310  DKYIHRMLDKGVPS  323



>ref|XP_002564541.1| Pc22g05050 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP97793.1| Pc22g05050 [Penicillium rubens Wisconsin 54-1255]
Length=834

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 45/79 (57%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            DN  YY GL +   +   D         +L ALY    ++  R  A +RIPLDFL+ ++F
Sbjct  254  DNSIYYNGLIKAKAIPESDHK-------ALKALYDEWVEKNPRCDAARRIPLDFLEGDEF  306

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++ A+ Y++ +L KGVPSL
Sbjct  307  KQTADAYLQRMLKKGVPSL  325



>gb|KFY12057.1| hypothetical protein V492_04122 [Pseudogymnoascus pannorum VKM 
F-4246]
Length=734

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 7/75 (9%)
 Frame = +1

Query  10   RYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEA  189
            +YY+GL   +       N  +     L A+Y   +++Y RS + +R+PLDFL  ++F+ A
Sbjct  256  KYYDGLAAAL-------NIEAANHKELKAIYDEYAEKYPRSDSARRLPLDFLDGDEFRTA  308

Query  190  AENYIRPLLTKGVPS  234
            A++Y+  +L KGVPS
Sbjct  309  ADSYVHRMLDKGVPS  323



>gb|KFY36377.1| hypothetical protein V494_05059 [Pseudogymnoascus pannorum VKM 
F-4513 (FW-928)]
Length=734

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 45/75 (60%), Gaps = 7/75 (9%)
 Frame = +1

Query  10   RYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEA  189
            +YY+GL   +       N  +     L A+Y   +++Y RS + +R+PLDFL  ++F+ A
Sbjct  256  KYYDGLAAAL-------NIEAANHKDLKAIYDEYAEKYPRSDSARRLPLDFLDGDEFRTA  308

Query  190  AENYIRPLLTKGVPS  234
            A++Y+  +L KGVPS
Sbjct  309  ADSYVHRMLDKGVPS  323



>ref|XP_002838318.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ82509.1| unnamed protein product [Tuber melanosporum]
Length=848

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 47/74 (64%), Gaps = 7/74 (9%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY+GL++ + +  +D         ++ A+Y   +++  RS A +RIPLDFL+   F++AA
Sbjct  258  YYKGLEQSMGIDPEDRK-------AMRAIYDEFTEKNPRSDAPRRIPLDFLEGGDFKQAA  310

Query  193  ENYIRPLLTKGVPS  234
            + Y++ LL KGVPS
Sbjct  311  DVYLQKLLKKGVPS  324



>ref|XP_001544452.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
 gb|EDN03634.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
Length=871

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 47/78 (60%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YYE L     + +K  + S  E  +L A++   +++  R  A +RIPLDFL+ + F
Sbjct  280  ENSNYYEAL-----IKAKGIDQSDHE--ALRAIFDEWAEKNPRGDATRRIPLDFLEGQDF  332

Query  181  QEAAENYIRPLLTKGVPS  234
            +EAA+NY+  +  +G+PS
Sbjct  333  REAADNYLERMFRRGIPS  350



>gb|KEQ84541.1| N-terminal acetyltransferase A, auxiliary subunit [Aureobasidium 
pullulans EXF-150]
Length=724

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY+GL++ + L   D    S +   L  LY S +++  R  A +R+PLDFL+ + F+EAA
Sbjct  257  YYDGLEQALSLDRND----SAQHTQLQDLYKSFAEKSERIDAPRRVPLDFLQGDAFKEAA  312

Query  193  ENYIRPLLTKGVPS  234
            + Y+  +  KGVPS
Sbjct  313  DVYLTRVFRKGVPS  326



>gb|KFY77612.1| hypothetical protein V499_03057 [Pseudogymnoascus pannorum VKM 
F-103]
Length=734

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (59%), Gaps = 7/75 (9%)
 Frame = +1

Query  10   RYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEA  189
            +YY+GL   +       N        L A+Y   +++Y RS + +R+PLDFL  ++F+ A
Sbjct  256  KYYDGLAAAL-------NIEPGNHKELKAIYDEYAEKYPRSDSARRLPLDFLDGDEFRTA  308

Query  190  AENYIRPLLTKGVPS  234
            A++Y+  +L KGVPS
Sbjct  309  ADSYVHRMLDKGVPS  323



>gb|ELR07815.1| hypothetical protein GMDG_00436 [Pseudogymnoascus destructans 
20631-21]
Length=734

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (59%), Gaps = 7/75 (9%)
 Frame = +1

Query  10   RYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEA  189
            +YY+GL   +       N        L A+Y   +++Y RS + +R+PLDFL  ++F+ A
Sbjct  256  KYYDGLAAAL-------NIEPGNHKELKAIYDEYAEKYPRSDSARRLPLDFLDGDEFRTA  308

Query  190  AENYIRPLLTKGVPS  234
            A++Y+  +L KGVPS
Sbjct  309  ADSYVHRMLDKGVPS  323



>gb|KFZ05559.1| hypothetical protein V501_08258 [Pseudogymnoascus pannorum VKM 
F-4519 (FW-2642)]
Length=734

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (59%), Gaps = 7/75 (9%)
 Frame = +1

Query  10   RYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEA  189
            +YY+GL   +       N        L A+Y   +++Y RS + +R+PLDFL  ++F+ A
Sbjct  256  KYYDGLAAAL-------NIEPGNHKELKAIYDEYAEKYPRSDSARRLPLDFLDGDEFRTA  308

Query  190  AENYIRPLLTKGVPS  234
            A++Y+  +L KGVPS
Sbjct  309  ADSYVHRMLDKGVPS  323



>gb|EHK26941.1| hypothetical protein TRIVIDRAFT_55208 [Trichoderma virens Gv29-8]
Length=819

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 46/75 (61%), Gaps = 7/75 (9%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YYE L+  ++L       S D++ +  A+Y   + ++ R    +R+PLDFL  ++F++ A
Sbjct  257  YYEKLEEAMEL-------SPDDVVARKAIYDEYAAKFPRCDIARRVPLDFLSGDEFRQVA  309

Query  193  ENYIRPLLTKGVPSL  237
            E+Y+  +L KGVPSL
Sbjct  310  ESYLTLVLNKGVPSL  324



>ref|XP_001797369.1| hypothetical protein SNOG_07014 [Phaeosphaeria nodorum SN15]
 gb|EAT85665.2| hypothetical protein SNOG_07014 [Phaeosphaeria nodorum SN15]
Length=1230

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 48/79 (61%), Gaps = 5/79 (6%)
 Frame = +1

Query  1    DNYR-YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEK  177
            + YR YY+GL++ + L       +  +I  L  LY S +++  R+ A +RIPL+F+  + 
Sbjct  632  NEYRAYYDGLEKALGL----SRTNEADIAKLKDLYDSYAKKSERNDAPRRIPLEFISGDD  687

Query  178  FQEAAENYIRPLLTKGVPS  234
            F+ A + Y+R +L KGVPS
Sbjct  688  FKTAVDEYLRRMLNKGVPS  706



>ref|XP_002795283.1| NMDA receptor-regulated protein [Paracoccidioides sp. 'lutzii' 
Pb01]
 gb|EEH40783.1| NMDA receptor-regulated protein [Paracoccidioides sp. 'lutzii' 
Pb01]
Length=848

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 46/78 (59%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+ L +   +   D        ++L AL+    ++Y R  A +RIPLD L+ + F
Sbjct  257  ENSNYYDALIKAKGIVESDR-------ETLKALFDEWVKKYPRGDAARRIPLDILEGQDF  309

Query  181  QEAAENYIRPLLTKGVPS  234
            +EAA++Y++ +L +GVPS
Sbjct  310  REAADSYLQRMLRRGVPS  327



>ref|XP_008721451.1| hypothetical protein HMPREF1541_08911 [Cyphellophora europaea 
CBS 101466]
 gb|ETN36633.1| hypothetical protein HMPREF1541_08911 [Cyphellophora europaea 
CBS 101466]
Length=746

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 47/78 (60%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N +YY+G  +   L       + D+   L   Y  LS+++ +S   +R PLDFL+ E+F
Sbjct  258  ENSQYYDGFIKAKGL-------TEDQAADLKKAYGELSEKFPKSDLPRRRPLDFLQGEEF  310

Query  181  QEAAENYIRPLLTKGVPS  234
            +EA ++Y++ +L KG+PS
Sbjct  311  REAVDSYLQRMLRKGIPS  328



>ref|XP_006676834.1| hypothetical protein BATDEDRAFT_34518 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82906.1| hypothetical protein BATDEDRAFT_34518 [Batrachochytrium dendrobatidis 
JAM81]
Length=872

 Score = 53.9 bits (128),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 46/79 (58%), Gaps = 2/79 (3%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            D+  Y EG +    L     + +S  ID +  +Y  L ++Y RS A++R+PL+F+  ++F
Sbjct  266  DSIAYLEGYRTARGLGGHFTDRAS--IDRVLRMYRELGEKYPRSHAIQRLPLNFVSGDEF  323

Query  181  QEAAENYIRPLLTKGVPSL  237
            +    +Y+ PL  KGVPSL
Sbjct  324  KTMITSYLVPLFRKGVPSL  342



>ref|XP_003503139.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Cricetulus griseus]
 ref|XP_007617427.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Cricetulus griseus]
Length=845

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         +D    +Y  +S+Q+ R+ + +R+PL+ +  +KF
Sbjct  242  ENWCYYEGLEKALQLRS---------LDERLQIYEEISKQHPRAVSPRRLPLNLVPGKKF  292

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++RP  +KG P L
Sbjct  293  RELMDKFLRPNFSKGCPPL  311



>ref|XP_962452.1| hypothetical protein NCU11379 [Neurospora crassa OR74A]
 gb|EAA33216.1| NMDA receptor-regulated protein 1 [Neurospora crassa OR74A]
 gb|KHE85895.1| hypothetical protein GE21DRAFT_5475 [Neurospora crassa]
Length=734

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 7/75 (9%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY+GL   +++  KD         +L A+Y   + +Y RS A KR+PL+FL  + F+ AA
Sbjct  257  YYKGLIEALEIDEKDEA-------ALKAIYDEYAAKYPRSDAAKRLPLNFLTGDSFKAAA  309

Query  193  ENYIRPLLTKGVPSL  237
            ++Y+  +L +GVPS+
Sbjct  310  KSYLTNMLDRGVPSV  324



>ref|XP_005847916.1| hypothetical protein CHLNCDRAFT_35269 [Chlorella variabilis]
 gb|EFN55814.1| hypothetical protein CHLNCDRAFT_35269 [Chlorella variabilis]
Length=736

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 53/94 (56%), Gaps = 15/94 (16%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDS---------------LAALYTSLSQQYHRSS  135
            +NY+Y+ GLQ  ++L +   N SS+                   LA +Y  L +++  S 
Sbjct  256  ENYQYHAGLQAALRLPAAAANGSSEAAGGQQQAEAALSEEQRARLAGVYAELRREHPHSV  315

Query  136  AVKRIPLDFLKDEKFQEAAENYIRPLLTKGVPSL  237
            A KR+PLDFL+ ++F  AA++Y+R  L +G+PSL
Sbjct  316  AAKRMPLDFLEGDEFVAAADSYVRKYLLRGIPSL  349



>gb|KFZ15643.1| hypothetical protein V502_05476 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=735

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 7/75 (9%)
 Frame = +1

Query  10   RYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEA  189
            +YY+GL   +       N        L A+Y   +++Y RS + +R+PLDFL  + F+ A
Sbjct  256  KYYDGLAAAL-------NIEPSNHKELKAIYDEYAEKYPRSDSARRLPLDFLDGDDFRTA  308

Query  190  AENYIRPLLTKGVPS  234
            A++Y+  +L KGVPS
Sbjct  309  ADSYVHRMLDKGVPS  323



>ref|XP_009849123.1| hypothetical protein NEUTE1DRAFT_59572 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGO58811.1| hypothetical protein NEUTE1DRAFT_59572 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ72911.1| N-terminal acetyltransferase A, auxiliary subunit [Neurospora 
tetrasperma FGSC 2509]
Length=734

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 46/75 (61%), Gaps = 7/75 (9%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY+GL   +++  KD         +L A+Y   + +Y RS A KR+PL+FL  + F+ AA
Sbjct  257  YYKGLIEALEIDEKDEA-------ALKAIYDEYAAKYPRSDAAKRLPLNFLTGDSFKAAA  309

Query  193  ENYIRPLLTKGVPSL  237
            ++Y+  +L +GVPS+
Sbjct  310  KSYLTNMLDRGVPSV  324



>ref|XP_002508463.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69721.1| predicted protein [Micromonas sp. RCC299]
Length=849

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 30/79 (38%), Positives = 43/79 (54%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YY  L+  + L   D       +  L A Y +L+ QY +S AV+R+PLDFL  + F
Sbjct  265  ENHGYYRQLEAVLGLVDGD-------VAKLEATYDALAVQYPKSDAVRRLPLDFLSGDSF  317

Query  181  QEAAENYIRPLLTKGVPSL  237
              A   Y+   + KGVPSL
Sbjct  318  AAAVRKYVVGPIRKGVPSL  336



>gb|EHK44818.1| hypothetical protein TRIATDRAFT_131899 [Trichoderma atroviride 
IMI 206040]
Length=817

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 46/75 (61%), Gaps = 7/75 (9%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YYE L++ +++       S D+  +  A+Y   + ++ R    +R+PLDFL  ++F++ A
Sbjct  257  YYEKLEQALEI-------SRDDAPARKAIYDEYAAKFPRCDIARRVPLDFLSGDEFRQTA  309

Query  193  ENYIRPLLTKGVPSL  237
            E+Y+  +L KGVPSL
Sbjct  310  ESYVALMLNKGVPSL  324



>gb|KFY64827.1| hypothetical protein V496_03018 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
 gb|KFY91087.1| hypothetical protein V498_05676 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
Length=735

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (59%), Gaps = 7/75 (9%)
 Frame = +1

Query  10   RYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEA  189
            +YY+GL   +       N        L A+Y   +++Y RS + +R+PLDFL  ++F+ A
Sbjct  256  KYYDGLAAAL-------NIEPGNHKELKAIYDEYAEKYPRSDSARRLPLDFLDGDEFRVA  308

Query  190  AENYIRPLLTKGVPS  234
            A++Y+  +L KGVPS
Sbjct  309  ADSYVHRMLDKGVPS  323



>ref|XP_001213051.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU35675.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=839

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 46/79 (58%), Gaps = 7/79 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+ L +   +   D         +L A+Y S  ++  R  A +RIPLDFL+ E F
Sbjct  253  ENSIYYDALIKAKGIPENDHK-------ALKAVYDSWVEKCPRGDAPRRIPLDFLEGEDF  305

Query  181  QEAAENYIRPLLTKGVPSL  237
            ++AA+ Y++ +L KGVPSL
Sbjct  306  KQAADAYLQRMLKKGVPSL  324



>ref|XP_007920186.1| hypothetical protein MYCFIDRAFT_55822 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EME89406.1| hypothetical protein MYCFIDRAFT_55822 [Pseudocercospora fijiensis 
CIRAD86]
Length=849

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 4/74 (5%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY GL++ + L       SS++ + L  +Y   + +  RS A +RIPLDFL  + F++ A
Sbjct  257  YYNGLEKSLGLERA----SSEDEEKLKEMYQYYADKNIRSDAARRIPLDFLTGDSFRKHA  312

Query  193  ENYIRPLLTKGVPS  234
            ++Y+R   TKGVPS
Sbjct  313  DSYLRRAFTKGVPS  326



>gb|KHN98615.1| Alpha-acetyltransferase 15, NatA [Metarhizium album ARSEF 1941]
Length=726

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            D+  YYE L   +K+         +   +  ALY   ++++ R  A KRIPLDFL  ++F
Sbjct  253  DHPMYYEKLASALKI-------PQNSSKARKALYDEYAEKFPRCDAAKRIPLDFLFGDEF  305

Query  181  QEAAENYIRPLLTKGVPS  234
             +AAE Y+  +L KGVPS
Sbjct  306  NQAAETYLTLMLNKGVPS  323



>ref|XP_005366096.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Microtus ochrogaster]
Length=859

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         +D    +Y  +S+Q+ R+ + +R+PL+ +  +KF
Sbjct  256  ENWCYYEGLEKALQLCS---------LDERLQIYEEISKQHPRAVSPRRLPLNLVPGKKF  306

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++RP  +KG P L
Sbjct  307  RELMDKFLRPNFSKGCPPL  325



>ref|XP_007827482.1| hypothetical protein PFICI_00710 [Pestalotiopsis fici W106-1]
 gb|ETS86882.1| hypothetical protein PFICI_00710 [Pestalotiopsis fici W106-1]
Length=826

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +1

Query  70   SDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAAENYIRPLLTKGVPS  234
            +D+  +  A+Y   +++Y RS A KR+PLDFL  + F+EAA++Y+  +L KGVPS
Sbjct  269  ADDQKAKKAIYDEYAEKYPRSDAAKRLPLDFLTGDIFREAAKSYLNLMLDKGVPS  323



>gb|EEH21001.2| hypothetical protein PABG_03232 [Paracoccidioides brasiliensis 
Pb03]
Length=848

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+ L +   +   D        ++L AL+    ++Y R  A +RIPLD L+ + F
Sbjct  257  ENSNYYDALIKAKGIVESDH-------ETLKALFDEWVKKYPRGDAARRIPLDILEGQDF  309

Query  181  QEAAENYIRPLLTKGVPS  234
            +EAA++Y++ +L +G+PS
Sbjct  310  REAADSYLQRMLCRGIPS  327



>gb|EEH08073.1| NMDA receptor-regulated gene 1 protein [Histoplasma capsulatum 
G186AR]
Length=845

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YYE L +   +   D         +L A++   +++  R  A +RIPLDFL+ + F
Sbjct  254  ENSNYYEALIKAKGIDQSDHK-------ALRAIFDEWAEKNPRGDAARRIPLDFLEGQDF  306

Query  181  QEAAENYIRPLLTKGVPS  234
            +EAA+NY+  +  +G+PS
Sbjct  307  REAADNYLERMFRRGIPS  324



>gb|EGC43116.1| NMDA receptor-regulated protein 1 [Histoplasma capsulatum H88]
Length=845

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YYE L +   +   D         +L A++   +++  R  A +RIPLDFL+ + F
Sbjct  254  ENSNYYEALIKAKGIDQSDHK-------ALRAIFDEWAEKNPRGDAARRIPLDFLEGQDF  306

Query  181  QEAAENYIRPLLTKGVPS  234
            +EAA+NY+  +  +G+PS
Sbjct  307  REAADNYLERMFRRGIPS  324



>gb|KHJ32748.1| putative subunit of the n-terminal acetyltransferase [Erysiphe 
necator]
Length=765

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/50 (46%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = +1

Query  85   SLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAAENYIRPLLTKGVPS  234
            +L A+Y   +++Y R  A +R+PLDFL+ + F+EAA+ Y+  +L KGVPS
Sbjct  274  ALKAIYDEYAEKYPRCDAARRLPLDFLEGDDFREAADKYLNRMLDKGVPS  323



>ref|XP_010757576.1| hypothetical protein PADG_01786 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH45636.1| hypothetical protein PADG_01786 [Paracoccidioides brasiliensis 
Pb18]
Length=848

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 7/78 (9%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  YY+ L +   +   D        ++L AL+    ++Y R  A +RIPLD L+ + F
Sbjct  257  ENSNYYDALIKAKGIVESDR-------ETLKALFDEWVKKYPRGDAARRIPLDILEGQDF  309

Query  181  QEAAENYIRPLLTKGVPS  234
            +EAA++Y++ +L +G+PS
Sbjct  310  REAADSYLQRMLCRGIPS  327



>ref|XP_010590884.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Loxodonta africana]
Length=874

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         ++    +Y  +S+Q+ R+ + +RIPL+ +  EKF
Sbjct  256  ENWCYYEGLEKALQLSSLGPFLPHGTLEERLQIYEEISKQHPRAISPRRIPLNLVPGEKF  315

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++R   +KG P L
Sbjct  316  RELMDKFLRVNFSKGCPPL  334



>gb|KFY99662.1| hypothetical protein V500_01320 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
Length=735

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 7/75 (9%)
 Frame = +1

Query  10   RYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEA  189
            +YY+GL   +       N        L A+Y   +++Y RS + +R+PLDFL  + F+ A
Sbjct  256  KYYDGLVAAL-------NIEPSNHKELKAIYDEYAEKYPRSDSARRLPLDFLDGDDFRTA  308

Query  190  AENYIRPLLTKGVPS  234
            A++Y+  +L KGVPS
Sbjct  309  ADSYVHRMLDKGVPS  323



>dbj|BAC79753.1| N-terminal acetyltransferase-like protein [Oryza sativa Japonica 
Group]
 dbj|BAD30365.1| N-terminal acetyltransferase-like protein [Oryza sativa Japonica 
Group]
Length=128

 Score = 50.1 bits (118),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVK  144
            DNY+ +  +Q+C+ LYS++  YS+D++D L   Y+SL ++Y  SS VK
Sbjct  80   DNYKCFIAIQKCLGLYSENGQYSTDDVDRLCTFYSSLKKEYGWSSVVK  127



>ref|XP_006003551.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Latimeria chalumnae]
Length=520

 Score = 52.4 bits (124),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 47/79 (59%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++          + ++    +Y  +S++Y R+ + KR+PL+F+  EKF
Sbjct  256  ENWSYYEGLEKALR---------PNTLEKRIQIYEDVSKKYPRTVSSKRLPLNFVSGEKF  306

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++R   +KG P L
Sbjct  307  RELMDKFLRINFSKGCPPL  325



>ref|XP_008075963.1| TPR-like protein [Glarea lozoyensis ATCC 20868]
 gb|EPE36648.1| TPR-like protein [Glarea lozoyensis ATCC 20868]
Length=830

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (61%), Gaps = 8/74 (11%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY+GL   + +        S++  +   L+   +++Y R  A +R+PLDFL+ ++F+EAA
Sbjct  257  YYDGLIEAMGI--------SEDKAAKKQLFDEYAEKYPRCDAARRLPLDFLEGDEFKEAA  308

Query  193  ENYIRPLLTKGVPS  234
            + YI  +L KGVPS
Sbjct  309  DQYINRMLDKGVPS  322



>ref|XP_643789.1| tetratricopeptide-like helical domain-containing protein [Dictyostelium 
discoideum AX4]
 gb|EAL69818.1| tetratricopeptide-like helical domain-containing protein [Dictyostelium 
discoideum AX4]
Length=814

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 1/60 (2%)
 Frame = +1

Query  61   NYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKD-EKFQEAAENYIRPLLTKGVPSL  237
            N S +EI +L +LY  LS  Y +S  +++IPL FLKD ++F+E A  Y +  L+KG+PSL
Sbjct  274  NLSDEEISTLDSLYKELSSLYPKSLLIQKIPLLFLKDKQQFREHAVLYTKNFLSKGIPSL  333



>ref|XP_003218678.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Anolis carolinensis]
Length=865

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++ +S         ++    +Y  +S+Q+ R+ + +R+PL+F+  EKF
Sbjct  256  ENWHYYEGLEKALQPHS---------LEERLEVYDEISKQHPRAVSPRRLPLNFVTGEKF  306

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++R   +KG P L
Sbjct  307  RELMDKFLRVNFSKGCPPL  325



>ref|XP_006003550.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Latimeria chalumnae]
Length=729

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 47/79 (59%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++          + ++    +Y  +S++Y R+ + KR+PL+F+  EKF
Sbjct  256  ENWSYYEGLEKALR---------PNTLEKRIQIYEDVSKKYPRTVSSKRLPLNFVSGEKF  306

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++R   +KG P L
Sbjct  307  RELMDKFLRINFSKGCPPL  325



>ref|XP_008852913.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Nannospalax galili]
Length=530

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         ++    +Y  +S+Q+ R+ + +R+PL+ +  +KF
Sbjct  256  ENWCYYEGLEKALQLRS---------LEERLQIYEEISKQHPRAISPRRLPLNLVPGKKF  306

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++RP  +KG P L
Sbjct  307  RELMDKFLRPNFSKGCPPL  325



>gb|KFY11380.1| hypothetical protein V491_07228 [Pseudogymnoascus pannorum VKM 
F-3775]
Length=735

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 45/75 (60%), Gaps = 7/75 (9%)
 Frame = +1

Query  10   RYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEA  189
            +YY+GL   +       N        L A+Y   +++Y RS + +R+PL+FL+ ++F+ A
Sbjct  256  KYYDGLAAAL-------NIEQSNHKELKAIYDEYAEKYPRSDSARRLPLNFLEGDEFRIA  308

Query  190  AENYIRPLLTKGVPS  234
            A++Y+  +L KGVPS
Sbjct  309  ADSYVHRMLDKGVPS  323



>ref|XP_001596993.1| hypothetical protein SS1G_01186 [Sclerotinia sclerotiorum 1980]
 gb|EDN96261.1| hypothetical protein SS1G_01186 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=734

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 7/74 (9%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY+ L + +++   D       + +  A+Y   + +Y R  A +R+PLDFL+ E+F+E A
Sbjct  257  YYDSLIQAMEIDPTD-------LQARKAIYDEYAAKYPRCDAARRLPLDFLEGEEFREVA  309

Query  193  ENYIRPLLTKGVPS  234
            + YI  +L KGVPS
Sbjct  310  DKYIHRMLDKGVPS  323



>ref|XP_006003549.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Latimeria chalumnae]
Length=864

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 47/79 (59%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++          + ++    +Y  +S++Y R+ + KR+PL+F+  EKF
Sbjct  256  ENWSYYEGLEKALR---------PNTLEKRIQIYEDVSKKYPRTVSSKRLPLNFVSGEKF  306

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++R   +KG P L
Sbjct  307  RELMDKFLRINFSKGCPPL  325



>dbj|GAM21819.1| hypothetical protein SAMD00019534_049940 [Acytostelium subglobosum 
LB1]
Length=867

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 46/79 (58%), Gaps = 1/79 (1%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N  Y++ L     + S D N + D+++ L  +Y  L++ Y +S  +++IPL FL  E+F
Sbjct  281  ENLTYHQRLWETKGVLSLD-NLNQDQVNQLTNMYVELAKVYPKSMMIQKIPLRFLAGEEF  339

Query  181  QEAAENYIRPLLTKGVPSL  237
            +     + +  LTKG+PSL
Sbjct  340  RTHLAMFSKNFLTKGIPSL  358



>gb|ESZ93612.1| N-terminal acetyltransferase-like protein [Sclerotinia borealis 
F-4157]
Length=734

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +1

Query  94   ALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAAENYIRPLLTKGVPS  234
            A+Y   +++Y R  A +R+PLDFL+ E+F+E A+ YI  +L KGVPS
Sbjct  277  AVYDEYAEKYPRCDAARRLPLDFLEGEEFRELADKYIHRMLDKGVPS  323



>ref|XP_008258238.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Oryctolagus cuniculus]
Length=741

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         ++    +Y  +S+Q+ R+ + +R+PL+ +  EKF
Sbjct  124  ENWCYYEGLEKALQLSSLGPFLPHGTLEERLQIYEEISKQHPRAISPRRLPLNLVPGEKF  183

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++R   +KG P L
Sbjct  184  KELMDKFLRVNFSKGCPPL  202



>ref|XP_008852912.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Nannospalax galili]
Length=863

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 48/79 (61%), Gaps = 9/79 (11%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         ++    +Y  +S+Q+ R+ + +R+PL+ +  +KF
Sbjct  256  ENWCYYEGLEKALQLRS---------LEERLQIYEEISKQHPRAISPRRLPLNLVPGKKF  306

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++RP  +KG P L
Sbjct  307  RELMDKFLRPNFSKGCPPL  325



>ref|XP_008705024.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
[Ursus maritimus]
Length=839

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL+R ++L S         ++    +Y  +S+Q+ R+ + +R+PL+    EKF
Sbjct  222  ENWCYYEGLERALQLSSLGPFLPHGTLEERLQIYEEISKQHPRAISPRRLPLNLAPGEKF  281

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++R   +KG P L
Sbjct  282  RELMDKFLRVNFSKGCPPL  300



>ref|XP_008258237.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Oryctolagus cuniculus]
Length=873

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         ++    +Y  +S+Q+ R+ + +R+PL+ +  EKF
Sbjct  256  ENWCYYEGLEKALQLSSLGPFLPHGTLEERLQIYEEISKQHPRAISPRRLPLNLVPGEKF  315

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++R   +KG P L
Sbjct  316  KELMDKFLRVNFSKGCPPL  334



>ref|XP_007296468.1| tetratricopeptide [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
 gb|EKD13136.1| tetratricopeptide [Marssonina brunnea f. sp. 'multigermtubi' 
MB_m1]
Length=840

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (61%), Gaps = 7/74 (9%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY+ L + + +       S D+  +  A+Y   +++Y R  A +R+PLDFL+ E+F  AA
Sbjct  257  YYDALIKVLGI-------SDDDHRARKAVYDEYAEKYPRCDAARRLPLDFLEGEEFTAAA  309

Query  193  ENYIRPLLTKGVPS  234
            ++Y+  +L KGVPS
Sbjct  310  DSYVVRMLDKGVPS  323



>ref|XP_006693595.1| N-terminal acetyltransferase-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
 gb|EGS21299.1| N-terminal acetyltransferase-like protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
Length=744

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 7/74 (9%)
 Frame = +1

Query  13   YYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEAA  192
            YY+GL   + +       S+D+ ++  A+Y   + +Y RS A KR+PL+FL  E+F+  A
Sbjct  257  YYKGLISALDI-------SADDEEAQKAVYDEYAAKYPRSDAAKRLPLNFLSGERFRTTA  309

Query  193  ENYIRPLLTKGVPS  234
            + Y+  +  KGVPS
Sbjct  310  KAYLTLMFDKGVPS  323



>ref|XP_006083565.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X5 [Myotis lucifugus]
Length=741

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         ++    +Y  +S+Q+ R+ + +R+PL+ +  EKF
Sbjct  124  ENWCYYEGLEKALQLSSLGPFLPHGTLEERLQIYEEISKQHPRAISPRRLPLNLVPGEKF  183

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++R   +KG P L
Sbjct  184  RELMDKFLRVNFSKGCPPL  202



>ref|XP_006083562.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X2 [Myotis lucifugus]
Length=837

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         ++    +Y  +S+Q+ R+ + +R+PL+ +  EKF
Sbjct  222  ENWCYYEGLEKALQLSSLGPFLPHGTLEERLQIYEEISKQHPRAISPRRLPLNLVPGEKF  281

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++R   +KG P L
Sbjct  282  RELMDKFLRVNFSKGCPPL  300



>ref|XP_006083561.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X1 [Myotis lucifugus]
Length=839

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         ++    +Y  +S+Q+ R+ + +R+PL+ +  EKF
Sbjct  222  ENWCYYEGLEKALQLSSLGPFLPHGTLEERLQIYEEISKQHPRAISPRRLPLNLVPGEKF  281

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++R   +KG P L
Sbjct  282  RELMDKFLRVNFSKGCPPL  300



>ref|XP_006083563.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Myotis lucifugus]
Length=826

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         ++    +Y  +S+Q+ R+ + +R+PL+ +  EKF
Sbjct  209  ENWCYYEGLEKALQLSSLGPFLPHGTLEERLQIYEEISKQHPRAISPRRLPLNLVPGEKF  268

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++R   +KG P L
Sbjct  269  RELMDKFLRVNFSKGCPPL  287



>ref|XP_005878697.1| PREDICTED: N-alpha-acetyltransferase 16, NatA auxiliary subunit 
isoform X3 [Myotis brandtii]
Length=741

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  1    DNYRYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKF  180
            +N+ YYEGL++ ++L S         ++    +Y  +S+Q+ R+ + +R+PL+ +  EKF
Sbjct  124  ENWCYYEGLEKALQLSSLGPFLPHGTLEERLQIYEEISKQHPRAISPRRLPLNLVPGEKF  183

Query  181  QEAAENYIRPLLTKGVPSL  237
            +E  + ++R   +KG P L
Sbjct  184  RELMDKFLRINFSKGCPPL  202



>gb|KFY21921.1| hypothetical protein V493_06976 [Pseudogymnoascus pannorum VKM 
F-4281 (FW-2241)]
Length=735

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 43/75 (57%), Gaps = 7/75 (9%)
 Frame = +1

Query  10   RYYEGLQRCVKLYSKDCNYSSDEIDSLAALYTSLSQQYHRSSAVKRIPLDFLKDEKFQEA  189
            +YY+GL   +       N        L A++   +++Y RS + +R+PLDFL   +F+ A
Sbjct  256  KYYDGLAGAL-------NIEPGNHKELKAIFDEYAEKYPRSDSARRLPLDFLDGNEFRIA  308

Query  190  AENYIRPLLTKGVPS  234
            A++Y+  +L KGVPS
Sbjct  309  ADSYVHRMLDKGVPS  323



Lambda      K        H        a         alpha
   0.316    0.133    0.381    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517576194536