BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16447_g1_i1 len=2124 path=[2102:0-2123]

Length=2124
                                                                      Score     E

ref|XP_009761357.1|  PREDICTED: putative UPF0481 protein At3g02645      588   0.0      
ref|XP_007023343.1|  Uncharacterized protein TCM_027333                 583   0.0      
ref|XP_009616817.1|  PREDICTED: putative UPF0481 protein At3g02645      583   0.0      
ref|XP_004305490.1|  PREDICTED: putative UPF0481 protein At3g0264...    578   0.0      
ref|XP_002313925.1|  hypothetical protein POPTR_0009s08870g             576   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009772094.1|  PREDICTED: putative UPF0481 protein At3g02645      573   0.0      
ref|XP_011005031.1|  PREDICTED: putative UPF0481 protein At3g02645      572   0.0      
ref|XP_006586421.1|  PREDICTED: putative UPF0481 protein At3g0264...    572   0.0      
gb|KHN38011.1|  Putative UPF0481 protein                                571   0.0      
ref|XP_008228744.1|  PREDICTED: putative UPF0481 protein At3g0264...    570   0.0      
gb|KCW70767.1|  hypothetical protein EUGRSUZ_F03927                     569   0.0      
emb|CDO98196.1|  unnamed protein product                                570   0.0      
emb|CAN62047.1|  hypothetical protein VITISV_026044                     569   0.0      Vitis vinifera
ref|XP_007217422.1|  hypothetical protein PRUPE_ppa026580mg             568   0.0      
ref|XP_006584161.1|  PREDICTED: putative UPF0481 protein At3g0264...    567   0.0      
gb|KHN01303.1|  Putative UPF0481 protein                                566   0.0      
ref|XP_003604314.1|  hypothetical protein MTR_4g009340                  566   0.0      
ref|XP_008228743.1|  PREDICTED: putative UPF0481 protein At3g0264...    565   0.0      
ref|XP_007023346.1|  Uncharacterized protein TCM_027342                 565   0.0      
ref|XP_009770998.1|  PREDICTED: putative UPF0481 protein At3g02645      563   0.0      
ref|XP_011016232.1|  PREDICTED: LOW QUALITY PROTEIN: putative UPF...    558   0.0      
ref|XP_010322657.1|  PREDICTED: putative UPF0481 protein At3g02645      557   0.0      
ref|XP_009606219.1|  PREDICTED: putative UPF0481 protein At3g02645      555   0.0      
ref|XP_002274147.1|  PREDICTED: putative UPF0481 protein At3g02645      555   0.0      Vitis vinifera
ref|XP_010065040.1|  PREDICTED: putative UPF0481 protein At3g02645      554   0.0      
ref|XP_010097138.1|  hypothetical protein L484_025683                   554   0.0      
ref|XP_010658671.1|  PREDICTED: putative UPF0481 protein At3g02645      551   0.0      
ref|XP_010250392.1|  PREDICTED: putative UPF0481 protein At3g02645      551   0.0      
ref|XP_006427511.1|  hypothetical protein CICLE_v10027595mg             551   0.0      
ref|XP_004492405.1|  PREDICTED: putative UPF0481 protein At3g0264...    551   0.0      
ref|XP_004236453.2|  PREDICTED: putative UPF0481 protein At3g02645      550   0.0      
ref|XP_008372690.1|  PREDICTED: putative UPF0481 protein At3g02645      550   0.0      
ref|XP_009338489.1|  PREDICTED: putative UPF0481 protein At3g02645      546   0.0      
ref|XP_006356264.1|  PREDICTED: putative UPF0481 protein At3g0264...    548   0.0      
ref|XP_002269592.1|  PREDICTED: putative UPF0481 protein At3g02645      541   0.0      Vitis vinifera
ref|XP_007023345.1|  Uncharacterized protein TCM_027335                 543   0.0      
emb|CDO98195.1|  unnamed protein product                                540   0.0      
gb|KCW70768.1|  hypothetical protein EUGRSUZ_F03928                     540   0.0      
ref|XP_010041919.1|  PREDICTED: putative UPF0481 protein At3g02645      537   2e-180   
ref|XP_008372804.1|  PREDICTED: putative UPF0481 protein At3g02645      536   9e-180   
ref|XP_008372803.1|  PREDICTED: putative UPF0481 protein At3g02645      536   2e-179   
ref|XP_002530454.1|  conserved hypothetical protein                     534   2e-179   Ricinus communis
ref|XP_010065042.1|  PREDICTED: putative UPF0481 protein At3g02645      540   3e-179   
ref|XP_009338526.1|  PREDICTED: putative UPF0481 protein At3g02645      528   4e-176   
ref|XP_006427508.1|  hypothetical protein CICLE_v10027562mg             527   6e-176   
ref|XP_003604327.1|  hypothetical protein MTR_4g009590                  527   8e-176   
ref|XP_006383340.1|  hypothetical protein POPTR_0005s14650g             524   3e-175   
ref|XP_006427517.1|  hypothetical protein CICLE_v10027572mg             521   4e-174   
ref|XP_010065043.1|  PREDICTED: putative UPF0481 protein At3g02645      522   8e-173   
ref|XP_006656701.1|  PREDICTED: putative UPF0481 protein At3g0264...    514   4e-171   
gb|KHN01304.1|  Putative UPF0481 protein                                514   5e-171   
ref|XP_007139376.1|  hypothetical protein PHAVU_008G024200g             513   1e-170   
ref|XP_006427512.1|  hypothetical protein CICLE_v10027367mg             513   1e-170   
ref|XP_010250391.1|  PREDICTED: putative UPF0481 protein At3g02645      507   2e-168   
gb|KHN13779.1|  Putative UPF0481 protein                                506   1e-167   
ref|XP_003604329.1|  hypothetical protein MTR_4g009620                  506   1e-167   
ref|XP_004491977.1|  PREDICTED: putative UPF0481 protein At3g0264...    503   8e-167   
ref|XP_002300077.1|  hypothetical protein POPTR_0001s36110g             502   2e-166   Populus trichocarpa [western balsam poplar]
ref|XP_006603600.1|  PREDICTED: putative UPF0481 protein At3g0264...    502   2e-166   
ref|XP_003599700.1|  hypothetical protein MTR_3g043530                  501   5e-166   
gb|KCW70769.1|  hypothetical protein EUGRSUZ_F03929                     496   4e-165   
ref|XP_011073606.1|  PREDICTED: putative UPF0481 protein At3g02645      496   5e-164   
emb|CAN79320.1|  hypothetical protein VITISV_029316                     491   3e-163   Vitis vinifera
ref|XP_011045249.1|  PREDICTED: putative UPF0481 protein At3g02645      493   5e-163   
ref|XP_006427505.1|  hypothetical protein CICLE_v10027555mg             491   2e-162   
gb|KDO43081.1|  hypothetical protein CISIN_1g039617mg                   489   8e-162   
ref|XP_011084573.1|  PREDICTED: putative UPF0481 protein At3g02645      490   2e-161   
ref|XP_008659214.1|  PREDICTED: putative UPF0481 protein At3g02645      489   1e-160   
ref|XP_006427513.1|  hypothetical protein CICLE_v10026970mg             486   3e-160   
ref|XP_002437949.1|  hypothetical protein SORBIDRAFT_10g005360          486   3e-160   Sorghum bicolor [broomcorn]
ref|XP_003599708.1|  hypothetical protein MTR_3g043650                  486   4e-160   
ref|XP_008461154.1|  PREDICTED: putative UPF0481 protein At3g02645      486   8e-160   
ref|XP_002300078.2|  hypothetical protein POPTR_0001s36120g             484   1e-159   Populus trichocarpa [western balsam poplar]
ref|XP_010904995.1|  PREDICTED: putative UPF0481 protein At3g02645      484   3e-159   
ref|XP_002269848.1|  PREDICTED: putative UPF0481 protein At3g02645      483   1e-158   Vitis vinifera
ref|XP_004964692.1|  PREDICTED: putative UPF0481 protein At3g0264...    483   2e-158   
ref|XP_003621603.1|  hypothetical protein MTR_7g017620                  481   3e-158   
ref|XP_004158823.1|  PREDICTED: putative UPF0481 protein At3g0264...    481   4e-158   
ref|XP_011045247.1|  PREDICTED: putative UPF0481 protein At3g02645      480   6e-158   
ref|NP_001056969.1|  Os06g0179500                                       481   8e-158   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010904996.1|  PREDICTED: putative UPF0481 protein At3g02645      480   9e-158   
gb|KCW70771.1|  hypothetical protein EUGRSUZ_F03931                     478   1e-157   
ref|XP_011084562.1|  PREDICTED: putative UPF0481 protein At3g02645      480   1e-157   
gb|KDO43083.1|  hypothetical protein CISIN_1g048792mg                   478   2e-157   
ref|XP_010904997.1|  PREDICTED: putative UPF0481 protein At3g02645      480   2e-157   
dbj|BAJ91240.1|  predicted protein                                      479   3e-157   
ref|XP_006465278.1|  PREDICTED: putative UPF0481 protein At3g0264...    478   4e-157   
ref|XP_006427507.1|  hypothetical protein CICLE_v10027418mg             476   1e-156   
dbj|BAJ94025.1|  predicted protein                                      477   3e-156   
ref|XP_008228745.1|  PREDICTED: putative UPF0481 protein At3g0264...    473   9e-156   
ref|XP_006465280.1|  PREDICTED: putative UPF0481 protein At3g0264...    479   2e-155   
ref|XP_006373129.1|  hypothetical protein POPTR_0017s08990g             473   3e-155   
ref|XP_010905001.1|  PREDICTED: putative UPF0481 protein At3g02645      473   3e-155   
ref|XP_006427515.1|  hypothetical protein CICLE_v10025330mg             472   7e-155   
ref|XP_011073607.1|  PREDICTED: putative UPF0481 protein At3g02645      472   2e-154   
ref|XP_010537915.1|  PREDICTED: putative UPF0481 protein At3g02645      471   3e-154   
ref|XP_002304083.1|  hypothetical protein POPTR_0003s01870g             469   1e-153   Populus trichocarpa [western balsam poplar]
ref|XP_011004989.1|  PREDICTED: putative UPF0481 protein At3g02645      465   5e-152   
ref|XP_002299686.1|  hypothetical protein POPTR_0001s21220g             464   8e-152   Populus trichocarpa [western balsam poplar]
gb|EYU21691.1|  hypothetical protein MIMGU_mgv1a004095mg                464   1e-151   
ref|XP_011002074.1|  PREDICTED: putative UPF0481 protein At3g02645      461   1e-150   
ref|XP_004152335.1|  PREDICTED: putative UPF0481 protein At3g0264...    460   2e-150   
ref|XP_010904999.1|  PREDICTED: putative UPF0481 protein At3g02645      459   8e-150   
ref|XP_011084549.1|  PREDICTED: putative UPF0481 protein At3g02645      458   2e-149   
ref|XP_003561017.1|  PREDICTED: putative UPF0481 protein At3g02645      456   2e-148   
ref|XP_011084585.1|  PREDICTED: putative UPF0481 protein At3g02645      454   1e-147   
ref|XP_004136095.1|  PREDICTED: putative UPF0481 protein At3g0264...    453   4e-147   
ref|XP_004136096.1|  PREDICTED: uncharacterized protein LOC101205322    478   8e-147   
ref|XP_008454198.1|  PREDICTED: putative UPF0481 protein At3g02645      450   2e-146   
ref|XP_010927029.1|  PREDICTED: putative UPF0481 protein At3g02645      449   5e-146   
ref|XP_008809769.1|  PREDICTED: putative UPF0481 protein At3g02645      449   1e-145   
ref|XP_011010776.1|  PREDICTED: putative UPF0481 protein At3g02645      441   1e-143   
gb|KDO43082.1|  hypothetical protein CISIN_1g046834mg                   435   4e-141   
ref|XP_008807192.1|  PREDICTED: putative UPF0481 protein At3g02645      429   2e-138   
ref|XP_008461157.1|  PREDICTED: putative UPF0481 protein At3g02645      429   1e-137   
gb|KGN45237.1|  hypothetical protein Csa_7G432180                       427   6e-137   
gb|KDO43084.1|  hypothetical protein CISIN_1g044514mg                   422   5e-136   
gb|EYU24625.1|  hypothetical protein MIMGU_mgv1a019875mg                422   5e-136   
ref|NP_001189794.1|  uncharacterized protein                            419   1e-134   
ref|XP_006408397.1|  hypothetical protein EUTSA_v10022378mg             410   4e-131   
ref|XP_002882245.1|  predicted protein                                  424   3e-130   
ref|XP_006299858.1|  hypothetical protein CARUB_v10016061mg             408   3e-130   
ref|XP_010417325.1|  PREDICTED: putative UPF0481 protein At3g02645      408   4e-130   
ref|XP_006852811.1|  hypothetical protein AMTR_s00033p00170840          408   9e-130   
emb|CDY68056.1|  BnaAnng26050D                                          406   2e-129   
gb|AAF32472.1|  hypothetical protein                                    421   5e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010467974.1|  PREDICTED: putative UPF0481 protein At3g02645      404   9e-129   
ref|XP_009394006.1|  PREDICTED: putative UPF0481 protein At3g02645      404   1e-128   
emb|CDY68015.1|  BnaAnng25930D                                          403   1e-128   
ref|XP_006852812.1|  hypothetical protein AMTR_s00033p00171210          404   2e-128   
ref|XP_008809768.1|  PREDICTED: putative UPF0481 protein At3g02645      395   8e-127   
gb|KCW70770.1|  hypothetical protein EUGRSUZ_F03930                     394   3e-126   
gb|KDO52339.1|  hypothetical protein CISIN_1g0411282mg                  394   3e-126   
ref|XP_010489648.1|  PREDICTED: putative UPF0481 protein At3g02645      396   1e-125   
ref|XP_008809767.1|  PREDICTED: putative UPF0481 protein At3g02645      394   1e-125   
ref|XP_009118403.1|  PREDICTED: putative UPF0481 protein At3g02645      394   3e-125   
gb|KDO52341.1|  hypothetical protein CISIN_1g044918mg                   390   9e-125   
ref|XP_008666123.1|  PREDICTED: putative UPF0481 protein At3g02645      391   2e-123   
ref|XP_010687822.1|  PREDICTED: putative UPF0481 protein At3g02645      390   2e-123   
ref|XP_004986874.1|  PREDICTED: putative UPF0481 protein At3g0264...    387   4e-122   
ref|XP_010250393.1|  PREDICTED: putative UPF0481 protein At3g02645      380   2e-121   
gb|KHN01305.1|  Putative UPF0481 protein                                380   1e-120   
ref|XP_009410371.1|  PREDICTED: putative UPF0481 protein At3g02645      382   3e-120   
ref|XP_006852809.1|  hypothetical protein AMTR_s00033p00169500          383   4e-120   
ref|XP_008809765.1|  PREDICTED: putative UPF0481 protein At3g02645      373   3e-118   
ref|XP_007135784.1|  hypothetical protein PHAVU_010G1581000g            371   2e-117   
gb|EEE59435.1|  hypothetical protein OsJ_11607                          374   3e-117   Oryza sativa Japonica Group [Japonica rice]
gb|AAT81750.1|  hypothetical protein                                    374   5e-117   Oryza sativa Japonica Group [Japonica rice]
gb|AAR06336.1|  hypothetical protein                                    374   1e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008809764.1|  PREDICTED: putative UPF0481 protein At3g02645      367   4e-116   
ref|XP_006427516.1|  hypothetical protein CICLE_v10027162mg             365   2e-114   
gb|EMT27622.1|  hypothetical protein F775_15946                         368   2e-114   
ref|XP_006427510.1|  hypothetical protein CICLE_v10027325mg             363   5e-114   
ref|XP_002465056.1|  hypothetical protein SORBIDRAFT_01g031420          363   4e-113   Sorghum bicolor [broomcorn]
gb|EYU21692.1|  hypothetical protein MIMGU_mgv1a019845mg                356   2e-111   
gb|EMT20139.1|  hypothetical protein F775_14017                         358   4e-111   
ref|XP_003581086.1|  PREDICTED: putative UPF0481 protein At3g02645      355   2e-109   
ref|XP_011042073.1|  PREDICTED: putative UPF0481 protein At3g0264...    338   3e-103   
ref|XP_002304763.2|  hypothetical protein POPTR_0003s20490g             338   4e-103   Populus trichocarpa [western balsam poplar]
ref|XP_011042071.1|  PREDICTED: putative UPF0481 protein At3g0264...    337   1e-102   
ref|XP_011015933.1|  PREDICTED: putative UPF0481 protein At3g02645      335   5e-102   
dbj|BAJ99504.1|  predicted protein                                      335   9e-102   
gb|KDO39093.1|  hypothetical protein CISIN_1g036543mg                   329   2e-101   
ref|XP_008678249.1|  PREDICTED: putative UPF0481 protein At3g02645      332   9e-101   
ref|XP_004974401.1|  PREDICTED: putative UPF0481 protein At3g0264...    326   2e-98    
ref|XP_003573433.1|  PREDICTED: putative UPF0481 protein At3g02645      326   3e-98    
emb|CBI29170.3|  unnamed protein product                                319   2e-97    
ref|XP_011015934.1|  PREDICTED: putative UPF0481 protein At3g02645      322   4e-97    
ref|XP_006659870.1|  PREDICTED: putative UPF0481 protein At3g0264...    318   3e-95    
ref|NP_001169081.1|  uncharacterized protein LOC100382923               317   8e-95    Zea mays [maize]
gb|EAZ41643.1|  hypothetical protein OsJ_26177                          314   8e-94    Oryza sativa Japonica Group [Japonica rice]
gb|EAZ05725.1|  hypothetical protein OsI_27952                          314   1e-93    Oryza sativa Indica Group [Indian rice]
ref|XP_006427506.1|  hypothetical protein CICLE_v10027406mg             308   2e-93    
ref|NP_001175401.1|  Os08g0167400                                       315   2e-93    
gb|KDO43086.1|  hypothetical protein CISIN_1g0428682mg                  306   4e-93    
emb|CBI31681.3|  unnamed protein product                                307   4e-93    
ref|XP_002445120.1|  hypothetical protein SORBIDRAFT_07g004430          309   8e-92    Sorghum bicolor [broomcorn]
emb|CBI36449.3|  unnamed protein product                                304   2e-91    
ref|XP_002436598.1|  hypothetical protein SORBIDRAFT_10g005390          306   1e-90    Sorghum bicolor [broomcorn]
gb|EMT33160.1|  hypothetical protein F775_13626                         299   3e-90    
ref|NP_001143080.1|  hypothetical protein                               304   8e-90    Zea mays [maize]
gb|KDO37854.1|  hypothetical protein CISIN_1g043783mg                   291   2e-88    
gb|EAY99899.1|  hypothetical protein OsI_21895                          296   3e-88    Oryza sativa Indica Group [Indian rice]
ref|XP_004975089.1|  PREDICTED: putative UPF0481 protein At3g0264...    297   2e-87    
ref|XP_010687780.1|  PREDICTED: putative UPF0481 protein At3g02645      295   5e-87    
ref|XP_009385543.1|  PREDICTED: putative UPF0481 protein At3g02645      282   2e-84    
ref|XP_010025908.1|  PREDICTED: putative UPF0481 protein At3g02645      286   7e-84    
ref|XP_002453500.1|  hypothetical protein SORBIDRAFT_04g006910          286   7e-83    Sorghum bicolor [broomcorn]
ref|XP_007152483.1|  hypothetical protein PHAVU_004G134500g             279   3e-81    
gb|EEE65203.1|  hypothetical protein OsJ_20332                          280   7e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006584162.1|  PREDICTED: putative UPF0481 protein At3g0264...    271   2e-80    
gb|KCW57618.1|  hypothetical protein EUGRSUZ_H00382                     273   1e-78    
ref|XP_003533280.1|  PREDICTED: putative UPF0481 protein At3g0264...    270   9e-78    
ref|XP_009413524.1|  PREDICTED: putative UPF0481 protein At3g02645      267   3e-77    
emb|CDY28699.1|  BnaCnng05850D                                          263   6e-76    
ref|XP_006427509.1|  hypothetical protein CICLE_v10027364mg             260   6e-76    
ref|XP_010025903.1|  PREDICTED: putative UPF0481 protein At3g02645      265   7e-76    
gb|KHM99773.1|  Putative UPF0481 protein                                262   4e-75    
gb|EAY90837.1|  hypothetical protein OsI_12441                          259   1e-74    Oryza sativa Indica Group [Indian rice]
ref|XP_010068366.1|  PREDICTED: putative UPF0481 protein At3g02645      262   1e-74    
ref|XP_007152487.1|  hypothetical protein PHAVU_004G134800g             258   2e-73    
gb|KHN24465.1|  Putative UPF0481 protein                                258   2e-73    
ref|XP_010025902.1|  PREDICTED: putative UPF0481 protein At3g02645      257   5e-73    
ref|XP_003548274.1|  PREDICTED: putative UPF0481 protein At3g0264...    257   8e-73    
gb|KCW57617.1|  hypothetical protein EUGRSUZ_H00381                     256   1e-72    
gb|ACU23293.1|  unknown                                                 255   3e-72    Glycine max [soybeans]
dbj|BAC99540.1|  pentatricopeptide (PPR) repeat-containing protei...    258   3e-72    Oryza sativa Japonica Group [Japonica rice]
gb|KCW44214.1|  hypothetical protein EUGRSUZ_L02360                     251   4e-71    
ref|XP_006584163.1|  PREDICTED: putative UPF0481 protein At3g0264...    242   2e-70    
ref|XP_010068365.1|  PREDICTED: putative UPF0481 protein At3g02645      247   6e-69    
gb|EMT15612.1|  hypothetical protein F775_19815                         236   7e-67    
ref|XP_011084181.1|  PREDICTED: putative UPF0481 protein At3g02645      238   3e-66    
ref|XP_010068363.1|  PREDICTED: putative UPF0481 protein At3g02645      236   4e-65    
gb|KCW44407.1|  hypothetical protein EUGRSUZ_L02105                     231   9e-64    
emb|CDP10499.1|  unnamed protein product                                228   3e-62    
emb|CDP16198.1|  unnamed protein product                                228   4e-62    
gb|KDP37018.1|  hypothetical protein JCGZ_06074                         216   5e-62    
ref|XP_006465279.1|  PREDICTED: putative UPF0481 protein At3g0264...    223   7e-62    
ref|XP_010068362.1|  PREDICTED: putative UPF0481 protein At3g02645      226   1e-61    
ref|XP_007139216.1|  hypothetical protein PHAVU_008G011100g             213   8e-60    
gb|EMS64820.1|  hypothetical protein TRIUR3_27080                       215   4e-59    
ref|XP_009615475.1|  PREDICTED: putative UPF0481 protein At3g02645      219   6e-59    
gb|EMT06592.1|  hypothetical protein F775_03624                         213   4e-58    
ref|XP_004243017.1|  PREDICTED: putative UPF0481 protein At3g02645      214   2e-57    
ref|XP_010041633.1|  PREDICTED: putative UPF0481 protein At3g02645      206   4e-55    
gb|EMT04415.1|  hypothetical protein F775_21123                         197   3e-54    
ref|XP_009760731.1|  PREDICTED: putative UPF0481 protein At3g02645      205   4e-54    
gb|KHM99774.1|  Putative UPF0481 protein                                202   8e-54    
ref|XP_004243020.1|  PREDICTED: putative UPF0481 protein At3g02645      203   2e-53    
ref|XP_010111081.1|  hypothetical protein L484_015136                   203   3e-53    
gb|EYU38309.1|  hypothetical protein MIMGU_mgv1a017744mg                201   4e-53    
ref|XP_010041367.1|  PREDICTED: putative UPF0481 protein At3g02645      196   8e-52    
gb|EMS45711.1|  hypothetical protein TRIUR3_14318                       202   2e-51    
gb|EYU25281.1|  hypothetical protein MIMGU_mgv1a004906mg                192   6e-50    
ref|XP_002530455.1|  hypothetical protein RCOM_0011030                  186   1e-48    Ricinus communis
ref|XP_010025907.1|  PREDICTED: putative UPF0481 protein At3g02645      184   8e-48    
gb|EYU25280.1|  hypothetical protein MIMGU_mgv1a026350mg                185   1e-47    
ref|XP_010111079.1|  hypothetical protein L484_015134                   186   3e-47    
gb|AEX11069.1|  hypothetical protein 0_11495_01                         171   6e-46    
gb|EMT19335.1|  hypothetical protein F775_42765                         172   2e-45    
ref|XP_009770903.1|  PREDICTED: putative UPF0481 protein At3g02645      174   5e-44    
ref|XP_010042194.1|  PREDICTED: putative UPF0481 protein At3g02645      169   4e-43    
gb|KCW63599.1|  hypothetical protein EUGRSUZ_G01225                     171   7e-43    
gb|KCW44512.1|  hypothetical protein EUGRSUZ_L01981                     168   8e-43    
ref|XP_009792464.1|  PREDICTED: putative UPF0481 protein At3g02645      169   2e-42    
gb|KHN14739.1|  Putative UPF0481 protein                                171   4e-42    
ref|XP_009591776.1|  PREDICTED: putative UPF0481 protein At3g02645      162   9e-42    
gb|KCW63598.1|  hypothetical protein EUGRSUZ_G01224                     166   4e-41    
ref|XP_010041237.1|  PREDICTED: putative UPF0481 protein At3g02645      167   9e-41    
gb|EMS57299.1|  hypothetical protein TRIUR3_33500                       159   1e-40    
ref|XP_010111078.1|  hypothetical protein L484_015133                   163   6e-40    
emb|CDO98198.1|  unnamed protein product                                152   3e-37    
emb|CDP09578.1|  unnamed protein product                                150   3e-35    
ref|XP_009760728.1|  PREDICTED: putative UPF0481 protein At3g0264...    146   1e-34    
ref|XP_009760729.1|  PREDICTED: putative UPF0481 protein At3g0264...    146   1e-34    
gb|EMT23033.1|  hypothetical protein F775_17418                         142   2e-34    
ref|XP_006590172.1|  PREDICTED: putative UPF0481 protein At3g0264...    146   4e-34    
gb|KCW44311.1|  hypothetical protein EUGRSUZ_L02244                     139   1e-33    
ref|XP_007161558.1|  hypothetical protein PHAVU_001G079700g             145   3e-33    
ref|XP_010025904.1|  PREDICTED: putative UPF0481 protein At3g02645      136   2e-32    
ref|XP_010042914.1|  PREDICTED: putative UPF0481 protein At3g02645      135   4e-32    
gb|KCW57616.1|  hypothetical protein EUGRSUZ_H00379                     136   3e-31    
ref|XP_007143941.1|  hypothetical protein PHAVU_007G115400g             135   8e-30    
emb|CDP20781.1|  unnamed protein product                                131   5e-29    
ref|XP_007152484.1|  hypothetical protein PHAVU_004G1346001g            130   6e-29    
emb|CDP08144.1|  unnamed protein product                                129   8e-29    
ref|XP_007022355.1|  Uncharacterized protein TCM_032578                 131   8e-29    
gb|KDP44461.1|  hypothetical protein JCGZ_16294                         120   4e-27    
ref|XP_007026840.1|  Uncharacterized protein TCM_021802                 123   3e-26    
gb|EPS60678.1|  hypothetical protein M569_14127                         122   3e-26    
gb|KDP33428.1|  hypothetical protein JCGZ_06999                         120   2e-25    
ref|XP_007022369.1|  Uncharacterized protein TCM_032624                 115   8e-24    
gb|EYU25278.1|  hypothetical protein MIMGU_mgv1a019940mg                114   9e-24    
gb|KHN05013.1|  Putative UPF0481 protein                                115   3e-23    
ref|XP_010041317.1|  PREDICTED: putative UPF0481 protein At3g02645      108   5e-23    
emb|CDP17593.1|  unnamed protein product                                113   9e-23    
emb|CDP08049.1|  unnamed protein product                                111   3e-22    
gb|KDP31987.1|  hypothetical protein JCGZ_12448                         110   4e-22    
gb|KHN05012.1|  Putative UPF0481 protein                                111   4e-22    
gb|ABK24401.1|  unknown                                                 107   2e-21    
ref|XP_010421052.1|  PREDICTED: UPF0481 protein At3g47200-like          107   3e-21    
ref|XP_008800520.1|  PREDICTED: UPF0481 protein At3g47200-like        99.4    1e-18    
ref|XP_008780214.1|  PREDICTED: UPF0481 protein At3g47200-like        99.0    2e-18    
ref|XP_002518651.1|  hypothetical protein RCOM_0810710                94.7    7e-18    
ref|XP_004141645.1|  PREDICTED: putative UPF0481 protein At3g0264...  97.1    1e-17    
ref|XP_008459642.1|  PREDICTED: putative UPF0481 protein At3g02645    97.1    1e-17    
ref|XP_009389077.1|  PREDICTED: UPF0481 protein At3g47200-like        94.0    1e-16    
ref|XP_004289130.1|  PREDICTED: UPF0481 protein At3g47200-like        93.6    1e-16    
ref|XP_008459652.1|  PREDICTED: putative UPF0481 protein At3g02645    94.0    1e-16    
ref|XP_004169586.1|  PREDICTED: putative UPF0481 protein At3g0264...  94.4    1e-16    
ref|XP_010041447.1|  PREDICTED: UPF0481 protein At3g47200-like        92.8    1e-16    
ref|XP_010908930.1|  PREDICTED: UPF0481 protein At3g47200-like        91.7    2e-16    
ref|XP_002451882.1|  hypothetical protein SORBIDRAFT_04g009190        92.8    3e-16    
gb|EMS51503.1|  hypothetical protein TRIUR3_11335                     89.7    4e-16    
ref|XP_010426560.1|  PREDICTED: UPF0481 protein At3g47200-like        92.0    4e-16    
ref|NP_190585.2|  uncharacterized protein                             91.7    5e-16    
ref|XP_010503688.1|  PREDICTED: UPF0481 protein At3g47200-like        91.7    5e-16    
gb|KHN41210.1|  UPF0481 protein                                       90.1    8e-16    
ref|XP_010259276.1|  PREDICTED: UPF0481 protein At3g47200-like        90.5    1e-15    
ref|XP_008222334.1|  PREDICTED: UPF0481 protein At3g47200-like        90.1    1e-15    
ref|XP_002443179.1|  hypothetical protein SORBIDRAFT_08g014550        89.7    1e-15    
ref|XP_006292637.1|  hypothetical protein CARUB_v10018880mg           90.5    1e-15    
ref|XP_010030563.1|  PREDICTED: putative UPF0481 protein At3g02645    88.2    1e-15    
ref|XP_006293039.1|  hypothetical protein CARUB_v10019318mg           90.1    1e-15    
gb|EMT25108.1|  hypothetical protein F775_16296                       88.2    2e-15    
ref|XP_008779673.1|  PREDICTED: UPF0481 protein At3g47200-like        89.4    2e-15    
gb|EYU44433.1|  hypothetical protein MIMGU_mgv1a004084mg              90.1    2e-15    
ref|XP_010031465.1|  PREDICTED: UPF0481 protein At3g47200-like        89.0    3e-15    
gb|EMT15613.1|  hypothetical protein F775_19816                       84.7    3e-15    
ref|XP_007015928.1|  UPF0481 protein, putative                        89.0    3e-15    
ref|XP_010917610.1|  PREDICTED: UPF0481 protein At3g47200-like        88.6    4e-15    
ref|NP_190584.1|  uncharacterized protein                             89.0    4e-15    
emb|CAB62124.1|  putative protein                                     89.0    4e-15    
ref|XP_007217420.1|  hypothetical protein PRUPE_ppa026411mg           88.2    5e-15    
ref|XP_010503687.1|  PREDICTED: UPF0481 protein At3g47200-like        88.6    5e-15    
ref|NP_190586.1|  uncharacterized protein                             88.6    6e-15    
ref|XP_010426559.1|  PREDICTED: UPF0481 protein At3g47200-like        88.6    6e-15    
ref|XP_002877733.1|  hypothetical protein ARALYDRAFT_485374           88.2    7e-15    
gb|AAU44488.1|  hypothetical protein AT3G50170                        88.2    8e-15    
gb|KGN52698.1|  hypothetical protein Csa_5G650621                     87.8    8e-15    
ref|XP_010045492.1|  PREDICTED: UPF0481 protein At3g47200-like        87.4    8e-15    
gb|KDP34692.1|  hypothetical protein JCGZ_10897                       87.4    9e-15    
emb|CDO99351.1|  unnamed protein product                              87.0    9e-15    
ref|XP_010927501.1|  PREDICTED: UPF0481 protein At3g47200-like is...  87.4    1e-14    
ref|XP_006494486.1|  PREDICTED: UPF0481 protein At3g47200-like        87.8    1e-14    
ref|XP_010056254.1|  PREDICTED: UPF0481 protein At3g47200-like        87.0    1e-14    
gb|KDO79087.1|  hypothetical protein CISIN_1g009939mg                 87.4    1e-14    
ref|XP_006425970.1|  hypothetical protein CICLE_v10025336mg           87.4    1e-14    
ref|XP_010927499.1|  PREDICTED: UPF0481 protein At3g47200-like is...  87.4    1e-14    
ref|XP_010093525.1|  hypothetical protein L484_007240                 87.4    1e-14    
ref|XP_009395234.1|  PREDICTED: UPF0481 protein At3g47200-like        87.0    1e-14    
gb|EMT10078.1|  hypothetical protein F775_13183                       86.7    1e-14    
gb|EMS67396.1|  hypothetical protein TRIUR3_09783                     86.7    1e-14    
gb|ABK28593.1|  unknown                                               87.0    2e-14    
ref|XP_002877732.1|  hypothetical protein ARALYDRAFT_485373           87.0    2e-14    
ref|XP_006384655.1|  hypothetical protein POPTR_0004s19870g           86.3    2e-14    
ref|XP_009353518.1|  PREDICTED: UPF0481 protein At3g47200-like        86.3    2e-14    
ref|XP_010243811.1|  PREDICTED: UPF0481 protein At3g47200             86.7    2e-14    
gb|KCW50773.1|  hypothetical protein EUGRSUZ_J00441                   86.3    2e-14    
ref|XP_006840961.1|  hypothetical protein AMTR_s00085p00029680        87.0    2e-14    
gb|KCW78764.1|  hypothetical protein EUGRSUZ_C00198                   85.9    2e-14    
ref|XP_010679532.1|  PREDICTED: UPF0481 protein At3g47200             86.7    2e-14    
ref|XP_010034196.1|  PREDICTED: UPF0481 protein At3g47200-like        86.3    2e-14    
emb|CDY23016.1|  BnaC07g31710D                                        84.7    2e-14    
ref|XP_010050240.1|  PREDICTED: UPF0481 protein At3g47200-like        85.9    2e-14    
ref|XP_008798703.1|  PREDICTED: UPF0481 protein At3g47200-like        84.7    2e-14    
ref|XP_006351390.1|  PREDICTED: UPF0481 protein At3g47200-like        86.7    2e-14    
ref|XP_009348601.1|  PREDICTED: UPF0481 protein At3g47200-like        85.9    2e-14    
ref|XP_006384651.1|  hypothetical protein POPTR_0004s19830g           86.3    2e-14    
ref|XP_006388739.1|  hypothetical protein POPTR_0108s00240g           84.0    3e-14    
ref|XP_002515541.1|  conserved hypothetical protein                   85.5    3e-14    
ref|XP_010911903.1|  PREDICTED: UPF0481 protein At3g47200-like        86.3    3e-14    
ref|XP_009136538.1|  PREDICTED: UPF0481 protein At3g47200             86.3    3e-14    
emb|CDY02093.1|  BnaA03g40740D                                        86.3    3e-14    
ref|XP_009785365.1|  PREDICTED: UPF0481 protein At3g47200-like        86.3    3e-14    
ref|XP_010030570.1|  PREDICTED: UPF0481 protein At3g47200-like        86.7    3e-14    
gb|KCW54898.1|  hypothetical protein EUGRSUZ_I00876                   85.9    4e-14    
gb|EAY81213.1|  hypothetical protein OsI_36391                        85.5    4e-14    
ref|XP_010050754.1|  PREDICTED: UPF0481 protein At3g47200-like        85.5    4e-14    
ref|XP_011086479.1|  PREDICTED: UPF0481 protein At3g47200-like is...  85.1    4e-14    
ref|XP_007034457.1|  Uncharacterized protein isoform 1                85.1    4e-14    
ref|XP_006582344.1|  PREDICTED: putative UPF0481 protein At3g0264...  85.1    4e-14    
ref|XP_010023722.1|  PREDICTED: UPF0481 protein At3g47200-like        83.2    4e-14    
ref|XP_003526324.1|  PREDICTED: UPF0481 protein At3g47200-like        84.7    4e-14    
ref|XP_006339855.1|  PREDICTED: UPF0481 protein At3g47200-like        85.9    4e-14    
ref|XP_010942387.1|  PREDICTED: UPF0481 protein At3g47200-like        85.1    5e-14    
ref|XP_007224029.1|  hypothetical protein PRUPE_ppa015150mg           85.5    5e-14    
emb|CDY00699.1|  BnaC03g36830D                                        83.6    5e-14    
emb|CDY00695.1|  BnaC03g36790D                                        83.6    5e-14    
ref|XP_010066263.1|  PREDICTED: UPF0481 protein At3g47200-like        85.1    5e-14    
gb|KCW80455.1|  hypothetical protein EUGRSUZ_C01795                   84.3    5e-14    
ref|XP_006388740.1|  hypothetical protein POPTR_0108s00240g           85.1    5e-14    
ref|XP_009353391.1|  PREDICTED: UPF0481 protein At3g47200-like        85.1    5e-14    
ref|XP_006387153.1|  hypothetical protein POPTR_1686s00200g           85.1    5e-14    
ref|XP_008779791.1|  PREDICTED: UPF0481 protein At3g47200-like        83.6    5e-14    
ref|XP_002528598.1|  conserved hypothetical protein                   85.1    6e-14    
ref|XP_010048250.1|  PREDICTED: UPF0481 protein At3g47200-like        84.7    6e-14    
ref|XP_002310707.1|  hypothetical protein POPTR_0007s10640g           85.1    7e-14    
gb|KHN41215.1|  UPF0481 protein                                       85.1    7e-14    
emb|CDO99345.1|  unnamed protein product                              84.0    8e-14    
ref|XP_004249743.1|  PREDICTED: UPF0481 protein At3g47200-like        84.7    8e-14    
ref|XP_010030528.1|  PREDICTED: UPF0481 protein At3g47200-like        82.4    8e-14    
ref|XP_004231874.1|  PREDICTED: UPF0481 protein At3g47200             84.7    9e-14    
ref|XP_010250414.1|  PREDICTED: UPF0481 protein At3g47200-like        84.3    9e-14    
ref|XP_006388733.1|  hypothetical protein POPTR_0108s00200g           82.4    9e-14    
ref|XP_002449055.1|  hypothetical protein SORBIDRAFT_05g004185        84.0    9e-14    
emb|CDY02089.1|  BnaA03g40780D                                        84.3    9e-14    
gb|EYU38618.1|  hypothetical protein MIMGU_mgv1a006266mg              84.3    9e-14    
emb|CDY23015.1|  BnaC07g31720D                                        84.3    1e-13    
emb|CDY23020.1|  BnaC07g31670D                                        84.7    1e-13    
ref|XP_004249744.1|  PREDICTED: UPF0481 protein At3g47200-like        84.7    1e-13    
ref|XP_008231146.1|  PREDICTED: UPF0481 protein At3g47200-like        84.0    1e-13    
ref|XP_009136541.1|  PREDICTED: UPF0481 protein At3g47200-like        84.3    1e-13    
ref|XP_010023716.1|  PREDICTED: uncharacterized protein LOC104414341  81.3    1e-13    
ref|XP_010270826.1|  PREDICTED: UPF0481 protein At3g47200-like        84.3    1e-13    
ref|XP_004288002.1|  PREDICTED: UPF0481 protein At3g47200-like        84.3    1e-13    
gb|KDP22060.1|  hypothetical protein JCGZ_25891                       83.6    1e-13    
ref|XP_008241878.1|  PREDICTED: UPF0481 protein At3g47200-like        84.0    1e-13    
ref|XP_011005812.1|  PREDICTED: UPF0481 protein At3g47200             84.0    1e-13    
gb|KCW60064.1|  hypothetical protein EUGRSUZ_H02793                   82.4    1e-13    
ref|XP_010558850.1|  PREDICTED: UPF0481 protein At3g47200             84.0    1e-13    
ref|XP_009619623.1|  PREDICTED: UPF0481 protein At3g47200-like        84.0    1e-13    
ref|XP_009355871.1|  PREDICTED: UPF0481 protein At3g47200-like        83.2    2e-13    
ref|XP_007030490.1|  Uncharacterized protein TCM_026256               83.6    2e-13    
ref|XP_009395235.1|  PREDICTED: UPF0481 protein At3g47200-like        84.0    2e-13    
ref|XP_009353385.1|  PREDICTED: UPF0481 protein At3g47200-like        83.2    2e-13    
ref|XP_010912062.1|  PREDICTED: UPF0481 protein At3g47200-like        82.8    2e-13    
emb|CDP02532.1|  unnamed protein product                              84.0    2e-13    
ref|XP_002278393.1|  PREDICTED: UPF0481 protein At3g47200             83.6    2e-13    
ref|XP_006404055.1|  hypothetical protein EUTSA_v10010280mg           83.6    2e-13    
tpg|DAA61082.1|  TPA: hypothetical protein ZEAMMB73_046017            83.2    2e-13    
dbj|BAF98606.1|  CM0545.450.nc                                        83.2    2e-13    
ref|XP_009128936.1|  PREDICTED: UPF0481 protein At3g47200-like is...  83.6    2e-13    
ref|XP_006388736.1|  hypothetical protein POPTR_0108s00220g           83.2    2e-13    
ref|XP_008652580.1|  PREDICTED: UPF0481 protein At3g47200-like        83.2    2e-13    
ref|XP_010045251.1|  PREDICTED: UPF0481 protein At3g47200-like        83.2    2e-13    
gb|KCW87411.1|  hypothetical protein EUGRSUZ_B03889                   82.8    2e-13    
ref|XP_008350149.1|  PREDICTED: UPF0481 protein At3g47200-like        83.2    2e-13    
gb|KHN41217.1|  UPF0481 protein                                       82.8    2e-13    
ref|XP_007014566.1|  Uncharacterized protein TCM_039778               82.8    2e-13    
ref|XP_007156767.1|  hypothetical protein PHAVU_002G015900g           83.2    2e-13    
emb|CAN82276.1|  hypothetical protein VITISV_020522                   83.2    2e-13    
ref|XP_006290339.1|  hypothetical protein CARUB_v10016996mg           83.2    2e-13    
ref|XP_007049922.1|  Uncharacterized protein TCM_003171               83.2    2e-13    
ref|XP_010244239.1|  PREDICTED: UPF0481 protein At3g47200-like        83.2    2e-13    
ref|XP_008440314.1|  PREDICTED: UPF0481 protein At3g47200             83.2    3e-13    
emb|CDY30604.1|  BnaAnng03790D                                        83.2    3e-13    
ref|XP_009793821.1|  PREDICTED: UPF0481 protein At3g47200-like        83.2    3e-13    
emb|CDY17749.1|  BnaC08g21570D                                        83.2    3e-13    
ref|XP_010036333.1|  PREDICTED: UPF0481 protein At3g47200-like        82.8    3e-13    
ref|XP_010242643.1|  PREDICTED: UPF0481 protein At3g47200-like        82.8    3e-13    
ref|XP_009115692.1|  PREDICTED: UPF0481 protein At3g47200-like        83.2    3e-13    
emb|CDO97121.1|  unnamed protein product                              77.0    3e-13    
ref|XP_010503686.1|  PREDICTED: UPF0481 protein At3g47200-like        82.8    3e-13    
ref|XP_006388735.1|  hypothetical protein POPTR_0108s00210g           82.4    3e-13    
ref|XP_010426554.1|  PREDICTED: UPF0481 protein At3g47200             82.8    3e-13    
gb|KDP34695.1|  hypothetical protein JCGZ_10900                       82.4    3e-13    
ref|XP_002877729.1|  hypothetical protein ARALYDRAFT_485370           82.8    4e-13    
ref|XP_010644741.1|  PREDICTED: UPF0481 protein At3g47200-like        82.4    4e-13    
ref|XP_009350298.1|  PREDICTED: UPF0481 protein At3g47200-like        82.0    4e-13    
ref|XP_008670773.1|  PREDICTED: UPF0481 protein At3g47200-like        82.4    4e-13    
gb|KDP28573.1|  hypothetical protein JCGZ_14344                       83.2    4e-13    
ref|NP_190581.1|  uncharacterized protein                             82.8    4e-13    
ref|XP_010431199.1|  PREDICTED: LOW QUALITY PROTEIN: UPF0481 prot...  82.4    4e-13    
ref|XP_006360837.1|  PREDICTED: putative UPF0481 protein At3g0264...  82.0    4e-13    
emb|CDP15373.1|  unnamed protein product                              82.4    4e-13    
ref|XP_010503684.1|  PREDICTED: UPF0481 protein At3g47200-like        82.8    4e-13    
tpg|DAA42078.1|  TPA: hypothetical protein ZEAMMB73_592358            82.4    4e-13    
ref|XP_009350296.1|  PREDICTED: UPF0481 protein At3g47200-like        81.3    4e-13    
gb|AAU44487.1|  hypothetical protein AT3G50120                        82.4    4e-13    
ref|XP_009395231.1|  PREDICTED: UPF0481 protein At3g47200-like        83.2    4e-13    
ref|XP_010644657.1|  PREDICTED: UPF0481 protein At3g47200-like        82.4    5e-13    
ref|XP_010034508.1|  PREDICTED: UPF0481 protein At3g47200-like        82.0    5e-13    
ref|XP_006293111.1|  hypothetical protein CARUB_v10019405mg           82.4    5e-13    
gb|KCW52264.1|  hypothetical protein EUGRSUZ_J01683                   81.6    5e-13    
ref|XP_010023544.1|  PREDICTED: UPF0481 protein At3g47200-like        81.6    5e-13    
gb|KDP42690.1|  hypothetical protein JCGZ_23630                       79.7    5e-13    
ref|XP_010046730.1|  PREDICTED: UPF0481 protein At3g47200-like        82.0    5e-13    
ref|XP_010911909.1|  PREDICTED: UPF0481 protein At3g47200-like        82.0    5e-13    
ref|XP_008391759.1|  PREDICTED: UPF0481 protein At3g47200-like        81.6    6e-13    
ref|XP_004979420.1|  PREDICTED: UPF0481 protein At3g47200-like        81.6    6e-13    
ref|XP_007203175.1|  hypothetical protein PRUPE_ppa024561mg           80.9    6e-13    
ref|XP_010431201.1|  PREDICTED: LOW QUALITY PROTEIN: UPF0481 prot...  81.6    6e-13    
ref|XP_007047372.1|  Uncharacterized protein TCM_000684               82.0    6e-13    
ref|XP_008798881.1|  PREDICTED: UPF0481 protein At3g47200-like        80.5    6e-13    
gb|EMS50847.1|  hypothetical protein TRIUR3_27150                     81.6    6e-13    
ref|XP_006386037.1|  hypothetical protein POPTR_0003s20630g           81.6    7e-13    
ref|XP_002449645.1|  hypothetical protein SORBIDRAFT_05g020790        81.6    7e-13    
ref|XP_007203930.1|  hypothetical protein PRUPE_ppa018818mg           82.0    7e-13    
ref|NP_190587.1|  uncharacterized protein                             82.0    7e-13    
ref|XP_011033130.1|  PREDICTED: UPF0481 protein At3g47200-like        80.9    7e-13    
ref|XP_002449644.1|  hypothetical protein SORBIDRAFT_05g020780        81.6    7e-13    
ref|NP_001078266.1|  uncharacterized protein                          81.3    7e-13    
ref|XP_007141615.1|  hypothetical protein PHAVU_008G211000g           81.6    7e-13    
gb|KDP22057.1|  hypothetical protein JCGZ_25888                       81.3    7e-13    
ref|XP_010242105.1|  PREDICTED: putative UPF0481 protein At3g02645    81.6    7e-13    
gb|AFW64916.1|  hypothetical protein ZEAMMB73_820356                  81.3    8e-13    
ref|XP_011099100.1|  PREDICTED: UPF0481 protein At3g47200             81.6    8e-13    
ref|XP_008369586.1|  PREDICTED: UPF0481 protein At3g47200-like        80.9    8e-13    
ref|NP_001141639.2|  uncharacterized protein LOC100273762             81.3    8e-13    
ref|XP_008371667.1|  PREDICTED: UPF0481 protein At3g47200-like        81.3    8e-13    
ref|XP_002303881.2|  hypothetical protein POPTR_0003s20550g           81.3    9e-13    
gb|KCW86090.1|  hypothetical protein EUGRSUZ_B02788                   80.5    9e-13    
gb|KHN36255.1|  UPF0481 protein                                       81.6    9e-13    
ref|XP_009618295.1|  PREDICTED: UPF0481 protein At3g47200-like        81.3    9e-13    
ref|XP_008445187.1|  PREDICTED: UPF0481 protein At3g47200-like        81.3    9e-13    
gb|KDP23229.1|  hypothetical protein JCGZ_23062                       81.3    9e-13    
ref|XP_003578269.2|  PREDICTED: UPF0481 protein At3g47200-like        82.0    9e-13    
gb|KCW54887.1|  hypothetical protein EUGRSUZ_I00852                   81.3    1e-12    
ref|XP_010028193.1|  PREDICTED: UPF0481 protein At3g47200-like        81.3    1e-12    
gb|EYU38311.1|  hypothetical protein MIMGU_mgv1a026329mg              79.7    1e-12    
gb|KCW54847.1|  hypothetical protein EUGRSUZ_I00792                   79.0    1e-12    
ref|XP_006430220.1|  hypothetical protein CICLE_v10011747mg           80.9    1e-12    
ref|XP_010046511.1|  PREDICTED: UPF0481 protein At3g47200-like        80.5    1e-12    
gb|EAY81226.1|  hypothetical protein OsI_36401                        79.0    1e-12    
gb|KFK36531.1|  hypothetical protein AALP_AA4G136200                  80.9    1e-12    
ref|XP_010047174.1|  PREDICTED: UPF0481 protein At3g47200-like        80.9    1e-12    
ref|XP_010036334.1|  PREDICTED: UPF0481 protein At3g47200-like        80.9    1e-12    
ref|XP_003526331.1|  PREDICTED: putative UPF0481 protein At3g0264...  80.5    1e-12    
ref|XP_003623076.1|  hypothetical protein MTR_7g060840                80.9    1e-12    



>ref|XP_009761357.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana sylvestris]
Length=560

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/540 (57%), Positives = 392/540 (73%), Gaps = 4/540 (1%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I++TL+ ELEE+ EI VSI+ VPK+LMV DP+ YVPQ VAIGPYHY  PEL+
Sbjct  18    DEHRWVIQIRRTLDEELEEDTEIPVSIYNVPKSLMVSDPDSYVPQLVAIGPYHYWRPELY  77

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             +MER+KLDAAK  QK L ++K H L E+++K + RIR SY K LN   ETLAWMMAVDAS
Sbjct  78    DMERYKLDAAKRTQKHLVSLKFHHLVEQLIKFDHRIRCSYHKYLNFSGETLAWMMAVDAS  137

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL++YA  EGKL+   +S++MSHLVD+ G+KS+HNA+LRDIIMLENQIP FILRKM
Sbjct  138   FLLEFLQIYATNEGKLLTK-VSSRMSHLVDVAGRKSTHNAILRDIIMLENQIPLFILRKM  196

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L+ Q PS + +D+ LL+MLMG  KELSPFK  +     Q+ +  H+L +L+Q IVP++E 
Sbjct  197   LEFQFPSLDFADNTLLSMLMGFCKELSPFKMVKEFQQFQLTECAHILDFLYQFIVPKLER  256

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
                EI  +++    +   GE   + K+  +V   F  VW IL K+N+GP R LKR+    
Sbjct  257   T-CEI-TEDDREQTDLNPGENSSYAKSISHVGQVFRGVWKILLKINRGPVRLLKRIVFSR  314

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIP  881
             PVK +  +PWK ++ LPG+ +   PI  +    +K + D   +S+ N +KPP +EEI IP
Sbjct  315   PVKLIFKLPWKLLSNLPGIKLFAQPIAYMCFSQEKEEQDPEKESESNINKPPLVEEIAIP  374

Query  880   SVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGP  701
             SVT+L  AGV F+ T  GI+SI FD K    YLP+V LDIN+E +LRNLVAYEAC A GP
Sbjct  375   SVTKLTKAGVSFVATNSGIMSINFDGKKMKFYLPIVNLDINTEAILRNLVAYEACNASGP  434

Query  700   LVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDK  521
             LV   YTE MNGI+DT+ED   LREKGIILNRLKSD+EVANLWNGM+KSVRLTKV +LDK
Sbjct  435   LVFTCYTELMNGIIDTEEDAVLLREKGIILNRLKSDTEVANLWNGMSKSVRLTKVPYLDK  494

Query  520   TIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFN  341
              I+DVN FYN RW VK  + M+ Y+FGSWQFLT +A I+ L L  LQ+FCSVY C+R FN
Sbjct  495   VIEDVNGFYNRRWKVKIGKIMKHYVFGSWQFLTFMACIMFLFLTTLQAFCSVYKCARIFN  554



>ref|XP_007023343.1| Uncharacterized protein TCM_027333 [Theobroma cacao]
 gb|EOY25965.1| Uncharacterized protein TCM_027333 [Theobroma cacao]
Length=560

 Score =   583 bits (1504),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/555 (56%), Positives = 406/555 (73%), Gaps = 13/555 (2%)
 Frame = -3

Query  1969  NIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN  1790
             N   DE +WVI+I++TLE ELE++NEI VSIF VPKTL+  DP+ Y PQ VAIGPYHY  
Sbjct  13    NANFDERRWVINIRRTLEAELEDDNEIPVSIFNVPKTLLSSDPDSYTPQLVAIGPYHYWR  72

Query  1789  PELHEMERHKLDAAKIFQKQL-RTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
             PEL+EMER+K+DAAK  QK L   ++   L E++  +E +IR  Y K L+   ETLAWMM
Sbjct  73    PELYEMERYKIDAAKRTQKNLLNNLQFDDLVEQLTWLEPKIRACYHKLLDFSNETLAWMM  132

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
             A+DASFLLEFL++YA+KEGKL+   +S++M+HLVD  G+KS+HNA+LRDI+MLENQIP F
Sbjct  133   AIDASFLLEFLQIYAMKEGKLLTR-VSSRMAHLVDYAGRKSAHNAILRDIMMLENQIPLF  191

Query  1432  ILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIV  1256
             +LRKML+ Q  S E +DDLLL+ML G+ KELSPFK  +    +++++ +HLL  L+  IV
Sbjct  192   VLRKMLEVQSASLEPADDLLLSMLTGVCKELSPFKMMKVLPKIRVSETSHLLDCLYDMIV  251

Query  1255  PEME----SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPAR  1088
             P+++    SE  EIE        ++         ++ GYV+    +VW +L KLNKGP  
Sbjct  252   PKLQPRTTSEISEIEDQNEDMKGKEGSS------EDPGYVQQLLSEVWKLLSKLNKGPIH  305

Query  1087  ALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKP  908
              +K+L    P+K +  +PW  I+KLPG +++K P+E  F   +  + D++      ADKP
Sbjct  306   LIKKLLVSKPIKVIFKLPWIIISKLPGFSILKQPVEYFFFNEENKEDDKSEGEGSGADKP  365

Query  907   PSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVA  728
             P +EEITIPSV+EL+N+GVRF+PT   +L+I FD KT T YLP V+LD+N+EV++RNLVA
Sbjct  366   PLVEEITIPSVSELSNSGVRFLPTTGNLLTITFDVKTVTFYLPTVSLDVNTEVIMRNLVA  425

Query  727   YEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVR  548
             YEA  A GPLV  RYTE MNGI+DT+EDVK LREKGIILNRLK D E A+LWNGM+KS+R
Sbjct  426   YEASNASGPLVFTRYTELMNGIIDTEEDVKLLREKGIILNRLKRDQEAADLWNGMSKSIR  485

Query  547   LTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCS  368
             LTKV FLDK I++VNK++N RWN+K K  M+SY+FGSWQFLT +A I+LLLLM LQ+FCS
Sbjct  486   LTKVPFLDKAIEEVNKYHNGRWNIKAKNMMKSYVFGSWQFLTFMAAILLLLLMALQAFCS  545

Query  367   VYTCSRFFNDVTILG  323
             VY+CSR F+  T  G
Sbjct  546   VYSCSRVFHIKTSTG  560



>ref|XP_009616817.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana tomentosiformis]
Length=560

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/547 (56%), Positives = 387/547 (71%), Gaps = 18/547 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I++TL+ ELEE+ EI VSI+ VPK+LMV DP+ YVPQ VAIGPYHY  PEL+
Sbjct  18    DERRWVIQIRRTLDEELEEDTEIPVSIYNVPKSLMVSDPDSYVPQLVAIGPYHYWRPELY  77

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             +MER+KL AAK  QK L+ +K   L E+++K + RIR SY K LN   ETLAWMMAVDAS
Sbjct  78    DMERYKLSAAKTTQKHLQGLKFQQLVEQLIKFDHRIRCSYHKYLNFSGETLAWMMAVDAS  137

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL++YA  EGKL+   +S++MSHLVD+ G+KS+HNA+LRDIIMLENQIP F+LRKM
Sbjct  138   FLLEFLQIYATNEGKLITK-VSSRMSHLVDVAGRKSTHNAILRDIIMLENQIPLFLLRKM  196

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEME-  1244
             L+ Q  S + SD+ LL+MLMG  KELSPFK  +     Q+ +  H+L +L+Q IVP++E 
Sbjct  197   LEFQFSSLDFSDNTLLSMLMGFCKELSPFKMVKEFPKFQLTECAHMLDFLYQFIVPKLER  256

Query  1243  ------SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARAL  1082
                    +H + +++               F K+  +V   F  VW IL K+N+GP R L
Sbjct  257   TCEITEDDHDQTDVNRGENSS---------FAKSISHVGQVFRGVWKILLKINRGPVRLL  307

Query  1081  KRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPS  902
             KR+    PVK +  +PWK ++ LPG+ +   PI  +    +K + +   +S+ N +KPP 
Sbjct  308   KRIVFSRPVKLIFKLPWKLLSSLPGIKLFAQPIAYMCFSEEKAEENPEKESESNINKPPL  367

Query  901   IEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYE  722
             +EEI IPSVT+L  AGV F+ T  GI+SI FD K    YLP V+LDIN+E +LRNLVAYE
Sbjct  368   VEEIAIPSVTKLTKAGVSFVATNSGIMSINFDGKKMKFYLPTVSLDINTETILRNLVAYE  427

Query  721   ACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLT  542
             AC A GPLV  RYTE MNGI+DT+ED   LREKGIILNRLK D+EVANLWNGM+KSVRLT
Sbjct  428   ACNASGPLVFTRYTELMNGIIDTEEDAALLREKGIILNRLKRDAEVANLWNGMSKSVRLT  487

Query  541   KVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVY  362
             KV FLDK I+DVN FYN RW VK  + M+ Y+FGSWQFLT +A I+ L L  LQ+FCSVY
Sbjct  488   KVPFLDKVIEDVNGFYNRRWKVKIVKIMKHYVFGSWQFLTFMACIMFLFLTTLQAFCSVY  547

Query  361   TCSRFFN  341
              C+R FN
Sbjct  548   KCARIFN  554



>ref|XP_004305490.1| PREDICTED: putative UPF0481 protein At3g02645-like [Fragaria 
vesca subsp. vesca]
Length=557

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/542 (57%), Positives = 394/542 (73%), Gaps = 9/542 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             +E +WVI I+KTLE ELE+ENEI VSIF VPKTL+  DPE Y PQ VAIGPYHY  PEL+
Sbjct  17    NELQWVIQIRKTLEAELEDENEIPVSIFNVPKTLLATDPESYTPQLVAIGPYHYWRPELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+K+ AAK  QKQL+T+K   L +++ + E RIR  Y K L    ETL WMMA+DAS
Sbjct  77    EMERYKVAAAKRTQKQLQTLKFQHLVDQLTRFEPRIRACYHKYLEFNGETLGWMMAIDAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             F LE L+VYAV+EGK +   +S++M+HLVD  G+KS+H+ +LRD +MLENQIP F+LRK+
Sbjct  137   FFLEILQVYAVQEGKTLTR-VSSRMAHLVDYAGRKSAHHTILRDFVMLENQIPLFVLRKV  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQTIVPEME  1244
             L+ Q P+ E +DD+LL+MLMGL KELSPFK  +E    +Q++   HLL +L+Q + P++E
Sbjct  196   LEFQFPTLECADDMLLSMLMGLCKELSPFKMKDEDLPKIQVSSCCHLLDFLYQLVTPKLE  255

Query  1243  SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
             +   EI  +E+      K+        NS YVK    +VW +L KLNKGP R LK++   
Sbjct  256   AGPSEITEEEDSKGTPHKEKSSA----NSNYVKQFLDEVWKLLSKLNKGPIRLLKKILIS  311

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPD-GDENSDSKDNADKPPSIEEIT  887
              PVK +  +PW  ++ LPG  ++K P++SLFS   K     E+  S +   KPP IEEIT
Sbjct  312   GPVKVIFKLPWTILSNLPGFAILKQPLQSLFSSEDKEAVKPEDEKSSNGISKPPLIEEIT  371

Query  886   IPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAK  707
             +PSV++LA +GV+F+P    + SI FDAKT + YLP  +LD N+EV+LRNLVAYEA  A 
Sbjct  372   VPSVSDLAKSGVKFLPVS-SVSSISFDAKTCSFYLPSTSLDGNTEVILRNLVAYEASTAS  430

Query  706   GPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFL  527
             GPLV  RYTE MNGI+DT+ED K LREKGIILNRLKSD EVANL+NGM+KS+RLTKV F+
Sbjct  431   GPLVFTRYTELMNGIIDTEEDAKLLREKGIILNRLKSDEEVANLYNGMSKSIRLTKVPFM  490

Query  526   DKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRF  347
             DK I+D NK+YN RW VK +RFM++Y+FGSW  L LLA I+LLLLM LQ+FCSVYTCSR 
Sbjct  491   DKAIEDANKYYNGRWKVKLRRFMKTYVFGSWPILALLAAILLLLLMTLQAFCSVYTCSRI  550

Query  346   FN  341
             FN
Sbjct  551   FN  552



>ref|XP_002313925.1| hypothetical protein POPTR_0009s08870g [Populus trichocarpa]
 gb|EEE87880.1| hypothetical protein POPTR_0009s08870g [Populus trichocarpa]
Length=559

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/541 (56%), Positives = 388/541 (72%), Gaps = 5/541 (1%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +W+I+I++TLE ELE + EI V IF VPK LM  DP+ Y PQ VAIGPYH+  PEL+
Sbjct  17    DEHRWIINIRRTLEEELENDAEIPVCIFNVPKALMTSDPDSYTPQEVAIGPYHHWRPELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL AAK  QK+++++K   + + + K+E +IR  Y K L+   ETL WMMA+DAS
Sbjct  77    EMERYKLAAAKRTQKKIQSLKFQHIVDHLSKLELKIRACYHKFLDFSNETLTWMMAIDAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL++YA+KEG  +  + S  MSHLVD  G+KS+HNA+LRD+ MLENQIP F+LRK+
Sbjct  137   FLLEFLEIYAIKEGIAITRVSSRSMSHLVDYAGRKSAHNAILRDVAMLENQIPLFVLRKI  196

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L+ Q  S E +DD+L +ML+G  KELSPFK  +    + I    HLL YL+  IVP++E+
Sbjct  197   LEVQLSSLELADDMLCSMLLGFCKELSPFKLMQDIPKIHIPQCAHLLDYLYDMIVPKVEA  256

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
                  EI      + +          NS +++  F ++W I+ +LNKGP R LKRL    
Sbjct  257   PP---EIISEADDQPEAMEGRYNSSGNSSHIRDLFSEIWKIITRLNKGPVRLLKRLLFSR  313

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLF-SCGQKPDGDENSDSKDNADKPPSIEEITI  884
             P K +L +PW  ++ LPG +++K P++ LF S  Q+    EN +S +  ++PP +EEITI
Sbjct  314   PCKVILKLPWTILSNLPGFSILKQPLQHLFFSQDQEEIKPENENSDNEVNRPPLVEEITI  373

Query  883   PSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKG  704
             P VTEL+ +GV F PT   ILSI FD K  TLYLPV++ D+N+EVVLRNLVA+EA  A G
Sbjct  374   PCVTELSKSGVCFAPTTGNILSITFDIKAVTLYLPVISFDVNTEVVLRNLVAFEASNASG  433

Query  703   PLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLD  524
             PLV  RYTE MNGI+DT+EDVKFLREKGIILNRLKSD EVANLWNGM+KS+RLTKV FLD
Sbjct  434   PLVFTRYTELMNGIIDTEEDVKFLREKGIILNRLKSDGEVANLWNGMSKSIRLTKVPFLD  493

Query  523   KTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFF  344
             K I+DVNK+YN RW VK  +FM+ Y+FGSWQFLTLLA + LLLLM LQ+FCSVY CSR  
Sbjct  494   KVIEDVNKYYNQRWTVKVGKFMKRYVFGSWQFLTLLAAVFLLLLMTLQAFCSVYRCSRVL  553

Query  343   N  341
             +
Sbjct  554   H  554



>ref|XP_009772094.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana sylvestris]
Length=550

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/540 (55%), Positives = 393/540 (73%), Gaps = 8/540 (1%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE++WVI I++TL+ EL+E+ EI VSIF VPK+L++ D + YVPQ V+IGPYHY   ELH
Sbjct  12    DENRWVIQIRRTLDEELDEDTEIPVSIFNVPKSLLLSDQDSYVPQVVSIGPYHYWRTELH  71

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             +MER+KL AAK  QKQL+++K   L E+++  E RIR SY K LN   ETLAWMMAVDAS
Sbjct  72    DMERYKLAAAKRTQKQLQSLKFQHLVEQLINFEHRIRCSYHKYLNFNGETLAWMMAVDAS  131

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL++YA++EGK++   +S++MSHLVD+ G+KS+HNA+LRD+IMLENQIP FILRKM
Sbjct  132   FLLEFLQIYAIREGKILTK-VSSRMSHLVDIAGRKSAHNAILRDLIMLENQIPLFILRKM  190

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L+ Q  S E +D++L+ ML    KELSPF+  +    +Q+ +  HLL +L+Q IVP++++
Sbjct  191   LEFQFSSLELADNMLVCMLTAFCKELSPFQMVDEFPKIQVTECAHLLDFLYQFIVPKLDA  250

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
                  E  ++    +    E   F+  S ++     ++W IL K+N+GP R LKR+    
Sbjct  251   TSEITE--DDHEQTDANQVENSNFVGKSSHIGQLINEIWKILVKINRGPVRLLKRIVFSR  308

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIP  881
             PVK +  +PWK I+ LPG+ +   PI  +F   +K +     +S+ N +KPP  +EI IP
Sbjct  309   PVKLMFKLPWKFISNLPGIKLFILPITYMFFSQEKAE----VNSETNVNKPPLFKEIAIP  364

Query  880   SVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGP  701
             SVTEL+ AGV F+ T  GI+SI FD K    YLP V+LD+N+EV+LRNLVAYEAC A GP
Sbjct  365   SVTELSKAGVSFVATNAGIMSINFDDKKMKFYLPTVSLDVNTEVILRNLVAYEACNASGP  424

Query  700   LVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDK  521
             LV  RYTE MNGI+DT+ED   LRE+GIILNRLKSD EVANLWNGM++S+RLTKV FLDK
Sbjct  425   LVFTRYTELMNGIIDTEEDAMLLRERGIILNRLKSDKEVANLWNGMSRSLRLTKVQFLDK  484

Query  520   TIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFN  341
              I+DVN FYN RWN+KT + M+ Y+FGSWQ LT LA I+LL+LM LQ+FCSVY C+R F+
Sbjct  485   VIEDVNGFYNGRWNIKTGKMMKHYVFGSWQVLTFLACIMLLMLMTLQAFCSVYKCARIFH  544



>ref|XP_011005031.1| PREDICTED: putative UPF0481 protein At3g02645 [Populus euphratica]
Length=552

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/545 (55%), Positives = 387/545 (71%), Gaps = 5/545 (1%)
 Frame = -3

Query  1969  NIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN  1790
             N+  +E +W+I+I++TLE ELE + EI V IF VPK LM  DP+ Y PQ VAIGPYH   
Sbjct  6     NLSFNEHRWIINIRRTLEEELENDAEIPVCIFSVPKALMTSDPDSYTPQEVAIGPYHQWR  65

Query  1789  PELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMA  1610
             PEL+EMER+KL AAK  QK+L+++K   +   + K+E +IR  Y K L+   ETL WMMA
Sbjct  66    PELYEMERYKLAAAKRTQKKLQSLKFQHVVHRLSKLELKIRACYHKCLDFSNETLTWMMA  125

Query  1609  VDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFI  1430
             +DASFLLEFL++YA+KEG  +  + S  MSHLVD  G+KS+HNA+LRD++MLENQIP F+
Sbjct  126   IDASFLLEFLEIYAIKEGIAITRVSSISMSHLVDYAGRKSAHNAILRDVVMLENQIPLFV  185

Query  1429  LRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVP  1253
             LRK+L+ Q  S E +DD+L +ML+G  KELSPFK  +    + I+   HLL YL+  IVP
Sbjct  186   LRKILEVQLSSLELADDMLCSMLLGFCKELSPFKMMQDIPKIHISQCAHLLDYLYGMIVP  245

Query  1252  EMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
             ++E+     EI      +            N  Y++  F ++W I+ +LNKGP R LKRL
Sbjct  246   KVEAPP---EIITEADDQPDAMEGRYNSSGNPTYIRDLFSEIWKIITRLNKGPVRLLKRL  302

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLF-SCGQKPDGDENSDSKDNADKPPSIE  896
                 P K +L +PW  ++ LPG +++K P++ LF S  Q+    EN +S +  ++PP +E
Sbjct  303   LFSRPFKVILKLPWTILSNLPGFSILKQPLQHLFFSQDQEEIKPENENSDNEVNRPPLVE  362

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EITIP VTEL+ +GV F PT   ILSI FD K  TLYLP ++LD+N+EVVLRNLVA+EA 
Sbjct  363   EITIPCVTELSKSGVCFEPTTGNILSITFDVKAVTLYLPTISLDVNTEVVLRNLVAFEAS  422

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
              A GPLV  RYTE MNGI+DT+EDVKFLREKGIILNRLKSD EVA LWNGM+KS+RLTKV
Sbjct  423   NASGPLVFTRYTELMNGIIDTEEDVKFLREKGIILNRLKSDEEVAILWNGMSKSIRLTKV  482

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
              FLDK I+DVNK+YN RW VK  +FM+ Y+FGSWQFLTLLA + LLLLM LQ+FCS+Y C
Sbjct  483   PFLDKVIEDVNKYYNQRWTVKVGKFMKRYVFGSWQFLTLLAAVFLLLLMTLQAFCSIYRC  542

Query  355   SRFFN  341
             SR  +
Sbjct  543   SRVLH  547



>ref|XP_006586421.1| PREDICTED: putative UPF0481 protein At3g02645-like [Glycine max]
Length=557

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/545 (57%), Positives = 400/545 (73%), Gaps = 10/545 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee-nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +WVI+I+KTLE ELEE+ ++  VSIF VPK LM  DP+ YVPQ+VA+GPYHY  PEL
Sbjct  11    DELQWVINIRKTLEEELEEDGDQFAVSIFSVPKLLMASDPDSYVPQQVALGPYHYWRPEL  70

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             +EM+R+K+ AAK FQK  ++ KL +L +++ K+E R+R  Y K L+   ETL WMM VDA
Sbjct  71    YEMQRYKIAAAKRFQKHHQSCKLENLVDQLTKLEQRVRACYHKFLDFNGETLVWMMTVDA  130

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLEFL+V++++EG      +S+ MSHLVD  GKKS+HNA+LRDI+MLENQIP F+LRK
Sbjct  131   SFLLEFLQVFSMQEGA-KVQRVSSSMSHLVDYAGKKSAHNAILRDIVMLENQIPLFVLRK  189

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEME  1244
             ML  +  S EA+DD+L  M +GL KE+SPFK  E    +Q+++  HLL +L+  IVP++E
Sbjct  190   MLDLKFSSLEAADDMLSLMFIGLFKEISPFKMMEEYPNIQVSENVHLLDFLYNVIVPKLE  249

Query  1243  SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
              +   IE++     KE  D E      +S +VK  F +VW +L KLNKGP + +K++   
Sbjct  250   QQSDTIEVEFQQEQKEGNDEEAT---SDSSHVKQFFSEVWKLLSKLNKGPMKMVKKVIVS  306

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGD--ENSDSKDNA--DKPPSIE  896
              P+K  + +PWK ++ LPGL VMK P+E      +K D +  E++ S+ N+  +KPPS+E
Sbjct  307   KPLKVFVQLPWKIVSNLPGLKVMKQPLEHFLFSQEKGDENKGESASSRSNSLMNKPPSVE  366

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EITIPSVTEL N G+RF+PTK  I SI FD KT T YLP + LD+N+EV LRNLVAYEA 
Sbjct  367   EITIPSVTELLNCGIRFVPTKGSISSISFDVKTCTFYLPTIGLDVNTEVFLRNLVAYEAS  426

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
             +A GPLV+ RYTE MNGI+D++ED K LREKGIILN LKSD EVANLWNGM+KS+RL++V
Sbjct  427   VALGPLVITRYTELMNGIIDSEEDAKVLREKGIILNHLKSDKEVANLWNGMSKSLRLSRV  486

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
             + LDK I+DVNK+YN R  VK  +FMR Y+F SWQFLT LA + LLLLM LQ+FCSVYTC
Sbjct  487   SLLDKVIEDVNKYYNGRMKVKIWKFMRVYVFSSWQFLTFLAALCLLLLMALQAFCSVYTC  546

Query  355   SRFFN  341
             SRFF 
Sbjct  547   SRFFQ  551



>gb|KHN38011.1| Putative UPF0481 protein [Glycine soja]
Length=564

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/545 (57%), Positives = 400/545 (73%), Gaps = 10/545 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee-nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +WVI+I+KTLE ELEE+ ++  VSIF VPK LM  DP+ YVPQ+VA+GPYHY  PEL
Sbjct  18    DELRWVINIRKTLEEELEEDGDQFAVSIFSVPKLLMASDPDSYVPQQVALGPYHYWRPEL  77

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             +EM+R+K+ AAK FQK  ++ KL +L +++ K+E R+R  Y K L+   ETL WMM VDA
Sbjct  78    YEMQRYKIAAAKRFQKHHQSCKLENLVDQLTKLEQRVRACYHKFLDFNGETLVWMMTVDA  137

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLEFL+V++++EG      +S+ MSHLVD  GKKS+HNA+LRDI+MLENQIP F+LRK
Sbjct  138   SFLLEFLQVFSMQEGA-KVQRVSSSMSHLVDYAGKKSAHNAILRDIVMLENQIPLFVLRK  196

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEME  1244
             ML  +  S EA+DD+L  M +GL KE+SPFK  E    +Q+++  HLL +L+  IVP++E
Sbjct  197   MLDLKFSSLEAADDMLSLMFIGLFKEISPFKMMEEYPNIQVSENVHLLDFLYNVIVPKLE  256

Query  1243  SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
              +   IE++     KE  D E      +S +VK  F +VW +L KLNKGP + +K++   
Sbjct  257   QQSDTIEVEFQQEQKEGNDEEAT---SDSSHVKQFFSEVWKLLSKLNKGPMKMVKKVIVS  313

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGD--ENSDSKDNA--DKPPSIE  896
              P+K  + +PWK ++ LPGL VMK P+E      +K D +  E++ S+ N+  +KPPS+E
Sbjct  314   KPLKVFVQLPWKIVSNLPGLKVMKQPLEHFLFSQEKGDENKGESASSRSNSLMNKPPSVE  373

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EITIPSVTEL N G+RF+PTK  I SI FD KT T YLP + LD+N+EV LRNLVAYEA 
Sbjct  374   EITIPSVTELLNCGIRFVPTKGSISSISFDVKTCTFYLPTIGLDVNTEVFLRNLVAYEAS  433

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
             +A GPLV+ RYTE MNGI+D++ED K LREKGIILN LKSD EVANLWNGM+KS+RL++V
Sbjct  434   VALGPLVITRYTELMNGIIDSEEDAKVLREKGIILNHLKSDKEVANLWNGMSKSLRLSRV  493

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
             + LDK I+DVNK+YN R  VK  +FMR Y+F SWQFLT LA + LLLLM LQ+FCSVYTC
Sbjct  494   SLLDKVIEDVNKYYNGRMKVKIWKFMRVYVFSSWQFLTFLAALCLLLLMALQAFCSVYTC  553

Query  355   SRFFN  341
             SRFF 
Sbjct  554   SRFFQ  558



>ref|XP_008228744.1| PREDICTED: putative UPF0481 protein At3g02645 isoform X2 [Prunus 
mume]
Length=561

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/548 (55%), Positives = 394/548 (72%), Gaps = 12/548 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             +E +WVI IQKTLE ELE++ EI VSIF VPK L+  +P+ Y+PQ VAIGPYHY  PEL+
Sbjct  17    NEFEWVIQIQKTLEEELEDDGEIPVSIFNVPKALLASEPDSYIPQEVAIGPYHYLRPELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+K+ AAK  QKQL+ +K   L E++ K+E RIR  Y K L++  +TL WMMA+ AS
Sbjct  77    EMERYKVAAAKRTQKQLQCLKFQDLVEQLKKLEPRIRACYHKYLDVNGDTLGWMMAIAAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             F LE L++Y  KEG+++   +S+ MSHLVD+ G KS+H+A+LRD++MLENQIP F+ R++
Sbjct  137   FFLELLQIYGAKEGRVLTR-VSSSMSHLVDVSGSKSAHHAILRDLVMLENQIPLFVSRRI  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQTIVPEME  1244
             L+ Q  S E +DDLLL+MLMGL KELSPFK  ++    +Q+++  HLL +L+Q I P++E
Sbjct  196   LEFQFTSLEQADDLLLSMLMGLCKELSPFKVVDQDLPKIQVSECAHLLDFLYQMITPKLE  255

Query  1243  ---SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
                SE VE E +      +  +        +  +VK    +VW +L KLNKGP R LK+L
Sbjct  256   RRPSEIVEAEDEGESTPHKGSESS-----DSPNFVKQFLQEVWKLLSKLNKGPVRLLKKL  310

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGD-ENSDSKDNADKPPSIE  896
                 PVK    +PW  ++ LPG  ++K P+  LFS   K + + EN +S ++  KPP IE
Sbjct  311   LVSGPVKVFFKLPWTILSNLPGFAMLKQPVSYLFSTQAKEETNPENENSSNSVSKPPLIE  370

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EITIPSV++L  +GVRF+ TK  + +I FD KT T YLP  +LD+N+EV+LRNLVAYE  
Sbjct  371   EITIPSVSDLVKSGVRFVKTKGSLSTISFDPKTVTFYLPATSLDVNTEVILRNLVAYEVS  430

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
              A GPLV  RYTE MNGI+DT+EDVK LREKGIILN LKSD EVAN+WNGM+KS+RLTKV
Sbjct  431   NASGPLVFTRYTELMNGIIDTEEDVKLLREKGIILNHLKSDEEVANVWNGMSKSIRLTKV  490

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
              FLDKTI+DVNK+YN RW +K  +FM+ Y+FGSWQFL +LA ++LLLLM LQ+FCSVY+C
Sbjct  491   PFLDKTIEDVNKYYNGRWKIKMTKFMKVYVFGSWQFLAVLAGLLLLLLMTLQAFCSVYSC  550

Query  355   SRFFNDVT  332
              R F+  T
Sbjct  551   GRVFHITT  558



>gb|KCW70767.1| hypothetical protein EUGRSUZ_F03927 [Eucalyptus grandis]
Length=534

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/519 (56%), Positives = 374/519 (72%), Gaps = 4/519 (1%)
 Frame = -3

Query  1891  INVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKL  1712
             + VSIF VP  LM  DP+ Y PQ+VAIGPYH+  PE++EMER+KL A K +QKQL  IK 
Sbjct  12    VPVSIFSVPTVLMSSDPDLYTPQQVAIGPYHHWRPEMYEMERYKLAAVKRYQKQLERIKF  71

Query  1711  HSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMIS  1532
              SL E+++K+E R+R  Y K L+   ETLAWMM +DA FLLEFL++YA+KEGK+++  +S
Sbjct  72    QSLVEQLVKLEPRVRACYHKYLDFNGETLAWMMVIDALFLLEFLQIYAIKEGKMLSR-VS  130

Query  1531  AKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGL  1352
             ++MSHLVD  G+KS+HNA+LRDI+MLENQIP FILRKML+ QC S + +DD+LLTMLMG 
Sbjct  131   SRMSHLVDFAGRKSAHNAILRDIVMLENQIPLFILRKMLEFQCASLDEADDMLLTMLMGF  190

Query  1351  SKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMESE-HVEIEIdenggmkekkdgee  1178
              KE+SPFK  E    +Q++   HLL +L+  +VP++E +  +  E       K++     
Sbjct  191   YKEVSPFKPMEALPNIQVSVCAHLLDFLYDILVPKVEGQPEIIEEEGNGEDKKDRGLSPL  250

Query  1177  dEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNV  998
                   + Y+K     +W +L KLN GP + LKRL    PVK +L +PW  ++KLP  +V
Sbjct  251   ASSSSGTSYIKQLCDAIWNLLSKLNNGPIKMLKRLLFSKPVKVLLKLPWTILSKLPFFSV  310

Query  997   MKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILS  818
             +  P+ESLF   +K DG   ++S  N  KPPS+EE+ IPSV++L+N GVRF+ T   + S
Sbjct  311   LAQPLESLFLSQEKEDGKSENES-SNPSKPPSVEEMAIPSVSDLSNVGVRFVATNGNLSS  369

Query  817   IEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVK  638
             I FD K  TLYLP ++LD+NSE  +RNLVAYEA  A GPLV  RYTE MNGI+D+DEDVK
Sbjct  370   IGFDTKMATLYLPAISLDVNSEAFMRNLVAYEASNASGPLVFTRYTELMNGIIDSDEDVK  429

Query  637   FLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFM  458
              LREKG+ILNRLKSD EVA LWN M+KS+RLTKV FLDK I+DVNK+YN RW VK  +FM
Sbjct  430   LLREKGVILNRLKSDEEVAKLWNSMSKSIRLTKVPFLDKAIEDVNKYYNGRWKVKLGKFM  489

Query  457   RSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFN  341
             + Y++GSWQFL LLA I LLLLM  Q+FCSVY+CSR F+
Sbjct  490   KLYVYGSWQFLALLAAIALLLLMTSQAFCSVYSCSRIFH  528



>emb|CDO98196.1| unnamed protein product [Coffea canephora]
Length=551

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/546 (56%), Positives = 404/546 (74%), Gaps = 16/546 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +W+I I++ +E ELEE+N++ VSIF VPKTL V DP+CY+PQ+VAIGPYH+   EL+
Sbjct  10    DEDRWIIQIRRAIEEELEEDNDVPVSIFNVPKTLKVSDPDCYIPQQVAIGPYHHWRSELY  69

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL +AK  QKQ++++K  ++ +++ + E RIR  Y K L+   ETLAWMMA+DAS
Sbjct  70    EMERYKLASAKRTQKQMQSLKFQNVVDQLARFEPRIRACYHKYLDFNGETLAWMMAMDAS  129

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+VYA KEGK++  + S++MSHLVD+ G+KS+HNA+LRD++MLENQIP F+LR+M
Sbjct  130   FLLEFLQVYAAKEGKVLTRL-SSRMSHLVDIAGRKSAHNAILRDMVMLENQIPLFLLREM  188

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEME-  1244
             L+ Q  S EA+D++LL+ML+G  KEL PFK  E     ++ D  HLL +L++ IVP++E 
Sbjct  189   LELQFSSLEAADNVLLSMLIGFCKELLPFKMMEELPKFEVTDYAHLLDFLYRVIVPKLEG  248

Query  1243  -SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSS  1067
              SE  EI+ +      E+        +K  GYV      VW I+ KLNK  AR +KR+  
Sbjct  249   PSEITEIDEEGEIKEAEESYFGMSSHVKQIGYV------VWNIISKLNKVSARLIKRILF  302

Query  1066  LAPVKTVLLMPWKAITKLPGLNVMKGPIESL-FSC---GQKPDGDENSDSKDNADKPPSI  899
               P+K +L +PW  I+ LP L ++K PIE L FS     QKP+ +EN +S  N +KPP +
Sbjct  303   SKPIKVILKLPWTIISNLPVLRLIKAPIEYLCFSQDKENQKPE-NENLNST-NINKPPLV  360

Query  898   EEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEA  719
             EEI IPSV EL+ AGV+F+PT +GILSI FD K  T  LP ++LD+N++ VLRNLVAYEA
Sbjct  361   EEIEIPSVIELSKAGVQFVPTNQGILSISFDDKMATFCLPSISLDVNTDAVLRNLVAYEA  420

Query  718   CIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTK  539
             C A GP+V  RYTE MNG+VDT+ED KFLREKGIILNRLKSD EVAN+WNGM+KSVRLTK
Sbjct  421   CNASGPVVFTRYTELMNGVVDTEEDAKFLREKGIILNRLKSDEEVANMWNGMSKSVRLTK  480

Query  538   VAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYT  359
             V FLDK I+DVNK+YN RW  K  RF++ Y+F SWQFLTL+A IVLL LM LQ+FCSVY+
Sbjct  481   VPFLDKVIEDVNKYYNGRWKTKIGRFLKHYVFDSWQFLTLIAAIVLLFLMTLQAFCSVYS  540

Query  358   CSRFFN  341
              +R F+
Sbjct  541   RARIFH  546



>emb|CAN62047.1| hypothetical protein VITISV_026044 [Vitis vinifera]
Length=551

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/547 (54%), Positives = 393/547 (72%), Gaps = 9/547 (2%)
 Frame = -3

Query  1969  NIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN  1790
             N   DE +WVI I++TL+ ELE+ +E+ V IF VPKTLM   P+CYVPQ VA+GPYH   
Sbjct  6     NSSFDELEWVIQIRRTLDEELEDNSEVPVCIFNVPKTLMATKPDCYVPQEVALGPYHRWR  65

Query  1789  PELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMA  1610
             PEL+EMER+KL AAK  QK L+++K HSL +++ K E RIR  Y K L    ETLAWMMA
Sbjct  66    PELYEMERYKLAAAKRIQKHLQSLKFHSLVDQLTKNEPRIRACYHKFLEFNGETLAWMMA  125

Query  1609  VDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFI  1430
             +DASFLLE L+VYA+KEG+++   +S++MSHLVD  G KS+HNA+LRD++MLENQIP  +
Sbjct  126   IDASFLLEXLQVYAMKEGRMLTR-VSSRMSHLVDYAGTKSAHNAILRDMVMLENQIPLLV  184

Query  1429  LRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVP  1253
             LR++L+ Q  S + +DD+L +ML G  ++L PF   E    +Q+ +  HLL +L+  IVP
Sbjct  185   LRQVLEFQFSSLDQADDMLCSMLTGFGEDLCPFGMMENLPKIQVEEYAHLLDFLYHLIVP  244

Query  1252  EMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
               +    E         + +    ++E   +  YV+  F ++W +L KLN+GP R LKR+
Sbjct  245   RSK----EPSEIIEVENENESKEGKEESFGDYSYVQQLFEEIWKLLSKLNRGPVRILKRI  300

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLF-SCGQKPDGDENSDSKDNAD--KPPS  902
                 PVK +L +PW  ++ LPG  ++K P+E  F S  ++ +  E+ +SK N+   KPP 
Sbjct  301   IFSKPVKVILKLPWTIVSNLPGFAILKQPVEYFFFSQDKEENKPEHGNSKSNSSIVKPPL  360

Query  901   IEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYE  722
             IEEITIPSV+EL+ +GVRF+PT  GI SI FDAK  TLYLP V+LD+N+EV LRNLVAYE
Sbjct  361   IEEITIPSVSELSKSGVRFLPTNGGISSITFDAKMVTLYLPTVSLDVNTEVTLRNLVAYE  420

Query  721   ACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLT  542
             +  A GPLV+ RYTE MNGI+DT ED KFLRE+GI+LNRLKSD EVANLWNGM++S+RLT
Sbjct  421   SSNASGPLVMTRYTELMNGIIDTKEDAKFLRERGIVLNRLKSDEEVANLWNGMSRSIRLT  480

Query  541   KVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVY  362
             KV FLDK I+DVNK+++ RW VK  +FM+ Y+FGSWQFLT LA  +++LLM LQ+FCSVY
Sbjct  481   KVPFLDKVIEDVNKYHSGRWKVKAGKFMKRYVFGSWQFLTFLAAXLIVLLMTLQAFCSVY  540

Query  361   TCSRFFN  341
             +C R FN
Sbjct  541   SCPRIFN  547



>ref|XP_007217422.1| hypothetical protein PRUPE_ppa026580mg [Prunus persica]
 gb|EMJ18621.1| hypothetical protein PRUPE_ppa026580mg [Prunus persica]
Length=561

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/548 (55%), Positives = 391/548 (71%), Gaps = 12/548 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             +E +WVI IQKTLE ELE++ EI VSIF VPK L+  DP+ Y+PQ VAIGPYHY  PEL+
Sbjct  17    NEFQWVIQIQKTLEEELEDDGEIPVSIFNVPKALLASDPDSYIPQEVAIGPYHYLRPELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+K+ AAK  QKQL+ +K   L E++ K+E RIR  Y K L+   +TL WMMA+ AS
Sbjct  77    EMERYKVAAAKRTQKQLQCLKFQDLVEQLKKLEPRIRACYHKYLDFNGDTLGWMMAIAAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             F LE L++Y  KEG++    +S+ MSHLVD+ G KS+H+A+LRD++MLENQIP F+ R++
Sbjct  137   FFLELLQIYGAKEGRVFTR-VSSSMSHLVDVSGSKSAHHAILRDLVMLENQIPLFVSRRI  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQTIVPEME  1244
             L+ Q  S E +DDLLL+MLMGL KELSPFK  ++    +Q+++  HLL +L+Q I P++E
Sbjct  196   LEFQFTSLEQADDLLLSMLMGLCKELSPFKVVDQDLPKIQVSECAHLLDFLYQMITPKLE  255

Query  1243  ---SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
                SE VE E +      +  +        +  ++K    +VW +L KLNKGP R LK+L
Sbjct  256   RRPSEIVEAEDEGESTPHKGSESS-----DSQNFMKQFLQEVWKLLSKLNKGPVRLLKKL  310

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGD-ENSDSKDNADKPPSIE  896
                 PVK    +PW  ++ LPG  ++K P+  LFS   K +   EN +S ++  KPP IE
Sbjct  311   LVSGPVKVFFKLPWTILSNLPGFAMLKQPVSYLFSTQDKEETKPENENSSNSISKPPLIE  370

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EITIPSV++L  +GVRF+ T   + +I FD KT T YLP  +LD+N+EV+LRNLVAYE  
Sbjct  371   EITIPSVSDLVKSGVRFVKTNGSLSTISFDPKTVTFYLPATSLDVNTEVILRNLVAYEVS  430

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
              A GPLVL RYTE MNGI+DT+EDVK LREKGIILNRLKSD EVA +WNGM+KS+RLTKV
Sbjct  431   NASGPLVLTRYTELMNGIIDTEEDVKLLREKGIILNRLKSDEEVAKVWNGMSKSIRLTKV  490

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
              FLDK I+DVNK+YN RW VK  +FM+ Y+FGSWQFL +LA ++LLLLM LQ+FCSVY+C
Sbjct  491   PFLDKAIEDVNKYYNGRWKVKMTKFMKVYVFGSWQFLAVLAGLLLLLLMTLQAFCSVYSC  550

Query  355   SRFFNDVT  332
             SR F+  T
Sbjct  551   SRVFHITT  558



>ref|XP_006584161.1| PREDICTED: putative UPF0481 protein At3g02645-like [Glycine max]
Length=556

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/542 (56%), Positives = 395/542 (73%), Gaps = 7/542 (1%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI+I+KTLE E+EE+ E  VSIF VPK LM  DP+ YVPQ+VAIGPYHY  PEL+
Sbjct  11    DELRWVINIRKTLEEEVEEDGEFAVSIFSVPKLLMASDPDSYVPQQVAIGPYHYWRPELY  70

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EM+R+K+ AAK FQK  ++ KL +L +++ K+E R+R  Y K L+   ETL WMM VDA+
Sbjct  71    EMQRYKIAAAKRFQKHQQSCKLENLVDQLNKLEQRVRACYHKFLDFNGETLVWMMTVDAA  130

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+V+A++EG      +S+ MSHLVD  GKKS+HNA+LRDI+MLENQIP F+LRKM
Sbjct  131   FLLEFLQVFAMQEGA-KVQRVSSSMSHLVDYAGKKSAHNAILRDIVMLENQIPLFVLRKM  189

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L  +  S EA+DD+L  M +GL KE+SPFK  E    + ++++ HLL +L+  IVP++E 
Sbjct  190   LDLKFSSLEAADDMLSLMFIGLFKEISPFKMMEEYPNIDVSESVHLLDFLYDLIVPKLEQ  249

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
             +   IE++     +++ + EE     +S +VK    +VW +L KLNKGP + +K++    
Sbjct  250   QPDTIEVELQQEEQKEGNNEEAT--SDSSHVKQFLCEVWKLLSKLNKGPVKMVKKVIVSK  307

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPD--GDE-NSDSKDNADKPPSIEEI  890
             P+K  + +PWK ++ LPGL V+K P+E      +K D  G+  NS S     KPPS+EEI
Sbjct  308   PLKVFVQLPWKIVSNLPGLKVLKQPLEHFLFSQEKADEKGESVNSSSNTLMKKPPSVEEI  367

Query  889   TIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIA  710
             TIPSVTEL N G+R +PTK  I +I FD KT T+YLP + LD+N+EV LRNLVAYEA +A
Sbjct  368   TIPSVTELLNCGIRLVPTKGSISNISFDVKTSTVYLPTIGLDVNTEVFLRNLVAYEASVA  427

Query  709   KGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAF  530
              GPLV+ RYTE MNGI+D++ED K LREKGIILN LKSD EVANLWNGM+KS+RL++V  
Sbjct  428   SGPLVITRYTELMNGIIDSEEDAKVLREKGIILNHLKSDKEVANLWNGMSKSLRLSRVPL  487

Query  529   LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
             LDK I+DVNK+YN R  VK  +FM+ Y+F SWQFLT LA I LLLLM LQ+FCSVYTCSR
Sbjct  488   LDKVIEDVNKYYNGRTKVKIWKFMKVYVFSSWQFLTFLAAICLLLLMALQAFCSVYTCSR  547

Query  349   FF  344
             FF
Sbjct  548   FF  549



>gb|KHN01303.1| Putative UPF0481 protein [Glycine soja]
Length=556

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/542 (56%), Positives = 394/542 (73%), Gaps = 7/542 (1%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI+I+KTLE E+EE+ E  VSIF VPK LM  DP+ YVPQ+VAIGPYHY  PEL+
Sbjct  11    DELRWVINIRKTLEEEVEEDGEFAVSIFSVPKLLMASDPDSYVPQQVAIGPYHYWRPELY  70

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EM+R+K+ AAK FQK  ++ KL +L +++ K+E R+R  Y K L+   ETL WMM VDA+
Sbjct  71    EMQRYKIAAAKRFQKHQQSCKLENLVDQLNKLEQRVRACYHKFLDFNGETLVWMMTVDAA  130

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+V+A++EG      +S+ MSHLVD  GKKS+HNA+LRDI+MLENQIP F+LRKM
Sbjct  131   FLLEFLQVFAMQEGA-KVQRVSSSMSHLVDYAGKKSAHNAILRDIVMLENQIPLFVLRKM  189

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L  +  S EA+DD+L  M +GL KE+SPFK  E    + ++++ HLL +L+  IVP++E 
Sbjct  190   LDLKFSSLEAADDMLSLMFIGLFKEISPFKMMEEYPNIDVSESVHLLDFLYDLIVPKLEQ  249

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
             +   IE++     +++ + EE     +S +VK    +VW +L KLNKGP + +K++    
Sbjct  250   QPDTIEVELQQEEQKEGNNEEAT--SDSSHVKQFLCEVWKLLSKLNKGPVKMVKKVIVSK  307

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPD--GDE-NSDSKDNADKPPSIEEI  890
             P+K  + +PWK ++ LPGL V+K P+E      +K D  G+  NS S     KPPS+EEI
Sbjct  308   PLKVFVQLPWKIVSNLPGLKVLKQPLEHFLFSQEKADEKGESVNSSSNTLMKKPPSVEEI  367

Query  889   TIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIA  710
             TIPSVTEL N G+R +PTK  I +I FD KT T YLP + LD+N+EV LRNLVAYEA +A
Sbjct  368   TIPSVTELLNCGIRLVPTKGSISNISFDVKTSTFYLPTIGLDVNTEVFLRNLVAYEASVA  427

Query  709   KGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAF  530
              GPLV+ RYTE MNGI+D++ED K LREKGIILN LKSD EVANLWNGM+KS+RL++V  
Sbjct  428   SGPLVITRYTELMNGIIDSEEDAKVLREKGIILNHLKSDKEVANLWNGMSKSLRLSRVPL  487

Query  529   LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
             LDK I+DVNK+YN R  VK  +FM+ Y+F SWQFLT LA I LLLLM LQ+FCSVYTCSR
Sbjct  488   LDKVIEDVNKYYNGRTKVKIWKFMKVYVFSSWQFLTFLAAICLLLLMALQAFCSVYTCSR  547

Query  349   FF  344
             FF
Sbjct  548   FF  549



>ref|XP_003604314.1| hypothetical protein MTR_4g009340 [Medicago truncatula]
 gb|AES86511.1| UPF0481 plant-like protein [Medicago truncatula]
Length=564

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/550 (54%), Positives = 398/550 (72%), Gaps = 15/550 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKT-lereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +WVIH++KT  E   EE+ E++V+IF VPK LM  DP+ YVPQ+VAIGPYHY  PEL
Sbjct  17    DELRWVIHVRKTLEEEFEEEDGELSVTIFNVPKLLMASDPDSYVPQQVAIGPYHYWRPEL  76

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             +EM+ +KL A K F K L++ KL +L +++ K E R+R  Y K L+L  ET+ WMM VDA
Sbjct  77    YEMQSYKLAATKRFLKSLQSFKLDNLVDQLTKYEQRVRGCYHKFLDLNGETMVWMMIVDA  136

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLE L++YA++EG     ++S+ MSHLVD  G+KS+HNA+LRDI+MLENQIP F+LRK
Sbjct  137   SFLLELLQIYAMQEGA-TKRVVSSSMSHLVDYAGRKSAHNAMLRDIVMLENQIPLFVLRK  195

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEME  1244
             +L+ +  S EA+D++L+ M +GL K+ SPFK  E    ++++++ HLL + +  IVP++E
Sbjct  196   LLEFKFSSKEAADEMLIFMFIGLFKQTSPFKMIEEFPSIKVSESAHLLDFFYDMIVPKLE  255

Query  1243  SEH---VEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
             + +   +++EI +     + +D         S YVK +  ++W IL KLNKGP ++LKR+
Sbjct  256   TGNDVTIDVEIQQEEEQDKGEDENSKG---ESSYVKQSLNEIWRILSKLNKGPMKSLKRV  312

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNA----DKPP  905
                 P+K ++  PWK I+ LPG  ++K PIESLF   +K  GDE     +N+    +KPP
Sbjct  313   LVSRPLKVLVKFPWKIISNLPGGKLLKQPIESLFFSKEK--GDEEKQETENSSTLINKPP  370

Query  904   SIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAY  725
              IEEITIPSV EL  +GV F PT   I SI FDAKT T YLP++ LD+N+EV LRNLVAY
Sbjct  371   LIEEITIPSVKELVKSGVNFSPTNGSISSISFDAKTRTFYLPIIGLDVNTEVFLRNLVAY  430

Query  724   EACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRL  545
             E+ +  GPLV+ RYTE MNGI+D+++D K LREKGIILN LKSD EVA++WNGM+KS+RL
Sbjct  431   ESSVGSGPLVITRYTELMNGIIDSEDDAKILREKGIILNHLKSDKEVADMWNGMSKSLRL  490

Query  544   TKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSV  365
             ++V FLDKTI+DVNKFYN R  VK  +FM+SY+FGSWQFLT LA I LLLLM +Q+FCSV
Sbjct  491   SRVLFLDKTIEDVNKFYNSRMKVKMLKFMKSYVFGSWQFLTFLAAIFLLLLMGVQAFCSV  550

Query  364   YTCSRFFNDV  335
             YTCSRFF  +
Sbjct  551   YTCSRFFGSL  560



>ref|XP_008228743.1| PREDICTED: putative UPF0481 protein At3g02645 isoform X1 [Prunus 
mume]
Length=562

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/547 (54%), Positives = 391/547 (71%), Gaps = 5/547 (1%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             +E +WVI IQKTLE ELE++ EI VSIF VPK L+  +P+ Y+PQ VAIGPYHY  PEL+
Sbjct  17    NEFEWVIQIQKTLEEELEDDGEIPVSIFNVPKALLASEPDSYIPQEVAIGPYHYLRPELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+K+ AAK  QKQL+ +K   L E++ K+E RIR  Y K L+   +TL WMMA+ AS
Sbjct  77    EMERYKVAAAKRTQKQLQCLKFQDLVEQLKKLEPRIRACYHKYLDFNGDTLGWMMAIAAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             F LE L++Y  KEG+++   +S+ MSHLVD  G KS+H+A+LRD++MLENQIP F+ R++
Sbjct  137   FFLELLQIYGAKEGRVLTR-VSSSMSHLVDFSGSKSAHHAILRDLVMLENQIPLFVSRRI  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQTIVPEME  1244
             L+ Q  S E +DDLLL+MLMGL KELSPFK  ++    +Q+++  HLL +L+Q I P++E
Sbjct  196   LEFQFTSLEQADDLLLSMLMGLCKELSPFKVVDQDLPKIQVSECAHLLDFLYQMITPKLE  255

Query  1243  SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
                 EI ++     +            +  +VK    +VW +L KLN+GP R LK+L   
Sbjct  256   RRPSEI-VEAEDEGESTPHKGSKSSDDSPNFVKQFLQEVWKLLSKLNEGPVRLLKKLLVS  314

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGD-ENSDSKDNADKPPSIEEIT  887
              PVK +  +PW  ++ LPG  +++ P+  LFS   K + + EN +S ++  KPP IEEIT
Sbjct  315   GPVKVLFKLPWTILSNLPGFAMLRQPVSYLFSTQDKEETNPENENSSNSISKPPLIEEIT  374

Query  886   IPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAK  707
             IPSV++L  +GV F+ TK  + +I FD KT T YLP  +LD+N+EV+LRNLVAYE   A 
Sbjct  375   IPSVSDLVKSGVCFVKTKGSLSTISFDPKTVTFYLPATSLDVNTEVILRNLVAYEVSNAS  434

Query  706   GPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFL  527
             GPLV  RYTE MNGI+DT+EDVK LREKGIILN LKSD EVAN+WNGM+KS+RLTKV FL
Sbjct  435   GPLVFTRYTELMNGIIDTEEDVKLLREKGIILNHLKSDEEVANVWNGMSKSIRLTKVPFL  494

Query  526   DKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRF  347
             DKTI+DVNK+YN RW +K  +FM+ Y+FGSWQFL +LA ++LLLLM LQ+FCSVY+CSR 
Sbjct  495   DKTIEDVNKYYNGRWKIKMTKFMKVYVFGSWQFLAVLAGLLLLLLMTLQAFCSVYSCSRV  554

Query  346   FNDVTIL  326
             F+  T +
Sbjct  555   FHITTTI  561



>ref|XP_007023346.1| Uncharacterized protein TCM_027342 [Theobroma cacao]
 gb|EOY25968.1| Uncharacterized protein TCM_027342 [Theobroma cacao]
Length=556

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/551 (53%), Positives = 396/551 (72%), Gaps = 12/551 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI+I+++L+ E+E + ++ V IF VPKTLM  +PE Y+PQ VA+GPYHY  PEL+
Sbjct  17    DERRWVINIRRSLDEEVEGDIDVPVCIFNVPKTLMSSNPESYIPQLVALGPYHYWRPELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL AAK  QKQL++   H+L +++ K E RIR  Y   L+   ETLAWMMA+DAS
Sbjct  77    EMERYKLAAAKRTQKQLQSPNFHTLVDQLAKHEPRIRACYHSYLDFNGETLAWMMAIDAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL++YA+KEGK ++  +S++MSHLVD  G+KS+HNA+LRDI+MLENQIP FILRK+
Sbjct  137   FLLEFLQIYALKEGKTLSR-VSSRMSHLVDYTGRKSAHNAILRDIVMLENQIPLFILRKV  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L+ Q  S E +DD+LL+ML GL +ELSPFK  E    + I+   H+L +L+  IVP+++ 
Sbjct  196   LEVQYSSMETADDMLLSMLRGLCQELSPFKMMENMPKIDISRCAHVLDFLYDMIVPKVDE  255

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
               +  E ++     E K  + D    +  Y+K    +VW +L K+ +GP R +K +    
Sbjct  256   PSITNEAEDQKEAPEDKQSDIDS--TDPSYLKQLLSEVWNLLSKIKRGPLRLIKAVLLSR  313

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIP  881
             PV+ +L +PWK ++ LPG +++K PIE L     K   +E S++    +KPP +EEI IP
Sbjct  314   PVRVILKLPWKILSNLPGFSILKQPIEYLLFSQDK--EEEKSETSSGLNKPPLVEEIAIP  371

Query  880   SVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGP  701
             SV +L+ +GVRF PT   I +I FD KT TLYLP ++LDIN+EVVLRNLVAYEA  A GP
Sbjct  372   SVADLSKSGVRFSPTNGSISNISFDVKTVTLYLPTISLDINTEVVLRNLVAYEASNASGP  431

Query  700   LVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDK  521
             L+  RYTE MNGI+DT+EDVK LRE G++LN LKSD E A+LWNGM+KS+RLTKV FLDK
Sbjct  432   LIFTRYTELMNGIIDTEEDVKLLRESGVVLNHLKSDEEAADLWNGMSKSIRLTKVPFLDK  491

Query  520   TIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFN  341
              I+DVN+++NCRWN+K + F + Y++GSWQFLTLLA I+LL+LM  Q+FC+VY+C R   
Sbjct  492   AIEDVNRYHNCRWNIKARNFFKHYVYGSWQFLTLLAAIMLLILMTFQAFCTVYSCFR---  548

Query  340   DVTILGTNEQN  308
                ILGT   +
Sbjct  549   ---ILGTQTSD  556



>ref|XP_009770998.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana sylvestris]
Length=555

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/544 (56%), Positives = 398/544 (73%), Gaps = 7/544 (1%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN   DES+WVI I++TL+ ELEE  E+ VSIF VPKTLMV DP+CYVPQ VA+GPYHY 
Sbjct  11    PNF--DESRWVIQIRRTLDEELEENTEVPVSIFNVPKTLMVSDPDCYVPQEVALGPYHYW  68

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
              PEL+E+ER+K+ AAK  QKQL+ +K  +L E ++K+ESRIR  Y K LN   ETLAWMM
Sbjct  69    RPELYEIERYKVAAAKRTQKQLQNLKFQNLVEHLLKLESRIRACYHKYLNFNGETLAWMM  128

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
             AVDASFLLEFL +YAVKEGK++  + S++MSHLVD  G+KS+HNA+LRD+ MLENQIP F
Sbjct  129   AVDASFLLEFLHIYAVKEGKVLTTVSSSRMSHLVDAAGRKSAHNAILRDLAMLENQIPLF  188

Query  1432  ILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIV  1256
             +LRK+L+ Q  S E +DD+L+ ML+GL KELSPFK  E    V++ ++ HLL +L+Q IV
Sbjct  189   VLRKILELQFSSLELADDMLMAMLVGLCKELSPFKVVEIFPEVKVTESAHLLDFLYQMIV  248

Query  1255  PEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             P++E    EI    +    +   GE++ F K+S +VK    ++W I  KLNKGP   LKR
Sbjct  249   PKLELGTSEITEIHDEDQCDANQGEKNSFGKSS-HVKQFLNEIWKIAIKLNKGPVHLLKR  307

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIE  896
             +    P+K +  +PW  ++ +PGL ++  P++ L    +KP   + +   +N++ PP +E
Sbjct  308   IVFSKPMKVMFKLPWTLLSNIPGLKILILPMKYLCFSQEKP---QENPENENSNNPPLVE  364

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EI IPS++EL+ AGV  + T  GI SI +D+K   LYLP V LD+N+EV+LRNLVAYEAC
Sbjct  365   EIAIPSISELSKAGVSIVATNGGITSISYDSKKMALYLPTVNLDVNTEVILRNLVAYEAC  424

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
              A GPLV  RYTE MNGI+DT EDV  LRE+G++LNRLKSD EV NLWN M+KSV+LTKV
Sbjct  425   NASGPLVFTRYTELMNGIIDTIEDVALLRERGVVLNRLKSDDEVTNLWNSMSKSVKLTKV  484

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
             + LDK I+DVNKFYN RW VK  + M+ Y+F SW+FLT LA I+LL+LM LQ+FCSVY+C
Sbjct  485   SCLDKVIEDVNKFYNGRWKVKIGKCMKYYVFESWKFLTFLAAIMLLMLMSLQAFCSVYSC  544

Query  355   SRFF  344
             SR F
Sbjct  545   SRVF  548



>ref|XP_011016232.1| PREDICTED: LOW QUALITY PROTEIN: putative UPF0481 protein At3g02645 
[Populus euphratica]
Length=539

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/536 (55%), Positives = 380/536 (71%), Gaps = 5/536 (1%)
 Frame = -3

Query  1969  NIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN  1790
             N+  +E +W+I+I++TLE ELE + EI V IF VPK  M  DP+ Y PQ VAIGPYH   
Sbjct  6     NLSFNEHRWIINIRRTLEEELENDAEIPVCIFNVPKAXMTSDPDSYTPQEVAIGPYHQWR  65

Query  1789  PELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMA  1610
             PEL+EMER+KL AAK  QK+L+++K   +   + K+E +IR  Y K L+   ETL WMMA
Sbjct  66    PELYEMERYKLAAAKRTQKKLQSLKFQHVVHRLSKLELKIRACYHKCLDFSNETLTWMMA  125

Query  1609  VDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFI  1430
             +DASFLLEFL++YA+KEG  +  + S  MSHLVD  G+KS+HNA+LRD++MLENQIP F+
Sbjct  126   IDASFLLEFLEIYAIKEGIAITRVSSISMSHLVDYAGRKSAHNAILRDVVMLENQIPLFV  185

Query  1429  LRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVP  1253
             LRK+L+ Q  S E +DD+L +ML+G  KELSPFK  +    + I+   HLL YL+  IVP
Sbjct  186   LRKILEVQLSSLELADDMLCSMLLGFCKELSPFKMMQDIPKIHISQCAHLLDYLYGMIVP  245

Query  1252  EMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
             ++E+     EI      +            N  Y++  F ++W I+ +LNKGP R LKRL
Sbjct  246   KVEAPP---EIITEADDQPDAMEGRYNSSGNPTYIRDLFSEIWKIITRLNKGPVRLLKRL  302

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLF-SCGQKPDGDENSDSKDNADKPPSIE  896
                 P K +L +PW  ++ LPG +++K P++ LF S  Q+    EN +S +  ++PP +E
Sbjct  303   LFSRPFKVILKLPWTILSNLPGFSILKQPLQHLFFSQDQEEIKPENENSDNEVNRPPLVE  362

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EITIP VTEL+ +GV F PT   ILSI FD K  TLYLP ++LD+N+EVVLRNLVA+EA 
Sbjct  363   EITIPCVTELSKSGVCFEPTTGNILSITFDVKAVTLYLPTISLDVNTEVVLRNLVAFEAS  422

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
              A GPLV  RYTE MNGI+DT+EDVKFLREKGIILNRLKSD EVA LWNGM+K++RLTKV
Sbjct  423   NASGPLVFTRYTELMNGIIDTEEDVKFLREKGIILNRLKSDEEVAILWNGMSKAIRLTKV  482

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCS  368
              FLDK I+DVNK+YN RW VK  +FM+ Y+FGSWQFLTLLA + LLLLM LQ+FCS
Sbjct  483   PFLDKVIEDVNKYYNQRWTVKVGKFMKRYVFGSWQFLTLLAAVFLLLLMTLQAFCS  538



>ref|XP_010322657.1| PREDICTED: putative UPF0481 protein At3g02645 [Solanum lycopersicum]
Length=549

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/540 (55%), Positives = 392/540 (73%), Gaps = 7/540 (1%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +W+I I++TL+ ELEE+ EI VSIF VPK L++ + +CYVPQ VAIGPYHY   +LH
Sbjct  11    DEHRWIIQIRRTLDEELEEDTEIPVSIFNVPKALLLSNQDCYVPQLVAIGPYHYWRSDLH  70

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             +MER+KL AAK  QK L ++K   L E+++K E RIR SY K LN   ETLAWMMAVDAS
Sbjct  71    DMERYKLAAAKRTQKHLYSLKFQHLVEQLIKFEHRIRSSYHKYLNFNGETLAWMMAVDAS  130

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL++YA+KEGK++   +S++MSHLVD+ G+KS+HNA+LRD+IMLENQIP F+LRK+
Sbjct  131   FLLEFLQIYAIKEGKILTR-VSSRMSHLVDVAGRKSAHNAILRDLIMLENQIPLFLLRKI  189

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L+ QC S E +D +L++ML G  KELSPF+  + S  V I + +HLL +L+Q IVP+++ 
Sbjct  190   LEVQCSSLELADTMLMSMLTGFCKELSPFQTTDESPKVNITECSHLLDFLYQFIVPKLDV  249

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
                EI  D++      ++       K S ++     ++W I+ K+N+GP R LK++    
Sbjct  250   TTSEITEDDHEQSSPIEEENITLGGKLS-HIAQLVNEIWKIIVKINRGPVRFLKKIVFSK  308

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIP  881
             P+K +L +PWK  T LP + ++  PI  LF   +K +      S+ N +KPP  EE+ IP
Sbjct  309   PIKFLLKVPWKLFTNLPVIKLLIQPITYLFFSQEKAE----VISESNMNKPPLFEELAIP  364

Query  880   SVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGP  701
             SVTEL+ +GV F+ T +GI+SI FD      +LP V+LD+N+EV+LRNLVAYEAC A GP
Sbjct  365   SVTELSESGVHFVATSEGIMSINFDDTNIKFHLPRVSLDVNTEVILRNLVAYEACNASGP  424

Query  700   LVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDK  521
             LV  RYTE MNGI+DT+ED   LREKGIILNRLKSD EVA LWNGM++S+RLTKV F+DK
Sbjct  425   LVFTRYTELMNGIIDTEEDAVLLREKGIILNRLKSDKEVAKLWNGMSRSLRLTKVPFIDK  484

Query  520   TIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFN  341
              I+DVN FYN RW++K  + M+ Y+FGSWQFLT LA I+LLLLM LQ+FCSVY C+R F+
Sbjct  485   VIEDVNGFYNGRWSIKIGKMMKHYVFGSWQFLTFLAAIMLLLLMTLQAFCSVYKCARIFH  544



>ref|XP_009606219.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana tomentosiformis]
 ref|XP_009606220.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana tomentosiformis]
Length=555

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/544 (56%), Positives = 396/544 (73%), Gaps = 7/544 (1%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN   DES+W+I I++TL+ ELEE  E+ VSIF VPKTLMV DP+ YVPQ  A+GPYHY 
Sbjct  11    PNF--DESRWIIQIRRTLDEELEEITEVPVSIFNVPKTLMVSDPDSYVPQEAALGPYHYW  68

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
              PEL+EMER+K+ AAK  QKQL+ +K  +L E ++K+ESRIR  Y K LN   ETLAWMM
Sbjct  69    RPELYEMERYKVAAAKRTQKQLQNLKFQNLVEHLIKLESRIRACYHKFLNFNGETLAWMM  128

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
             AVDASFLLEFL +YA KEGK++  +  ++MSHLVD  G+KS+HNA+LRD+ MLENQIP F
Sbjct  129   AVDASFLLEFLHIYAAKEGKVLTTVSFSRMSHLVDASGRKSAHNAILRDLAMLENQIPLF  188

Query  1432  ILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIV  1256
             +LRK+L+ Q  S E +DD+L++ML+GL KELSPFK  E    V++ ++ HLL +L+QTIV
Sbjct  189   VLRKILELQFSSLELADDMLVSMLVGLCKELSPFKMVEIFPEVKVTESAHLLDFLYQTIV  248

Query  1255  PEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             P++E    EI  D +        G ++ F K+S ++K    ++W IL KLN+GP   LKR
Sbjct  249   PKLELGTNEITEDHDQEQCNANQGGKNSFGKSS-HMKQFLNEIWKILVKLNRGPVHLLKR  307

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIE  896
             +    P+K +  +PW  ++ +PGL ++  P++ L    +KP   + +   +N++ PP +E
Sbjct  308   IVFSKPMKVMFKLPWTLLSNIPGLKILILPMKYLCFSQEKP---QENPENENSNNPPLVE  364

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EI IPSV+EL+ AGV  + T  GI SI +D+K   L+LP V LD+N+EV+LRNLVAYEAC
Sbjct  365   EIAIPSVSELSKAGVSIVATNGGITSISYDSKKMALHLPTVNLDVNTEVILRNLVAYEAC  424

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
              A GPLV  RYTE MNGI+DT EDV  LRE+GI+LNRLKSD EVANLWN M+KSV+LTKV
Sbjct  425   NASGPLVFTRYTELMNGIIDTAEDVTLLRERGIVLNRLKSDDEVANLWNSMSKSVKLTKV  484

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
               LDK I+DVNKFYN RW VK  + M+ Y+F SW+FLT LA I+LL+LM LQ+FCSVY+C
Sbjct  485   PVLDKVIEDVNKFYNGRWKVKFGKCMKYYVFESWKFLTFLAAIMLLMLMSLQAFCSVYSC  544

Query  355   SRFF  344
             +R F
Sbjct  545   ARVF  548



>ref|XP_002274147.1| PREDICTED: putative UPF0481 protein At3g02645 [Vitis vinifera]
Length=547

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/543 (54%), Positives = 394/543 (73%), Gaps = 14/543 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I++TL+ ELEE++E+ V+I+ VPKTLM   P+CYVPQ VA+GPYH+  PEL+
Sbjct  10    DELRWVIEIRRTLDEELEEDSEVPVNIYNVPKTLMATKPDCYVPQEVALGPYHHWRPELY  69

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL AAK  QK L+ +K  SL +++ K E RIR  Y K L    +TLAWMMA+DAS
Sbjct  70    EMERYKLAAAKRTQKHLQRVKFESLVDQLTKHEPRIRACYHKFLEFNGDTLAWMMAIDAS  129

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+VYA+K G+++   +S++MSHLVD  G KS+HNA+LRD++MLENQIP F+LRK+
Sbjct  130   FLLEFLQVYAIKAGRVLTR-VSSRMSHLVDYAGTKSAHNAILRDMVMLENQIPLFVLRKV  188

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEME-  1244
             L+ Q P+ + +DD+L +ML G  ++L PF   +    + + +  HLL +L+  IVP  + 
Sbjct  189   LEFQFPTLDQADDMLCSMLAGFGEDLCPFGMMKDLPQIHVEEQAHLLDFLYHLIVPRSKE  248

Query  1243  -SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSS  1067
              SE +E+E       +++    ++E   +S YV+  F  +W ++    +GP R LKRL  
Sbjct  249   PSEIIEVE------NEDESKEGKEESFGDSNYVQQLFQIIWNLVSTCTQGPIRLLKRLLL  302

Query  1066  LAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENS-DSKDNADKPPSIEEI  890
               PVK +L +PW  ++KLPG +++K P+E +F    K   +EN  ++ +N  KPP IEEI
Sbjct  303   SDPVKVILKLPWTIVSKLPGFSILKQPVEDIFFSQNK---EENKPENGNNIIKPPLIEEI  359

Query  889   TIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIA  710
              IPSV+EL+ +GVRF+PT   I SI FDAK  TLYLP V+L++N+EV+LRNLVAYEA  A
Sbjct  360   AIPSVSELSKSGVRFLPTNGSISSITFDAKMATLYLPTVSLEVNTEVILRNLVAYEASNA  419

Query  709   KGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAF  530
              GPL++ARYTE MNGI+DT ED +FLRE+GIILNRLKSD EVA+LWNGMNK++RLTKV F
Sbjct  420   SGPLIIARYTELMNGIIDTKEDAQFLRERGIILNRLKSDEEVADLWNGMNKTIRLTKVPF  479

Query  529   LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
             LDK I+DVN ++   W VK  +FM+ Y+FGSWQFLT LAT+ +L LM LQ+FCSVY+C R
Sbjct  480   LDKVIEDVNNYHTGIWQVKAGKFMKRYVFGSWQFLTFLATVCILWLMALQAFCSVYSCPR  539

Query  349   FFN  341
              FN
Sbjct  540   MFN  542



>ref|XP_010065040.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis]
Length=548

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/541 (54%), Positives = 379/541 (70%), Gaps = 19/541 (4%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I++ LE ELE+E E+ VSIF VP  LM  DP+ Y PQ+VAIGPYH+  PE++
Sbjct  19    DEIQWVIQIRRMLEEELEDETEVPVSIFSVPTVLMSSDPDLYTPQQVAIGPYHHWRPEMY  78

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL A K +QKQL  IK  SL E+++K+E R+R  Y K L+   ETLAWMM +DA 
Sbjct  79    EMERYKLAAVKRYQKQLERIKFQSLVEQLVKLEPRVRACYHKYLDFNGETLAWMMVIDAL  138

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL++YA+KEGK+++                +S+HNA+LRDI+MLENQIP FILRKM
Sbjct  139   FLLEFLQIYAIKEGKMLS----------------RSAHNAILRDIVMLENQIPLFILRKM  182

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L+ QC S + +DD+LLTMLMG  KE+SPFK  E    +Q++   HLL +L+  +VP++E 
Sbjct  183   LEFQCASLDEADDMLLTMLMGFYKEVSPFKPMEALPNIQVSVCAHLLDFLYDILVPKVEG  242

Query  1240  E-HVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
             +  +  E       K++           + Y+K     +W +L KLN GP + LKRL   
Sbjct  243   QPEIIEEEGNGEDKKDRGLSPLASSSSGTSYIKQLCDAIWNLLSKLNNGPIKMLKRLLFS  302

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITI  884
              PVK +L +PW  ++KLP  +V+  P+ESLF   +K DG   ++S  N  KPPS+EE+ I
Sbjct  303   KPVKVLLKLPWTILSKLPFFSVLAQPLESLFLSQEKEDGKSENES-SNPSKPPSVEEMAI  361

Query  883   PSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKG  704
             PSV++L+N GVRF+ T   + SI FD K  TLYLP ++LD+NSE  +RNLVAYEA  A G
Sbjct  362   PSVSDLSNVGVRFVATNGNLSSIGFDTKMATLYLPAISLDVNSEAFMRNLVAYEASNASG  421

Query  703   PLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLD  524
             PLV  RYTE MNGI+D+DEDVK LREKG+ILNRLKSD EVA LWN M+KS+RLTKV FLD
Sbjct  422   PLVFTRYTELMNGIIDSDEDVKLLREKGVILNRLKSDEEVAKLWNSMSKSIRLTKVPFLD  481

Query  523   KTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFF  344
             K I+DVNK+YN RW VK  +FM+ Y++GSWQFL LLA I LLLLM  Q+FCSVY+CSR F
Sbjct  482   KAIEDVNKYYNGRWKVKLGKFMKLYVYGSWQFLALLAAIALLLLMTSQAFCSVYSCSRIF  541

Query  343   N  341
             +
Sbjct  542   H  542



>ref|XP_010097138.1| hypothetical protein L484_025683 [Morus notabilis]
 gb|EXB67205.1| hypothetical protein L484_025683 [Morus notabilis]
Length=564

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/547 (54%), Positives = 388/547 (71%), Gaps = 13/547 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WV  I++TLE ELE+++E+ VSIF VPK LM  D + Y PQ VAIGPYH+  PEL+
Sbjct  17    DELRWVTQIRRTLEEELEDDSEVPVSIFNVPKILMASDLDSYTPQEVAIGPYHFWRPELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL AAK  QK L+ +K   L +++ K E RIR  Y K L++  ETLAWMMA+DAS
Sbjct  77    EMERYKLTAAKRAQKHLKNLKFQDLVQQLTKHEHRIRACYHKYLDVNGETLAWMMAMDAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+VYA    + +   +S++MSHLVD   +KS+HN +LRDI+MLENQIP F+L KM
Sbjct  137   FLLEFLQVYANLNEEKVLRRLSSRMSHLVDYARRKSAHNTILRDIVMLENQIPLFVLIKM  196

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK-----NEGSAVVQIADATHLLGYLFQTIVP  1253
             L+ Q  S EA++D+LL+ML G S+ELSPFK           + ++D  HLL +L+Q I P
Sbjct  197   LEFQFSSLEAANDMLLSMLSGFSQELSPFKMMDVDPHTPNTLLVSDFAHLLDFLYQMITP  256

Query  1252  EMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
             ++E+   EI       + E  +G ++    NS  VK     +W +L KLNKGP R LKR+
Sbjct  257   KIEAHADEI-----IDVVEDGEGNKESSFGNSNSVKQLLHTIWKVLSKLNKGPMRLLKRI  311

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDG---DENSDSKDNADKPPS  902
                 P+K  L +PW  ++ LPGL ++K P E  FS   K +    ++NS +K   +KPP 
Sbjct  312   LFSRPLKVFLKLPWTILSNLPGLRMLKAPTEMFFSQANKEEAKPENDNSSNKTTINKPPL  371

Query  901   IEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYE  722
             IEEITIPSVTEL+ +GVRF PT   + +I FD KT   YLP ++LD+N+E +LRNL+AYE
Sbjct  372   IEEITIPSVTELSKSGVRFSPTNGSLSTITFDPKTVIFYLPTISLDVNTEAILRNLIAYE  431

Query  721   ACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLT  542
             A  A GPLV  RYTE MNGI+DT++DVK LRE+G+ILNRLKSD EVANLWNGM+KS+RLT
Sbjct  432   ASNAYGPLVFTRYTELMNGIIDTEDDVKLLRERGVILNRLKSDEEVANLWNGMSKSIRLT  491

Query  541   KVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVY  362
             KV FLDK I+DVN ++N RW VK  +FM+ Y+FGSW+FLTLLA +++LLLM LQ+FCSVY
Sbjct  492   KVPFLDKVIEDVNTYHNGRWKVKFGKFMKLYVFGSWRFLTLLAAVLMLLLMGLQAFCSVY  551

Query  361   TCSRFFN  341
             TC+R F+
Sbjct  552   TCARIFH  558



>ref|XP_010658671.1| PREDICTED: putative UPF0481 protein At3g02645 [Vitis vinifera]
Length=537

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/547 (54%), Positives = 383/547 (70%), Gaps = 23/547 (4%)
 Frame = -3

Query  1969  NIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN  1790
             N   DE +WVI I++TL+ ELE+ +E+ V IF VPKTLM   P+CYVPQ VA+GPYH   
Sbjct  6     NSSFDELEWVIQIRRTLDEELEDNSEVPVCIFNVPKTLMATKPDCYVPQEVALGPYHRWR  65

Query  1789  PELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMA  1610
             PEL+EMER+KL AAK  QK L+++K HSL +++ K E RIR  Y K L    ETLAWMMA
Sbjct  66    PELYEMERYKLAAAKRIQKNLQSLKFHSLVDQLTKHEPRIRACYHKFLEFNGETLAWMMA  125

Query  1609  VDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFI  1430
             +DASFLLEFL+VYA+KE               VD  G KS+HNA+LRD++MLENQIP  +
Sbjct  126   IDASFLLEFLQVYAMKE---------------VDYAGTKSAHNAILRDMVMLENQIPLLV  170

Query  1429  LRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVP  1253
             LR++L+ Q  S + +DD+L +ML G  ++L PF   E    +Q+    HLL +L+  IVP
Sbjct  171   LRQVLEFQFSSLDQADDMLCSMLTGFGEDLCPFGMMENLPKIQVEKYAHLLDFLYHLIVP  230

Query  1252  EMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
               +    E         + +    ++E   +S YV+  F ++W +L K+N+GP R LKR+
Sbjct  231   RSK----EPSEIIEVENENESKEGKEESFGDSSYVQQLFEEIWKLLSKMNRGPVRILKRI  286

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLF-SCGQKPDGDENSDSKDNAD--KPPS  902
                 PVK +L +PW  ++ LPG  ++K P+E  F S  ++ +  EN +SK N+   KPP 
Sbjct  287   IFSKPVKVILKLPWTIVSNLPGFAILKQPVEYFFFSQDKEENKPENGNSKSNSSIVKPPL  346

Query  901   IEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYE  722
             IEEITIPSV+EL+ +GVRF+PT  GI SI FDAK  TLYLP V+LD+N+EV LRNLVAYE
Sbjct  347   IEEITIPSVSELSKSGVRFLPTNGGISSITFDAKMVTLYLPTVSLDVNTEVTLRNLVAYE  406

Query  721   ACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLT  542
             +  A GPLV+ RYTE MNGI+DT ED KFLRE+GI+LNRLKSD EVANLWNGM++S+RLT
Sbjct  407   SSNASGPLVITRYTELMNGIIDTKEDAKFLRERGIVLNRLKSDEEVANLWNGMSRSIRLT  466

Query  541   KVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVY  362
             KV FLDK I+DVNK+++ RW VK  +FM+ Y+FGSWQFLT LA I+++LLM LQ+FCSVY
Sbjct  467   KVPFLDKVIEDVNKYHSGRWKVKAGKFMKRYVFGSWQFLTFLAAILIVLLMTLQAFCSVY  526

Query  361   TCSRFFN  341
             +C R FN
Sbjct  527   SCPRIFN  533



>ref|XP_010250392.1| PREDICTED: putative UPF0481 protein At3g02645 [Nelumbo nucifera]
Length=546

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/545 (56%), Positives = 387/545 (71%), Gaps = 19/545 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeen-EINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +WV  I++TL+ ELE++N    V IF VPKTLM   PE Y+PQ+VA+GPYHY  PEL
Sbjct  10    DELRWVSQIRRTLDEELEDDNGSTPVCIFNVPKTLMSSKPESYIPQQVALGPYHYWRPEL  69

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             +EMER+KL AAK  QKQL+ IK   L +++ K+E RIR  Y K L+   ETLAWMMAVDA
Sbjct  70    YEMERYKLSAAKRTQKQLQCIKFQHLVDQLTKLEPRIRSCYHKYLDFNGETLAWMMAVDA  129

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLEFL++YA+KEGK++              +  KS+HNA+LRDI+MLENQIP F+LRK
Sbjct  130   SFLLEFLQIYAIKEGKILT-------------RVSKSAHNAILRDIVMLENQIPLFLLRK  176

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEME  1244
             +L+ Q  S E +D +L +ML GL  ELSPFK  +    + +++  HLL +L+  IVP  E
Sbjct  177   ILECQFLSLETADGVLFSMLTGLCTELSPFKMIDNFPRIHVSERFHLLDFLYHMIVPMSE  236

Query  1243  SEHVEI-EIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSS  1067
              +  EI E D++ G     D  E+E    S +VK    ++W +L KLNKGP R LK+   
Sbjct  237   EQQSEINEADDDQGSNPTDDRGEEETFAKSNHVKQLLDEIWKLLSKLNKGPVRYLKQALV  296

Query  1066  LAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPD-GDEN--SDSKDNADKPPSIE  896
               PVK VL +PW  IT+LPG +++K P+E  F    K D   EN  S S +NA+KPP IE
Sbjct  297   SKPVKLVLKLPWAIITRLPGFSILKQPVEYYFFTQDKEDVKPENGASSSTNNANKPPLIE  356

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EITIPSVTEL  +G+RF  T   I +I FD KT T YLP ++LD+N+EVVLRNLVAYEA 
Sbjct  357   EITIPSVTELYKSGIRFSLTTGDITTISFDEKTVTFYLPTISLDVNTEVVLRNLVAYEAS  416

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
              A GPLV  RYTE MNGI+DT EDV+ LRE+GI+LNRLKSD EVANLWNGM+KSVRLTKV
Sbjct  417   AASGPLVFTRYTELMNGIIDTKEDVELLRERGIVLNRLKSDEEVANLWNGMSKSVRLTKV  476

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
               LDK I+DVN++Y+ RW VK  +FM++Y+FGSWQFLTL+A I+LLLLM LQ+FCSVY+C
Sbjct  477   PLLDKVIEDVNRYYSSRWKVKAGKFMKAYVFGSWQFLTLVAAIMLLLLMTLQAFCSVYSC  536

Query  355   SRFFN  341
             +R F+
Sbjct  537   ARVFH  541



>ref|XP_006427511.1| hypothetical protein CICLE_v10027595mg [Citrus clementina]
 gb|ESR40751.1| hypothetical protein CICLE_v10027595mg [Citrus clementina]
Length=561

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/542 (54%), Positives = 387/542 (71%), Gaps = 8/542 (1%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +W+I+I++TLE ELE + +I V IF VPKTLM  DP+ Y PQ VAIGPYHY  PEL+
Sbjct  16    DEHRWIINIRRTLEEELETDTDIPVCIFSVPKTLMFSDPDSYTPQEVAIGPYHYWRPELY  75

Query  1777  EMERHKLDAAKIFQKQLR-TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             EMER+KL AAK  Q+ +    K   + +++ ++E +IR  Y K LN   ETLAWMMA+DA
Sbjct  76    EMERYKLAAAKRAQRHIDGDHKFQYIVDQLKELELKIRACYHKFLNFSNETLAWMMAIDA  135

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLEFL++YAVKE KL A   S  MSHL+D  G K++HN +LRD++MLENQIP F+LRK
Sbjct  136   SFLLEFLQIYAVKEAKLSATYSSTSMSHLLDYAGTKAAHNTILRDMVMLENQIPLFVLRK  195

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPEME  1244
             ML+ Q  S E++DD+L  MLMG  +ELSPFK  +   ++ +++  HLL +L+ TIVP++E
Sbjct  196   MLEVQYSSLESADDMLQAMLMGFCEELSPFKLMKDMPMIDVSECAHLLDFLYDTIVPKVE  255

Query  1243  SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
              +    EI E    +   +  ++ +   S YVK  FG++W +L KLNKGP   +K+L   
Sbjct  256   QKS---EISEVVEDQGDDEKPKERYTGGSTYVKKIFGEIWKLLSKLNKGPILFIKKLLVS  312

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLF---SCGQKPDGDENSDSKDNADKPPSIEE  893
              PVK    +P+  ++KLPG +++  PI+ L        K   DE+S + +N +KPP +EE
Sbjct  313   KPVKFFFKLPFTMLSKLPGFSMLAQPIQYLIFPQDNDDKKSDDESSHTSNNLNKPPLVEE  372

Query  892   ITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACI  713
             I IPSVTELA + V F+PT   I ++ FD KT TL+LP ++ DIN+EV+LRNLVAYEA  
Sbjct  373   IIIPSVTELAKSQVHFLPTAGNISTLRFDRKTATLHLPTISFDINTEVILRNLVAYEASN  432

Query  712   AKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVA  533
             A GPLV  RYTE MNGI+DT+EDVK LREKGIILNRLKSD+E+ NLWNGM+KS+RLTKV 
Sbjct  433   ASGPLVFTRYTELMNGIIDTEEDVKLLREKGIILNRLKSDAEITNLWNGMSKSIRLTKVP  492

Query  532   FLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCS  353
              +DK I+ VNK YN +W VK ++ M+ Y+FGSWQFLTLLATI+LLLLM LQ+FCSVY C 
Sbjct  493   HIDKVIEGVNKHYNSQWKVKFRKSMKHYVFGSWQFLTLLATIMLLLLMTLQAFCSVYNCR  552

Query  352   RF  347
             +F
Sbjct  553   KF  554



>ref|XP_004492405.1| PREDICTED: putative UPF0481 protein At3g02645-like [Cicer arietinum]
Length=564

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/542 (55%), Positives = 391/542 (72%), Gaps = 6/542 (1%)
 Frame = -3

Query  1957  DESKWVIHIQKT-lereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE KWVIH++KT  E   EE+ E +V+IF VPK LM  DP+ YVPQ+VAIGPYHY   EL
Sbjct  17    DELKWVIHVRKTLEEEFEEEDGEFSVTIFHVPKLLMASDPDSYVPQQVAIGPYHYWRQEL  76

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             +EM+ +KL + K F KQL+++KL  L +++ K+E R+R  Y K L+L  ETL WMM VDA
Sbjct  77    YEMQNYKLASTKRFLKQLQSLKLDHLLDQLTKLEQRVRGCYHKFLDLNGETLVWMMIVDA  136

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLE L+ YA++EG     +I +KMS+LVD  G+KS+HN +LRD++MLENQIP  +LRK
Sbjct  137   SFLLELLQFYAMQEGA--KKVILSKMSNLVDYGGRKSAHNEILRDLVMLENQIPLCVLRK  194

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEME  1244
             ML+ +  S EASD++L+ ML+GL KE+SPFK  E    ++++   HLL + +  IVP++E
Sbjct  195   MLKFKFSSKEASDEMLVLMLLGLFKEISPFKMIEDVPNIKVSQIAHLLDFFYNMIVPKLE  254

Query  1243  SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
             ++   I   E    +E+++  ++     S YV   F ++W IL KLNKGP + +KR    
Sbjct  255   TQQDIIIDVEIQQEEEQQNEGDENSKGKSSYVNQFFSELWKILSKLNKGPMKLIKRGLVS  314

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPD-GDENSDSKDNADKPPSIEEIT  887
              P+K +  +PWK IT LPG  ++K PIE++F   +K D  +EN +     + PP IEEIT
Sbjct  315   RPLKVLGKIPWKIITNLPGGKLLKKPIENIFFSHEKSDEKNENENPTSQINNPPLIEEIT  374

Query  886   IPSVTELANAGVRFIPTKKGILS-IEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIA  710
             IPSV EL N+GV F PT  G +S I FDAKT  LYLP++ LD+N+EV LRNLVA+E+ + 
Sbjct  375   IPSVKELVNSGVHFFPTSNGTISNINFDAKTRILYLPIIGLDVNTEVFLRNLVAFESSVG  434

Query  709   KGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAF  530
              GPLV+ RYTE MNGI+DT+ED K LREKGIILN LKSD EVAN+WNGM+KS+RL+KVAF
Sbjct  435   SGPLVITRYTELMNGIIDTEEDAKILREKGIILNHLKSDKEVANMWNGMSKSLRLSKVAF  494

Query  529   LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
             LDKTI+DVNK+YN R  VK  +FM+SY+FGSWQFLT LA I LLLLM LQ+FCSVY CSR
Sbjct  495   LDKTIEDVNKYYNSRLKVKIWKFMKSYVFGSWQFLTFLAAIFLLLLMALQAFCSVYNCSR  554

Query  349   FF  344
             FF
Sbjct  555   FF  556



>ref|XP_004236453.2| PREDICTED: putative UPF0481 protein At3g02645 [Solanum lycopersicum]
Length=558

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/538 (55%), Positives = 388/538 (72%), Gaps = 3/538 (1%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +W+I I++TL+ ELEE +EI V IF VPK+LMV DP+ YVPQ V++GPYHY  PEL+
Sbjct  14    DEDRWIIQIRRTLDEELEEFSEIPVCIFNVPKSLMVSDPDSYVPQEVSLGPYHYWRPELY  73

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL AAK  QKQL+ IK   L E+++K+ESRIR  Y K LN   ETLAWMMAVDAS
Sbjct  74    EMERYKLGAAKRTQKQLQNIKFQHLVEQLIKLESRIRSCYHKYLNFNGETLAWMMAVDAS  133

Query  1597  FLLEFLKVYAVKEGKLMA-AMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             FLLEFL++YAVKEG ++  AM S+ MSHL+D+ G+KS+HNALLRD+ MLENQIP F+LRK
Sbjct  134   FLLEFLRIYAVKEGMVLTRAMSSSTMSHLIDVAGRKSAHNALLRDLAMLENQIPLFVLRK  193

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPEME  1244
             +L+ Q  S + +D++L++ML+G+ KELSPFK  E    VQ+ ++ HLL +L+Q IVP++E
Sbjct  194   ILELQFTSLDLADNMLMSMLVGICKELSPFKMEEKIREVQVTESAHLLDFLYQMIVPKLE  253

Query  1243  SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
                 +   D +   +      ++     S +VK    +VW IL K+N+GP R +KRL   
Sbjct  254   LPTSDTTEDRDDQDQIDTHQCQNNSFGKSIHVKQFVNEVWKILVKVNRGPVRLVKRLVLS  313

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITI  884
              P+K +  +PW  ++ +PGL ++  P++ L    Q+   +   +  +N    P +EEI I
Sbjct  314   KPMKVMFKLPWTLVSNIPGLKLLILPMKCL-CFSQEKAVENPENENENESNSPLVEEIAI  372

Query  883   PSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKG  704
             PSV+EL+ AGV F  T  GI SI FD K  T YLP + +DIN+EV+LRNLVAYEAC A G
Sbjct  373   PSVSELSKAGVNFAATNGGITSISFDFKNMTFYLPTINVDINTEVILRNLVAYEACNASG  432

Query  703   PLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLD  524
             PLV  RYTE MNGI+DT+EDV  LR +GI+LNRLKSD +V+NLWN M+KSV+LTKV  LD
Sbjct  433   PLVFTRYTELMNGIIDTEEDVALLRGRGIVLNRLKSDDQVSNLWNSMSKSVKLTKVELLD  492

Query  523   KTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
             K I+DVNKFYN RW VK  ++M+ Y+F SWQFLT LA I+LL+LM LQ+FCSVY+C+R
Sbjct  493   KVIEDVNKFYNGRWRVKIGKYMKYYVFESWQFLTFLAAIMLLMLMTLQAFCSVYSCAR  550



>ref|XP_008372690.1| PREDICTED: putative UPF0481 protein At3g02645 [Malus domestica]
Length=560

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/547 (53%), Positives = 389/547 (71%), Gaps = 6/547 (1%)
 Frame = -3

Query  1954  ESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHE  1775
             E +WVI I+KTLE EL++++EI VSIF VPKTL+  DP+ Y PQ VAIGPYHY  PEL+E
Sbjct  18    EFQWVIQIRKTLEEELDDDSEIPVSIFNVPKTLLASDPDSYTPQEVAIGPYHYLRPELYE  77

Query  1774  MERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASF  1595
             MER+K+ AAK  QK L+ +K  +L ++++K+E RIR  Y K L+   ETL WMMA+DASF
Sbjct  78    MERYKVAAAKRTQKNLQCLKFQNLVDQLIKLEPRIRACYHKYLDFNGETLGWMMAIDASF  137

Query  1594  LLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKML  1415
             LLE ++VY  KEGK++   +S+KMS LVD  G+ S+H+++LRD++MLENQIP F+LRKML
Sbjct  138   LLEMVQVYGAKEGKILTR-VSSKMSRLVDYSGRNSAHHSILRDLVMLENQIPLFVLRKML  196

Query  1414  QPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQTIVPEMES  1241
             + +  S E +D++LL+MLMGL KELSPFK  +E    +++++  HLL +L+Q I P++E 
Sbjct  197   EFRFQSLETADEMLLSMLMGLCKELSPFKMKDEDLPKIKVSECAHLLDFLYQMITPKLER  256

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
                EI ++     +   + +E +  K+  YVK    +VW +L KLNKGP R LK +    
Sbjct  257   RPSEI-VEAEDQGEGTDEDKESKSTKSPNYVKQFLEEVWNLLSKLNKGPVRLLKNILVSG  315

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIP  881
             P+K +  +PW  ++ LPG  ++K P+  LFS   K +    ++S  N  KPP +EEITIP
Sbjct  316   PIKVIFKLPWTILSSLPGFALLKQPVAYLFSSQDKEEIKPENESSVN--KPPLVEEITIP  373

Query  880   SVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGP  701
             SV++L  +G+RF+PTK  I SI FD KT TLYLP  +LD+N+EV+LRNLV YEA  A G 
Sbjct  374   SVSDLMESGIRFVPTKGCISSISFDPKTVTLYLPATSLDVNAEVILRNLVTYEASNASGQ  433

Query  700   LVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDK  521
             LV  RYTE MNGI+DT+ED K LREKGIILNRLKSD EVA+L+NGM+KS+RLTKV FLD+
Sbjct  434   LVFTRYTEMMNGIIDTEEDAKLLREKGIILNRLKSDEEVASLFNGMSKSIRLTKVPFLDQ  493

Query  520   TIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFN  341
              I+DVNK+YN RW VK  +  + Y+ G W  L LLA + LLLLM LQ+FCSVY+C R F+
Sbjct  494   AIEDVNKYYNGRWKVKMAKIFKVYVVGCWPILALLAAVFLLLLMALQAFCSVYSCGRIFH  553

Query  340   DVTILGT  320
               T   T
Sbjct  554   INTTTTT  560



>ref|XP_009338489.1| PREDICTED: putative UPF0481 protein At3g02645 [Pyrus x bretschneideri]
Length=560

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/548 (52%), Positives = 390/548 (71%), Gaps = 6/548 (1%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             +E +WVI I+KTL  EL++++EI VS+F VPKTL+  DP+ Y PQ VA+GPYHY  PEL+
Sbjct  17    NEFQWVIQIRKTLGEELDDDSEIPVSVFSVPKTLLASDPDSYTPQEVAVGPYHYLRPELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+K+ AAK  QK L+ +K  +L ++++ +E RIR  Y K L+   ETL WMMA+DAS
Sbjct  77    EMERYKVAAAKRTQKNLQCLKFQNLVDQLINLEPRIRACYHKYLDFNGETLGWMMAIDAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLE +++Y  KEGK++   +S+KMS LVD  G+ S+H+A+LRD++MLENQIP F+LRKM
Sbjct  137   FLLEMIQLYGAKEGKILTR-VSSKMSRLVDYSGRNSAHHAILRDLVMLENQIPLFVLRKM  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQTIVPEME  1244
             L+ +  S E +D++LL+ML GL KELSPFK  +E   ++ +++  HLL +++Q I P++E
Sbjct  196   LEFRFQSLETADEMLLSMLTGLCKELSPFKMKDEDLPMITVSECAHLLDFVYQMITPKLE  255

Query  1243  SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
                 EI ++     +  ++ +E +  KN  YVK    +VW +L KLNKGP R LK++   
Sbjct  256   RRPSEI-VEAEDQGEGTEEDKESKSTKNPNYVKQFLEEVWKLLSKLNKGPVRLLKKILVS  314

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITI  884
              P+K +  +PW  ++ LPG  ++K P+  LFS   K +    ++S  N  KPP +EEITI
Sbjct  315   GPIKVIFKLPWTILSSLPGFALLKQPVAYLFSSQDKEEIKPENESSVN--KPPLVEEITI  372

Query  883   PSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKG  704
             PS ++L  +GVRF+PTK  I SI FD KT TLYLP  +LD+N+EV+LRNLVAYEA  A G
Sbjct  373   PSASDLMESGVRFVPTKGCISSISFDPKTVTLYLPATSLDVNTEVILRNLVAYEASNASG  432

Query  703   PLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLD  524
              LV  RYTE MNGI+DT+ED K LR+KGIILNRLKSD+EVANL+NGM+KS+RLTKV FLD
Sbjct  433   QLVFTRYTEMMNGIIDTEEDAKLLRKKGIILNRLKSDAEVANLFNGMSKSIRLTKVPFLD  492

Query  523   KTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFF  344
             + I+D+NK+YN RW VK  +  + Y+ G W  L LLA + LLLLM LQ+FCSVY+C R F
Sbjct  493   QAIEDLNKYYNGRWKVKMAKNFKVYVVGCWPILALLAAVFLLLLMALQAFCSVYSCGRIF  552

Query  343   NDVTILGT  320
             +  T   T
Sbjct  553   HINTTTTT  560



>ref|XP_006356264.1| PREDICTED: putative UPF0481 protein At3g02645-like [Solanum tuberosum]
Length=623

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/537 (53%), Positives = 387/537 (72%), Gaps = 7/537 (1%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +W+I I++TL+ ELEE+ EI VSIF VPK L++ D +CYVPQ +AIGPYHY   +LH
Sbjct  11    DEHRWIIQIRRTLDEELEEDTEIPVSIFNVPKALLLSDQDCYVPQLLAIGPYHYWRSDLH  70

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             +MER+KL AAK  QK L ++K   L E+++K E RIR SY K LN   ETLAWMMAVDAS
Sbjct  71    DMERYKLAAAKRTQKHLYSLKFQHLVEQLIKFEHRIRCSYHKYLNFNGETLAWMMAVDAS  130

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL++YA+KEGK++   +S++MSHLVD+ G+KS+HNA+LRD+IMLENQIP F+LRK+
Sbjct  131   FLLEFLQIYAIKEGKILTR-VSSRMSHLVDVAGRKSAHNAILRDLIMLENQIPLFLLRKI  189

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L+ Q  S E +D +L++ML G  KE+SPF+  + S    + + +HLL +L+Q IVP+++ 
Sbjct  190   LEVQYSSLELADTMLMSMLTGFCKEISPFQMIDESPKENVTECSHLLDFLYQFIVPKLDV  249

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
                EI  +++       + E + F+  S ++     ++W IL K+N+GP R LK++    
Sbjct  250   TTSEIT-EDDHEQISLIEEENNTFVGKSSHIGQLINEIWNILVKINRGPVRFLKKIVFSK  308

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIP  881
             P+K +L +PWK  + LP + +   PI  L    +K + +  S    N +KPP  EE+ IP
Sbjct  309   PIKFLLKVPWKLFSNLPVIKLFIQPITYLIFSQEKAEVNFES----NMNKPPLFEELAIP  364

Query  880   SVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGP  701
             SV EL+ +GV F+ T +GI+SI FD      +LP V+LD+N+EV+LRNLVAYEAC A GP
Sbjct  365   SVAELSKSGVNFVATNEGIMSINFDDTKIKFHLPRVSLDVNTEVILRNLVAYEACNASGP  424

Query  700   LVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDK  521
             LV  RYTE MNGI+DT+ED   LREKGIILNRLKSD EVANLWNGM++S+RLTKV F+DK
Sbjct  425   LVFTRYTELMNGIIDTEEDAVLLREKGIILNRLKSDKEVANLWNGMSRSLRLTKVPFIDK  484

Query  520   TIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
              I+DVN FYN RW++K  + M+ Y+FGSWQFLT LA I+LL+LM LQ+FCSVY C+ 
Sbjct  485   VIEDVNGFYNGRWSIKIGKMMKHYVFGSWQFLTFLAAIMLLMLMTLQAFCSVYKCAH  541



>ref|XP_002269592.1| PREDICTED: putative UPF0481 protein At3g02645 [Vitis vinifera]
Length=552

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/554 (52%), Positives = 390/554 (70%), Gaps = 13/554 (2%)
 Frame = -3

Query  1969  NIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN  1790
             N + DE +WVI I++TL+ ELEE++E+ V+I+ VPKTLM   P+CYVPQ VA+GPYH+  
Sbjct  6     NPRFDELRWVIEIRRTLDEELEEDSEVPVNIYNVPKTLMAAKPDCYVPQEVALGPYHHWQ  65

Query  1789  PELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMA  1610
             PEL+EMER+KL AAK  QK L+ +K  SL +++ K E RIR  Y K L    +TLAWMMA
Sbjct  66    PELYEMERYKLAAAKRTQKHLQRVKFESLVDQLNKHEPRIRACYHKFLQFNGDTLAWMMA  125

Query  1609  VDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFI  1430
             +DASFLLEFL+VY++K G L+   +S++MSHLVD  G KS+HNA+LRD++M+ENQIP F+
Sbjct  126   IDASFLLEFLQVYSIKAGWLLTR-VSSRMSHLVDYAGTKSAHNAILRDMVMVENQIPLFV  184

Query  1429  LRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVP  1253
             LRK+L+ Q P+ + +DD+L +ML G  ++L PF+  E    V + +  HLL +L+  IVP
Sbjct  185   LRKVLEFQFPTLDQADDMLRSMLAGFGEDLCPFRMKEDLTQVHVEEQAHLLDFLYHIIVP  244

Query  1252  EME--SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALK  1079
               +  SE +E+E       +++    ++    +S YV+  F  +W +L   N+GP   LK
Sbjct  245   RSKEPSEIIEVE------NEDESKEGKEGSFGDSSYVQQLFQIIWNLLSTSNQGPISLLK  298

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNAD---KP  908
             RL S  PVK +L +PWK I  LPG +++K P+E +F   +K + +  + + ++     KP
Sbjct  299   RLLSSDPVKVILKLPWKIIFNLPGFSILKRPVEYIFFSQKKEESNPENGNSNSNSNIIKP  358

Query  907   PSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVA  728
             P IEEI IPSV++L  +GVRF+P    I SI FDAK  TLYLP V+LD+N+EV LRNLVA
Sbjct  359   PLIEEIAIPSVSKLYKSGVRFLPANGSISSITFDAKMATLYLPTVSLDVNTEVTLRNLVA  418

Query  727   YEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVR  548
             YEA  A GPLV+ RYTE MNGI+DT+ED K LRE+GIILNRLKSD EVANLWNGM+KS+R
Sbjct  419   YEASNASGPLVMTRYTELMNGIIDTEEDAKILRERGIILNRLKSDEEVANLWNGMSKSIR  478

Query  547   LTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCS  368
             LTKV FLDK I+DVN ++   W VK  +FM+ Y+ GSWQ LT +AT+++ LLM LQ+FCS
Sbjct  479   LTKVPFLDKVIEDVNNYHTGIWKVKAGKFMKRYVIGSWQLLTFVATVLIFLLMTLQAFCS  538

Query  367   VYTCSRFFNDVTIL  326
             VY C R F   T L
Sbjct  539   VYNCPRMFRVTTDL  552



>ref|XP_007023345.1| Uncharacterized protein TCM_027335 [Theobroma cacao]
 gb|EOY25967.1| Uncharacterized protein TCM_027335 [Theobroma cacao]
Length=614

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/539 (53%), Positives = 380/539 (71%), Gaps = 2/539 (0%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI+I++ L+ ELE++ EI VSIF VPK LM   P+CY PQ+V I PYHY  P+L+
Sbjct  71    DEFRWVINIRRFLDEELEDDIEIPVSIFNVPKALMSSSPDCYTPQQVGISPYHYWRPDLY  130

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL AAK  QKQL+      L E++ +V+ RIR  Y K L+L  ETLAWMMA+  S
Sbjct  131   EMERYKLAAAKRTQKQLQCPTFEDLVEQLEQVDPRIRACYHKYLDLDSETLAWMMAISTS  190

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL++Y   EGK +++ + ++MSHLVD  G KS+HN++LRDI+MLENQIP F+LRK+
Sbjct  191   FLLEFLQIYVFHEGKTLSSEVCSRMSHLVDHAGAKSAHNSILRDIMMLENQIPLFVLRKV  250

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L+ Q  S EA+DDL L ML GL +ELSPFK  +    + I+   H+L +L+  IVP++E 
Sbjct  251   LEVQFSSLEAADDLSLLMLRGLCRELSPFKMMKNLPKIDISKCPHVLDFLYNMIVPKLEE  310

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
             +   I+  E+   +  KD + +  L +S Y K    ++W +   +N  P R +K      
Sbjct  311   QSEPIQQPEDQNKETTKDKQSNPVL-DSSYAKWLLSEIWKMFSTMNCAPTRLIKAALKSG  369

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIP  881
             PV+ +L +PWK ++ LPG ++++ PIE L    +K +   +S S  +  KPP IEEI IP
Sbjct  370   PVRLILNLPWKILSNLPGFSILRKPIEYLCFIKEKEEQVISSASNFSIHKPPLIEEIAIP  429

Query  880   SVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGP  701
             SV +L+ AGVR +PT   I +I FD  T TLYLP+V LDIN+EVVLRNLVAYEA  A GP
Sbjct  430   SVADLSKAGVRILPTNGNISTISFDVTTVTLYLPIVCLDINTEVVLRNLVAYEASNASGP  489

Query  700   LVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDK  521
             LV  RYTE MNGI+DT+EDVK LRE+GIILN LKSD E A++WNGM+KS+RLTKV FLDK
Sbjct  490   LVFTRYTELMNGIIDTEEDVKLLRERGIILNHLKSDKEAADMWNGMSKSIRLTKVPFLDK  549

Query  520   TIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFF  344
              I+DVNK++N RWNVK   F + Y++GSWQFLTLLA I+LL LM  Q+FCSVY+CS+ F
Sbjct  550   VIEDVNKYHNGRWNVKATDFFKQYVYGSWQFLTLLAAIMLLFLMTFQAFCSVYSCSQIF  608



>emb|CDO98195.1| unnamed protein product [Coffea canephora]
Length=545

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/545 (55%), Positives = 391/545 (72%), Gaps = 18/545 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I+ +LE ELEE N++ VSIF VPKTLMV   +C+VPQ VA+GPYH+   EL+
Sbjct  6     DEQRWVIQIRLSLEEELEEYNDLPVSIFSVPKTLMVSALDCFVPQVVALGPYHHWRSELY  65

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EME++K+ +AK  QK+L+++K   + +++ + E RIR  Y K L+   ET+AWMMA+DAS
Sbjct  66    EMEKYKIASAKRTQKRLQSLKFQDVVDQLARFEPRIRACYHKYLDFNGETIAWMMAMDAS  125

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+VYA KEGK++  + S++MSHL+DL G KS HNA+LRD++MLENQIP F+LR+M
Sbjct  126   FLLEFLQVYAAKEGKVLTRL-SSRMSHLLDLAGTKSVHNAILRDMVMLENQIPLFLLREM  184

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPEME-  1244
             L+ Q  S E +D+LL++ML+G  KEL PFK  E    V++    HLL +L++ IVPE+E 
Sbjct  185   LELQLSSLEEADNLLMSMLIGFGKELLPFKVMEELPKVEVTSYAHLLDFLYRVIVPELEG  244

Query  1243  -SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSS  1067
              SE  EI+       + +    E+ ++     VK     V  IL KL   P   +KR+  
Sbjct  245   PSEITEID------EEGEIKEAEESYVGKPSQVKQLSHLVRKILSKLRISPELLIKRIFR  298

Query  1066  LAPVKTVLLMPWKAITKLPGLNVMKGPIESL-FSC---GQKPDGDENSDSKDNADKPPSI  899
               P+K +L +PWK I+KLP L +MK PIE++ FS    GQKP   EN +S  N  KPP +
Sbjct  299   SKPIKVILKLPWKFISKLPVLKLMKAPIENMCFSADKGGQKP---ENLNST-NIKKPPLV  354

Query  898   EEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEA  719
             EEITIPSVTEL+ AGV+F+PT +GI SI FD K  T  LP + LD+N+EVVLRNLVAYEA
Sbjct  355   EEITIPSVTELSKAGVKFMPTNEGIFSINFDDKMATFRLPKICLDLNTEVVLRNLVAYEA  414

Query  718   CIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTK  539
             C A GPLV  RYTE +NGI+DT+ED KFLREKGIILN LKSD EVA+L NGM+KSVRLT 
Sbjct  415   CNASGPLVFTRYTELLNGIIDTEEDAKFLREKGIILNHLKSDEEVAHLCNGMSKSVRLTT  474

Query  538   VAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYT  359
             V  LDK I+DVN++YN RW +KT +F++ YIF SWQ LTL+A IVLL L  LQ+FCSVY+
Sbjct  475   VPRLDKVIEDVNRYYNRRWQIKTSKFLKHYIFRSWQLLTLIAAIVLLSLTTLQAFCSVYS  534

Query  358   CSRFF  344
             CSR F
Sbjct  535   CSRVF  539



>gb|KCW70768.1| hypothetical protein EUGRSUZ_F03928, partial [Eucalyptus grandis]
Length=562

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/549 (54%), Positives = 396/549 (72%), Gaps = 18/549 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE++WVI I+  LE ELE+E E+ VSIF VP+ LM  DP+ Y PQ+VAIGPYH+  PE++
Sbjct  19    DENQWVIQIRWALEEELEDETEVPVSIFSVPRVLMSSDPDLYTPQQVAIGPYHHWRPEMY  78

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL AAK  QKQL+ IK+H+L E++ K+E R R  Y K L+ + ETLAWMMA+DAS
Sbjct  79    EMERYKLAAAKRSQKQLQKIKIHNLVEQLEKLELRTRACYHKYLDFKGETLAWMMAIDAS  138

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+VYA+KEGK+++  +S++MSHLVD  G+KS+HN++L+DI+MLENQIP FILRKM
Sbjct  139   FLLEFLRVYAIKEGKMLSR-VSSRMSHLVDYTGRKSAHNSILKDIVMLENQIPLFILRKM  197

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L+ +  S + +D++L  MLMG  KE+SPFK  E    +Q++   HLL +L++TIVP+++ 
Sbjct  198   LEFRFTSLDEADNMLHGMLMGFYKEVSPFKLMEALPKIQVSVCAHLLDFLYETIVPKVQ-  256

Query  1240  EHVEI---------EIdenggmkekkdgeedEFLKNSG--YVKSAFGQVWGILKKLNKGP  1094
             E  EI         E + +   KE K       L +SG  Y++    Q+W +L KL KGP
Sbjct  257   EQPEIVEEEGEEEGEEEGDNEDKEGKAKSPWSLLSSSGTNYIRPLCVQIWNLLSKLIKGP  316

Query  1093  ARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDG-DENSDSKDNA  917
                +KRL  L+    VL +P   ++K+P L+V+  P+ESL S   K +G  EN +S  N 
Sbjct  317   IETVKRLL-LSNRAKVLKLPLTILSKIPLLSVLAQPLESLISSQVKEEGMSENENS--NP  373

Query  916   DKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRN  737
              +PPS+EEITIPSV++L+N GVRF+ TK  + SI FDAK  TL+LP +TLD++SEV +RN
Sbjct  374   HEPPSVEEITIPSVSDLSNVGVRFVATKGNLSSISFDAKMATLFLPAITLDVSSEVFMRN  433

Query  736   LVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNK  557
             LVAYEA  A GPLV  RYTE MNGI+DT EDVK LRE+G+ILN+LKSD EVA LWNGM++
Sbjct  434   LVAYEASNASGPLVFTRYTELMNGIIDTSEDVKLLRERGVILNQLKSDEEVAKLWNGMSR  493

Query  556   SVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQS  377
             S+RLTKV FLDK I+DVNK YN RW VK  +F + Y+   W+FL +LA IV+L+ + L +
Sbjct  494   SIRLTKVPFLDKAIEDVNKHYNGRWKVKLSKFTKQYVLSPWKFLAVLAGIVVLMFLTLHA  553

Query  376   FCSVYTCSR  350
             FCS Y+CSR
Sbjct  554   FCSAYSCSR  562



>ref|XP_010041919.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis]
Length=531

 Score =   537 bits (1384),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 296/543 (55%), Positives = 376/543 (69%), Gaps = 40/543 (7%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I++ LE ELE+E E+ VSIF VP  LM  DP+ Y PQ+VAIGPYH+  PE++
Sbjct  19    DEIRWVIQIRRMLEEELEDETEVPVSIFSVPAVLMSSDPDLYTPQQVAIGPYHHWRPEMY  78

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EM+R+KL A K +QKQL  IK  SL E+++K+E R+R  Y K L+   ETLAWMMA+DA 
Sbjct  79    EMQRYKLAAVKRYQKQLERIKFQSLVEQLVKLEPRVRACYHKYLDFNGETLAWMMAIDAL  138

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL++YA+KEGK+++                +S+HNA+LRDI+MLENQIP FILRKM
Sbjct  139   FLLEFLQIYAIKEGKMLS----------------RSAHNAILRDIVMLENQIPLFILRKM  182

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQTIVPEMESE  1238
             L+ QC S + +DD+LLTMLMG  KE+SPFK                       +P ++S+
Sbjct  183   LEFQCASLDEADDMLLTMLMGFYKEISPFK-------------------LMEALPNIQSQ  223

Query  1237  HVEIEIdenggmkekkdgeedEFLKNSG----YVKSAFGQVWGILKKLNKGPARALKRLS  1070
               + EI E  G  E K  +    L +S     YVK     +W +L KLN GP + LKRL 
Sbjct  224   SGQPEIIEEEGNGEDKKDKGLSPLASSSSGTSYVKQFCDAIWNLLSKLNNGPIKMLKRLL  283

Query  1069  SLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEI  890
                PVK +L +PW  ++KLP  +V+  P+E+LFS  +K DG   ++S  N  KPPS+EEI
Sbjct  284   FSNPVKVLLKLPWTILSKLPFFSVLAQPLEALFSSQEKEDGKPENES-SNPYKPPSVEEI  342

Query  889   TIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIA  710
              IPSV++L+N GVRF+ T   + SI FD K  TLYLP ++LD+NSEV +RNLVAYEA  A
Sbjct  343   AIPSVSDLSNVGVRFVATNGNLSSIGFDTKMATLYLPAISLDVNSEVFMRNLVAYEASNA  402

Query  709   KGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAF  530
              GPLV  RYTE MNGI+D+DEDVK LREKG+ILNRLKSD EVA LWN M+KS+RLTKV F
Sbjct  403   SGPLVFTRYTELMNGIIDSDEDVKLLREKGVILNRLKSDEEVAKLWNSMSKSIRLTKVPF  462

Query  529   LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
             LDK I+DVNK+YN RW VK  +FM+ Y++GSWQFL LLA I LLLLM LQ+FCSVY+CSR
Sbjct  463   LDKAIEDVNKYYNGRWKVKLGKFMKLYVYGSWQFLALLAAIALLLLMTLQAFCSVYSCSR  522

Query  349   FFN  341
              F+
Sbjct  523   IFH  525



>ref|XP_008372804.1| PREDICTED: putative UPF0481 protein At3g02645 [Malus domestica]
Length=560

 Score =   536 bits (1382),  Expect = 9e-180, Method: Compositional matrix adjust.
 Identities = 287/541 (53%), Positives = 382/541 (71%), Gaps = 6/541 (1%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             +E +WVI I+KTLE EL+++ EI VS+F VPKTL+  DP  Y PQ VAIGPYHY   EL+
Sbjct  17    NEFQWVIQIRKTLEEELDDDGEIPVSVFNVPKTLLASDPHSYTPQEVAIGPYHYLRTELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+K+ AAK  QK L+ +K  ++ ++++K E  IR  Y K L+   ETL WMMA+DAS
Sbjct  77    EMERYKVAAAKRTQKNLQCLKFQNVVDQLIKFEPWIRACYHKYLDFNGETLGWMMAIDAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             F+LE L+VY  KEGK++   +S+KMS LVD  G+ S+H+A+LRD++MLENQIP F+ RKM
Sbjct  137   FVLEMLQVYGAKEGKILTR-VSSKMSRLVDYSGRNSAHHAILRDLVMLENQIPLFVSRKM  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAV--VQIADATHLLGYLFQTIVPEME  1244
             L+ Q PS E +D++LL+MLMGL KELSPFK +   +  +++++  HLL +L+Q I P++E
Sbjct  196   LEFQFPSLETADEMLLSMLMGLCKELSPFKMKDDDLPKIKVSECAHLLDFLYQMITPKLE  255

Query  1243  SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
                 EI ++     +   + +E +  K+  YVK    +VW +L KLNKGP R LK++   
Sbjct  256   RRPSEI-VEAEDQGEAADEDKESKSTKSPNYVKQFLKEVWKLLWKLNKGPVRLLKKIFVS  314

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITI  884
              P+K +  +PW  ++ LPG  ++K P   LFS   K +    ++S  N   PP +EEITI
Sbjct  315   RPIKVIFKLPWTILSSLPGFALLKQPSAYLFSSQDKEEIKPENESSVNI--PPLVEEITI  372

Query  883   PSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKG  704
             PSV+ L  +GVRF+PTK  I SI FD KT TLYLPV +LD+N+EV+LRNLVAYEA  A G
Sbjct  373   PSVSCLMESGVRFVPTKGSISSISFDPKTVTLYLPVTSLDVNAEVILRNLVAYEASNASG  432

Query  703   PLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLD  524
              LV  RYTE MNGI+DT+ED K LR+KGIILNRLKSD EVANL++GM+KS+RLTKV FLD
Sbjct  433   QLVFTRYTEMMNGIIDTEEDAKLLRDKGIILNRLKSDEEVANLFSGMSKSIRLTKVPFLD  492

Query  523   KTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFF  344
             + IDDVNK+YN RW VK  +  + Y+ G W  L+LLA + LLLLM LQ+ CSVY+C R F
Sbjct  493   QAIDDVNKYYNGRWKVKMAKMFKVYVVGCWPILSLLAAVFLLLLMTLQAVCSVYSCGRTF  552

Query  343   N  341
              
Sbjct  553   G  553



>ref|XP_008372803.1| PREDICTED: putative UPF0481 protein At3g02645 [Malus domestica]
Length=566

 Score =   536 bits (1381),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 287/545 (53%), Positives = 386/545 (71%), Gaps = 9/545 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             +E +WVI I+KTLE EL++++EI VS+F VPKTL+  DP+ Y PQ VAIGPYHY  PEL+
Sbjct  17    NEFQWVIQIRKTLEEELDDDSEIPVSVFNVPKTLLASDPDSYTPQEVAIGPYHYLRPELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+K+ AAK  QK L+ +K  +L ++++ +E RIR  Y K LN   ETL WMMA+DAS
Sbjct  77    EMERYKVAAAKRTQKNLQCLKFQNLVDQLINLEPRIRGCYHKYLNFNGETLGWMMAIDAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLE L+VY  KEGK++   +S+KMS LVD  G+ S+H+++LRD++MLENQIP F+LRKM
Sbjct  137   FLLEILQVYGAKEGKILTR-VSSKMSRLVDYSGRNSAHHSILRDLVMLENQIPLFVLRKM  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQTIVPEME  1244
              + +  S E +D++LL+MLMGL KELS FK  +E    +++++  HLL +L+Q I P +E
Sbjct  196   SEFRFQSLETADEMLLSMLMGLCKELSLFKMKDEDLPKIKVSECAHLLDFLYQMITPILE  255

Query  1243  ---SEHVEIE-IdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
                SE VE E ++     +   + +E +  K+  YVK    +VW +L KL+KGP R LK+
Sbjct  256   RQPSEIVEAEFVEAEDQGEGTDEDKESKSTKSPNYVKQFLEEVWKLLSKLSKGPVRLLKK  315

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIE  896
             +    P+K +  +PW  ++ LPG  ++K P+  LFS   K +    ++S  N  +PP +E
Sbjct  316   ILVSGPIKVIFKLPWTILSSLPGFALLKQPVAYLFSSQDKEEIKPENESSVN--RPPLVE  373

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EITIPSV++L  +GVRF+PT   I S+ FD KT TLYLP  +LD+N+EV+LRNLV YEA 
Sbjct  374   EITIPSVSDLMKSGVRFVPTNGCISSVSFDPKTVTLYLPATSLDVNTEVILRNLVXYEAS  433

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
              A G LV  RYTE MNGI+DT+ED K LREKGIILN LKSD EVA L+NGM+KS+RLTKV
Sbjct  434   NASGQLVFTRYTEMMNGIIDTEEDAKLLREKGIILNXLKSDEEVAXLFNGMSKSIRLTKV  493

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
              FLD+ I+DVNK+YN RW VK  +F + Y+ G W  L LLA + LLLLM LQ+FCSVY+C
Sbjct  494   PFLDQAIEDVNKYYNGRWKVKMAKFFKVYVVGXWPILALLAAVFLLLLMALQAFCSVYSC  553

Query  355   SRFFN  341
              R F+
Sbjct  554   GRIFH  558



>ref|XP_002530454.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31924.1| conserved hypothetical protein [Ricinus communis]
Length=531

 Score =   534 bits (1376),  Expect = 2e-179, Method: Compositional matrix adjust.
 Identities = 287/547 (52%), Positives = 374/547 (68%), Gaps = 37/547 (7%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN   DE  W+IHI++T+E ELE E+E+ VSIF VPK LM  DP+ Y PQ+VAIGPYH+ 
Sbjct  12    PNPNFDEHLWIIHIRRTIEEELENESEVPVSIFSVPKILMTADPDSYTPQQVAIGPYHHW  71

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
              PE++EMER+KL AAK  QKQL+ +K   + + + ++E +IR SY + L+L  ETLAWMM
Sbjct  72    RPEIYEMERYKLAAAKRTQKQLQNVKFQYIVDHLTELEPKIRASYHRFLDLSNETLAWMM  131

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
             A+DASFLLEFL++YA+KEG +    +S +MSHLVD  GKKS+HNA+LRD++MLENQIP F
Sbjct  132   AIDASFLLEFLQIYAIKEG-MSITRVSTRMSHLVDYAGKKSAHNAILRDMVMLENQIPLF  190

Query  1432  ILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAV-VQIADATHLLGYLFQTIV  1256
             +LRK+L+ Q  S E +D++LL+ML G SKELSPFK    A  + I+   HLL YL++ IV
Sbjct  191   VLRKILEVQFLSLELADEMLLSMLSGFSKELSPFKMTKEARKISISQCAHLLDYLYEMIV  250

Query  1255  PEMESE-HVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALK  1079
             P++E     + EI E     E+    ++     S YVK  F Q+  I+ K+NKGP + LK
Sbjct  251   PKIEGALPPQREITETEDQDEETKEGKERSSTYSSYVKDLFDQILKIISKVNKGPLKILK  310

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPD-GDENSDSKDNADKPPS  902
             +L    P+K +L +PWK ++ LPG +++K P++ L S   K +   EN  S   A+KPP 
Sbjct  311   KLIFSKPIKLILKLPWKILSNLPGFSILKQPVDYLMSAEDKEEIKPENDSSNSEANKPPL  370

Query  901   IEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYE  722
             +EEI IPSV EL+ +GVRF+PT                                  VAYE
Sbjct  371   VEEIAIPSVAELSKSGVRFLPTT---------------------------------VAYE  397

Query  721   ACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLT  542
                A GP+V  RYTE MNGI+DTDEDVK LREKGI+LNR+KSD EVA+LWNGMNKS++LT
Sbjct  398   TSTASGPMVFTRYTELMNGIIDTDEDVKLLREKGIVLNRMKSDREVADLWNGMNKSIKLT  457

Query  541   KVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVY  362
             KV FLDK I+DVNK+YN RW V+   FM+SY+FGSWQFLTLLA + LL+L  LQ+FCSVY
Sbjct  458   KVPFLDKVIEDVNKYYNGRWKVRVGSFMKSYVFGSWQFLTLLAAVFLLMLTALQAFCSVY  517

Query  361   TCSRFFN  341
             +CSR FN
Sbjct  518   SCSRLFN  524



>ref|XP_010065042.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis]
Length=698

 Score =   540 bits (1392),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 299/560 (53%), Positives = 399/560 (71%), Gaps = 18/560 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE++WVI I+  LE ELE+E E+ VSIF VP+ LM  DP+ Y PQ+VAIGPYH+  PE++
Sbjct  19    DENQWVIQIRWALEEELEDETEVPVSIFSVPRVLMSSDPDLYTPQQVAIGPYHHWRPEMY  78

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL AAK  QKQL+ IK+H+L E++ K+E R R  Y K L+ + ETLAWMMA+DAS
Sbjct  79    EMERYKLAAAKRSQKQLQKIKIHNLVEQLEKLELRTRACYHKYLDFKGETLAWMMAIDAS  138

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+VYA+KEGK+++  +S++MSHLVD  G+KS+HN++L+DI+MLENQIP FILRKM
Sbjct  139   FLLEFLRVYAIKEGKMLSR-VSSRMSHLVDYTGRKSAHNSILKDIVMLENQIPLFILRKM  197

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L+ +  S + +D++L  MLMG  KE+SPFK  E    +Q++   HLL +L++TIVP+++ 
Sbjct  198   LEFRFTSLDEADNMLHGMLMGFYKEVSPFKLMEALPKIQVSVCAHLLDFLYETIVPKVQ-  256

Query  1240  EHVEI---------EIdenggmkekkdgeedEFLKNSG--YVKSAFGQVWGILKKLNKGP  1094
             E  EI         E + +   KE K       L +SG  Y++    Q+W +L KL KGP
Sbjct  257   EQPEIVEEEGEEEGEEEGDNEDKEGKAKSPWSLLSSSGTNYIRPLCVQIWNLLSKLIKGP  316

Query  1093  ARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDG-DENSDSKDNA  917
                +KRL  L+    VL +P   ++K+P L+V+  P+ESL S   K +G  EN +S  N 
Sbjct  317   IETVKRLL-LSNRAKVLKLPLTILSKIPLLSVLAQPLESLISSQVKEEGMSENENS--NP  373

Query  916   DKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRN  737
              +PPS+EEITIPSV++L+N GVRF+ TK  + SI FDAK  TL+LP +TLD++SEV +RN
Sbjct  374   HEPPSVEEITIPSVSDLSNVGVRFVATKGNLSSISFDAKMATLFLPAITLDVSSEVFMRN  433

Query  736   LVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNK  557
             LVAYEA  A GPLV  RYTE MNGI+DT EDVK LRE+G+ILN+LKSD EVA LWNGM++
Sbjct  434   LVAYEASNASGPLVFTRYTELMNGIIDTSEDVKLLRERGVILNQLKSDEEVAKLWNGMSR  493

Query  556   SVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQS  377
             S+RLTKV FLDK I+DVNK YN RW VK  +F + Y+   W+FL +LA IV+L+ + L +
Sbjct  494   SIRLTKVPFLDKAIEDVNKHYNGRWKVKLSKFTKQYVLSPWKFLAVLAGIVVLMFLTLHA  553

Query  376   FCSVYTCSRFFNDVTILGTN  317
             FCS Y+CSR      +LG  
Sbjct  554   FCSAYSCSRPLKIQRLLGAQ  573



>ref|XP_009338526.1| PREDICTED: putative UPF0481 protein At3g02645 [Pyrus x bretschneideri]
Length=571

 Score =   528 bits (1359),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 287/545 (53%), Positives = 384/545 (70%), Gaps = 9/545 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             +E +WVI I+KTLE EL++++EI VS+F VPKTL+  +P+ Y PQ VAIGPYHY  PEL+
Sbjct  17    NEFQWVIQIRKTLEEELDDDSEIPVSVFNVPKTLLASNPDSYTPQEVAIGPYHYLRPELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+K+ AAK  QK L+ +K  +L ++++  E RIR  Y K L+   ETL WMMA+DAS
Sbjct  77    EMERYKVAAAKRTQKNLQCLKFQNLVDQLINFEPRIRACYHKYLDFNGETLGWMMAIDAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLE  +VY  KEGK++   +S+KMS LVD  G+ S+H+++LRD++MLENQIP F+LRKM
Sbjct  137   FLLEIFQVYGAKEGKILTR-VSSKMSRLVDYSGRNSAHHSILRDLVMLENQIPLFVLRKM  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQTIVPEME  1244
             L+ +  S E +D++LL+MLMGL KELSPFK  +E    +++++  HLL +L+Q I P++E
Sbjct  196   LEFRFQSLETADEMLLSMLMGLCKELSPFKMKDEHLPKIKVSECAHLLDFLYQMITPKLE  255

Query  1243  ---SEHVEIEIdenggmkekkdgeedEFLKNS-GYVKSAFGQVWGILKKLNKGPARALKR  1076
                SE VE E  E     E  D +++   K S  YV+    +VW +L KLNKG  R LK+
Sbjct  256   RQPSEIVEAEFVEAEDQGEGTDEDKESKSKKSPNYVEQFLEKVWKLLSKLNKGFVRLLKK  315

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIE  896
             +    P+K +  +PW  ++ LPG  ++K P+  LFS   K +    ++S  N  +PP +E
Sbjct  316   ILVSGPIKVIFKLPWTVLSILPGFALLKQPVAYLFSSQDKEEIKPENESSIN--RPPLVE  373

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EITIPSV++L  +GVRF+PTK  I SI FD KT TLYLP  +LD+N+EV+LRNLV YEA 
Sbjct  374   EITIPSVSDLMKSGVRFVPTKGCISSISFDPKTVTLYLPATSLDVNTEVILRNLVDYEAS  433

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
              A G LV  R TE MNGI+DT+ED K LREKGIIL  LKSD EVANL+NGM+KS+RLTKV
Sbjct  434   TASGQLVFTRSTEMMNGIIDTEEDAKLLREKGIILKHLKSDEEVANLFNGMSKSIRLTKV  493

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
              FLD+ I++VNK+YN RW VK  +F + Y+ G    L LLA + LLLLM LQ+FCSVY+C
Sbjct  494   PFLDQAIENVNKYYNGRWKVKMAKFFKVYVVGCLPILALLAAVFLLLLMALQAFCSVYSC  553

Query  355   SRFFN  341
              R F+
Sbjct  554   GRIFH  558



>ref|XP_006427508.1| hypothetical protein CICLE_v10027562mg [Citrus clementina]
 gb|ESR40748.1| hypothetical protein CICLE_v10027562mg [Citrus clementina]
Length=561

 Score =   527 bits (1357),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 290/546 (53%), Positives = 380/546 (70%), Gaps = 8/546 (1%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN   DE +W+I I++ LE ELE + +  V IF VPKTLM  +P+ Y PQ VAIGPYHY 
Sbjct  7     PNPTFDEHQWIISIRRKLEEELETDTDFPVCIFSVPKTLMFSNPDSYTPQEVAIGPYHYF  66

Query  1792  NPELHEMERHKLDAAKIFQKQLR-TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWM  1616
              PELHEME +KL AAK  Q  +    K   + +++ K+E +IR  Y K LN   ETLAWM
Sbjct  67    RPELHEMEWYKLAAAKRAQTHIDGDHKFQYIVDQLKKLELKIRACYHKFLNFNSETLAWM  126

Query  1615  MAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPF  1436
             MA+DASFLLEFL++YAVKEGK  A   S   SHL+D  G K++HNA+LRD++MLENQIP 
Sbjct  127   MAIDASFLLEFLQIYAVKEGKSSATSPSTSTSHLLDYAGTKAAHNAILRDMVMLENQIPL  186

Query  1435  FILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTI  1259
             F+LRKML+ Q  S E++DD+L  MLMG  +ELSPF   +   ++ + +  HLL +L+ TI
Sbjct  187   FVLRKMLELQYSSLESADDMLQAMLMGFCEELSPFTLMKDMPMIDVLECAHLLDFLYDTI  246

Query  1258  VPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALK  1079
             VP++E +    EI E    +      ++    +S +VK  F ++W +L KLNKGP   +K
Sbjct  247   VPKVEQKS---EITEVVEDQGDDKQPKERDTGDSTFVKKIFSEIWKLLSKLNKGPILFIK  303

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLF---SCGQKPDGDENSDSKDNADKP  908
             +L    PVK  L +P+  ++KLPG +++  PI+ L        K   DE+S + +N +KP
Sbjct  304   KLLVSKPVKFFLKLPFTMLSKLPGFSMLAQPIQYLLFPQDNDDKKSDDESSHTSNNINKP  363

Query  907   PSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVA  728
             P +EEITIPSVTELA + VRF+ T   I ++ FD KT TL+LP ++ D+N+EV+LRNLVA
Sbjct  364   PLVEEITIPSVTELAKSQVRFLATVGNISTVRFDTKTATLHLPTISFDVNTEVILRNLVA  423

Query  727   YEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVR  548
             YEA  A GPLV  RYTE M+GI+DT+EDVK LREKGIILNRLKSD+EV NLWNGM+KS+R
Sbjct  424   YEASNASGPLVFTRYTELMSGIIDTEEDVKLLREKGIILNRLKSDAEVTNLWNGMSKSIR  483

Query  547   LTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCS  368
             LTKV  +DK I+ +NK YN +W VK  + M+ Y+FGSWQFLTLLATI+LLLLM LQ+FCS
Sbjct  484   LTKVPHIDKVIEGINKHYNSQWKVKFWKSMKHYVFGSWQFLTLLATIMLLLLMTLQAFCS  543

Query  367   VYTCSR  350
             VY C +
Sbjct  544   VYNCRK  549



>ref|XP_003604327.1| hypothetical protein MTR_4g009590 [Medicago truncatula]
 gb|AES86524.1| UPF0481 plant-like protein [Medicago truncatula]
Length=569

 Score =   527 bits (1357),  Expect = 8e-176, Method: Compositional matrix adjust.
 Identities = 287/559 (51%), Positives = 396/559 (71%), Gaps = 18/559 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeen-EINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +WVIHI+K LE E EEE+ +++V+IF VPK LM  DP+ YVPQ+VAIGPYHY   EL
Sbjct  17    DELQWVIHIRKILEEEFEEEDGKLSVTIFNVPKLLMASDPDSYVPQQVAIGPYHYWRSEL  76

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             +EM+ +KL A K F K L++ KL +L +++ K E R+R  Y K L+L  ET+ WMM VDA
Sbjct  77    YEMQSYKLAATKRFLKSLQSFKLDNLVDQLTKYEQRVRACYHKFLDLNGETMVWMMIVDA  136

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLE L++YA++EG+    ++S+ MSHLVD  G+KS+HNA+L+DI+MLENQIP  +LRK
Sbjct  137   SFLLELLQIYAMQEGEPKREVLSS-MSHLVDYAGRKSAHNAMLKDIVMLENQIPLMVLRK  195

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEME  1244
             +L+ +  S EA+D++L+ M +GL K+ SPFK  E    ++++++ HLL + +  IVP++E
Sbjct  196   LLEFKLSSKEAADEMLIFMFIGLFKQTSPFKMIEKFPSIKVSESAHLLDFFYDMIVPKLE  255

Query  1243  SEH---VEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
             + +   +++EI +     + +D         S YVK  F ++W IL K  KGP ++L R+
Sbjct  256   TGNDVTIDVEIQQEEEQDKGEDENSKG---ESSYVKQPFNEIWRILSKHIKGPMKSLNRV  312

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGD----ENSDSKDNADKPP  905
              S  P+K ++  PWK I+ LPG  ++K P+ESLF   +K D +    ENS S D  +KPP
Sbjct  313   VS-RPLKVLVKFPWKIISNLPGGKLLKQPVESLFFSKEKGDEEKQENENS-STDLVNKPP  370

Query  904   SIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAY  725
              ++EI IPSV +L  AGV F+PT   I SI FDAKT T +LP++ LD+N+EV LRNLVAY
Sbjct  371   LMDEIAIPSVEQLVLAGVNFLPTNGSISSISFDAKTNTFHLPMIRLDVNTEVFLRNLVAY  430

Query  724   EACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRL  545
             E+ +  GPLV+ RYTE MNGI+D+++D K LREKGIILN LKSD EVAN+WNGM+KS+RL
Sbjct  431   ESSVGSGPLVITRYTELMNGIIDSEKDAKILREKGIILNHLKSDQEVANMWNGMSKSLRL  490

Query  544   TKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSV  365
             ++V FLDKTI+DVNK YN    +K  +FM+SY+FGSW  LT LA++ LL +  LQ+FCS+
Sbjct  491   SRVPFLDKTIEDVNKSYNNTMKIKIWKFMKSYVFGSWPVLTFLASMFLLFMTALQAFCSI  550

Query  364   YTCSRFFN---DVTILGTN  317
             YTC RFF+   D T   TN
Sbjct  551   YTCHRFFDKALDFTSPDTN  569



>ref|XP_006383340.1| hypothetical protein POPTR_0005s14650g [Populus trichocarpa]
 gb|ERP61137.1| hypothetical protein POPTR_0005s14650g [Populus trichocarpa]
Length=546

 Score =   524 bits (1350),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 293/545 (54%), Positives = 379/545 (70%), Gaps = 19/545 (3%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN   DE +W+I+I++TL+ ELE++ EI V IF V K LM   P+CYVPQ+VAIGPYHY 
Sbjct  14    PNF--DEHRWMINIRRTLDEELEDDTEIPVCIFNVLKILMTSCPDCYVPQQVAIGPYHYW  71

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
              PEL+EMER+KL AAK  QK+L ++K   + + ++ +E +IR  Y K L+   ETLAWMM
Sbjct  72    RPELYEMERYKLAAAKRAQKRLESLKFSHIVDNLINLELKIRACYHKFLDFSNETLAWMM  131

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
             A+DASFLLEFL++YA+KEG +    +S++MSHLVD  G+KS HNA+LRD++MLENQIP F
Sbjct  132   AIDASFLLEFLQIYAIKEG-IAFTRVSSRMSHLVDYAGRKSGHNAILRDMVMLENQIPLF  190

Query  1432  ILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIV  1256
             +LRK+L+ Q  S E +DD LL+ML+G  KE+SPFK  E    + I+   HLL YL+  IV
Sbjct  191   VLRKILEVQLSSLEMADDTLLSMLVGFYKEISPFKTLEDIPKINISQCAHLLDYLYDIIV  250

Query  1255  PEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             P +E+     EI+E                 ++   K    +   ++ +L++G  R LK 
Sbjct  251   PNIEAPE---EINEADDQL------------DAMQGKCLSSENSNLISRLSEGLVRLLKI  295

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIE  896
             L     VK +L +PW  ++ LPG +++K P+E LF    +    EN +  +  +KPP  E
Sbjct  296   LLFSRHVKAMLKLPWTIVSNLPGCSILKQPVEYLFFSQDREVKPENENLNNEHNKPPLAE  355

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EI IP V EL  +G+RF PT   ILSI FDAKT T YLP+++L++N+EVVLRNLVAYEA 
Sbjct  356   EIAIPCVAELFRSGIRFAPTTGNILSISFDAKTDTFYLPIISLEVNTEVVLRNLVAYEAS  415

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
              A GPLV  RYTE MNGI+DT+EDVK LREKGIILNRLKSD EVANLWNGM+KS+RLTKV
Sbjct  416   NASGPLVFTRYTELMNGIIDTEEDVKLLREKGIILNRLKSDEEVANLWNGMSKSIRLTKV  475

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
              FLDK I+DVNK+YN RW VK  RFMR Y+F SWQFLTLLA I LLLLM L+ FC+VY  
Sbjct  476   PFLDKVIEDVNKYYNGRWTVKGGRFMRQYVFSSWQFLTLLAAIFLLLLMTLEVFCTVYRY  535

Query  355   SRFFN  341
             +R  +
Sbjct  536   TRILH  540



>ref|XP_006427517.1| hypothetical protein CICLE_v10027572mg [Citrus clementina]
 gb|ESR40757.1| hypothetical protein CICLE_v10027572mg [Citrus clementina]
Length=544

 Score =   521 bits (1343),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 281/547 (51%), Positives = 381/547 (70%), Gaps = 18/547 (3%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN   DE +W+I+I++TL  ELEE+ ++ V IF VPK LM  DP+ Y PQ++AIGPYH+ 
Sbjct  7     PNF--DEHRWIINIRRTLGEELEEDADLPVCIFNVPKALMSIDPDSYTPQQIAIGPYHHW  64

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
              PEL EMER+KL AAK  Q+QL+ IK  +  E +MK+E RIR+ Y K L+   ETLAWMM
Sbjct  65    RPELQEMERYKLAAAKRTQRQLQRIKFQNFVEHLMKLEPRIRVCYHKILDFGDETLAWMM  124

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
             A+DA+FLLEFL +YA+KEG+ +  + S  MSHL D  G+ S HNA+LRDI+MLENQIP F
Sbjct  125   AIDAAFLLEFLHIYAIKEGQALTRVSSRSMSHLADYAGRNSGHNAILRDIVMLENQIPLF  184

Query  1432  ILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIV  1256
             ILRKML+ Q PS E +DD+LL+ L+GL K+LSPFK  E    +++++  HLL +L+  IV
Sbjct  185   ILRKMLEFQSPSMELADDILLSKLIGLCKDLSPFKMIENLPHIEVSECAHLLDFLYNVIV  244

Query  1255  PEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             P++E E +E+  DE+    +++         +S +VK    ++       NKGP R +K+
Sbjct  245   PKLE-EPIEMTEDEDRDHNDEEAQGRKRLFADSNHVKKLLSKI------CNKGPLRFMKK  297

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIE  896
             +        +L +P   ++ LPG  ++K  ++       + +  +  +S +  +KPP +E
Sbjct  298   M--------LLNLPCMILSNLPGFAILKQLLQHSCLSQDQEETTQEQESSNKTNKPPLVE  349

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EITIPSVTEL+ AG  F      I +I+FD KT T YLP V+LD+N+EV+LRNLVAYEA 
Sbjct  350   EITIPSVTELSKAGFCFSTANGSISAIDFDVKTATFYLPTVSLDVNTEVLLRNLVAYEAS  409

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
              A GPLV  RYTE MNGI+DT++DVK LREKG+ILNRLKSD + ANLWNGM+KS+RLTKV
Sbjct  410   NASGPLVFTRYTELMNGIIDTEDDVKLLREKGVILNRLKSDEQAANLWNGMSKSIRLTKV  469

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
              FLDK I+D+N +Y+ RW VK  +FM+ Y+F SWQFLTLLAT++LL LM LQ+FC++Y C
Sbjct  470   PFLDKVIEDINNYYDSRWCVKVGKFMKHYVFDSWQFLTLLATVLLLFLMTLQAFCAIYGC  529

Query  355   SRFFNDV  335
              R F+ V
Sbjct  530   HRSFHHV  536



>ref|XP_010065043.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis]
Length=652

 Score =   522 bits (1344),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 298/551 (54%), Positives = 387/551 (70%), Gaps = 41/551 (7%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE++WVI I+  LE ELE+E E+ VSIF VP+ LM  DPE Y PQ+VAIGPYH+  PE++
Sbjct  19    DENQWVIQIRWALEEELEDETEVPVSIFSVPRVLMSSDPELYTPQQVAIGPYHHWRPEMY  78

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL AAK  QKQL+ IK+H+L E++ K+E R R  Y K L+ + ETLAWMMA+DAS
Sbjct  79    EMERYKLAAAKRSQKQLQKIKIHNLVEQLEKLELRTRACYHKYLDFKGETLAWMMAIDAS  138

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+VYA+KEG +++  +S++MSHLVD  G+KS+HNA+L+DI+MLENQIP FILRKM
Sbjct  139   FLLEFLRVYAIKEGTMLSR-VSSRMSHLVDYTGRKSAHNAILKDIVMLENQIPLFILRKM  197

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQTIVPEMESE  1238
             L+ +  S + +D++L  MLMG           G+A               Q  +P+++ E
Sbjct  198   LEFRFTSLDEADNMLHGMLMGFG---------GAA---------------QDTIPKVQ-E  232

Query  1237  HVEI---------EIdenggmkekkdgeedEFLKNSG--YVKSAFGQVWGILKKLNKGPA  1091
               EI         E + +   KE K       L +SG  Y++    Q+W +L KL KGP 
Sbjct  233   QPEIVEEEGEEEGEEEGDNEDKEGKAKSPWSLLSSSGTNYIRPLCDQIWNLLSKLIKGPI  292

Query  1090  RALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDG-DENSDSKDNAD  914
               +KRL  L+    VL +P   ++K+P L+V+  P+ESL S   K +G  EN +S  N  
Sbjct  293   ETVKRLL-LSNRAKVLKLPLTILSKIPLLSVLAQPLESLISSQVKEEGMSENENS--NPH  349

Query  913   KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNL  734
             +PPS+EEITIPSV++L+N GVRF+ TK  + SI FDAK  TLYLP +TLD++SEV +RNL
Sbjct  350   EPPSVEEITIPSVSDLSNVGVRFVSTKGNLSSISFDAKLATLYLPAITLDVSSEVFMRNL  409

Query  733   VAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS  554
             VAYEA  A GPLV  RYTE MNGI+DT EDVK LRE+G+ILN+LKSD EVA LWNGM++S
Sbjct  410   VAYEASNATGPLVFTRYTELMNGIIDTSEDVKLLRERGVILNQLKSDEEVAKLWNGMSRS  469

Query  553   VRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSF  374
             +RLTKV FLDK I+DVNK+YN RW VK  +FM+ Y++GSWQFL LLA I LLLLM LQ+F
Sbjct  470   IRLTKVPFLDKAIEDVNKYYNGRWKVKLGKFMKLYVYGSWQFLALLAAIALLLLMTLQAF  529

Query  373   CSVYTCSRFFN  341
             CSVY+CSR F+
Sbjct  530   CSVYSCSRIFH  540



>ref|XP_006656701.1| PREDICTED: putative UPF0481 protein At3g02645-like [Oryza brachyantha]
Length=560

 Score =   514 bits (1324),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 277/556 (50%), Positives = 371/556 (67%), Gaps = 31/556 (6%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEIN---VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNP  1787
             DE +WVI I+ +L+ +  E+++ N   VS+F VPK L V+ PE YVPQ +A+GPYH+  P
Sbjct  19    DELRWVIQIRHSLQEDGGEDDDDNGIPVSVFNVPKQLQVHKPEAYVPQFIALGPYHHWRP  78

Query  1786  ELHEMERHKLDAAKIFQKQLRT-IKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMA  1610
             EL+EMER+KL AA+  Q+ LR  +KL  L E+  ++E ++R  Y + L+   ETLAWMM 
Sbjct  79    ELYEMERYKLAAARRAQRPLRAGVKLEQLVEQFARLERKVRAYYHRYLDFSGETLAWMMV  138

Query  1609  VDASFLLEFLKVYAVKE-------GKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLE  1451
             VD +FLLEFL+++A  E       GK     +S++M+ LVD  G+KS+HN +LRD++MLE
Sbjct  139   VDGAFLLEFLQIFAAAEASEDGGGGKPALRRVSSRMAPLVDFAGRKSAHNLILRDMLMLE  198

Query  1450  NQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGY  1274
             NQ+P F+LRK+L+PQC S + + +LL  M+ GL KEL PFK  +    + +A   HLL  
Sbjct  199   NQMPLFLLRKLLEPQCSSADEAGELLGRMVTGLMKELCPFKMMDNFPAIDVAKHAHLLEL  258

Query  1273  LFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGP  1094
             L+  +VP+   +      DE                    YVK  F  VWGI+  L  GP
Sbjct  259   LYYLLVPKPADDSGGGGGDEKPSA-------------GCEYVKQLFAAVWGIVSNLKTGP  305

Query  1093  ARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSC-GQKPDGDENSDSKDNA  917
              + + +     P+   +  PWK +T +PG + MK P+ES FS  G     D +S +  + 
Sbjct  306   MQYVAK-----PISFAVKAPWKMLTVVPGFSAMKHPVESFFSGDGGSTARDPSSTAGGHI  360

Query  916   DKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRN  737
              +PP IEEI IPSV+EL NAGV+F+PT   I S+ FDAKT T +LPVVTLD N+EVVLRN
Sbjct  361   SRPPLIEEIMIPSVSELVNAGVQFVPTNGDISSVSFDAKTATFHLPVVTLDSNTEVVLRN  420

Query  736   LVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNK  557
             LVAYEA  A GPLVL RYTE MNGI+DTDEDV  LR +G++LNR+KSD EVA LWNGM++
Sbjct  421   LVAYEASAASGPLVLTRYTELMNGIIDTDEDVALLRGRGVVLNRMKSDGEVARLWNGMSR  480

Query  556   SVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQS  377
             SVRLT+VAF+D  +++ N++++ RW VKTKRFMR Y+F SWQ LT LA IV+LLL  LQ+
Sbjct  481   SVRLTRVAFMDAAVEEANRYHDARWRVKTKRFMRKYVFSSWQLLTFLAAIVMLLLTTLQA  540

Query  376   FCSVYTCSRFFNDVTI  329
             FCSVYTCSR+F  VT+
Sbjct  541   FCSVYTCSRWFGAVTV  556



>gb|KHN01304.1| Putative UPF0481 protein [Glycine soja]
Length=548

 Score =   514 bits (1323),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 290/545 (53%), Positives = 381/545 (70%), Gaps = 23/545 (4%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I++TLE EL E++E  VSIF VPK L   DP  Y+PQ+VA+GPYHY  PEL+
Sbjct  17    DELQWVIQIRRTLEEELGEDDEFPVSIFSVPKLLRACDPASYIPQQVALGPYHYWRPELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EM+R+KL AAK FQKQL++ K  ++ +++ K+E RIR  + K L+   ETL WMMAVDAS
Sbjct  77    EMQRYKLAAAKRFQKQLQSHKFDNIIDQLTKLEQRIRACHHKFLDFNGETLVWMMAVDAS  136

Query  1597  FLLEFLKVY--AVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
             FLLEFL+V+  A+++GK              + KGK S HNA+LRDI+MLENQIP F+LR
Sbjct  137   FLLEFLQVFDCAIQDGK-------------KEPKGK-SYHNAILRDIVMLENQIPMFVLR  182

Query  1423  KMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEM  1247
             KM++ +  S EASD +L    +GL KE+SPFK  E    +Q++ + HLL +L+  IVP +
Sbjct  183   KMMEFKFSSLEASDQMLKLKFIGLFKEISPFKMMEEYPNIQVSKSAHLLDFLYHIIVPNI  242

Query  1246  ESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSS  1067
                   IE++   G +EK+  EE     +S  VK  F ++W +L KLNKGP   +K+L  
Sbjct  243   LERQDTIEVETQQGDEEKEGNEESN--ADSSQVKQLFSELWKLLSKLNKGPVNIIKKLLV  300

Query  1066  LAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNA---DKPPSIE  896
               P+K  + +PWK I  LPG+ ++K P+E  F C Q    +E+S    N    +KPPS+E
Sbjct  301   SRPMKVFVKLPWKIIINLPGIKILKQPLEYFF-CSQNEGENESSIRWSNTLMINKPPSVE  359

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EITIPSVTEL NAGVRF+PT   I +I F+AKT T YLP + LD+N++V L+NLVAYEA 
Sbjct  360   EITIPSVTELLNAGVRFLPTIGSISNISFNAKTCTFYLPTIGLDVNTKVFLKNLVAYEAS  419

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
             +A GPLV+ RYTE MNGI+D++ED K LREKGIILN LKSD EVANLWNGM+KS+RL++ 
Sbjct  420   VALGPLVITRYTELMNGIIDSEEDAKALREKGIILNHLKSDKEVANLWNGMSKSLRLSRE  479

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
               LDK I+DVNK+YN R  VK  +FM++Y+F SWQ  T LATI+LLLL  LQ+FCSVYTC
Sbjct  480   PLLDKVIEDVNKYYNGRMKVKVVKFMKAYVFSSWQIFTFLATIMLLLLTTLQAFCSVYTC  539

Query  355   SRFFN  341
             +  F+
Sbjct  540   NHTFS  544



>ref|XP_007139376.1| hypothetical protein PHAVU_008G024200g [Phaseolus vulgaris]
 gb|ESW11370.1| hypothetical protein PHAVU_008G024200g [Phaseolus vulgaris]
Length=559

 Score =   513 bits (1322),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 269/541 (50%), Positives = 375/541 (69%), Gaps = 11/541 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I+ TL   LE++++ +VSIF VPK LM  DP+ Y+PQ+V+IGPYH+   EL+
Sbjct  17    DELRWVIQIRDTLNEVLEDDDQFHVSIFNVPKPLMATDPDSYIPQQVSIGPYHHWRQELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+K+ +AK FQ+QL+++KL  + +++MK+E RIR  Y + LN   ETL WM+A+DAS
Sbjct  77    EMERYKIASAKRFQEQLQSLKLEHIVDQLMKLEHRIRACYHRYLNYNGETLMWMVAIDAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+VY++++G +M   +S++MSH +D  G++ +HNA+L+DI+MLENQIP F+LRKM
Sbjct  137   FLLEFLQVYSIQDGTVMIPGVSSRMSHFMDYAGRRIAHNAILKDIVMLENQIPLFVLRKM  196

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQTIVPEME  1244
             L+ +  S E +D +L+ ML+GL K+LSPFK   +  + + +++  HLL +L+  IVP++E
Sbjct  197   LEFKFSSMELADGMLVAMLIGLLKQLSPFKVIEKDYSEISVSECAHLLDFLYAMIVPKLE  256

Query  1243  SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
              +    ++ +     +  +  E+ FL    Y K    ++W  L KL       +K+    
Sbjct  257   EQS---DVVQLEDQHKDNEDHEESFL---NYAKQFLCEIWSFLSKLVTAFVNLIKKFQQC  310

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESL-FSCGQKPDGDENSD-SKDNA-DKPPSIEE  893
               +K +  +PW  I+ LPG+ ++K P+E L FS  ++    EN + S DNA +KPP +EE
Sbjct  311   RTMKVITWLPWTIISNLPGVGIIKQPVEYLFFSEDKEASTAENGNLSSDNATNKPPLMEE  370

Query  892   ITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACI  713
             I IPSVTEL+ +GV F+ T   I +I FD KT TLYLP + LD+NSEV+LRNLVAYEA  
Sbjct  371   IAIPSVTELSKSGVCFMATNGDISTIGFDVKTVTLYLPTIGLDVNSEVLLRNLVAYEASA  430

Query  712   AKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVA  533
             A G LV  RYTE MNGI+D +ED K LREKG+ILN LKSD EVA LWNGM KS++LT+V 
Sbjct  431   ASGSLVFTRYTELMNGIIDHEEDAKILREKGVILNHLKSDEEVATLWNGMTKSIKLTRVP  490

Query  532   FLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCS  353
             FLDK I+DVN+ YN R  +K  +FM+ Y+F SWQFL  LA I LL LM LQ FCS Y C+
Sbjct  491   FLDKVIEDVNQHYNGRMCIKVLKFMKVYVFASWQFLIFLAAIFLLFLMSLQVFCSFYVCN  550

Query  352   R  350
             R
Sbjct  551   R  551



>ref|XP_006427512.1| hypothetical protein CICLE_v10027367mg [Citrus clementina]
 gb|ESR40752.1| hypothetical protein CICLE_v10027367mg [Citrus clementina]
Length=567

 Score =   513 bits (1322),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 275/542 (51%), Positives = 373/542 (69%), Gaps = 8/542 (1%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DES+W+I I++TLE  LE   +  VSIF VPKTL   DP+ Y PQ+VAIGPYHY  PEL+
Sbjct  18    DESRWIIRIRRTLEEALENNTDFPVSIFSVPKTLRSSDPDAYTPQQVAIGPYHYWRPELY  77

Query  1777  EMERHKLDAAKIFQKQLR-TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             +ME +KL AAK  Q+ +    KL  + +++ ++E +IR  Y K LN   ET+AWMMA+D+
Sbjct  78    DMEMYKLAAAKRAQRHINGNHKLKYVVDQLKELELKIRACYHKFLNFSNETVAWMMAIDS  137

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLEFL++Y ++E KL     S  MSHL+D  G K++HNA+LRD++MLENQIP F++RK
Sbjct  138   SFLLEFLQIYTIEEDKLSTTYSSRSMSHLLDCAGIKAAHNAILRDVVMLENQIPLFVMRK  197

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPEME  1244
             ML+ Q  S E++DD+L  MLMG  +E+SPFK  +   ++ I++  HLL Y + TIVP+ +
Sbjct  198   MLEIQYSSLESADDMLQAMLMGFYEEVSPFKMKKDMPMIDISEGAHLLDYFYHTIVPKAD  257

Query  1243  SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
                   E+ E    +      ++ +  +  Y+K  F ++W +L KL+KGP R +K+L   
Sbjct  258   KRS---EVTEAVENEGDDKQPKERYSGDPTYIKYLFIEIWKLLSKLDKGPIRFIKKLLLS  314

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLF---SCGQKPDGDENSDSKDNADKPPSIEE  893
              PVK    +PW  ++KLPG  ++  PI+ L       +     E S S+ + + PP +EE
Sbjct  315   EPVKFFFKLPWTILSKLPGYPILARPIQYLVFPEVNEENKSHAERSPSRKHMNMPPLVEE  374

Query  892   ITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACI  713
             I IPSVTELA   + F  T   I ++ FD KT TL+LP ++ D+N+EV+LRNLVAYEA  
Sbjct  375   IAIPSVTELAKINIHFSATVGNISTVHFDTKTATLHLPTISFDVNTEVILRNLVAYEASN  434

Query  712   AKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVA  533
             A GPLVLARYTE MNGI+D++EDV+ LREKGIILNRLKSD+EVAN WNGMNKS+RLTKV 
Sbjct  435   ASGPLVLARYTELMNGIIDSEEDVRLLREKGIILNRLKSDAEVANSWNGMNKSIRLTKVP  494

Query  532   FLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCS  353
              +DK I+ VNK+YN +W VK ++ M+ Y+F SW+ LTLLATI+LLLLM LQ+FCSVY C 
Sbjct  495   HIDKAIEGVNKYYNSQWKVKFRKNMKVYVFSSWKCLTLLATIMLLLLMTLQAFCSVYNCR  554

Query  352   RF  347
              F
Sbjct  555   NF  556



>ref|XP_010250391.1| PREDICTED: putative UPF0481 protein At3g02645 [Nelumbo nucifera]
Length=550

 Score =   507 bits (1305),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 277/530 (52%), Positives = 355/530 (67%), Gaps = 16/530 (3%)
 Frame = -3

Query  1888  NVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKLH  1709
             + SIF VPKTL    P+ Y+PQ V +GPYHY  PEL+EM R+K  A +   KQL +I   
Sbjct  15    HASIFIVPKTLKSTKPDSYIPQHVTLGPYHYRRPELYEMVRYKHAAVRTTHKQLHSIGFE  74

Query  1708  SLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISA  1529
              L EE  K E RIR SY K L+   ETLAWMMAVDASFLLEFL + AV++G      +S+
Sbjct  75    ELVEEFKKQEPRIRSSYHKYLDFDRETLAWMMAVDASFLLEFLHINAVRKGSRNLTKVSS  134

Query  1528  KMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEA-SDDLLLTMLMGL  1352
              M++ +D    KS +N +LRDI+MLENQIP F+L+K+L  QC SPE  +DD+L ++LM L
Sbjct  135   GMAYFIDYARTKSDYNPILRDIVMLENQIPLFLLKKILDYQCLSPEIDADDVLYSILMDL  194

Query  1351  SKELSP------FKNEGSAVVQIADATHLLGYLFQTIVPEMESE-HVEIEIdenggmkek  1193
              KELSP      F+     V       HLL +L+ TIVP +  E H EI+   +G     
Sbjct  195   CKELSPLKMIHNFQRTRKRVSFSEHFHHLLDFLYSTIVPRLNKEQHSEIDEVVDGDEGSN  254

Query  1192  kdg---eedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAI  1022
                    ++E  KN G VK     +W +L  +NKGP  ++ ++ +  PVK VL +PW+ +
Sbjct  255   NPAGDGRKEETFKNCGPVKQVLEFIWKMLSNVNKGPMHSVTKVLASKPVKVVLQLPWEIL  314

Query  1021  TKLPGLNVMKGPIESLFSCGQKPDG---DENSDSKDNADKPPSIEEITIPSVTELANAGV  851
             ++LPG  ++K P E LFS G   DG   D++S S ++ D+PP IEEITIPSVTEL   GV
Sbjct  315   SRLPGFAILKQPAE-LFSQGDG-DGNPEDDDSSSTNSVDRPPLIEEITIPSVTELHKCGV  372

Query  850   RFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFM  671
             RF PT   I +I FD K  T +LP ++LD+N+EVVLRNLVAYE   A GPL+  RYTE M
Sbjct  373   RFSPTNGDITTISFDVKRVTFHLPKISLDVNTEVVLRNLVAYETSAASGPLIFTRYTELM  432

Query  670   NGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYN  491
              GI+DT ED + LRE+GIILNRLKSD EVANLWNGM+KSV+LTKV   DK I+DVNK+Y 
Sbjct  433   TGIIDTKEDAELLRERGIILNRLKSDEEVANLWNGMSKSVKLTKVELFDKVIEDVNKYYG  492

Query  490   CRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFN  341
              RW VK K+F+++Y+FGSWQ LTLLA ++LLLLM LQ+FCSVY+C R FN
Sbjct  493   SRWKVKAKKFLKAYVFGSWQLLTLLAALMLLLLMTLQAFCSVYSCPRIFN  542



>gb|KHN13779.1| Putative UPF0481 protein [Glycine soja]
Length=558

 Score =   506 bits (1302),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 271/541 (50%), Positives = 379/541 (70%), Gaps = 12/541 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I++TL    E++++  VSIF VPK LM  DP+ Y+PQ+VAIGPYHY + EL+
Sbjct  17    DEFRWVIQIRETLNEGHEDDDQFPVSIFNVPKPLMATDPDSYIPQQVAIGPYHYWSQELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+K+ +AK FQ+QL+++KL  + ++++++E RIR  Y + LN   ETL WMMA+DAS
Sbjct  77    EMERYKIASAKRFQEQLQSLKLEHMVDQLIRLEHRIRACYHRYLNFNGETLMWMMAIDAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+VY + +G ++   +S++MSHL+D  G++ +HN +L+DI+MLENQ+P F+LRKM
Sbjct  137   FLLEFLQVYTIHDGAMIPG-VSSRMSHLMDYAGRRIAHNEILKDIVMLENQLPLFVLRKM  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQTIVPEME  1244
             L+ +  S E +DD+LL+ML+GL KELSPFK   +    V +++  HLL +L+  IVP++E
Sbjct  196   LEFKFSSLELADDMLLSMLLGLLKELSPFKVIEKDCPEVIVSECAHLLDFLYAMIVPKLE  255

Query  1243  SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
              +   +++++    KE  +           YVK   G+VW +L KL       + ++   
Sbjct  256   EQTDLVQLEDQHRDKEDSEKSIV------NYVKQFLGEVWRVLSKLATALISLINKVLQC  309

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDE---NSDSKDNADKPPSIEE  893
               +K + L+PW  I+ LPG+ ++K P+E LF    K   +E   N  S++  +KPP +EE
Sbjct  310   RAMKIITLLPWTVISNLPGVGLIKQPVEYLFFSQDKEATEEENGNLSSENVMNKPPLMEE  369

Query  892   ITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACI  713
             I IPSVTEL+ +GV F+ T   I +I FD KT TLYLP + LD+NSEV+LRNLVAYEA  
Sbjct  370   IAIPSVTELSKSGVCFMATNGDISTIGFDVKTVTLYLPTIGLDLNSEVLLRNLVAYEAST  429

Query  712   AKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVA  533
             A G LV  RYTE MNGI+D++ED K LREKG+ILNRLKSD EVANLWNGM+KS++LT+V 
Sbjct  430   ASGSLVFTRYTELMNGIIDSEEDAKILREKGVILNRLKSDEEVANLWNGMSKSIKLTRVP  489

Query  532   FLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCS  353
             FLDK I+DVN+ YN R N+K  +F++ Y+F SW+FLT  A I LL LM LQ FCS Y C+
Sbjct  490   FLDKVIEDVNQHYNGRMNIKVWKFIKLYVFASWKFLTFFAAIFLLFLMSLQVFCSFYKCN  549

Query  352   R  350
             R
Sbjct  550   R  550



>ref|XP_003604329.1| hypothetical protein MTR_4g009620 [Medicago truncatula]
 gb|AES86526.1| UPF0481 plant-like protein [Medicago truncatula]
Length=568

 Score =   506 bits (1302),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 281/545 (52%), Positives = 379/545 (70%), Gaps = 11/545 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenE-INVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE+ WVI ++KTLE E EEEN  +++SIF VPK LM  DP  YVPQ+VAIGPYHY   EL
Sbjct  17    DENLWVIQVRKTLEEEFEEENGELSISIFNVPKLLMASDPNSYVPQQVAIGPYHYWRQEL  76

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
              EM+ HKL + K FQKQL+++K+ +L +++ K+E +IR  Y K L+L  ETLAWMM VDA
Sbjct  77    FEMQNHKLASTKRFQKQLQSLKIDNLVDQLTKLEQKIRACYHKFLDLNGETLAWMMIVDA  136

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLEFL+ YA++E      +IS+ MSH V+  G++ S NA+LRDI+MLENQIP F+LRK
Sbjct  137   SFLLEFLQFYAMQEES--RKVISSNMSHFVNYVGRRLSPNAILRDIVMLENQIPLFVLRK  194

Query  1420  MLQPQC-PSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEM  1247
             ML+ +   S E +DD+L+ M + L KE+SPFK  E    +Q+ +  HLL +L+  IVP++
Sbjct  195   MLELKFFSSEENADDVLILMCIRLFKEISPFKMFEEYPNIQVLECAHLLDFLYDMIVPKL  254

Query  1246  ESEH--VEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
             E +H  +E+EI +    +E  +        +S +VK     +W  L K+ KGP   +K++
Sbjct  255   EKQHDIIEVEIQQEVDQQEGDEKSST---NDSIHVKKFLSILWKFLSKIIKGPLHGIKKV  311

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENS-DSKDNADKPPSIE  896
                AP+K +  +PW+ IT LPG+ ++K PIE   +  +K +      +S    +K P +E
Sbjct  312   LISAPLKVLKKLPWENITNLPGIKLVKQPIEYFLNTQKKEEEKPKDENSSTLKNKTPLVE  371

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EI IPSV +L  AGV F+P K  I SI FDAKT T +LP ++LD+N+EV LRNLVAYE+ 
Sbjct  372   EIAIPSVEQLVTAGVNFLPAKGSISSISFDAKTNTFHLPTISLDVNTEVFLRNLVAYESS  431

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
             +  GPLV+ RYTE MNGI+D++ D K LREKGIILN LKSD EVAN+WNGM+K +RL++V
Sbjct  432   VGSGPLVITRYTELMNGIIDSENDAKILREKGIILNHLKSDQEVANMWNGMSKLLRLSRV  491

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
              FLDKTI+DVN+ YN    +K  +FM+SY+FGSWQFLT LATI LL +  LQ+F SVYTC
Sbjct  492   PFLDKTIEDVNQSYNNTMKIKIWKFMKSYVFGSWQFLTFLATIFLLFMTALQAFGSVYTC  551

Query  355   SRFFN  341
              RFF+
Sbjct  552   HRFFD  556



>ref|XP_004491977.1| PREDICTED: putative UPF0481 protein At3g02645-like [Cicer arietinum]
Length=552

 Score =   503 bits (1295),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 268/541 (50%), Positives = 375/541 (69%), Gaps = 13/541 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I+  L +EL++  E+ VSIF VPK+LM  DP+ Y+PQ+VAIGPYH+ + EL+
Sbjct  10    DELEWVIKIRDILNKELDDNEELFVSIFNVPKSLMASDPDSYIPQQVAIGPYHFWHQELY  69

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+K+D+AK FQ QL +IKL  + +++  +E RIR  Y K LN  V+TL WMM VDAS
Sbjct  70    EMERYKIDSAKRFQNQLHSIKLEYVVDQLTMLEHRIRACYHKYLNFNVDTLMWMMVVDAS  129

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+VY +++  ++ +  S++MSHLVD  G+K +HNA+L+DI+MLENQIP FILRKM
Sbjct  130   FLLEFLQVYTIQDETMIVSF-SSRMSHLVDYGGRKLAHNAILKDIVMLENQIPLFILRKM  188

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQTIVPEME  1244
             L+ +  S E +DD+L++M +GL KE+SPFK        + +++ +HLL +L+  IVP+ E
Sbjct  189   LEFKFESIELADDMLISMFIGLYKEISPFKMVEHDYLDIVVSECSHLLDFLYYMIVPKFE  248

Query  1243  SEHVEIEIdenggmkekkdgeedEFLKNSG-YVKSAFGQVWGILKKLNKGPARALKRLSS  1067
              E  +I I+       K++ E     K+ G Y+K    +VW +L KL     R+ K++  
Sbjct  249   -EQSDIIIELENRNNNKEENE-----KSYGNYLKIFLCEVWRLLSKLTSTLTRSFKKIMQ  302

Query  1066  LAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDG---DENSDSKDNADKPPSIE  896
                +K    +PW  I+ LPG+ ++K P+E  F   +K      +EN +S+D  +K   ++
Sbjct  303   FRAMKVFTWLPWTIISNLPGMGIIKQPVEYYFFSEEKEVNKAENENLNSEDIINKSLLMD  362

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EI IPS+TEL+ +GV F+ TK  I +I FD KT TLYLP + LDIN++V +RNLVAYEA 
Sbjct  363   EIAIPSITELSKSGVSFVATKGDISTICFDVKTTTLYLPSIGLDINTKVFMRNLVAYEAS  422

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
              A GPLV ARY E MNGI+DT++D + LREKG+ILN LKSD E+ANLWNGMNKS++LT+V
Sbjct  423   TASGPLVFARYIELMNGIIDTEDDARILREKGVILNHLKSDQELANLWNGMNKSIKLTRV  482

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
              FLDK I+DVN+ YN + ++K  + ++ Y+F SWQFL  LA + LL LM LQ FCS Y C
Sbjct  483   PFLDKVIEDVNQHYNGKVSIKVWKLVKVYVFASWQFLIFLAVVFLLFLMSLQVFCSFYRC  542

Query  355   S  353
             +
Sbjct  543   N  543



>ref|XP_002300077.1| hypothetical protein POPTR_0001s36110g [Populus trichocarpa]
 gb|EEE84882.1| hypothetical protein POPTR_0001s36110g [Populus trichocarpa]
Length=545

 Score =   502 bits (1292),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 274/541 (51%), Positives = 375/541 (69%), Gaps = 17/541 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WV  I++T+E E+E+++ I + IF VPK LM  DP+ Y PQ++++GPYHY+  ELH
Sbjct  17    DELQWVNTIRRTIEDEVEDDSNIPICIFNVPKALMSSDPDSYTPQQLSLGPYHYSRLELH  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EM+R+KL AAK  QK L+++K   L E++MK+ES+IR  Y K LN   ETLAWMMA+DAS
Sbjct  77    EMDRYKLSAAKRSQKLLQSLKFRDLVEQLMKLESKIRACYHKYLNFNGETLAWMMAIDAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+VY ++ G  M + +S+ M H ++   +KSS NA+LRDI+MLENQIP F LRK+
Sbjct  137   FLLEFLQVYDLR-GPKMLSEVSSGMPHFLEYSYRKSSCNAILRDIVMLENQIPLFTLRKV  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGS-AVVQIADATHLLGYLFQTIVPEMES  1241
             L+ +  S E++DD+L +MLMG  KELSPFK      V ++++  HLL +L+  IVP++E 
Sbjct  196   LEFRFLSLESADDMLYSMLMGSCKELSPFKTMVRLPVARVSEHAHLLDFLYHIIVPKVEE  255

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
                 + I E      K   E +E    S Y+K    ++W +   LN  PA  LK+L   A
Sbjct  256   S---VNIPEEVKDHTKATQENEEPSVGSTYMKQLLIEIWNLFSSLNIDPAGFLKKLLESA  312

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSK-DNADKPPSIEEITI  884
             PV  +L +PW  ++ + G           F   ++PD    S S   + D+PP +EEITI
Sbjct  313   PVAVILKLPWSILSNVLG-----------FGSAKQPDAFSESQSVCSSIDQPPLVEEITI  361

Query  883   PSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKG  704
             PSVT+L+  GVRF+P+K  I +I FD KT T YLP V+LD+NS+VVLRNLVAYEA  A G
Sbjct  362   PSVTQLSKCGVRFVPSKGSISTINFDKKTCTFYLPTVSLDVNSDVVLRNLVAYEASNASG  421

Query  703   PLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLD  524
             P+V  RYTE MNGI+DT ED K LRE+GIILN LK+D EVAN+WNGM++S+RLTKV FLD
Sbjct  422   PMVFTRYTELMNGIIDTGEDAKILRERGIILNHLKNDEEVANIWNGMSRSIRLTKVPFLD  481

Query  523   KTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFF  344
             K I+DVNK+++  + VK ++FM+ ++F SW+ LTLLA+I+LLL+  LQ+FCSVY C+R F
Sbjct  482   KVIEDVNKYHDGLFKVKVEKFMKQHVFSSWKLLTLLASILLLLITSLQAFCSVYDCARLF  541

Query  343   N  341
             +
Sbjct  542   H  542



>ref|XP_006603600.1| PREDICTED: putative UPF0481 protein At3g02645-like [Glycine max]
Length=558

 Score =   502 bits (1292),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 269/541 (50%), Positives = 378/541 (70%), Gaps = 12/541 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I++TL    E++++  VSIF VPK LM  DP+ Y+PQ+VAIGPYHY + EL+
Sbjct  17    DEFRWVIQIRETLNEGHEDDDQFPVSIFNVPKPLMATDPDSYIPQQVAIGPYHYWSQELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+K+ +AK FQ+QL+++KL  + ++++++E RIR  Y + LN   ETL WMMA+DAS
Sbjct  77    EMERYKIASAKRFQEQLQSLKLEHMVDQLIRLEHRIRACYHRYLNFNGETLMWMMAIDAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+VY + +G ++   +S++MSHL+D  G++ +HN +L+DI+MLENQ+P F+LRKM
Sbjct  137   FLLEFLQVYTIHDGAMIPG-VSSRMSHLMDYAGRRIAHNEILKDIVMLENQLPLFVLRKM  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQTIVPEME  1244
             L+ +  S E +DD+LL+ML+GL KE SPFK   +    V +++  HLL +L+  IVP++E
Sbjct  196   LEFKFSSLELADDMLLSMLLGLLKEFSPFKVIEKDCPEVIVSECAHLLDFLYAMIVPKLE  255

Query  1243  SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
              +   +++++    KE  +           +VK   G+VW +L KL       + ++   
Sbjct  256   EQTDLVQLEDQHRDKEDSEKSIV------NHVKQFLGEVWRVLSKLATALISLINKVLQC  309

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDE---NSDSKDNADKPPSIEE  893
               +K + L+PW  I+ LPG+ ++K P+E LF    K   +E   N  S++  +KPP +EE
Sbjct  310   RAMKIITLLPWTVISNLPGVGLIKQPVEYLFFSQDKEATEEENGNLSSENVMNKPPLMEE  369

Query  892   ITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACI  713
             I IPSVTEL+ +GV F+ T   I +I FD KT TLYLP + LD+NSEV+LRNLVAYEA  
Sbjct  370   IAIPSVTELSKSGVCFMATNGDISTIGFDVKTVTLYLPTIGLDLNSEVLLRNLVAYEAST  429

Query  712   AKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVA  533
             A G LV  RYTE MNGI+D++ED K LREKG+ILNRLKSD EVANLWNGM+KS++LT+V 
Sbjct  430   ASGSLVFTRYTELMNGIIDSEEDAKILREKGVILNRLKSDEEVANLWNGMSKSIKLTRVP  489

Query  532   FLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCS  353
             FLDK I+DVN+ YN R N+K  +F++ Y+F SW+FLT  A I LL LM LQ FCS Y C+
Sbjct  490   FLDKVIEDVNQHYNGRMNIKVWKFIKLYVFASWKFLTFFAAIFLLFLMSLQVFCSFYKCN  549

Query  352   R  350
             R
Sbjct  550   R  550



>ref|XP_003599700.1| hypothetical protein MTR_3g043530 [Medicago truncatula]
Length=555

 Score =   501 bits (1290),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 276/548 (50%), Positives = 382/548 (70%), Gaps = 30/548 (5%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeen-EINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +WVIHI+K LE E EEE+ +++V+IF VPK LM  DP+ YVPQ+VAIGPYHY   EL
Sbjct  17    DELQWVIHIRKILEEEFEEEDGKLSVTIFNVPKLLMASDPDSYVPQQVAIGPYHYWRSEL  76

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             +EM+ +KL A K F K L++ KL +L +++ K E R+R  Y K L+L  ET+ WMM VDA
Sbjct  77    YEMQSYKLAATKRFLKSLQSFKLDNLVDQLTKYEQRVRACYHKFLDLNGETMVWMMIVDA  136

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLE L++YA++EG+    ++S+ MSHLVD  G+KS+HNA+L+DI+MLENQIP  +LRK
Sbjct  137   SFLLELLQIYAMQEGEPKREVLSS-MSHLVDYAGRKSAHNAMLKDIVMLENQIPLMVLRK  195

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEME  1244
             +L+ +  S EA+D++L+ M +GL K+ SPFK  E    ++++++ HLL + +  IVP++E
Sbjct  196   LLEFKLSSKEAADEMLIFMFIGLFKQTSPFKMIEKFPSIKVSESAHLLDFFYDMIVPKLE  255

Query  1243  SEH---VEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
             + +   +++EI +     + +D         S YVK  F ++W IL K  KGP ++L R+
Sbjct  256   TGNDVTIDVEIQQEEEQDKGEDENSK---GESSYVKQPFNEIWRILSKHIKGPMKSLNRV  312

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGD----ENSDSKDNADKPP  905
              S  P+K ++  PWK I+ LPG  ++K P+ESLF   +K D +    ENS S D  +KPP
Sbjct  313   VS-RPLKVLVKFPWKIISNLPGGKLLKQPVESLFFSKEKGDEEKQENENS-STDLVNKPP  370

Query  904   SIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAY  725
              ++EI IPSV +L  AGV F+PT   I SI FDAKT T +LP++ LD+N+EV LRNLVAY
Sbjct  371   LMDEIAIPSVEQLVLAGVNFLPTNGSISSISFDAKTNTFHLPMIRLDVNTEVFLRNLVAY  430

Query  724   EACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRL  545
             E+ +  GPLV+ RYTE MNGI+D+++D               SD EVAN+WNGM+KS+RL
Sbjct  431   ESSVGSGPLVITRYTELMNGIIDSEKD---------------SDQEVANMWNGMSKSLRL  475

Query  544   TKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSV  365
             ++V FLDKTI+DVNK YN    +K  +FM+SY+FGSWQFLT LATI LL +  LQ+FCSV
Sbjct  476   SRVPFLDKTIEDVNKSYNNTMKIKIWKFMKSYVFGSWQFLTFLATIFLLFMTALQAFCSV  535

Query  364   YTCSRFFN  341
             YTC RFF+
Sbjct  536   YTCHRFFD  543



>gb|KCW70769.1| hypothetical protein EUGRSUZ_F03929 [Eucalyptus grandis]
Length=500

 Score =   496 bits (1278),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 255/483 (53%), Positives = 330/483 (68%), Gaps = 24/483 (5%)
 Frame = -3

Query  1891  INVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKL  1712
             + VSIFGVP  LM  DP+ Y PQ+VAIGPYH+  PE+                    IK 
Sbjct  12    VPVSIFGVPTVLMSSDPDLYTPQQVAIGPYHHWRPEM--------------------IKF  51

Query  1711  HSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMIS  1532
              SL E+++K+E R+R  Y K L+   ETLAWMMA+D  FLLEFL++YA+KEGK+++  +S
Sbjct  52    QSLVEQLVKLEPRVRACYHKYLDFNGETLAWMMAIDVLFLLEFLQIYAIKEGKMLSR-VS  110

Query  1531  AKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGL  1352
             ++MSHLVD   +KS+HNA+LRDI+MLENQIP FILRKML+ QC S + +DD+LLTMLMG 
Sbjct  111   SRMSHLVDFARRKSAHNAILRDIVMLENQIPLFILRKMLEFQCASLDEADDMLLTMLMGF  170

Query  1351  SKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMESE-HVEIEIdenggmkekkdgee  1178
              KE+SPFK  E    +Q++   HLL +LF  IVP++E +  +  E       K+K     
Sbjct  171   YKEVSPFKPMEALPNIQVSVCAHLLDFLFDIIVPKVEGQPEIIEEEGNGEDKKDKGRSPL  230

Query  1177  dEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNV  998
                   + Y+K     +W +L KLN  P + LKRL    PVK +L +PW  ++KLP  ++
Sbjct  231   ASSSSGTTYIKQLCDAIWNLLSKLNNDPIKMLKRLLFSKPVKVLLKLPWTILSKLPFFSI  290

Query  997   MKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILS  818
             +  P+E+LFS  +K DG   ++S  N  KPPS+EEI IPSV++L+N GVRF+ T   + S
Sbjct  291   LAQPLEALFSSQEKEDGKPENES-SNPYKPPSVEEIAIPSVSDLSNVGVRFVATNGNLSS  349

Query  817   IEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVK  638
             I FD K  TLYLP ++LD+NSEV +RNLVAYEA  A GPLV  RYTE MNGI+D+DEDVK
Sbjct  350   IGFDTKMATLYLPAISLDVNSEVFMRNLVAYEASNASGPLVFTRYTELMNGIIDSDEDVK  409

Query  637   FLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFM  458
              LREKG+ILNRLKSD EVA LWN M+KS+RLTKV FLDK I+DVNK+YN RW VK  +FM
Sbjct  410   LLREKGVILNRLKSDEEVAKLWNSMSKSIRLTKVPFLDKAIEDVNKYYNGRWKVKLGKFM  469

Query  457   RSY  449
             + Y
Sbjct  470   KLY  472



>ref|XP_011073606.1| PREDICTED: putative UPF0481 protein At3g02645 [Sesamum indicum]
Length=572

 Score =   496 bits (1278),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 268/548 (49%), Positives = 382/548 (70%), Gaps = 14/548 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WV  I++TL+ EL+EE E  V+IF VPKTL +  P+ Y+PQ+VAIGPYH+   EL+
Sbjct  17    DERQWVKQIRQTLDEELDEETETPVTIFAVPKTLFISCPDYYIPQQVAIGPYHHLRAELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             +MER+K+ AAK  Q++L  +KL  + + ++K E RIR  Y + ++L  E LAW++AVD S
Sbjct  77    DMERYKVAAAKRNQRELNNLKLQGIVDHLIKFEFRIRACYHRPVSLGGEALAWLLAVDVS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEF +V  VK+G+++  + S +++HLVDL G K +H+A+L+DI+MLENQ+P F+LR +
Sbjct  137   FLLEFFEVCGVKKGRMLTKLPS-RLAHLVDLSGNKVAHDAILKDIVMLENQVPLFVLRMV  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQTIVP---  1253
             L+ Q  S + +D++LL MLM LS E+SPF+    G   +++ +  HLL +L++ IVP   
Sbjct  196   LECQFSSLDLADEVLLDMLMELSGEVSPFEMAKAGCRKIEVKECAHLLDFLYRFIVPAEP  255

Query  1252  EMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
             ++ SE +EI  +E+G  +  ++      L    +++    +VWGIL KL  GP   +K L
Sbjct  256   DVASETIEIHDEEDGETEGLENKNS---LAEPSHLRLFLAEVWGILSKLKAGPVGWIKTL  312

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQK-----PDGDENSDSKDNADKP  908
                 P++  + +PW  ++K+P + ++K P+E +F+  QK      D  E+S S    ++ 
Sbjct  313   VCSKPIRVFVKLPWTILSKIPVIKLLKEPVEHIFNAYQKENKEKTDDQESSSSISKKNRL  372

Query  907   PSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVA  728
             P ++EI IPSVT+L+  GV+F+P  +GI SI+FDAKT T Y+PV+ LD+ SEVVLRNLVA
Sbjct  373   PLLDEIKIPSVTQLSEVGVQFVPIHEGITSIKFDAKTLTFYIPVINLDVYSEVVLRNLVA  432

Query  727   YEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVR  548
             YEAC A GPL L RY E MNGIVDTD D KFL  +GII+N LKS+ EVA LWNGM++S+R
Sbjct  433   YEACSASGPLFLTRYVELMNGIVDTDLDAKFLCGRGIIINHLKSEGEVAELWNGMSQSIR  492

Query  547   LTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCS  368
             LTKV  LD+ I DVNKFY+ RW VK  +FM+ Y++GSW+ LT LA I+LLLL +LQ+FC 
Sbjct  493   LTKVPSLDQLIGDVNKFYDGRWKVKYVKFMKQYVYGSWRILTFLAAIMLLLLTILQAFCQ  552

Query  367   VYTCSRFF  344
             VYTCSR F
Sbjct  553   VYTCSRIF  560



>emb|CAN79320.1| hypothetical protein VITISV_029316 [Vitis vinifera]
Length=477

 Score =   491 bits (1264),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 256/480 (53%), Positives = 340/480 (71%), Gaps = 10/480 (2%)
 Frame = -3

Query  1774  MERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASF  1595
             MER+KL AAK  QK L+ +K  SL +++ K E RIR  Y K L    +TLAWMMA+DASF
Sbjct  1     MERYKLAAAKRTQKHLQRVKFESLVDQLTKHEPRIRACYHKXLEFNGDTLAWMMAIDASF  60

Query  1594  LLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKML  1415
             LLEFL+VYA+K G+++   +S++MSHLVD  G KS+HNA+LRD++MLENQIP F+LRK+L
Sbjct  61    LLEFLQVYAIKAGRVLTR-VSSRMSHLVDYAGTKSAHNAILRDMVMLENQIPLFVLRKVL  119

Query  1414  QPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMESE  1238
             + Q P+ + +DD+L +ML G  ++L PF   +    + + +  HLL +L+  IVP  +  
Sbjct  120   EFQFPTLDQADDMLCSMLAGFGEDLCPFGMMKDLPQIHVEEQAHLLDFLYHLIVPRSKEP  179

Query  1237  HVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAP  1058
                IE++     KE K+        +S YV+  F  +W +L    +GP R LKRL    P
Sbjct  180   SEIIEVENEDEXKEGKEES----FGBSNYVQQLFQIIWNLLSTCTQGPIRLLKRLLLSDP  235

Query  1057  VKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENS-DSKDNADKPPSIEEITIP  881
             VK +L +PW  ++KLPG +++K P+E +F    K   +EN  ++ +N  KPP IEEI IP
Sbjct  236   VKVILKLPWTIVSKLPGFSILKQPVEDIFFSQNK---EENKPENGNNIIKPPLIEEIAIP  292

Query  880   SVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGP  701
             SV+EL+ +GVRF+PT   I SI FDAK  TLYLP V+LD+N+EV+LRNLVAYEA  A GP
Sbjct  293   SVSELSKSGVRFLPTNGSISSITFDAKMATLYLPTVSLDVNTEVILRNLVAYEASNASGP  352

Query  700   LVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDK  521
             L++ARYTE MNGI+DT ED +FLRE+GIILNRLKSD EVA+LWNGMNK++RLTKV FLDK
Sbjct  353   LIIARYTELMNGIIDTKEDAQFLRERGIILNRLKSDEEVADLWNGMNKTIRLTKVPFLDK  412

Query  520   TIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFN  341
              I+DVN ++   W VK  +FM+ Y+FGSWQFLT LAT+ +L LM LQ+FCSVY+C R FN
Sbjct  413   VIEDVNNYHTGIWQVKAGKFMKRYVFGSWQFLTFLATVCILWLMALQAFCSVYSCPRMFN  472



>ref|XP_011045249.1| PREDICTED: putative UPF0481 protein At3g02645 [Populus euphratica]
Length=545

 Score =   493 bits (1269),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 268/540 (50%), Positives = 373/540 (69%), Gaps = 17/540 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WV  I++T+E E+E+++     IF VPK LM  DP+ Y P+++++GPYHY+  ELH
Sbjct  17    DELQWVNTIRRTIEDEVEDDSNTPTCIFNVPKALMSSDPDSYTPRQLSLGPYHYSRLELH  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EM+R+KL AAK  QK+L+++K   L E++MK+ES+IR  Y K L+   ETLAWMMA+DAS
Sbjct  77    EMDRYKLSAAKRSQKRLQSLKFRDLVEQLMKLESKIRACYHKYLHFNSETLAWMMAIDAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+VY ++ G  M + +S+   H+++   +KSS NA+LRDI+MLENQIP F LRK+
Sbjct  137   FLLEFLQVYDLR-GPKMLSEVSSGTPHVLEYSNRKSSCNAILRDIVMLENQIPLFTLRKV  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGS-AVVQIADATHLLGYLFQTIVPEMES  1241
             L+ +  S E++DD+L +MLMG   ELSPFK      V ++++  HLL +L+  IVP++E 
Sbjct  196   LEFRFLSLESADDMLYSMLMGSCVELSPFKTMVRLPVARVSEHAHLLDFLYHIIVPKVEE  255

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
                 + I E      K   E +E    S Y+K    ++W +   LN  PAR LK+L   A
Sbjct  256   S---VNIPEEVKDHTKAKQENEESSVGSTYMKQLMIEIWNLFSSLNIDPARFLKKLLESA  312

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSK-DNADKPPSIEEITI  884
             PV  +L +PW  ++ + G           F   ++PD    S S   + D+ P +EEITI
Sbjct  313   PVAVILKLPWPILSNVLG-----------FGSAKQPDAFSESQSVCSSIDQSPRVEEITI  361

Query  883   PSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKG  704
             PSVT+L+  GVRF+P+K  I +I FD KT T YLP V+LD+NS+VVLRNLVAYEA  A G
Sbjct  362   PSVTQLSKCGVRFVPSKGSISTINFDKKTCTFYLPTVSLDVNSDVVLRNLVAYEASNASG  421

Query  703   PLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLD  524
             P+V  RYTE MNGI+DT+ED K LRE+GIILN LK+D EVAN+WNGM++S+RLTKV F+D
Sbjct  422   PMVFTRYTELMNGIIDTEEDAKILRERGIILNHLKNDEEVANIWNGMSRSIRLTKVPFMD  481

Query  523   KTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFF  344
             K I+DVNK+++  + VK ++FM+ ++F SW+ LTLLA+I+LLL+  LQ+FCSVY C+R F
Sbjct  482   KVIEDVNKYHDGLFKVKVEKFMKLHVFSSWKLLTLLASILLLLITSLQAFCSVYDCARLF  541



>ref|XP_006427505.1| hypothetical protein CICLE_v10027555mg [Citrus clementina]
 gb|ESR40745.1| hypothetical protein CICLE_v10027555mg [Citrus clementina]
Length=537

 Score =   491 bits (1264),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 274/550 (50%), Positives = 365/550 (66%), Gaps = 28/550 (5%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN   DE +W+I+I +TLE E E + +  V IF VPKTLM  DP+ Y P+ VAIGPYHY 
Sbjct  9     PNF--DEHRWIINILRTLEEEPETDTDFPVCIFSVPKTLMSSDPDSYTPKEVAIGPYHYW  66

Query  1792  NPELHEMERHKLDAAKIFQKQLR-TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWM  1616
              PEL+EMER+KL AAK  Q+      K   + +++ ++E +IR  Y   LN   E LAWM
Sbjct  67    RPELYEMERYKLAAAKSAQRHFNGDHKFQDVVDQLKELELQIRACYHNFLNFSNEALAWM  126

Query  1615  MAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPF  1436
             MA+ ASFLLEFL++YA+K+GKL     S  MSHL+D  G K++HNA+LRD++MLENQIP 
Sbjct  127   MAIGASFLLEFLQIYAIKDGKLSKTYSSRSMSHLLDYAGTKAAHNAILRDMVMLENQIPL  186

Query  1435  FILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTI  1259
             F+LRKML+ +  S E++D++L  MLMG  +ELSPFK  +   ++ I+++ HLLGYL+  +
Sbjct  187   FVLRKMLEFEYSSLESADEMLQAMLMGFCEELSPFKLMKDMPMINISESAHLLGYLYDMV  246

Query  1258  VPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALK  1079
             VP+  SE    EI E      +    ++ +  +  Y    F +VW ++ KL   P R +K
Sbjct  247   VPK--SEQKASEIIEVVDDVGEAKQPQERYSTDLAYSNKLFREVWKLVSKLTIRPIRLIK  304

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESL-FSCGQKP--DGDENSDSKDNADKP  908
              L                   LP L+++    + L F  G K   DG  +  S+ + +KP
Sbjct  305   NL-------------------LPLLSILARQFQYLLFREGNKSGDDGSSSHPSESDVNKP  345

Query  907   PSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVA  728
             P +EEITIPSVTEL  + V F      I ++ FDA+T TL+LP ++LD+NS VVLRNLVA
Sbjct  346   PLVEEITIPSVTELYKSNVTFSAVVGNISTVSFDAETATLHLPTISLDVNSNVVLRNLVA  405

Query  727   YEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVR  548
             YEA  A GPL+  RYTEFMNGI+DT+ED K LREKGII+NRLKSD+EVA+LWNGM++S+R
Sbjct  406   YEASNASGPLIFTRYTEFMNGIIDTEEDAKLLREKGIIVNRLKSDAEVAHLWNGMSRSIR  465

Query  547   LTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCS  368
             LTKV  +DK I+ VNK YN +W VK  ++M+ Y+FGSWQFLTL+ATI+LL LM LQ FCS
Sbjct  466   LTKVPHIDKVIEGVNKHYNSQWKVKFGKYMKYYVFGSWQFLTLIATIMLLFLMTLQGFCS  525

Query  367   VYTCSRFFND  338
             VYTC +F  D
Sbjct  526   VYTCRKFDTD  535



>gb|KDO43081.1| hypothetical protein CISIN_1g039617mg [Citrus sinensis]
Length=520

 Score =   489 bits (1259),  Expect = 8e-162, Method: Compositional matrix adjust.
 Identities = 272/547 (50%), Positives = 365/547 (67%), Gaps = 42/547 (8%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN   DE +W+I+I++TL  ELEE+ ++ V IF VPK LM  DP+ Y PQ++AIGPYH+ 
Sbjct  7     PNF--DEHRWIINIRRTLGEELEEDADLPVCIFNVPKALMSIDPDSYTPQQIAIGPYHHW  64

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
              PEL EMER+KL AAK  Q+QL+ IK                           ETLAWMM
Sbjct  65    RPELQEMERYKLAAAKRTQRQLQRIKFGD------------------------ETLAWMM  100

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
             A+DA+FLLEFL +YA+KEG+ +  + S  MSHL D  G+ S HNA+LRDI+MLENQIP F
Sbjct  101   AIDAAFLLEFLHIYAIKEGQALTRVSSRSMSHLADYAGRNSGHNAILRDIVMLENQIPLF  160

Query  1432  ILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIV  1256
             ILRKML+ Q PS E +DD+LL+ L+GL K+LSPFK  E    +++++  HLL +L+  IV
Sbjct  161   ILRKMLEFQSPSMELADDILLSKLIGLCKDLSPFKMIENLPHIEVSECAHLLDFLYNVIV  220

Query  1255  PEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             P++E E +E+  DE+    +++         +S +VK    ++       NKGP R +K+
Sbjct  221   PKLE-EPIEMTEDEDRDHNDEEAQGRKRLFADSNHVKKLLSKI------CNKGPLRFMKK  273

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIE  896
             +        +L  P   ++ LPG  ++K  ++       + +  +  +S +  +KPP +E
Sbjct  274   M--------LLNFPCMILSNLPGFAILKQLLQHSCLSQDQEETTQEQESSNKTNKPPLVE  325

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EITIPSVTEL+ AG  F      I +I+FD KT T YLP V+LD+N+EV+LRNLVAYEA 
Sbjct  326   EITIPSVTELSKAGFCFSTANGSISAIDFDVKTATFYLPTVSLDVNTEVLLRNLVAYEAS  385

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
              A GPLV  RYTE MNGI+DT++DVK LREKG+ILNRLKSD E ANLWNGM+KS+RLTKV
Sbjct  386   NASGPLVFTRYTELMNGIIDTEDDVKLLREKGVILNRLKSDEEAANLWNGMSKSIRLTKV  445

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
              FLDK I+D+N +Y+ RW VK  +FM+ Y+F SWQFLTLLAT++LL LM LQ+FC++Y C
Sbjct  446   PFLDKVIEDINNYYDGRWCVKVGKFMKHYVFDSWQFLTLLATVLLLFLMTLQAFCAIYGC  505

Query  355   SRFFNDV  335
              R F+ V
Sbjct  506   HRSFHHV  512



>ref|XP_011084573.1| PREDICTED: putative UPF0481 protein At3g02645 [Sesamum indicum]
Length=565

 Score =   490 bits (1261),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 283/563 (50%), Positives = 374/563 (66%), Gaps = 37/563 (7%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN   DE +WVI I++ L+ ELEEE E  V IF VPK L+   P+ Y+P +V++GPYHYT
Sbjct  12    PNPSFDEKQWVIQIRRALDEELEEETETPVRIFTVPKPLLATHPDSYIPHQVSVGPYHYT  71

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
              PEL EMER+KL AAK   K  + +KL  L + ++++E +IR  Y+K L    ETLAWMM
Sbjct  72    RPELREMERYKLAAAKRNHKDFQNLKLQFLVDCLVELEPKIRACYNKYLIFNGETLAWMM  131

Query  1612  AVDASFLLEFLKVYAVKEGK--LMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIP  1439
             AVD SFL EFL+V AVK G    M  ++S++ S+LV L G K++HNA+LRDI MLENQIP
Sbjct  132   AVDVSFLFEFLQVCAVKHGNETAMTNVVSSRFSYLVGLAGNKAAHNAILRDISMLENQIP  191

Query  1438  FFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK---NEGSAVVQIADATHLLGYLF  1268
              F+LRK+L+    S E +D+ LL MLMG  +ELSPF+    +   + Q+ D  HLL  L+
Sbjct  192   LFVLRKLLELVFSSSENADETLLVMLMGFCEELSPFRMVEEDLPNIFQVRDCAHLLDVLY  251

Query  1267  QTIVPEME------SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQ---VWGIL  1115
             +  VP++E      SE VE  +             + E+  +     S  G+   VW  +
Sbjct  252   RFCVPKLEGFSYMNSESVEEAV-----------QVKQEYCGDERRAASDDGEGQKVW--M  298

Query  1114  KKLN-KGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDEN  938
             K LN + P   +K++    P+K ++ +PW  ++ LP L V K  +E+ F+     D +E 
Sbjct  299   KVLNFQAPLNFIKKIVFSKPMKMIVRLPWTILSNLPILKVTKQLLENFFN---SLDENEK  355

Query  937   SDSKDNADK------PPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPV  776
             S++K  + K      PP +EEI IPSV ELA AGVRF PT+ GI +I FD K   LYLP 
Sbjct  356   SNNKGGSTKNSITHNPPLLEEIKIPSVMELAKAGVRFEPTEGGISTITFDNKNVVLYLPT  415

Query  775   VTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKS  596
             ++LD+NSEVVLRNLVAYEAC A GPLVLARYTE MNGI+DT+ED KFL E+GII N LKS
Sbjct  416   ISLDVNSEVVLRNLVAYEACSAWGPLVLARYTELMNGIIDTEEDAKFLCERGIIRNHLKS  475

Query  595   DSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltll  416
             D EVA+LWNGM+KS+RLTKV FLDK I+DVNK++N  W VK  ++M++Y+FGSW+ LT L
Sbjct  476   DGEVADLWNGMSKSIRLTKVPFLDKVIEDVNKYHNGMWKVKCGKYMKNYVFGSWRILTFL  535

Query  415   ativllllmvLQSFCSVYTCSRF  347
             A I++LL M LQ+FCSVY C+R 
Sbjct  536   AAILMLLFMALQAFCSVYNCARL  558



>ref|XP_008659214.1| PREDICTED: putative UPF0481 protein At3g02645 [Zea mays]
 gb|AFW85585.1| hypothetical protein ZEAMMB73_478306 [Zea mays]
Length=597

 Score =   489 bits (1258),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 276/580 (48%), Positives = 373/580 (64%), Gaps = 43/580 (7%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeen-----EINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             DE +WV+ I+++LE      +      I VS+F VPK L V+ PE Y PQ +A+GPYH+ 
Sbjct  20    DEVRWVVQIRQSLEEGGPGSDDDNDDGIQVSVFNVPKPLQVHKPEAYTPQFIALGPYHHW  79

Query  1792  NPELHEMERHKLDAAKIFQKQLRT-IKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWM  1616
              PEL+EMER+KL AA+  QK+LR   +L  L ++  ++E R+R  Y + L+   ETLAWM
Sbjct  80    RPELYEMERYKLAAARRAQKRLRGGARLDGLVDQFKRLERRVRAYYHRYLDFGGETLAWM  139

Query  1615  MAVDASFLLEFLKVYAVK-------------EGKLMAAMISAKMSHLVDLKGKKSSHNAL  1475
             M VD +FLLEFL+VYAV              +GK +   +S++M HLVD  G+KS+H+ +
Sbjct  140   MLVDGAFLLEFLQVYAVAAANEGDVATTGSGDGKALRRGVSSRMQHLVDYAGRKSAHSLI  199

Query  1474  LRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIA  1298
             LRD++MLENQ+P F+LR++L+PQC SP  + +LL  M+ GL KEL P K  +    + ++
Sbjct  200   LRDMLMLENQVPLFLLRRILEPQCASPGEAGELLPRMVTGLMKELCPLKMLDKFPAIDVS  259

Query  1297  DATHLLGYLFQTIVPE--MESEHVEIEIdenggmkekkdgeedEFLKNSG----------  1154
                HLL  L+  +VP+   +    E     +G  +E     E++ +   G          
Sbjct  260   KNAHLLEVLYYLLVPKPTDDGGAAEAGDAAHGSRREDGYDIEEQLVDGGGGDEEQKPAAG  319

Query  1153  --YVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIE  980
               YVK     V  +   L+ G  R + R     P+   +  PWK +T +PG + MK P+E
Sbjct  320   CEYVKQLLLTVSSMASGLSTGRMRYVTR-----PIAFAVKAPWKMLTVVPGFSAMKQPVE  374

Query  979   SLFSCGQKPDGDENSDSKDNAD---KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEF  809
             + F  G   DG  ++   + A    +PP IEEI IPSV+ELAN GV+F PT   + +I F
Sbjct  375   AYFMSGAA-DGSTHAHDPNGAGYLTRPPLIEEIMIPSVSELANIGVQFCPTAGDLSTIAF  433

Query  808   DAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLR  629
             DA+T T +LP VTLD N+EVVLRNLVAYEA  A GPLVLARYTE MNGI+DTDEDV  LR
Sbjct  434   DARTVTFHLPAVTLDSNTEVVLRNLVAYEAAAASGPLVLARYTELMNGIIDTDEDVALLR  493

Query  628   EKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSY  449
              +G++LNR+KSD EVA LWNGM++SVRLTKVAF+D+ +++VN++YN RW VKTKRFMR Y
Sbjct  494   RRGVVLNRMKSDGEVAKLWNGMSRSVRLTKVAFVDRAVEEVNRYYNSRWRVKTKRFMRKY  553

Query  448   IFGSWQFltllativllllmvLQSFCSVYTCSRFFNDVTI  329
             +F SWQ LT LA IV+LLL  LQ+FCSVYTCSR+F  VT+
Sbjct  554   VFSSWQLLTFLAAIVMLLLTTLQAFCSVYTCSRWFGTVTV  593



>ref|XP_006427513.1| hypothetical protein CICLE_v10026970mg [Citrus clementina]
 gb|ESR40753.1| hypothetical protein CICLE_v10026970mg [Citrus clementina]
Length=560

 Score =   486 bits (1252),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 271/549 (49%), Positives = 366/549 (67%), Gaps = 13/549 (2%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN   DE +W+I+I++TLE ELE + +  V IF VPKTL   DP+ Y PQ+VAIGPYH  
Sbjct  7     PNPSFDECRWIINIRRTLEEELESDTDFPVCIFSVPKTLRSSDPDAYTPQQVAIGPYHCW  66

Query  1792  NPELHEMERHKLDAAKIFQKQLR-TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWM  1616
              PEL++ME +KL AAK  Q+ +    +   + +++ ++E +IR  Y K LN   E LAWM
Sbjct  67    RPELYDMEMYKLTAAKRAQRHINGDHEFQYVVDQLKELELKIRACYHKYLNFSNEALAWM  126

Query  1615  MAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPF  1436
             MA+DASFLLEFL++Y ++E KL     S  MSHL+D  G K++HNA+LRD++MLENQIP 
Sbjct  127   MAIDASFLLEFLQIYTIEEDKLSTTYSSRSMSHLLDNAGTKAAHNAILRDVVMLENQIPL  186

Query  1435  FILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTI  1259
              +LRKM++ Q  S E +DD+L  +L G  +ELSPFK  +   ++ I++ THL  +L+ TI
Sbjct  187   CVLRKMVEVQYSSLELADDMLQALLTGFCEELSPFKMMKDMPMIDISECTHLQDFLYDTI  246

Query  1258  VPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALK  1079
             VP+ E      E+ E+   +      ++    +  Y+   F  +  +   L+ GP   +K
Sbjct  247   VPKAEQNS---EVTEDVHYQGDDKQPKEGCTDDPVYINYFFILICKLFSMLDIGPISLIK  303

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNA-----D  914
             +L    PVK    +PW  ++KLPG ++   P++ L       D +EN    + +     +
Sbjct  304   KLLLSKPVKCFFKLPWTILSKLPGFSIFAKPLQYLVF---PEDNEENQSHAEGSSRRLMN  360

Query  913   KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNL  734
             KPP +EEI IPSVTELA   V F  T   I ++ FD KT TL+LP ++ D+N+EV+LRNL
Sbjct  361   KPPLVEEIAIPSVTELAKVNVHFSATVGNISTVRFDTKTATLHLPTISFDVNTEVILRNL  420

Query  733   VAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS  554
             VAYE   A GPLVLARYTE MNGI+DT+EDVK LREKGIILNRLKSD+EVANLWNGMNKS
Sbjct  421   VAYETSNASGPLVLARYTELMNGIIDTEEDVKLLREKGIILNRLKSDAEVANLWNGMNKS  480

Query  553   VRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSF  374
             +RLTKV  +DK I  VNK+YN +W VK ++ M+ Y+FGSW+ LTLLATI+LLLLM LQ+F
Sbjct  481   IRLTKVPQIDKVIGGVNKYYNSQWKVKFRKNMKVYVFGSWKCLTLLATIMLLLLMTLQAF  540

Query  373   CSVYTCSRF  347
             CSVY+C  F
Sbjct  541   CSVYSCRNF  549



>ref|XP_002437949.1| hypothetical protein SORBIDRAFT_10g005360 [Sorghum bicolor]
 gb|EER89316.1| hypothetical protein SORBIDRAFT_10g005360 [Sorghum bicolor]
Length=562

 Score =   486 bits (1252),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 272/565 (48%), Positives = 359/565 (64%), Gaps = 47/565 (8%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeen------EINVSIFGVPKTLMVYDPECYVPQRVAIGPYHY  1796
             DE +WV+ I+ +L+ +            I VS+F VPK L V+ PE Y PQ +A+GPYH+
Sbjct  19    DEVRWVVQIRHSLQDDDAAAGDDDDDNGIPVSVFNVPKQLRVHKPEAYTPQFIALGPYHH  78

Query  1795  TNPELHEMERHKLDAAKIFQKQL-RTIKLHS-LAEEMMKVESRIRLSYDKQLNLRVETLA  1622
               PEL+EMER+KL AA+  QK+L   +KL   L ++  ++E +IR  Y + L+   ETLA
Sbjct  79    WRPELYEMERYKLAAARRAQKRLCAGLKLDGGLVQQFARLERKIRAYYHRYLDFNGETLA  138

Query  1621  WMMAVDASFLLEFLKVYAVK-----EGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIM  1457
             WMM VD +FLLEFL++YAV      +G      +S++M+HLVD  G+KS+HN +LRD++M
Sbjct  139   WMMVVDGAFLLEFLQIYAVAGDGEGDGGRALRRVSSRMAHLVDFTGRKSAHNLILRDMLM  198

Query  1456  LENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-----NEGSAVVQIADA  1292
             LENQ+P F+LRK+L+PQ PS + + + L  M+ GL KEL PFK       G    + ADA
Sbjct  199   LENQVPLFLLRKILEPQHPSCDDAGETLARMVTGLMKELCPFKMMDNFPAGDDPTEEADA  258

Query  1291  THLLGYLFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILK  1112
              +               E  +IE     G    +        +   YVK  F  VWGI+ 
Sbjct  259   AN----------GTFRDEGYDIEEQAADGGGADEQKTAAGGCE---YVKQLFLAVWGIVS  305

Query  1111  KLN-KGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENS  935
              LN  GP R + +     P++  +  PWK +  +PG       + S  S     D  + S
Sbjct  306   GLNTAGPMRYVTK-----PIEFAIKAPWKMLAVVPG-------VGSFMSGDGSNDPRDPS  353

Query  934   DSKDNAD---KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLD  764
              S   A    +PP IEEI IPSV+EL NAGV+F+PT   + +I FDAKT T  LPVVTLD
Sbjct  354   SSAAGAGYLTRPPLIEEIMIPSVSELVNAGVKFLPTSGDLSTIAFDAKTATFQLPVVTLD  413

Query  763   INSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEV  584
              N+EVV+RNLVAYEA  A GPLVLARYTE MNGI+DTDEDV  LR +G++LNR+KSD EV
Sbjct  414   SNTEVVVRNLVAYEASAASGPLVLARYTELMNGIIDTDEDVALLRRRGVVLNRMKSDGEV  473

Query  583   ANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativ  404
             A LWNGM +SVRLTKVAF+D+TI++VN++YN RW VKTKRFMR Y+F SWQ LT +A ++
Sbjct  474   AKLWNGMTRSVRLTKVAFMDRTIEEVNRYYNSRWRVKTKRFMRKYVFSSWQLLTFVAAVM  533

Query  403   llllmvLQSFCSVYTCSRFFNDVTI  329
             +LLL  LQ+FCSVYTCSR+F  VT+
Sbjct  534   MLLLTTLQAFCSVYTCSRWFGAVTV  558



>ref|XP_003599708.1| hypothetical protein MTR_3g043650 [Medicago truncatula]
Length=555

 Score =   486 bits (1251),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 262/514 (51%), Positives = 356/514 (69%), Gaps = 11/514 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenE-INVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE+ WVI ++KTLE E EEEN  +++SIF VPK LM  DP  YVPQ+VAIGPYHY   EL
Sbjct  17    DENLWVIQVRKTLEEEFEEENGELSISIFNVPKLLMASDPNSYVPQQVAIGPYHYWRQEL  76

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
              EM+ HKL + K FQKQL+++K+ +L +++ K+E +IR  Y K L+L  ETLAWMM VDA
Sbjct  77    FEMQNHKLASTKRFQKQLQSLKIDNLVDQLTKLEQKIRACYHKFLDLNGETLAWMMIVDA  136

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLEFL+ YA++E      +IS+ MSH V+  G++ S NA+LRDI+MLENQIP F+LRK
Sbjct  137   SFLLEFLQFYAMQEES--RKVISSNMSHFVNYVGRRLSPNAILRDIVMLENQIPLFVLRK  194

Query  1420  MLQPQC-PSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEM  1247
             ML+ +   S E +DD+L+ M + L KE+SPFK  E    +Q+ +  HLL +L+  IVP++
Sbjct  195   MLELKFFSSEENADDVLILMCIRLFKEISPFKMFEEYPNIQVLECAHLLDFLYDMIVPKL  254

Query  1246  ESEH--VEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
             E +H  +E+EI +    +E  +        +S +VK     +W  L K+ KGP   +K++
Sbjct  255   EKQHDIIEVEIQQEVDQQEGDEKSST---NDSIHVKKFLSILWKFLSKIIKGPLHGIKKV  311

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENS-DSKDNADKPPSIE  896
                AP+K +  +PW+ IT LPG+ ++K PIE   +  +K +      +S    +K P +E
Sbjct  312   LISAPLKVLKKLPWENITNLPGIKLVKQPIEYFLNTQKKEEEKPKDENSSTLKNKTPLVE  371

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EI IPSV +L  AGV F+P K  I SI FDAKT T +LP ++LD+N+EV LRNLVAYE+ 
Sbjct  372   EIAIPSVEQLVTAGVNFLPAKGSISSISFDAKTNTFHLPTISLDVNTEVFLRNLVAYESS  431

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
             +  GPLV+ RYTE MNGI+D++ D K LREKGIILN LKSD EVAN+WNGM+KS+RL++V
Sbjct  432   VGSGPLVITRYTELMNGIIDSENDAKILREKGIILNHLKSDQEVANMWNGMSKSLRLSRV  491

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSW  434
              FLDKTI+DVNK YN    +K  +FM+SY+FGSW
Sbjct  492   PFLDKTIEDVNKSYNNTMKIKIWKFMKSYVFGSW  525



>ref|XP_008461154.1| PREDICTED: putative UPF0481 protein At3g02645 [Cucumis melo]
 ref|XP_008461155.1| PREDICTED: putative UPF0481 protein At3g02645 [Cucumis melo]
 ref|XP_008461156.1| PREDICTED: putative UPF0481 protein At3g02645 [Cucumis melo]
Length=575

 Score =   486 bits (1251),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 278/554 (50%), Positives = 374/554 (68%), Gaps = 11/554 (2%)
 Frame = -3

Query  1957  DESKWVIHI-QKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +WVI I Q   E ELEE+  I V IF VPK+LMV DP+ Y PQ VAIGPYH+   EL
Sbjct  25    DEERWVIQIRQSLDEEELEEDIGIPVCIFNVPKSLMVIDPDSYTPQEVAIGPYHHWRQEL  84

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             +EMER+K+ AAK  QKQL+++K H L E++ K E + R  Y K LN   ET AWMMAVDA
Sbjct  85    YEMERYKIAAAKRAQKQLQSLKFHDLVEKLTKHEQKTRACYHKYLNFNSETFAWMMAVDA  144

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLE L+VY  +E     + +S+K+S+LVD +G+KS+HNA+LRDI+MLENQIP F+LR 
Sbjct  145   SFLLEVLRVYTREET--SISSVSSKLSYLVDYEGRKSAHNAILRDIVMLENQIPLFVLRM  202

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAV---VQIADATHLLGYLFQTIVPE  1250
             ML+ Q  + E +D LLL+ML+GL ++LSPFK     V   V +++  HLL +L++ I P+
Sbjct  203   MLELQFSAVEPADQLLLSMLLGLYEDLSPFKVMEDLVELQVSVSECFHLLDFLYRMITPK  262

Query  1249  MESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLS  1070
             +  + +E   D+    +   +  E  F      + S   ++W IL KLN+GP    KR+ 
Sbjct  263   L-VDTLETMEDDQNQQEPAIEIVESTFKHPCSPLSSLGSEIWKILSKLNEGPVHLFKRIV  321

Query  1069  SLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSC----GQKPDGDENSDSKDNADKPPS  902
                P++ +  +PW  ++ +PG+  +  P+E +FS      +K      S  KD   K P 
Sbjct  322   GSRPLQVIFKLPWTIVSNIPGIGTLMKPLEYIFSLRKVEEEKDPEKGGSSRKDGITKLPL  381

Query  901   IEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYE  722
             +EEITIPSV+EL  +GV F+P   G+ +I FD+K     LP + LD+NSEVVLRNLVAYE
Sbjct  382   LEEITIPSVSELTKSGVHFLPINGGVSAIAFDSKAVIFNLPTIKLDVNSEVVLRNLVAYE  441

Query  721   ACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLT  542
             A  + GPLV  R+ E MNGI+D++EDVK L+EKGIILN LKSD+EVA +WNGM+KS++LT
Sbjct  442   ASKSSGPLVFTRFIELMNGIIDSEEDVKLLKEKGIILNHLKSDAEVAEVWNGMSKSIKLT  501

Query  541   KVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVY  362
             KV FLDK I+DVNK Y+ RW VK  +F+  Y+FGSW  L LLATI+LL +  LQ+FCSVY
Sbjct  502   KVPFLDKVIEDVNKHYSSRWKVKAAKFVEKYVFGSWPLLALLATILLLAMNALQAFCSVY  561

Query  361   TCSRFFNDVTILGT  320
             +CSRFF+ ++  GT
Sbjct  562   SCSRFFDHLSTAGT  575



>ref|XP_002300078.2| hypothetical protein POPTR_0001s36120g [Populus trichocarpa]
 gb|EEE84883.2| hypothetical protein POPTR_0001s36120g [Populus trichocarpa]
Length=544

 Score =   484 bits (1247),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 265/541 (49%), Positives = 374/541 (69%), Gaps = 21/541 (4%)
 Frame = -3

Query  1954  ESKWVIHIQKTlereleee-nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             E +WV + ++T+E +  E+ +E ++SIF VPK LM  DP+ Y PQ++++GPYH++  ELH
Sbjct  19    ELQWVTNTRRTIEADHLEDDSETSISIFNVPKALMSTDPDSYAPQQLSLGPYHFSRLELH  78

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             +M+ +K  AAK  Q  L+++K   L E++MK+ES+IR  Y+K LNL  ETLAWMMA+DAS
Sbjct  79    DMDTYKFSAAKRSQDLLQSLKFQDLVEQLMKLESKIRACYNKYLNLNSETLAWMMAIDAS  138

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+VYA+++ K+++  +S+ M H ++   +KSS NA+LRDI+MLENQIP F LRK+
Sbjct  139   FLLEFLQVYALRDPKMLSE-VSSGMPHFLEYSYRKSSCNAILRDIVMLENQIPLFTLRKV  197

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGS-AVVQIADATHLLGYLFQTIVPEMES  1241
             L+ +  S E++D +L +MLMG  KELSPFK      V ++++  HLL +L+  IVP++E 
Sbjct  198   LESRFLSLESADVMLYSMLMGSCKELSPFKTMVRLPVARVSEHAHLLDFLYHIIVPKVEE  257

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
                 ++I E      K   E +E    S ++K    ++W +   LN  PAR L +L    
Sbjct  258   S---VKIPEEVKDHTKATQENEEPSVGSTHMKQLLIEIWNLFSNLNIDPARFLNKL---P  311

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSK-DNADKPPSIEEITI  884
             PV  +L +PW + + + G           F   ++PD    S S   + D+PP +EEITI
Sbjct  312   PVAVILKLPWSSFSNVLG-----------FGSAKQPDAFSESQSVCSSIDQPPLVEEITI  360

Query  883   PSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKG  704
             PSVT+L+  GVRF+PTK  I +I FD KT T YLP V+LD+NS+VVLRNLVAYEA  A G
Sbjct  361   PSVTQLSKCGVRFVPTKGSISTINFDKKTCTFYLPTVSLDVNSDVVLRNLVAYEASNASG  420

Query  703   PLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLD  524
             P+V  RYTE MNGI+DT+ED K LRE+GIILN LK+D EVAN+WNGM++S+RLTKV F+D
Sbjct  421   PMVFTRYTELMNGIIDTEEDAKILRERGIILNHLKNDEEVANIWNGMSRSIRLTKVPFMD  480

Query  523   KTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFF  344
             K I+DVNK+++  + VK ++FM+ Y+F SW+ L LLA+I+ LLL  LQ+FCSVY C+R F
Sbjct  481   KVIEDVNKYHDGLFKVKVEKFMKQYVFSSWKLLILLASILFLLLAFLQAFCSVYDCARLF  540

Query  343   N  341
             +
Sbjct  541   H  541



>ref|XP_010904995.1| PREDICTED: putative UPF0481 protein At3g02645 [Elaeis guineensis]
Length=553

 Score =   484 bits (1245),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 273/550 (50%), Positives = 368/550 (67%), Gaps = 25/550 (5%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I+ T E E EE   I VS+F VPKTL+   PE YVPQ  A+GPYH+ +P+L+
Sbjct  18    DERRWVIQIRNTFEEEAEEGVRIPVSVFSVPKTLLSTKPEAYVPQLFALGPYHHWHPQLY  77

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL  AK  QKQL+ +KL    E     E +IR  Y + L+L  ETLAWMM +D S
Sbjct  78    EMERYKLATAKRTQKQLQNLKLEQAVEHFTGREHKIRSHYHRHLDLSGETLAWMMVIDGS  137

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+ Y+  E K    + S  MSH+VD    K  +N++LRDI+MLENQIP  ++RK+
Sbjct  138   FLLEFLRNYSDAERKPFRKVPS--MSHMVDAARMKLVYNSILRDIVMLENQIPLHLVRKI  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPEME-  1244
             L+ Q  S + +D+ L TML+G  KE+ PFK  +  + +      HLL  L+  IVP++  
Sbjct  196   LRFQRTSNQIADNELSTMLIGFVKEVCPFKVMDNLSSIDTKRYAHLLQLLYFVIVPKVRE  255

Query  1243  -SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSS  1067
              SE  EIE   +     ++        ++  YVK+ F  VW          A  LK L+ 
Sbjct  256   GSETNEIEHHLDVPKSNEETPP-----EDPSYVKNLFNSVWS--------SASGLKILNV  302

Query  1066  L--APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEE  893
             L   P+  ++ +PWK I+ LPG++++  PI +L       + DE S+ +++ +KPP +EE
Sbjct  303   LIKKPLVFLVKVPWKIISHLPGISILAAPIVNLLF-----NRDEKSEDEESGNKPPLVEE  357

Query  892   ITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACI  713
             I IPSVTEL  AGV+F PT+  + +I FD KT TL+LP V+LD+N+EV+LRNLVAYE  +
Sbjct  358   IMIPSVTELTKAGVKFSPTRGDLTTIAFDVKTATLHLPTVSLDVNTEVLLRNLVAYETSV  417

Query  712   AKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVA  533
               GP+V  RYTE +NGIVDT+EDVK LR+KGIILNR+K+D EVANLWNGM+KSVRLTKVA
Sbjct  418   ESGPMVFTRYTELINGIVDTEEDVKLLRQKGIILNRMKNDEEVANLWNGMSKSVRLTKVA  477

Query  532   FLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCS  353
             F+DK + DVNKFYN RW+VK+++FM++Y+FGSWQ LTLLA I+LL L  +Q+FCSVY+C 
Sbjct  478   FIDKVLVDVNKFYNSRWSVKSRKFMKTYVFGSWQILTLLAAILLLFLTCVQAFCSVYSCG  537

Query  352   RFFNDVTILG  323
               ++ VT  G
Sbjct  538   TRWSFVTDTG  547



>ref|XP_002269848.1| PREDICTED: putative UPF0481 protein At3g02645 [Vitis vinifera]
 emb|CBI36450.3| unnamed protein product [Vitis vinifera]
Length=583

 Score =   483 bits (1243),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 282/549 (51%), Positives = 373/549 (68%), Gaps = 18/549 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE  W   I++ L  ELEE++E+ V+IF VPKTLM   P+CYVPQ+V +GPYH+   EL+
Sbjct  28    DEKNWATQIREALNEELEEDSEVPVNIFNVPKTLMATKPDCYVPQQVGLGPYHHLQQELY  87

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+K+ AAK  +K L++    SL +++ + ESRIR  Y K L+   ETLA MM VDAS
Sbjct  88    EMERYKIAAAKRTKKHLQSENFESLIKQLNEHESRIRACYHKFLDFDGETLALMMLVDAS  147

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+VYA++E + +  +   K SHL+D    KS++N +LRD++M+ENQIP F+L+++
Sbjct  148   FLLEFLQVYAIREERALPRVFHRK-SHLLDYARTKSAYNEILRDMVMVENQIPLFVLKQV  206

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAV----VQIADATHLLGYLFQTIVPE  1250
             L+ Q  +P  +D +L +ML G  K L PF   G  V    +Q+ +  HLL +L+  IVP 
Sbjct  207   LEFQFSTPRQADGILCSMLAGFGKYLCPF---GIRVELSHIQVEEHAHLLDFLYYLIVPR  263

Query  1249  MESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGP-ARALKRL  1073
              +      EI E  G  E + GE +     S   K  F  +  +L KL +GP  R +K++
Sbjct  264   SKEPS---EIIEVAGENEPQQGEAEGSSGESSSAKGTFEVISKLLSKLTEGPIGRLIKKI  320

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDN------ADK  911
                  VK +L +P  A++K+PG +V+K P+ES+ S  ++ +  EN DS  N        K
Sbjct  321   IFSDAVKYILKLPNTAVSKIPGYSVLKKPVESVLSTHEEENESENVDSNSNSNSDSNTTK  380

Query  910   PPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLV  731
             PP +EEITIPSV+EL+ +GVRF+PT   I SI FDAK   LYLP ++LD N+EV LRNLV
Sbjct  381   PPLMEEITIPSVSELSESGVRFLPTNGSISSISFDAKMAKLYLPTISLDPNTEVTLRNLV  440

Query  730   AYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSV  551
             AYEA    GPLV+ARYTE MNGI+DT ED KFLRE+GIILNRLKSD EVANLWNGM+KS+
Sbjct  441   AYEASTGSGPLVIARYTELMNGIIDTKEDAKFLRERGIILNRLKSDEEVANLWNGMSKSI  500

Query  550   RLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFC  371
             RLTKV FLDK I+DVNK++  RW VK  + +  Y+FGSWQ LTLLA I +LLLMVLQ+FC
Sbjct  501   RLTKVPFLDKVIEDVNKYHGSRWQVKAGKVITRYVFGSWQLLTLLAIIAILLLMVLQAFC  560

Query  370   SVYTCSRFF  344
             SVY+CSR F
Sbjct  561   SVYSCSRIF  569



>ref|XP_004964692.1| PREDICTED: putative UPF0481 protein At3g02645-like [Setaria italica]
Length=590

 Score =   483 bits (1243),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 268/575 (47%), Positives = 365/575 (63%), Gaps = 43/575 (7%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenE------INVSIFGVPKTLMVYDPECYVPQRVAIGPYHY  1796
             DE +WV+ I+ +L+ +    ++      I VS+F VPK L V+ PE Y PQ +A+GPYH+
Sbjct  23    DEVRWVVQIRHSLQDDGAGGSDDDDDNGIPVSVFNVPKQLRVHKPEAYTPQFIALGPYHH  82

Query  1795  TNPELHEMERHKLDAAKIFQKQL--RTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLA  1622
               PEL+EMER+KL AA+  QK+L    +KL  L ++  ++E R+R  Y + L+   ETLA
Sbjct  83    WRPELYEMERYKLAAARRAQKRLCPAGLKLDGLVDQFKRLERRVRAHYHRYLDFNGETLA  142

Query  1621  WMMAVDASFLLEFLKVYAV---KEGKLMAA---MISAKMSHLVDLKGKKSSHNALLRDII  1460
             WMM VD +FLLEFL++YA     EG         +S++M HLVD  G+KS+HN +LRD++
Sbjct  143   WMMLVDGAFLLEFLQIYAFAADNEGDGSGRELRRVSSRMQHLVDFAGRKSAHNLILRDML  202

Query  1459  MLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHL  1283
             MLENQ+P F++R++L+PQC S   + +LL  M+ GL +EL PFK  E   V+ I    HL
Sbjct  203   MLENQVPLFLIRRILEPQCASAGEAGELLGRMVAGLMRELCPFKMMESFPVIDIGKHAHL  262

Query  1282  LGYLFQTIVPE---------------MESEHVEIEIdenggmkekkdgeedEFLKNSGYV  1148
             L  L+  ++P+                  +  +IE ++          E+ +      YV
Sbjct  263   LEVLYYILLPKPADDDSAAEADANGNFHDDGYDIE-EQPAAGSGGGGEEQRKPAAGCEYV  321

Query  1147  KSAFGQVWGILKKLNK--GPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESL  974
             K  F  VWGI+  LN   GP R + +     P++  +  PWK +  +PG+    G   S 
Sbjct  322   KQLFLAVWGIVSGLNNTAGPVRYVTK-----PIEFAIKAPWKMLAVVPGV----GSFVSG  372

Query  973   FSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTF  794
                   P  D ++ +     +PP IEEI IPSV+EL NAGV+F+PT   + ++ FDAKT 
Sbjct  373   DGSTTNPR-DPSTSAAGYLTRPPLIEEIMIPSVSELVNAGVKFLPTAGDLSTVSFDAKTA  431

Query  793   TLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGII  614
             T  LPVVTLD N+EVVLRNLVAYEA  A GPLVLARYTE MNGI+DT EDV  LR +G++
Sbjct  432   TFSLPVVTLDSNTEVVLRNLVAYEAAAASGPLVLARYTELMNGIIDTGEDVALLRRRGVV  491

Query  613   LNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSW  434
             LNR+KSD EVA LWNGM +SVRLTKVA +D+ +++VN++YN RW VKTKRFMR Y+F SW
Sbjct  492   LNRMKSDGEVAKLWNGMTRSVRLTKVASMDRAVEEVNRYYNSRWRVKTKRFMRKYVFSSW  551

Query  433   QFltllativllllmvLQSFCSVYTCSRFFNDVTI  329
             Q LT +A I++LLL  LQ+FCSVYTCSR+F  VT+
Sbjct  552   QLLTFVAAILMLLLTTLQAFCSVYTCSRWFGAVTV  586



>ref|XP_003621603.1| hypothetical protein MTR_7g017620 [Medicago truncatula]
 gb|AES77821.1| UPF0481 plant-like protein [Medicago truncatula]
Length=553

 Score =   481 bits (1238),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 261/541 (48%), Positives = 366/541 (68%), Gaps = 19/541 (4%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I+++L++EL+++ E  VSIF VPK L+  DP+ Y PQ++AIGPYH+   EL+
Sbjct  17    DELEWVIKIRESLDKELDDDIEFIVSIFNVPKPLLASDPDSYTPQQIAIGPYHFWRQELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EME +K+ + K FQ QL+++KL  + ++++++E +IR  Y K LN  VETL WMM VDAS
Sbjct  77    EMEIYKIASTKRFQSQLQSLKLEHIVDQLIRLEHKIRSCYHKYLNFNVETLMWMMVVDAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL++Y +++  ++ +  S++MSHL D  G+K  HNA+L+DI+MLENQIP FILRKM
Sbjct  137   FLLEFLQIYTIQDETMILSF-SSRMSHLFDYGGRKLGHNAILKDIVMLENQIPLFILRKM  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK---NEGSAVVQIADATHLLGYLFQTIVPEM  1247
             L+ +  S E +DD+L+ M +GL KE+SPFK   ++ S +V +++  HLL +L+  IVP++
Sbjct  196   LEFKFTSLELADDMLILMFIGLYKEISPFKVMEHDYSDIV-VSECAHLLDFLYNMIVPKL  254

Query  1246  ESEH---VEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             + +    VE+E             +E  ++K   YVK    +V  +  KL        K+
Sbjct  255   DEQSDLVVELE-----NQHNDNVDDEKSYMK---YVKKFLCEVCRLFSKLKTILISLFKK  306

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIE  896
             L     +K    +PW  I+ LPG+ ++K P+E      +K      +D  +N+     I+
Sbjct  307   LKQCRAIKVFTWLPWAIISNLPGMGIIKQPVEYFLFSKEKETTKAENDITNNS---LLID  363

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EI IPSV EL+ +GV F+ TK  I +I FD KT TLYLP + LDIN+EV +RNLVAYEA 
Sbjct  364   EIAIPSVLELSKSGVSFVATKGDISTIWFDVKTTTLYLPTIGLDINTEVFMRNLVAYEAS  423

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
              + GPLV ARYTE MNGI+DT+ED + LREKG+ILN LKSD EVANLWNGMNKS++LT+V
Sbjct  424   TSSGPLVFARYTELMNGIIDTEEDARILREKGVILNHLKSDQEVANLWNGMNKSIKLTRV  483

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
              FLDK I+DVN+ YN   ++K  +FM+ Y+F SWQFLT LA + LL LM LQ FCS Y C
Sbjct  484   PFLDKVIEDVNQHYNGNVSIKVWKFMKVYVFSSWQFLTFLAVVFLLFLMSLQVFCSFYRC  543

Query  355   S  353
             +
Sbjct  544   N  544



>ref|XP_004158823.1| PREDICTED: putative UPF0481 protein At3g02645-like [Cucumis sativus]
Length=560

 Score =   481 bits (1237),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 276/558 (49%), Positives = 368/558 (66%), Gaps = 26/558 (5%)
 Frame = -3

Query  1969  NIQNDESKWVIHI-QKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             N   DE +WVI I Q   E ELEE+  I V IF VPK+LMV DP+ Y+PQ VAIGPYH+ 
Sbjct  21    NSDFDEERWVIQIRQSLDEEELEEDTGIPVCIFNVPKSLMVIDPDSYIPQEVAIGPYHHW  80

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
               EL+EMER+K+ AAK  QKQL+++K H L E++ K E + R  Y K LN   ET AWMM
Sbjct  81    RQELYEMERYKIAAAKRAQKQLQSLKFHDLVEKLTKHEQKTRACYHKYLNFNSETFAWMM  140

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
             AVDASFLLE L+VY  +E  + +                 S+HNA+LRDI+MLENQIP F
Sbjct  141   AVDASFLLEVLRVYTREETSISS-----------------SAHNAILRDIVMLENQIPLF  183

Query  1432  ILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAV---VQIADATHLLGYLFQT  1262
             +LRKML+ Q  + E +D LLL+ML+GL + LSPFK     V   V +++  HLL +L++ 
Sbjct  184   VLRKMLELQFSAVEPADQLLLSMLLGLYEHLSPFKVMEDLVELQVSVSECFHLLDFLYRI  243

Query  1261  IVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARAL  1082
             I P++ ++ +E   D+    +   +  E  F      + S   ++W IL KLNKGP    
Sbjct  244   ITPKL-ADTLETMEDDQNQQEPAIEIVESTFKHPCSPLSSLGSEIWKILSKLNKGPVHLF  302

Query  1081  KRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSC--GQKPDGDE--NSDSKDNAD  914
             KR++   P+  +  +PW  ++ +PG+ ++  P+E +FS   G++ +  E   S  KD   
Sbjct  303   KRIAGSRPLLVIFKLPWTIVSNIPGIGILMKPLEYIFSLKKGEEENDPEKGGSSRKDGKI  362

Query  913   KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNL  734
             + P +EEITIPSV+EL  +GV F+P   G+ +I FD+K     LP + LD+NSEVVLRNL
Sbjct  363   RLPLLEEITIPSVSELTKSGVLFLPIGGGVSAIAFDSKAVIFNLPTIKLDVNSEVVLRNL  422

Query  733   VAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS  554
             VAYEA  + GPLV  R+ E MNGI+D++EDVK LREKGIILN LKSD+EVA LWNGM+KS
Sbjct  423   VAYEASKSSGPLVFTRFIELMNGIIDSEEDVKLLREKGIILNHLKSDAEVAELWNGMSKS  482

Query  553   VRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSF  374
             ++LTKV FLDK I+DVNK Y+ RW VK  +F+  Y+FGSW  L LLATI+LL +  LQ+F
Sbjct  483   IKLTKVPFLDKVIEDVNKHYSNRWKVKAAKFVEKYVFGSWPLLALLATILLLAMNALQAF  542

Query  373   CSVYTCSRFFNDVTILGT  320
             CSVY+CSRFFN ++  GT
Sbjct  543   CSVYSCSRFFNHLSTAGT  560



>ref|XP_011045247.1| PREDICTED: putative UPF0481 protein At3g02645 [Populus euphratica]
Length=544

 Score =   480 bits (1235),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 264/542 (49%), Positives = 373/542 (69%), Gaps = 21/542 (4%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee-nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +WV ++++T+E +  E+ +E ++SIF VPK LM  DP+ Y PQ++++GPYH++  EL
Sbjct  18    DELQWVTNVRRTIEADHLEDDSETSISIFNVPKALMSTDPDSYAPQQLSLGPYHFSRLEL  77

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             H+M+ +K  AAK  Q  ++++K   L E++MK+ES+IR  Y+K LNL  ETLAWMMA+DA
Sbjct  78    HDMDTYKFSAAKRSQDLIQSLKFEDLVEQLMKLESKIRACYNKYLNLNSETLAWMMAIDA  137

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLEFL+VYA+++ K+++  +S++M H ++   +KSS NA+LRDI+MLENQIP F LRK
Sbjct  138   SFLLEFLQVYALRDPKMLSE-VSSRMPHFLEYSYRKSSCNAILRDIVMLENQIPLFTLRK  196

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGS-AVVQIADATHLLGYLFQTIVPEME  1244
             +L+ +  S E++DD+L +MLMG  KELSPFK      V ++++  HLL +L+  IVP++E
Sbjct  197   VLEFRSMSLESADDMLYSMLMGSCKELSPFKTMVRLPVARVSEHAHLLDFLYHVIVPKVE  256

Query  1243  SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
                  +EI E      K   E +E    S  +K    ++W +   LN  PAR L +L  +
Sbjct  257   ES---VEIPEEVEDHTKATEENEEPSVGSTRMKQRLIEIWNLFSNLNIDPARFLNKLPLV  313

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSK-DNADKPPSIEEIT  887
             A    +  +PW   + + G           F   ++PD    S S   + D PP +EEIT
Sbjct  314   A---VIFKLPWSIFSNVLG-----------FGSAKQPDAFSESQSVCSSIDHPPLVEEIT  359

Query  886   IPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAK  707
             IPSVT+L+  GVRF+P+K  I +I FD KT T YLP V+LD+NS+VVLRNLVAYEA  A 
Sbjct  360   IPSVTQLSKCGVRFVPSKGSISTINFDKKTCTFYLPTVSLDVNSDVVLRNLVAYEASNAS  419

Query  706   GPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFL  527
             GP+V  RYTE MNGI+DT+ED K LRE+GIILN LK+D EVAN+WNGM++S+RLTKV F+
Sbjct  420   GPMVFTRYTELMNGIIDTEEDAKILRERGIILNHLKNDEEVANVWNGMSRSIRLTKVPFM  479

Query  526   DKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRF  347
             DK I+DVNK+++  + VK ++FM+ Y+F SW+ L LLA+IV LLL  LQ+ CSVY C+R 
Sbjct  480   DKVIEDVNKYHDGLFKVKVEKFMKQYVFSSWKLLVLLASIVFLLLACLQALCSVYDCARL  539

Query  346   FN  341
             F+
Sbjct  540   FH  541



>ref|NP_001056969.1| Os06g0179500 [Oryza sativa Japonica Group]
 dbj|BAC22241.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza 
sativa Japonica Group]
 dbj|BAF18883.1| Os06g0179500 [Oryza sativa Japonica Group]
Length=586

 Score =   481 bits (1238),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 272/569 (48%), Positives = 363/569 (64%), Gaps = 31/569 (5%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEIN---VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNP  1787
             DE +WVI I+++L+ +  ++++ N   VS+F VPK L  + PE YVPQ +A+GPYH+  P
Sbjct  19    DELRWVIQIRRSLQEDGGDDDDDNGIPVSVFNVPKQLQAHKPEAYVPQFIALGPYHHWRP  78

Query  1786  ELHEMERHKLDAAKIFQKQLR-TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMA  1610
             EL+EMER+KL AA+  Q+ LR  +KL  L E+  + E ++R  Y + L+   ETLAWMM 
Sbjct  79    ELYEMERYKLAAARRAQRHLREGVKLEHLVEQFARAERKVRAHYHRYLDFSGETLAWMMV  138

Query  1609  VDASFLLEFLKVYAVKEGKLMAAM-------ISAKMSHLVDLKGKKSSHNALLRDIIMLE  1451
             VD +FLLEFL+++A  E              +S++M+HLVD  G+KS+HN +LRD++MLE
Sbjct  139   VDGAFLLEFLQIFAAAEAAASGGGGKPELRRVSSRMAHLVDFAGRKSAHNLILRDMLMLE  198

Query  1450  NQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGY  1274
             NQIP F+LRK+L+PQC S E + +LL  M+ GL KEL PFK  +    + +A   HLL  
Sbjct  199   NQIPLFLLRKLLEPQCSSAEEASELLGRMVTGLMKELCPFKMMDNFPAIDVAKHAHLLEL  258

Query  1273  LFQTIVPE-------MESEHVE-IEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGI  1118
             L+  +VP+           H E  +I+E         GEE +      YVK     VWGI
Sbjct  259   LYHLLVPKPSDDAAAAADGHDEGYDIEEQPVDGGGGGGEEKQQSAGCEYVKQLLAAVWGI  318

Query  1117  LKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLF-----SCGQKP  953
             +  L  GP + + +     P+   +  PWK +T +PG + MK P+ES F           
Sbjct  319   VSSLKSGPMQYVAK-----PISFAVKAPWKMLTVVPGFSAMKHPVESFFMSGGGGDPSSS  373

Query  952   DGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVV  773
                   D      +PP IEEI IPSVTELA AGV+F PT     ++ FDAKT TL+LPVV
Sbjct  374   STAAGQDHHHAISRPPLIEEIMIPSVTELAAAGVQFAPTNGDATTVSFDAKTATLHLPVV  433

Query  772   TLD-INSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKS  596
             TLD   +EVVLRNLVAYEA  A GPLVLARYTE MNGI+DT EDV  LR +G++LNR+KS
Sbjct  434   TLDGSTTEVVLRNLVAYEASAATGPLVLARYTELMNGIIDTGEDVAALRRRGVVLNRMKS  493

Query  595   DSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltll  416
             D E A LWNGM++SVRLTKVA +D  ++ VN+++  RW VK +RFMR Y+FGSWQ LT L
Sbjct  494   DGEAARLWNGMSRSVRLTKVAAMDAAVEGVNRYHGARWRVKARRFMRRYVFGSWQLLTFL  553

Query  415   ativllllmvLQSFCSVYTCSRFFNDVTI  329
             A +++LLL  LQ+FCSVYTCSR+F  V +
Sbjct  554   AAVLMLLLTTLQAFCSVYTCSRWFGAVAV  582



>ref|XP_010904996.1| PREDICTED: putative UPF0481 protein At3g02645 [Elaeis guineensis]
Length=568

 Score =   480 bits (1236),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 266/548 (49%), Positives = 368/548 (67%), Gaps = 19/548 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I+ T + E EE+  I VS+F VPKTL+   PE YVPQ  A+GPYH+  P+L+
Sbjct  18    DERRWVIQIRNTFDEEDEEDVRIPVSVFSVPKTLLSTKPEAYVPQLFALGPYHHWYPQLY  77

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL  AK  QKQL+ +KL    E +M+ E +IR  Y + L+L  E LAWMM +D S
Sbjct  78    EMERYKLATAKRTQKQLQKLKLEQAVEHLMRKEHKIRSHYHRHLDLSGEALAWMMVIDGS  137

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+ Y+  EGK    + S  MSH+VD    K ++N++LRDI+MLENQIP  ++RK+
Sbjct  138   FLLEFLRNYSDAEGKAFRKVPS--MSHMVDAARMKLAYNSILRDIVMLENQIPLNLVRKI  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L+ Q  S + +D  L TML+G  KE+ PFK  +  + +      HLL  L+  IVP+++ 
Sbjct  196   LRFQSISNQIADSELSTMLIGFVKEVCPFKVMDNLSSIDTKRYAHLLQLLYFVIVPKVKE  255

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
             E    EI+ +  + E  + +      +  YVK  F  VW    +LN      +  +    
Sbjct  256   ESGTNEIEHHVDVPESNEDQAPA---DPSYVKKLFNSVWSSASRLN------IMNVFIKG  306

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIP  881
             P K ++ +PWK I+ LPG++++  PI +LF      + DE  + +++ +KPP +EEI IP
Sbjct  307   PFKFLVKVPWKIISHLPGISILAAPIGNLFF-----NRDEKEEDEESGNKPPLVEEIMIP  361

Query  880   SVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGP  701
             SVTEL  AGV+F PT+  + +I FD KT TL LP V+LDIN+EV+LRNLVAYE  +  GP
Sbjct  362   SVTELTKAGVKFSPTRGDLTTIAFDVKTATLRLPTVSLDINTEVLLRNLVAYETSVESGP  421

Query  700   LVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDK  521
             +V  RYTE +NGI+DT+EDVK LR+KGIILNR+K+D EVA LWNGM+KSVRLTKVAF+DK
Sbjct  422   MVFTRYTELINGIIDTEEDVKLLRQKGIILNRMKNDEEVAKLWNGMSKSVRLTKVAFIDK  481

Query  520   TIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFN  341
              + DVNKFYN RW+VK+++FM++ +FGSWQ LTLLA ++LL +  +++FCSVY+    ++
Sbjct  482   VLVDVNKFYNSRWSVKSRKFMKNCVFGSWQILTLLAALLLLFMTCVEAFCSVYSRGTRWS  541

Query  340   DVTILGTN  317
              VT  GTN
Sbjct  542   FVT--GTN  547



>gb|KCW70771.1| hypothetical protein EUGRSUZ_F03931 [Eucalyptus grandis]
Length=511

 Score =   478 bits (1230),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 275/543 (51%), Positives = 363/543 (67%), Gaps = 60/543 (11%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE++WVI I+  LE ELE+E E+ VSIF VP+ LM  DPE Y PQ+VAIGPYH+  PE++
Sbjct  19    DENQWVIQIRWALEEELEDETEVPVSIFSVPRVLMSSDPELYTPQQVAIGPYHHWRPEMY  78

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL AAK  QKQL+ IK+H+L E++ K+E R R  Y K L+ + ETLAWMMA+DAS
Sbjct  79    EMERYKLAAAKRSQKQLQKIKIHNLVEQLEKLELRTRACYHKYLDFKGETLAWMMAIDAS  138

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+VYA+KEG  M + +S++MSHLVD  G+KS+HNA+L+DI +             
Sbjct  139   FLLEFLRVYAIKEGT-MLSRVSSRMSHLVDYTGRKSAHNAILKDIAL-------------  184

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQTIVPEMESE  1238
               P+                                +Q++   HLL +L++TIVP+++ E
Sbjct  185   --PK--------------------------------IQVSVCAHLLDFLYETIVPKVQ-E  209

Query  1237  HVEIEIdenggmkekkdgeedEFLKNSGYVKSAF---GQVWGILKKLNKGPARALKRLSS  1067
               EI  +E     E++   E       G  KS +    Q+W +L KL KGP   +KRL  
Sbjct  210   QPEIVEEEGEEEGEEEGDNE----DKEGKAKSPWPLCDQIWNLLSKLIKGPIETVKRLL-  264

Query  1066  LAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDG-DENSDSKDNADKPPSIEEI  890
             L+    VL +P   ++K+P L+V+  P+ESL S   K +G  EN +S  N  +PPS+EEI
Sbjct  265   LSNRAKVLKLPLTILSKIPLLSVLAQPLESLISSQVKEEGMSENENS--NPHEPPSVEEI  322

Query  889   TIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIA  710
             TIPSV++L+N GVRF+ TK  + SI FDAK  TLYLP +TLD++SEV +RNLVAYEA  A
Sbjct  323   TIPSVSDLSNVGVRFVSTKGNLSSISFDAKLATLYLPAITLDVSSEVFMRNLVAYEASNA  382

Query  709   KGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAF  530
              GPLV  RYTE MNGI+DT EDVK LRE+G+ILN+LKSD EVA LWNGM++S+RLTKV F
Sbjct  383   TGPLVFTRYTELMNGIIDTSEDVKLLRERGVILNQLKSDEEVAKLWNGMSRSIRLTKVPF  442

Query  529   LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
             LDK I+DVNK+YN RW VK  +F + Y+   W+FL +LA IV+L+L  LQ+FCSVY+CSR
Sbjct  443   LDKAIEDVNKYYNGRWKVKLSKFTKQYVLSPWKFLAVLAGIVVLMLFTLQAFCSVYSCSR  502

Query  349   FFN  341
              F+
Sbjct  503   VFH  505



>ref|XP_011084562.1| PREDICTED: putative UPF0481 protein At3g02645 [Sesamum indicum]
Length=564

 Score =   480 bits (1235),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 278/551 (50%), Positives = 374/551 (68%), Gaps = 26/551 (5%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             +E++WVIHI++ LE ELEEE E  +SIF VPK L+   P+ ++PQ+V+IGPYHYT PE+H
Sbjct  17    NENQWVIHIRRALEEELEEETETPLSIFTVPKPLVAIRPDSFIPQQVSIGPYHYTRPEIH  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL AA+  QK  + +KL  L + ++  E  IR  Y+K LN   ETLAWMMAVDAS
Sbjct  77    EMERYKLAAARRNQKDYQNLKLQGLVDRLLGFERGIRACYNKYLNFNGETLAWMMAVDAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMI--SAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
             FL EFL+V AVK GK  A +   S+++S+LV L G K++HNA+LRDI MLENQIP F+LR
Sbjct  137   FLFEFLQVCAVKHGKETATINVGSSRLSYLVRLAGNKAAHNAILRDISMLENQIPLFVLR  196

Query  1423  KMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQTIVPEME  1244
             K+L+ Q  S E  D+ L  ML+GL +ELSPFK     +  + D  HLL  L+   VP++E
Sbjct  197   KLLELQFSSSEKGDETLSCMLIGLCEELSPFK-MVEDLPNVRDLAHLLDVLYHFCVPKLE  255

Query  1243  S----------EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLN-KG  1097
                        E V++E ++ G  + +   ++D   K                K LN   
Sbjct  256   GYSYMTTGSVQEVVQLEEEDRGADEHQATSDDDHDEKEHKVCT----------KVLNFDA  305

Query  1096  PARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLF-SCGQKPDGDENSDSKDN  920
             P   +K++    P+K ++ +PW  ++ LP L ++K P+E+ F S  +  + +E+  ++++
Sbjct  306   PLNFIKKIVFSKPMKVIVKLPWIILSSLPMLKLIKEPVENFFTSLDEDQESNEDKSTQNS  365

Query  919   A-DKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVL  743
               +KPP +EEI IPSVTEL  AGV F  T+ GI +I FD K   LYLP ++LDINSEVVL
Sbjct  366   IINKPPLLEEIKIPSVTELTEAGVHFEATEGGISTITFDNKNVVLYLPTISLDINSEVVL  425

Query  742   RNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGM  563
             RNLVAYEAC   GPLVLARY E MNGI+DT+ED KFLRE+GII NRLKSD EVANLWNGM
Sbjct  426   RNLVAYEACNVSGPLVLARYVELMNGIIDTEEDAKFLRERGIIKNRLKSDEEVANLWNGM  485

Query  562   NKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvL  383
             +KS+RLTKV +LDK I+DVNK+++  W VK +  M+ Y+F SW+FLT LA +++LLL+ L
Sbjct  486   SKSIRLTKVPYLDKVIEDVNKYHSGMWKVKCENCMKKYVFRSWRFLTFLAALLMLLLLAL  545

Query  382   QSFCSVYTCSR  350
             Q+FCSVY C+R
Sbjct  546   QAFCSVYNCAR  556



>gb|KDO43083.1| hypothetical protein CISIN_1g048792mg [Citrus sinensis]
Length=535

 Score =   478 bits (1231),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 271/544 (50%), Positives = 358/544 (66%), Gaps = 30/544 (6%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DES+W+  ++  L+  L  + ++  SIF VPKTLM  DP+ Y PQ++AIGPYHY  P L+
Sbjct  5     DESQWIDSVRGILKNGLGIDTDLRPSIFTVPKTLMSSDPDSYTPQQLAIGPYHYWRPGLY  64

Query  1777  EMERHKLDAA-KIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             EMER+KL AA +     L   K   + +++ K   RIR  Y K L +  E LAWMMA+DA
Sbjct  65    EMERYKLAAAIRAETYLLGNHKFEYVVDQLEKHVLRIRACYQKVLPISNEALAWMMAIDA  124

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLEFL VYA+KEGK+     S  MSHL    G K++ N +LRD++MLENQIP F+LRK
Sbjct  125   SFLLEFLMVYAMKEGKVTTTYPSKSMSHL---SGTKAALNTILRDLVMLENQIPLFVLRK  181

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEME  1244
             ML+ +  S EA+D++L  MLMG  KELSPF+  + + V+ +++  HLL YL+ TIVP  +
Sbjct  182   MLEVEYSSLEAADEMLQAMLMGFCKELSPFEMMKDTPVINVSECQHLLDYLYDTIVPNAQ  241

Query  1243  SEHVEIEIdenggmkekkdgeedEF----LKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
                VEI +       E K+    E       +  YVK  F  +W  L K+N      +KR
Sbjct  242   ETKVEITVVVEDQSGEAKESVTIEIDAAAAGDPTYVKKLFSLIWKYLSKVN-----FVKR  296

Query  1075  LSSLAPVKTVLLMPWKAITK-LPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSI  899
             L            PW  ++K LPG++++   I+ +       +G E SD   + +KPP +
Sbjct  297   L------------PWGKLSKALPGISLIVQMIQQMIP---GKNGKEKSDDDSDMNKPPLM  341

Query  898   EEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEA  719
             EEITIPSVTELAN+ V F  T   I ++ FDAK  TL+LP ++ D+N+EV+LRNLVAYEA
Sbjct  342   EEITIPSVTELANSLVHFRATTGDISTVRFDAKKRTLHLPTISFDVNTEVILRNLVAYEA  401

Query  718   CIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTK  539
               A GPLV  RYTE MNGI+D++EDVK LREKGIILNRLKSD+EVANLWNGM+KS+RLTK
Sbjct  402   SYASGPLVFTRYTELMNGIIDSEEDVKLLREKGIILNRLKSDAEVANLWNGMSKSIRLTK  461

Query  538   VAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYT  359
             V  +DK I+ VNK+YN +WNVK ++ MR+Y+FGSW+ LT LA I LL L ++QSFCSVY 
Sbjct  462   VPHIDKAIEGVNKYYNRQWNVKFRKNMRAYVFGSWKCLTFLAAITLLFLTMVQSFCSVYN  521

Query  358   CSRF  347
             C +F
Sbjct  522   CRKF  525



>ref|XP_010904997.1| PREDICTED: putative UPF0481 protein At3g02645 [Elaeis guineensis]
Length=583

 Score =   480 bits (1235),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 267/552 (48%), Positives = 369/552 (67%), Gaps = 26/552 (5%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I  TLE E+EE   I VS+F VPK L+   PE Y+P+  A+GPYH+ +P+L+
Sbjct  49    DEGRWVIQICSTLEEEVEEGARIPVSVFSVPKILLSNKPEAYIPELFALGPYHHWHPQLY  108

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL  A+  QK+L++ KLH L E  +K E  IR  Y + L+   ETLAWMMA+DAS
Sbjct  109   EMERYKLATARRTQKKLQSTKLHQLVEYFIKKEHMIRSHYHRHLDFNGETLAWMMAIDAS  168

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+ Y+  EGK+   + +  MSH+VD +  K ++N +LRDI+MLENQIP F++RK+
Sbjct  169   FLLEFLRNYSEAEGKVFRRVPT--MSHMVDAERIKLAYNCILRDIMMLENQIPLFLVRKI  226

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPF---KNEGSAVVQIADATHLLGYLFQTIVPEM  1247
             L+ QCPS + +D  L  ML+G  K +SPF   KN  S  + +    H+L  L+  IVP+ 
Sbjct  227   LRFQCPSYQIADKDLSNMLIGFVKAVSPFEVMKNFPS--IDVKRYAHVLQLLYFMIVPKA  284

Query  1246  E--SEHV-EIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             +  SE + E E+  +     +        + N  YVK  F  VW     L       +  
Sbjct  285   KEGSETINETEVHVDIPELNETKP-----MGNPSYVKQLFNSVWSRASDLK------IME  333

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNAD-KPPSI  899
             + +  P+K +  +PWK I+KLPG++++  PI  LF       GDE S  +D+ D +PP +
Sbjct  334   VPATRPIKFLGKLPWKIISKLPGVSILTAPIAKLFFF----QGDEKSKDEDSTDDEPPLV  389

Query  898   EEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEA  719
             EEI IPSVTEL+ AGV+F PTK  + ++ F+++T T YLP V+LD+N+EV+LRNLVAYE 
Sbjct  390   EEIMIPSVTELSKAGVKFSPTKGDLTTVSFNSRTATFYLPAVSLDVNTEVLLRNLVAYET  449

Query  718   CIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTK  539
              +  GP+V  RYTE MNGI+DT+EDVK LR+ GIILNR+K+D EVA LWN M++SVRLTK
Sbjct  450   AVELGPMVFTRYTELMNGIIDTEEDVKLLRQSGIILNRMKNDEEVAKLWNAMSRSVRLTK  509

Query  538   VAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYT  359
             V F+DK + DVNKF++ RW+VK ++ M++Y+FGSWQ LT LA I+LLLL  +Q+FCSVY+
Sbjct  510   VGFIDKVLVDVNKFHSSRWSVKARKIMKTYVFGSWQILTFLAAILLLLLTCVQAFCSVYS  569

Query  358   CSRFFNDVTILG  323
             C   + +VT  G
Sbjct  570   CGSRWLNVTNAG  581



>dbj|BAJ91240.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=581

 Score =   479 bits (1234),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 274/565 (48%), Positives = 372/565 (66%), Gaps = 21/565 (4%)
 Frame = -3

Query  1957  DESKWVIHIQK--TlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE +WV+ I++  T + + E++N I VS+F VPK L+V+ PE YVPQ +A+GPYH+  PE
Sbjct  22    DELRWVVQIRESLTEDGDDEDDNGIPVSVFNVPKQLLVHKPEAYVPQFIALGPYHHWRPE  81

Query  1783  LHEMERHKLDAAKIFQKQLRT--IKLHSLAEEMM-KVESRIRLSYDKQLNLRVETLAWMM  1613
             L+EMER+KL AA+  Q++LR   +KL +L  E   ++E +IR  Y + L+    TL WMM
Sbjct  82    LYEMERYKLAAARRAQRRLRPAGLKLEALVAEFADRLERKIRAYYHRYLDFSGLTLTWMM  141

Query  1612  AVDASFLLEFLKVYAVKE--GKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIP  1439
              VD +FLLEFL++YAV E  GK     +S++M+HLVD  G+KS+H  +LRD++MLENQIP
Sbjct  142   VVDGAFLLEFLQIYAVAEDGGKPALRRVSSRMAHLVDFAGRKSAHGLILRDMLMLENQIP  201

Query  1438  FFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSA--VVQIADATHLLGYLFQ  1265
              F+LRK+L+PQC S + +  LL +M+ GL KEL PFK    A   V IA   HLL  L+ 
Sbjct  202   LFLLRKILEPQCASADEAGVLLTSMVTGLVKELCPFKMMDGAFPAVDIAKYAHLLELLYY  261

Query  1264  TIVPEMESE------HVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLN  1103
              +VP+  +E      H   E  +        DGE+      S YV   F  +WG+  KL 
Sbjct  262   LLVPKPPAEDTTAEAHDHGENYDIEEQPADGDGEDKPSGGGSEYVAQLFAALWGMASKLG  321

Query  1102  KGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDS-K  926
             KGP   + R     P+   +  PWK +T +PG++ MK P+ES F  G    GD +S S  
Sbjct  322   KGPLHYVMR-----PIAFAVKAPWKMLTVVPGMSGMKHPVESFFMSGADGRGDPSSSSTA  376

Query  925   DNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVV  746
              +  +PP IEEI +PSV+EL NAGV+   T   + +I FD  T TL+LPVVTLD N+EV+
Sbjct  377   GHLSRPPLIEEIMVPSVSELVNAGVQVAATTGDLSTICFDCNTATLHLPVVTLDSNTEVM  436

Query  745   LRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNG  566
             +RNLVAYE+  A GPLVL RYTE MNGI+DTD DV  LR++G++LNR+KSD EV  LWN 
Sbjct  437   IRNLVAYESSAASGPLVLTRYTELMNGIIDTDADVALLRQRGVVLNRMKSDGEVTKLWNS  496

Query  565   MNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmv  386
             M++S RLTKV  +D  ++ +N++Y+ RW VKTKRFMR Y+F SWQ LT LA I++L+L  
Sbjct  497   MSRSTRLTKVPAVDVAVEQMNRYYDGRWRVKTKRFMRRYVFSSWQLLTFLAAIMMLMLTT  556

Query  385   LQSFCSVYTCSRFFNDVTILGTNEQ  311
             LQ+FCSVYTCSR+F  VT+   + +
Sbjct  557   LQAFCSVYTCSRWFGSVTVTAASGE  581



>ref|XP_006465278.1| PREDICTED: putative UPF0481 protein At3g02645-like [Citrus sinensis]
Length=535

 Score =   478 bits (1229),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 275/548 (50%), Positives = 368/548 (67%), Gaps = 35/548 (6%)
 Frame = -3

Query  1966  IQN-DESKWVIHIQKTler-eleeenEINVSIFGVPKTLMVYDP-ECYVPQRVAIGPYHY  1796
             IQN DE +W+I+I++TLE  +LE E EI V IF VPKTLM  DP   Y PQ VAIGPYH+
Sbjct  6     IQNFDERQWIINIRRTLEEDQLENETEIPVCIFSVPKTLMSSDPVSLYTPQEVAIGPYHH  65

Query  1795  TNPELHEMERHKLDAAKIFQKQLR-TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAW  1619
               PELHEMER+KL AA+  Q+Q     KL  + +++ ++E +IR  Y K L    ETLAW
Sbjct  66    LRPELHEMERYKLAAARRAQRQFYGDHKLQCVVDQLKELEPQIRACYHKYLKFSSETLAW  125

Query  1618  MMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIP  1439
             MMA+DASFLLEFL++YA+K+ KL A   S  + HLVD  G K++HNA+LRD+ MLENQIP
Sbjct  126   MMAIDASFLLEFLQIYAMKDDKLPATSSSLSILHLVDYAGMKAAHNAILRDMSMLENQIP  185

Query  1438  FFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQT  1262
              F+LRKMLQ Q  S E++D LL  ML+G  +E+SPFK  +   ++Q ++  HLL YL+ T
Sbjct  186   IFVLRKMLQVQYSSSESADYLLQAMLIGFCEEVSPFKMKKYKPMIQASECAHLLDYLYNT  245

Query  1261  IVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARAL  1082
             IVP+ E       ID+                  S   K  F ++W +L K+       L
Sbjct  246   IVPKAEQRAAITGIDDQEIY--------------SDDSKRFFTELWKLLSKM------IL  285

Query  1081  KRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLF----SCGQKPDGDENSDSKDNAD  914
              R     P++ +  +P   ++K+PG +++  P+++L     + G K D  E S S  + +
Sbjct  286   SR-----PIQFLFKLPCFMLSKIPGFSILAQPVKNLIFPQDNEGNKSDA-ERSPSNKHMN  339

Query  913   KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNL  734
             KPP +EEITIPSVTELA + VRF+PT   I ++ FDAK   L+LP ++LD+N+E+VLRNL
Sbjct  340   KPPLVEEITIPSVTELAKSNVRFLPTVGDISTVSFDAKKAILHLPTISLDVNTELVLRNL  399

Query  733   VAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS  554
             VAYEA  A GPLVL RY+E MN I+DT+EDVK LRE G++LNRL+SD+EVA LWNG++KS
Sbjct  400   VAYEASNASGPLVLTRYSELMNRIIDTEEDVKLLRENGVVLNRLRSDAEVAKLWNGISKS  459

Query  553   VRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSF  374
             VRLTKV  +D  I+DVNK+YN RW VK  +  +  +FGSWQFLT +AT++LLLL  LQ+F
Sbjct  460   VRLTKVPHIDIVIEDVNKYYNSRWRVKCWKNKKLNVFGSWQFLTFMATVMLLLLTALQAF  519

Query  373   CSVYTCSR  350
             CS+Y C +
Sbjct  520   CSIYDCRK  527



>ref|XP_006427507.1| hypothetical protein CICLE_v10027418mg [Citrus clementina]
 gb|ESR40747.1| hypothetical protein CICLE_v10027418mg [Citrus clementina]
Length=535

 Score =   476 bits (1225),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 273/548 (50%), Positives = 368/548 (67%), Gaps = 35/548 (6%)
 Frame = -3

Query  1966  IQN-DESKWVIHIQKTler-eleeenEINVSIFGVPKTLMVYDP-ECYVPQRVAIGPYHY  1796
             IQN DE +W+I+I++TLE  +LE E EI V IF VPKTLM  DP   Y PQ VAIGPYH+
Sbjct  6     IQNFDERQWIINIRRTLEEDQLENETEIPVCIFSVPKTLMSSDPVSLYTPQEVAIGPYHH  65

Query  1795  TNPELHEMERHKLDAAKIFQKQLR-TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAW  1619
               PEL+EMER+KL AA+  Q+Q     KL  + +++ ++E +IR  Y K L    ETLAW
Sbjct  66    LRPELYEMERYKLAAARRAQRQFYGEHKLQCVVDQLKELEPQIRACYHKYLKFSSETLAW  125

Query  1618  MMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIP  1439
             MM +DASFLLEFL++YA+K+ KL A   S  +SHLVD  G K++HNA+LRD+ MLENQIP
Sbjct  126   MMTIDASFLLEFLQIYAMKDDKLPATSSSLSISHLVDYAGMKAAHNAILRDMSMLENQIP  185

Query  1438  FFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQT  1262
              F+LRKMLQ Q  S E++D LL  ML+G  + +SPFK  +   ++Q +++ HLL YL+ T
Sbjct  186   LFVLRKMLQVQYSSSESTDYLLQAMLIGFCEGVSPFKMKKNKPMIQASESAHLLDYLYNT  245

Query  1261  IVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARAL  1082
             IVP+ E       ID+                  S   K  F ++W +L K+N      L
Sbjct  246   IVPKAEQRAAITGIDDQEIY--------------SDDSKRFFTELWKLLSKMN------L  285

Query  1081  KRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLF----SCGQKPDGDENSDSKDNAD  914
              R     P+K +  +P   ++K+PG +++  P+E+L     + G K D  E S S  + +
Sbjct  286   SR-----PIKFLFKLPCFMLSKIPGFSILAQPVENLIFPQDNEGNKSDA-ERSPSNKHMN  339

Query  913   KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNL  734
             KPP +EEITIPSVTELA + VRF+PT   I ++ FDAK   L+LP ++LD+N+E VLRNL
Sbjct  340   KPPLVEEITIPSVTELAKSNVRFLPTVGDISTVSFDAKKAILHLPTISLDVNTEFVLRNL  399

Query  733   VAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS  554
             VAYEA  A GPLVL RY+E MN I+DT++DV+ LRE G++LNRL+SD+EVA LWNG++KS
Sbjct  400   VAYEASNASGPLVLTRYSELMNRIIDTEKDVELLRENGVVLNRLRSDAEVAKLWNGISKS  459

Query  553   VRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSF  374
             +RLTKV  +D  I+DVNK+YN RW VK  +  +  +FGSWQFLT +AT++LLLL  LQ+F
Sbjct  460   IRLTKVPHIDIVIEDVNKYYNSRWRVKCWKNKKLNVFGSWQFLTFMATVMLLLLTALQAF  519

Query  373   CSVYTCSR  350
             CS+Y C +
Sbjct  520   CSIYDCRK  527



>dbj|BAJ94025.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=581

 Score =   477 bits (1227),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 273/565 (48%), Positives = 371/565 (66%), Gaps = 21/565 (4%)
 Frame = -3

Query  1957  DESKWVIHIQK--TlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE +WV+ I++  T + + E++N I VS+F VPK L+V+ PE YVPQ +A+GPYH+  PE
Sbjct  22    DELRWVVQIRESLTEDGDDEDDNGIPVSVFNVPKQLLVHKPEAYVPQFIALGPYHHWRPE  81

Query  1783  LHEMERHKLDAAKIFQKQLRT--IKLHSLAEEMM-KVESRIRLSYDKQLNLRVETLAWMM  1613
             L+EMER+KL AA+  Q++LR   +KL +L  E   ++E +IR  Y + L+    TL WMM
Sbjct  82    LYEMERYKLAAARRAQRRLRPAGLKLEALVAEFADRLERKIRAYYHRYLDFSGLTLTWMM  141

Query  1612  AVDASFLLEFLKVYAVKE--GKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIP  1439
              VD +FLLEFL++YAV E  GK     +S++M+HLVD  G+KS+H  +LRD++MLENQIP
Sbjct  142   VVDGAFLLEFLQIYAVAEDGGKPALRRVSSRMAHLVDFAGRKSAHGLILRDMLMLENQIP  201

Query  1438  FFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSA--VVQIADATHLLGYLFQ  1265
              F+LRK+L+PQC S + +  LL +M+ GL KEL PFK    A   V IA   HLL  L+ 
Sbjct  202   LFLLRKILEPQCASADEAGVLLTSMVTGLVKELCPFKMMDGAFPAVDIAKYAHLLELLYY  261

Query  1264  TIVPEMESE------HVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLN  1103
              +VP+  +E      H   E  +        DGE+      S YV   F  +WG+  KL 
Sbjct  262   LLVPKPPAEDTTAEAHDHGENYDIEEQPADGDGEDKPSGGGSEYVAQLFAALWGMASKLG  321

Query  1102  KGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDS-K  926
             KGP   + R     P+   +  PWK +T +PG++ MK P+ES F  G    GD +S S  
Sbjct  322   KGPLHYVMR-----PIAFAVKAPWKMLTVVPGMSGMKHPVESFFMSGADGRGDPSSSSTA  376

Query  925   DNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVV  746
              +  +PP IEEI +PSV+EL NAGV+   T   + +I FD  T TL+LPVVTLD N+EV+
Sbjct  377   GHLSRPPLIEEIMVPSVSELVNAGVQVAATTGDLSTICFDCNTATLHLPVVTLDSNTEVM  436

Query  745   LRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNG  566
             +RNLVAYE+  A GPLVL RYTE M GI+DTD DV  LR++G++LNR+KSD EV  LWN 
Sbjct  437   IRNLVAYESSAASGPLVLTRYTELMKGIIDTDADVALLRQRGVVLNRMKSDGEVTKLWNS  496

Query  565   MNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmv  386
             M++S RLTKV  +D  ++ +N++Y+ RW VKTKRFMR Y+F SWQ LT LA I++L+L  
Sbjct  497   MSRSTRLTKVPAVDVAVEQMNRYYDGRWRVKTKRFMRRYVFSSWQLLTFLAAIMMLMLTT  556

Query  385   LQSFCSVYTCSRFFNDVTILGTNEQ  311
             LQ+FCSVYTCSR+F  VT+   + +
Sbjct  557   LQAFCSVYTCSRWFGAVTVTAASGE  581



>ref|XP_008228745.1| PREDICTED: putative UPF0481 protein At3g02645 isoform X3 [Prunus 
mume]
Length=497

 Score =   473 bits (1216),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 242/469 (52%), Positives = 325/469 (69%), Gaps = 5/469 (1%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             +E +WVI IQKTLE ELE++ EI VSIF VPK L+  +P+ Y+PQ VAIGPYHY  PEL+
Sbjct  17    NEFEWVIQIQKTLEEELEDDGEIPVSIFNVPKALLASEPDSYIPQEVAIGPYHYLRPELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+K+ AAK  QKQL+ +K   L E++ K+E RIR  Y K L+   +TL WMMA+ AS
Sbjct  77    EMERYKVAAAKRTQKQLQCLKFQDLVEQLKKLEPRIRACYHKYLDFNGDTLGWMMAIAAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             F LE L++Y  KEG+++   +S+ MSHLVD  G KS+H+A+LRD++MLENQIP F+ R++
Sbjct  137   FFLELLQIYGAKEGRVLTR-VSSSMSHLVDFSGSKSAHHAILRDLVMLENQIPLFVSRRI  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQTIVPEME  1244
             L+ Q  S E +DDLLL+MLMGL KELSPFK  ++    +Q+++  HLL +L+Q I P++E
Sbjct  196   LEFQFTSLEQADDLLLSMLMGLCKELSPFKVVDQDLPKIQVSECAHLLDFLYQMITPKLE  255

Query  1243  SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
                 EI ++     +            +  +VK    +VW +L KLN+GP R LK+L   
Sbjct  256   RRPSEI-VEAEDEGESTPHKGSKSSDDSPNFVKQFLQEVWKLLSKLNEGPVRLLKKLLVS  314

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGD-ENSDSKDNADKPPSIEEIT  887
              PVK +  +PW  ++ LPG  +++ P+  LFS   K + + EN +S ++  KPP IEEIT
Sbjct  315   GPVKVLFKLPWTILSNLPGFAMLRQPVSYLFSTQDKEETNPENENSSNSISKPPLIEEIT  374

Query  886   IPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAK  707
             IPSV++L  +GV F+ TK  + +I FD KT T YLP  +LD+N+EV+LRNLVAYE   A 
Sbjct  375   IPSVSDLVKSGVCFVKTKGSLSTISFDPKTVTFYLPATSLDVNTEVILRNLVAYEVSNAS  434

Query  706   GPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMN  560
             GPLV  RYTE MNGI+DT+EDVK LREKGIILN LKSD EVAN+WNG+ 
Sbjct  435   GPLVFTRYTELMNGIIDTEEDVKLLREKGIILNHLKSDEEVANVWNGVG  483



>ref|XP_006465280.1| PREDICTED: putative UPF0481 protein At3g02645-like [Citrus sinensis]
Length=709

 Score =   479 bits (1233),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 274/554 (49%), Positives = 363/554 (66%), Gaps = 31/554 (6%)
 Frame = -3

Query  1972  PNIQN-DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHY  1796
             P + N DES+W+  ++  L+  L  + ++  SIF VPKTLM  DP+ Y PQ++AIGPYHY
Sbjct  50    PKMSNFDESQWIDSVRGILKNGLGIDTDLRPSIFTVPKTLMSSDPDSYTPQQLAIGPYHY  109

Query  1795  TNPELHEMERHKLDAA-KIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAW  1619
               P L+EMER+KL AA +     L   K   + +++ K   RIR  Y K L +  E LAW
Sbjct  110   WRPGLYEMERYKLAAAIRAETYLLGNHKFEYVVDQLEKHVLRIRACYQKVLPISNEALAW  169

Query  1618  MMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIP  1439
             MMA+DASFLLEFL VYA+KEGK+     S  MSHL    G K++ N +LRD++MLENQIP
Sbjct  170   MMAIDASFLLEFLMVYAMKEGKVTTTYPSKSMSHL---SGTKAALNTILRDLVMLENQIP  226

Query  1438  FFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQT  1262
              F+LRKML+ +  S EA+D++L  MLMG  KELSPF+  + + V+ +++  HLL YL+ T
Sbjct  227   LFVLRKMLEVEYSSLEAADEMLQAMLMGFCKELSPFEMMKDTPVINVSECQHLLDYLYDT  286

Query  1261  IVPEMESEHVEIEIdenggmkekkdgeedEF----LKNSGYVKSAFGQVWGILKKLNKGP  1094
             IVP  +   VEI +       E K+    E       +  YVK  F  +W  L K+N   
Sbjct  287   IVPNAQETKVEITVVVEDQSGEAKESVTIEIDAAAAGDPTYVKKLFSLIWKYLSKVN---  343

Query  1093  ARALKRLSSLAPVKTVLLMPWKAITK-LPGLNVMKGPIESLFSCGQKPDGDENSDSKDNA  917
                +KRL            PW  ++K LPG++++   I+ +       +G E SD   + 
Sbjct  344   --FVKRL------------PWGKLSKALPGISLIVQMIQQM---NPGKNGKEKSDDDSDM  386

Query  916   DKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRN  737
             +KPP +EEITIPSVTELAN+ V F  T   I ++ FDAK  TL+LP ++ D+N+EV+LRN
Sbjct  387   NKPPLMEEITIPSVTELANSLVHFRATTGDISTVRFDAKKRTLHLPTISFDVNTEVILRN  446

Query  736   LVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNK  557
             LVAYEA  A GPLV  RYTE MNGI+D++EDVK LREKGIILNRLKSD+EVANLWNGM+K
Sbjct  447   LVAYEASYASGPLVFTRYTELMNGIIDSEEDVKLLREKGIILNRLKSDAEVANLWNGMSK  506

Query  556   SVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQS  377
             S+RLTKV  +DK I+ VNK+YN +WNVK ++ MR+Y+FGSW+ LT LA I LL L ++QS
Sbjct  507   SIRLTKVPHIDKAIEGVNKYYNRQWNVKFRKNMRAYVFGSWKCLTFLAAITLLFLTMVQS  566

Query  376   FCSVYTCSRFFNDV  335
             FCSVY C +F  D+
Sbjct  567   FCSVYNCRKFNFDL  580



>ref|XP_006373129.1| hypothetical protein POPTR_0017s08990g, partial [Populus trichocarpa]
 gb|ERP50926.1| hypothetical protein POPTR_0017s08990g, partial [Populus trichocarpa]
Length=553

 Score =   473 bits (1218),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 263/538 (49%), Positives = 363/538 (67%), Gaps = 17/538 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeen-EINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +WV  I++TLERELE++  +I V I+ VPKTLM   P+ Y P ++ +GPYHY  P+L
Sbjct  10    DEFQWVNTIRRTLERELEDDTDQIPVCIYTVPKTLMSSHPDFYTPHQLPLGPYHYWRPDL  69

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
              EME +KL A K  Q Q ++    +L E+++K+E +IR  Y   LNL  ETLAWMMA+DA
Sbjct  70    SEMESYKLSAVKKLQNQFQSDNFQNLVEKLVKLEPKIRACYHNYLNLNAETLAWMMALDA  129

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLEFL++Y+VKE +++   IS++M+HL+D   +KS+H  +LRDI+M+ENQIP F+LRK
Sbjct  130   SFLLEFLQIYSVKENEVLWT-ISSRMTHLLDYSKRKSAHYVILRDIVMMENQIPLFVLRK  188

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQTIVPEMES  1241
             +L+    S E++DD+L++ML+GL KELSPFK       ++ + +HLL  L+  +VP  E 
Sbjct  189   VLKFLLMSAESADDMLISMLLGLCKELSPFKMVELEKTKVLEHSHLLDSLYDIMVPREEE  248

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
               +EI I++    + +   E +    +   VKS   ++W    +LN GP R LK  S  A
Sbjct  249   LPIEITIEDVEANRSETVQENEGSGIDMNLVKSFLSELWNTASELNIGPMRFLKNAS--A  306

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIP  881
              + + L   W  ++KL  L+     IE            EN  +++N   PP +EEI IP
Sbjct  307   SMTSKLGFSWTILSKLLNLSASNYGIEP-----------ENESARNNQQLPPLVEEIAIP  355

Query  880   SVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGP  701
             SVT+L+N GVRF+PTK  I +I FD +    Y+P+++LD NSE + RNLVAYE   A GP
Sbjct  356   SVTQLSNTGVRFLPTKGNISTINFDTEKAAFYIPMISLDANSEFIFRNLVAYEISHASGP  415

Query  700   LVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMN--KSVRLTKVAFL  527
             ++ ARY E MNGI+DT+EDV+ LRE+GII N LKSD EVANLWNGM+  KS+RLTK  FL
Sbjct  416   MIFARYIELMNGIIDTEEDVRLLRERGIIFNHLKSDQEVANLWNGMSKCKSMRLTKAPFL  475

Query  526   DKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCS  353
             DK I+DVNK+YN RW VK ++FM+  +F SWQFLT+LA+I+LLLLM ++SFCSVY  S
Sbjct  476   DKVIEDVNKYYNSRWKVKIRKFMKHTVFCSWQFLTMLASILLLLLMAVESFCSVYKLS  533



>ref|XP_010905001.1| PREDICTED: putative UPF0481 protein At3g02645 [Elaeis guineensis]
Length=545

 Score =   473 bits (1217),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 259/545 (48%), Positives = 370/545 (68%), Gaps = 36/545 (7%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I  TLE E+EE+ +I VS+F VPKT +   PE Y+P+  A+GPYH+ +P+L+
Sbjct  15    DEHRWVIQICSTLEEEVEEDVQIPVSVFSVPKTWLSNKPEAYIPELFALGPYHHWHPQLY  74

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL  A+  QK+L++IKLH L E  +K E  IR  Y + L+   ETLAWMMA+DA 
Sbjct  75    EMERYKLATARRTQKKLQSIKLHQLVEYFIKKEHMIRSHYHRHLDFNGETLAWMMAIDAC  134

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FL EFL+ Y+  EGK+   + +  MSH+VD    K ++N +LRDI+MLENQIP +++RK+
Sbjct  135   FLFEFLRNYSNAEGKVFRKVTT--MSHMVDAARMKLAYNCILRDIMMLENQIPLYLVRKI  192

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPF---KNEGSAVVQIADATHLLGYLFQTIVPE-  1250
             L+ QCPS + +D+ L  ML+G  KE+SPF   KN  S  + + +  HLL  L+  IVP+ 
Sbjct  193   LRFQCPSYQIADEELSNMLIGFVKEVSPFEVMKNFSS--IDVKNYAHLLQLLYFMIVPKA  250

Query  1249  MES------EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPAR  1088
             MES        V ++I E    K          + N  YVK  F  VW       + P  
Sbjct  251   MESIGTINKTEVHVDIPELKETKP---------MCNPNYVKQLFSSVW------RQAPGL  295

Query  1087  ALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKP  908
              +  + +  P+K +  +PWK I++LPG++++   +E +FS      G++ S+ +D+ D+P
Sbjct  296   KVMEVLAKRPIKFLEKIPWKIISRLPGVSIL---VEKIFSF----QGEKKSEDEDSTDEP  348

Query  907   PSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVA  728
             P +E+I IPSVTEL+ AGV+F PT+  + +I F+++T T YLP V+LD+N+EV+LRNL+A
Sbjct  349   PLVEKIMIPSVTELSKAGVKFSPTEGDLTTIWFNSRTATFYLPTVSLDVNTEVLLRNLIA  408

Query  727   YEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVR  548
             YE  +  GP+V  RYTE MNGI+DT+EDVK LR+ GIILNR+K+D EVA LWNGM++SVR
Sbjct  409   YETTVELGPMVFTRYTELMNGIIDTEEDVKLLRQSGIILNRMKNDEEVAQLWNGMSRSVR  468

Query  547   LTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCS  368
             LTKV F+DK ++DVNKF++ RW+VK ++ M++Y+F +WQ LT LA I+LLLL  +Q++CS
Sbjct  469   LTKVGFIDKVLEDVNKFHSSRWSVKARKIMKTYVFEAWQILTFLAAILLLLLTCVQAYCS  528

Query  367   VYTCS  353
             VY C 
Sbjct  529   VYGCG  533



>ref|XP_006427515.1| hypothetical protein CICLE_v10025330mg [Citrus clementina]
 gb|ESR40755.1| hypothetical protein CICLE_v10025330mg [Citrus clementina]
Length=535

 Score =   472 bits (1214),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 266/544 (49%), Positives = 355/544 (65%), Gaps = 30/544 (6%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DES+W+  ++  L+  L  + ++  SIF VPKTLM  DP+ Y PQ++AIGPYHY  P L+
Sbjct  5     DESQWIDSVRGILKNGLGIDTDLRPSIFTVPKTLMSSDPDSYTPQQLAIGPYHYWRPGLY  64

Query  1777  EMERHKLDAA-KIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             EMER+KL AA +     L   K   + +++ K   RIR  Y K L +  E LAWMMA+DA
Sbjct  65    EMERYKLAAAIRAETYLLGNHKFEYVVDQLEKHVLRIRACYQKVLTISNEALAWMMAIDA  124

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLEFL VYA+KEGK+     S  MSHL    G K++ N +LRD++MLENQIP F+LRK
Sbjct  125   SFLLEFLMVYAMKEGKVTTTYPSKSMSHL---SGTKAALNTILRDLVMLENQIPLFVLRK  181

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEME  1244
             ML+ +  S EA+D++L  ML+G  +ELSPF   + + V+ +++  HLL YL+ TIVP  +
Sbjct  182   MLEVEYSSLEAADEMLQAMLIGFCEELSPFNMMKDTPVINVSECQHLLDYLYNTIVPNAQ  241

Query  1243  SEHVEIEIdenggmkekkdgeedEF----LKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
                VEI +       E K     E       +   VK  F  +W  L K+N      +KR
Sbjct  242   ETKVEITVVVEDQSGEAKQSATIEIDAAAAGDPTSVKKLFSLIWKYLSKVN-----FVKR  296

Query  1075  LSSLAPVKTVLLMPWKAITK-LPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSI  899
             L            PW  ++K LPG++++   I+ +       +G E SD   + +KPP +
Sbjct  297   L------------PWGKLSKALPGISLIVQMIQQMIP---GKNGKEKSDDDSDMNKPPLM  341

Query  898   EEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEA  719
             EEITIPSVTELA++ V F  T   I ++ FDAK  T++LP ++ D+N+EV+LRNLVAYEA
Sbjct  342   EEITIPSVTELADSLVHFTATTGDISTVRFDAKKRTIHLPTISFDVNTEVILRNLVAYEA  401

Query  718   CIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTK  539
               A GPLV  RYTE MNGI+D++EDVK LREKGIILNRLKSD+EVANLWNGM+KS+RLTK
Sbjct  402   SYASGPLVFTRYTELMNGIIDSEEDVKLLREKGIILNRLKSDAEVANLWNGMSKSIRLTK  461

Query  538   VAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYT  359
             V  +DK I+ VNK+YN +WNVK ++ MR+Y+FGSW+ LT LA I LL L ++QSFCSVY 
Sbjct  462   VPHIDKAIEGVNKYYNRQWNVKFRKNMRAYVFGSWKCLTFLAAITLLFLTMVQSFCSVYN  521

Query  358   CSRF  347
             C +F
Sbjct  522   CRKF  525



>ref|XP_011073607.1| PREDICTED: putative UPF0481 protein At3g02645 [Sesamum indicum]
Length=575

 Score =   472 bits (1214),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 266/553 (48%), Positives = 378/553 (68%), Gaps = 19/553 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE KWV  I+KTL+ E+EEE EI V+IF VPKTL + DP  Y PQ VAIGPYH+   EL+
Sbjct  17    DERKWVDEIRKTLDEEIEEETEIPVTIFAVPKTLFISDPNSYTPQEVAIGPYHHLRAELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             +ME +K+ AAK  Q +L+ +KL  +   + ++E +IR  Y + ++   E LAWMMAVD S
Sbjct  77    DMETYKVAAAKRNQGELKNLKLQHIVAHLSELELKIRACYHRPVSFGSEALAWMMAVDVS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FL EF +V  V++GK++   + ++++HL+ L G K++HNA+LRDI+MLENQIP F+++ +
Sbjct  137   FLFEFFEVCGVRKGKILTK-VPSRLAHLISLSGHKTTHNAILRDIMMLENQIPLFVIKML  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAV---VQIADATHLLGYLFQTIVP-E  1250
             L+ Q   P   D++L  MLM LS+E+SPFK   +A    +++ D  HLL +L++ IVP  
Sbjct  196   LKFQFSFP---DEVLFDMLMELSQEVSPFKMADAAAGRKIEVKDCAHLLDFLYRFIVPLP  252

Query  1249  MESE-----HVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARA  1085
             M+S+     +++++ +E GG +   +  +  F + S +++    ++W IL +L+  P R 
Sbjct  253   MKSDASDAANIDLQDEEEGGEQADHETSKTPFSEPS-HLRQLLSELWRILSRLSVRPMRL  311

Query  1084  LKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQ-----KPDGDENSDSKDN  920
             +KR+    PVK  + +PW  ++K+P + ++K P+E +F+  Q     K D  E+S +  N
Sbjct  312   IKRMIFSRPVKVFVKLPWTILSKIPVIKLLKEPVERVFTFFQQDKEKKGDEQESSSTSSN  371

Query  919   ADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLR  740
               K P +EEI IPSV +L+  GV+F+P  +GI SI+FDAKT T Y+P++ LD+NSEVVLR
Sbjct  372   TSKLPLLEEIKIPSVIQLSEVGVQFVPIHEGITSIKFDAKTLTFYIPIIKLDVNSEVVLR  431

Query  739   NLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMN  560
             NLVAYEAC A GPLVL RY E MNGI+DTD D +FL  K II+N LKS+ EVA+LWNGM+
Sbjct  432   NLVAYEACSASGPLVLTRYIELMNGIIDTDLDARFLCRKEIIINHLKSEKEVADLWNGMS  491

Query  559   KSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQ  380
             KS+RLTKV  LD  I +VN +Y  RW VK  RFM+ Y+F SW+ LT LATI+LL+LM LQ
Sbjct  492   KSIRLTKVPPLDDLIGEVNNYYKGRWKVKLGRFMKKYVFASWRILTFLATILLLMLMSLQ  551

Query  379   SFCSVYTCSRFFN  341
             +FC VY CSR F 
Sbjct  552   AFCQVYNCSRLFR  564



>ref|XP_010537915.1| PREDICTED: putative UPF0481 protein At3g02645 [Tarenaya hassleriana]
 ref|XP_010537916.1| PREDICTED: putative UPF0481 protein At3g02645 [Tarenaya hassleriana]
Length=550

 Score =   471 bits (1211),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 253/541 (47%), Positives = 361/541 (67%), Gaps = 18/541 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE++W+++++++L+ + E+++E+ V IF VPK LM   P+CY PQ+VAIGPYH   PEL+
Sbjct  17    DEARWLVNVRQSLDADFEDDSEVLVCIFHVPKALMYSHPDCYTPQQVAIGPYHCLRPELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL AA+  Q + +T K   L+E + ++E +IR  Y K +  + ETL+WMMAVDAS
Sbjct  77    EMERYKLLAARRIQSRFKTFKFLHLSERLQEMEPKIRACYHKYVEFKGETLSWMMAVDAS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+ Y + +GK ++  IS+ MSHLVD  G++S HN +LRDI+MLENQIP  +LRK 
Sbjct  137   FLLEFLQTYNITKGKTLSR-ISSGMSHLVDNAGRRSGHNEILRDILMLENQIPLLVLRKT  195

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L+ Q  S EA+DDLL ++L GLS+ELSP    E     +I +  H+L +++QTIVP+ME 
Sbjct  196   LELQLESVEAADDLLFSILTGLSRELSPLSTAEYLPSTRIQEYAHILDFMYQTIVPKMEE  255

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
             E  E+ I        + D   ++   NS             L++  +      K++    
Sbjct  256   E--ELGIVGEDEEDGENDHGREKASPNSR------------LREFLREIKLRFKKVFESR  301

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENS--DSKDNADKPPSIEEIT  887
             P   +L +PWK ++ LPG  V+K     LF+  +  +G  NS  +S  + +KPP  EEIT
Sbjct  302   PAGFILKLPWKILSNLPGFVVLKVSAGYLFTRQENEEGQGNSCPESSTDIEKPPLAEEIT  361

Query  886   IPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAK  707
             IPSV+EL  +GVRF PT   I +I FD+ +   YLPV+ LD+N+E++LRNLVAYEA    
Sbjct  362   IPSVSELYKSGVRFRPTNGNISTISFDSNSGLFYLPVINLDVNTEIILRNLVAYEASNTC  421

Query  706   GPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFL  527
             GPLV  RYTE +NGIVD+++DV+ LRE+GI++NRLKSD E ANLWNGM+KS+RLTKV FL
Sbjct  422   GPLVFTRYTELINGIVDSEDDVRLLREQGILMNRLKSDEEAANLWNGMSKSLRLTKVPFL  481

Query  526   DKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRF  347
             DKTI++VN++++ RW VK    +  Y++GSW+FL  +A +++LLL  LQ    VY  +R 
Sbjct  482   DKTIEEVNRYFSGRWRVKVGNLVELYVYGSWRFLAFVAAVLVLLLFSLQVLSLVYNSTRL  541

Query  346   F  344
              
Sbjct  542   L  542



>ref|XP_002304083.1| hypothetical protein POPTR_0003s01870g [Populus trichocarpa]
 gb|EEE79062.1| hypothetical protein POPTR_0003s01870g [Populus trichocarpa]
Length=544

 Score =   469 bits (1206),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 269/558 (48%), Positives = 372/558 (67%), Gaps = 38/558 (7%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEIN-VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +WVI+I + LE+ELEE+ + + V IF VPKTLM  DP  Y PQ++++GPYHY   +L
Sbjct  12    DEYQWVINIGRALEKELEEDCDESPVCIFTVPKTLMSSDPHSYTPQQLSLGPYHYRRADL  71

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             HEMER+KL AAK  Q QL++ +  +L E+++K+E +IR  Y K L+   ETLAWMMA+D 
Sbjct  72    HEMERYKLSAAKKLQNQLQSHRFENLVEQLIKLEPQIRACYHKYLDFNAETLAWMMALDV  131

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLEFL++Y+V+E K+++   S  MSHL+D   +KS+H+ +LRD++MLENQ+P FILRK
Sbjct  132   SFLLEFLQIYSVRETKMLSRAPSG-MSHLLDYSKRKSAHHVILRDMVMLENQVPQFILRK  190

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEME  1244
             +L+ Q  S E +D++LL+M++GL+KELSPFK  E     ++ + +HLL +L+  IVP++E
Sbjct  191   VLEFQYMSAELADEMLLSMVIGLAKELSPFKMIELPKTTEVLEHSHLLDFLYDIIVPKVE  250

Query  1243  S------EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARAL  1082
                    E V  +I+ +   +E++ G       +S YVK      W ++ +L   P R +
Sbjct  251   GPIEMVLEDVADQIESDNQQEEERSGV------DSSYVKQLLTVTWNMVSQLKITPVRLV  304

Query  1081  KRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDS-KDNADKPP  905
             K +SS   +K  L + W  ++KL                 + PD  EN DS +   +KPP
Sbjct  305   KNISSSMAIK--LKLSWTILSKL-----------------KNPDDHENEDSSRSTKNKPP  345

Query  904   SIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAY  725
              +EEITIPSVT+L+  GV FIPTK  I +I FD +    +LP ++LD NSEV+ RNLVAY
Sbjct  346   LVEEITIPSVTQLSKYGVSFIPTKGNISTIAFDKEKAAFHLPTISLDSNSEVMFRNLVAY  405

Query  724   EACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMN--KSV  551
             E   A GPL+  RY E MNGIVDT+ED + LRE GIILNRLKSD EVAN+ NGM+  K +
Sbjct  406   EISSASGPLLFTRYIELMNGIVDTEEDARLLRESGIILNRLKSDEEVANMLNGMSNCKCI  465

Query  550   RLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFC  371
             RLTK  FLDK I+DVNK+Y+  W V+ KRFM+  +F SWQ+LT+LA I+L LLM ++ FC
Sbjct  466   RLTKAPFLDKVIEDVNKYYDSLWMVRMKRFMKRSVFCSWQYLTMLAAILLFLLMAMEVFC  525

Query  370   SVYTCSRFFNDVTILGTN  317
             S Y C+R F+ V I  T 
Sbjct  526   SFYQCARIFH-VDIFNTT  542



>ref|XP_011004989.1| PREDICTED: putative UPF0481 protein At3g02645 [Populus euphratica]
 ref|XP_011016041.1| PREDICTED: putative UPF0481 protein At3g02645 [Populus euphratica]
Length=551

 Score =   465 bits (1196),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 264/552 (48%), Positives = 370/552 (67%), Gaps = 26/552 (5%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEIN-VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +WVI+I + LE+ELEE+ + + V IF VPKTLM  DP+ Y PQ++++GPYHY   +L
Sbjct  19    DEYQWVINIGRALEKELEEDGDESPVCIFTVPKTLMSSDPDSYTPQQLSLGPYHYRRADL  78

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             HEMER+KL AAK  Q QL++++  +L E+++K+E +IR  Y K L+   ETLAWMMA+D 
Sbjct  79    HEMERYKLSAAKKLQNQLQSLRFENLVEQLIKLEPQIRACYHKYLDFNAETLAWMMALDV  138

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLEFL++Y+V+E K+++   S +MSHL+D   +KS+H+ +LRD++MLENQ+P FILRK
Sbjct  139   SFLLEFLQIYSVEETKMLSRAPS-RMSHLLDYSKRKSAHHVILRDMVMLENQVPQFILRK  197

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEME  1244
             +L+ Q  S E +D++LL+M++GL+KELSPFK  E     ++ + +HLL +L+  IVP +E
Sbjct  198   VLEFQYMSAELADEMLLSMVIGLAKELSPFKMIELPKTTKVLEHSHLLDFLYDIIVPRVE  257

Query  1243  SEHVEIEIdenggmkekkdgeedEFLK-NSGYVKSAFGQVWGILKKLNKGPARALKRLSS  1067
                  +  +      E  +  E+E +  +S YVK      W ++ +L   P R LK +SS
Sbjct  258   EPIEILLEELVADQIESDNKPEEERVGVDSNYVKQLLTVTWNMVSQLKITPVRLLKNISS  317

Query  1066  LAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEIT  887
                ++  L + W  ++KL                 + PD  EN DS  +++K P +EEIT
Sbjct  318   SMTIQ--LKLSWTILSKL-----------------KNPDDRENEDSSTSSNKSPLVEEIT  358

Query  886   IPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAK  707
             IPSVT+L+  GV FIPTK  I +I FD      +LP ++LD+NSEV+ RNLVAYE   A 
Sbjct  359   IPSVTQLSKYGVSFIPTKGNISTIAFDKGKAAFHLPTISLDLNSEVMFRNLVAYEISSAS  418

Query  706   GPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMN--KSVRLTKVA  533
             GPL+  RY E MNGI+DT+ED + LRE GIILNRLKSD EVA + NGM+  K +RLTK  
Sbjct  419   GPLLFTRYIELMNGIIDTEEDARLLRESGIILNRLKSDEEVAKMLNGMSNCKCIRLTKAP  478

Query  532   FLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCS  353
             FLDK I+DVNK+Y+  W V+ KRFM+  +F SWQ+LT+LA I+L LLM ++ FCS Y C+
Sbjct  479   FLDKVIEDVNKYYDSLWMVRMKRFMKRSVFCSWQYLTMLAAILLFLLMAMEVFCSFYQCA  538

Query  352   RFFNDVTILGTN  317
             R F+ V I  T 
Sbjct  539   RIFH-VDIFNTT  549



>ref|XP_002299686.1| hypothetical protein POPTR_0001s21220g [Populus trichocarpa]
 gb|EEE84491.1| hypothetical protein POPTR_0001s21220g [Populus trichocarpa]
Length=552

 Score =   464 bits (1195),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 262/549 (48%), Positives = 368/549 (67%), Gaps = 27/549 (5%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI++ + LE+ELE+ +E  V IF VPKTLM   P+ Y PQ++++GPYHY  P+LH
Sbjct  17    DEYQWVINVGRALEKELEDGDEDPVCIFTVPKTLMSSHPDTYTPQQLSLGPYHYLRPDLH  76

Query  1777  EMERHKLDAAKIFQKQLRTI-KLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             EME +KL AAK  Q QL +     +L E+++K+E +IR  Y K L+   ETLAWMMA+D 
Sbjct  77    EMECYKLFAAKKLQNQLHSSHNFENLVEQLIKLEPKIRACYHKYLSFNAETLAWMMALDV  136

Query  1600  SFLLEFLKVYAVKEGKLMA-AMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
             SFLLEFL++Y++KE    +   ++++MSHL+D   +KS H+ +LRD++MLENQIP F+LR
Sbjct  137   SFLLEFLQIYSLKETSSSSRVQVTSRMSHLLDYSKRKSVHHVILRDMVMLENQIPLFVLR  196

Query  1423  KMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEM  1247
             K+L+ Q  S E++DD+LL+M+ GL+KELSPFK  E     +I + +HLL  L+  IVP++
Sbjct  197   KVLEFQYLSVESADDMLLSMIRGLAKELSPFKTIELPKSQKILEQSHLLDLLYDIIVPKV  256

Query  1246  ESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARAL-KRLS  1070
             E E VEI  +    ++     E + F  +S YVK    ++W ++ +L  GP   L K +S
Sbjct  257   E-EPVEISEEFADQIEADIQLESEGFGSDSNYVKQLLNEIWNMVSQLTTGPVSLLIKNIS  315

Query  1069  SLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDG---DENSDSKDNADKPPSI  899
             S   +K  +   W  ++ L  ++               PDG    E+  S  + +KPP +
Sbjct  316   SSVTIK--MKFSWTILSTLLHIS---------------PDGLIKTEDDGSTTSMNKPPLV  358

Query  898   EEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEA  719
             EEITIPSVTEL+N+GV FIPT+  I +I FD      YLP ++LDIN+EVV RNL+AYE 
Sbjct  359   EEITIPSVTELSNSGVSFIPTRGNISTINFDKDKAAFYLPTISLDINTEVVFRNLMAYEI  418

Query  718   CIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGM--NKSVRL  545
               A GPL+  RY E +NGI+DT+EDV  LRE+GIILNRLKSD EVAN+ NGM  +K++RL
Sbjct  419   SNASGPLIFTRYIELLNGIIDTEEDVGLLRERGIILNRLKSDEEVANMLNGMSDSKAIRL  478

Query  544   TKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSV  365
             TK   LDK I+DVNK++   W VK ++F +  +F SWQ+LTL A IVL+LL+ ++SFCSV
Sbjct  479   TKAPILDKVIEDVNKYHGSLWMVKIRKFTKRSVFSSWQYLTLFAAIVLMLLLAVESFCSV  538

Query  364   YTCSRFFND  338
             +TC R F++
Sbjct  539   FTCYRIFHN  547



>gb|EYU21691.1| hypothetical protein MIMGU_mgv1a004095mg [Erythranthe guttata]
Length=544

 Score =   464 bits (1193),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 253/534 (47%), Positives = 341/534 (64%), Gaps = 33/534 (6%)
 Frame = -3

Query  1855  MVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVES  1676
             M  DP  Y+PQ+VA+GPYH+  PE+++MER+K+ AAK  Q  L+  K     + +MK+E 
Sbjct  1     MATDPNSYIPQQVAVGPYHHLRPEVYDMERYKIAAAKRNQLDLQKAKFQDFVDHLMKLEL  60

Query  1675  RIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMIS--AKMSHLVDLK  1502
             RIR +Y + L    E LAW+MAVD SFL EF +V  V++G     ++   ++++HL  L 
Sbjct  61    RIRAAYHRPLAFGGEALAWIMAVDVSFLFEFFQVCGVRQGVCENVLMKTPSRLAHLTALS  120

Query  1501  GKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK--  1328
               K++H+A+LRD+IMLENQIP F+LR +L+ Q  S +++D+ LL +L GLS E+SPF+  
Sbjct  121   ANKTAHSAILRDVIMLENQIPLFVLRALLEMQYSSLDSADEALLVILNGLSIEMSPFRPA  180

Query  1327  ------------NEGSAVVQIADATHLLGYLFQTIVPEMES-----EHVEIEIdenggmk  1199
                           G   V + +  HLL +L+  IVP  E      E +EI   E     
Sbjct  181   ARAAAPAAEGNGGGGPRKVPVKEYAHLLDFLYHFIVPFEEDSSPSEEIIEIGDGEEEDRD  240

Query  1198  ekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAIT  1019
             +  D E+        +++    ++W IL  L  GP + +K +    P+K V+ +PW  +T
Sbjct  241   QIDDVEKSNSFSKPSHLRQLLDELWRILSTLADGPVKWVKGVIFSKPLKFVVKLPWTILT  300

Query  1018  KLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNA-----------DKPPSIEEITIPSVT  872
             K+P + +MK PIE +F+   K D DEN   KD+             KPP +EEITIPSVT
Sbjct  301   KIPIIKMMKEPIEQMFAVFHK-DDDENGKKKDDERESSSSSNRTLQKPPLLEEITIPSVT  359

Query  871   ELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVL  692
             +L+  GV+F PT +GI  I FD KT T Y PVV LD+NSEVVLRNLVAYEAC A+GPL+L
Sbjct  360   QLSGVGVQFQPTDEGITGISFDEKTLTFYFPVVELDVNSEVVLRNLVAYEACSARGPLIL  419

Query  691   ARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTID  512
              RYTE MNGI+DTD D +FL EKGII+N LKS+ EVA +WNGM+KSV+LTKV  LDK I 
Sbjct  420   TRYTELMNGIIDTDADARFLCEKGIIVNHLKSEKEVAEMWNGMSKSVKLTKVPSLDKVIG  479

Query  511   DVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
             DVNK+YN RW VK  +FM+ Y+FGSW+ LT LA I+LL LM LQ+FC VY+C R
Sbjct  480   DVNKYYNGRWKVKFGKFMKDYVFGSWRILTFLAAIMLLALMSLQAFCQVYSCRR  533



>ref|XP_011002074.1| PREDICTED: putative UPF0481 protein At3g02645 [Populus euphratica]
Length=551

 Score =   461 bits (1186),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 255/544 (47%), Positives = 363/544 (67%), Gaps = 18/544 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WV++I + LE+ELE+ NE  V +F VPKTLM   P+ Y PQ++++GPYHY  P+LH
Sbjct  17    DEYQWVLNIGRALEKELEDGNEDPVCVFTVPKTLMSSHPDTYTPQQISLGPYHYLRPDLH  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EME +KL AAK  Q QL ++   +L E+++K+E +IR  Y K L+   ETLAWMMA+D S
Sbjct  77    EMECYKLSAAKKLQNQLHSLNFQNLVEQLIKLEPKIRACYHKYLSFNAETLAWMMALDVS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL++Y++KE    + + +++MSHL+D   +KS H+ +LRD++MLENQ+P F+LRK+
Sbjct  137   FLLEFLQIYSLKETSSSSRVFASRMSHLLDYSKRKSVHHVILRDMVMLENQVPLFVLRKV  196

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L+ Q  S E++DD+LL+M+ GL+KELSPFK  E     +I + +HLL  L+  IVP++E 
Sbjct  197   LEFQYLSVESADDMLLSMIRGLAKELSPFKTIELPKSKKILEHSHLLDLLYDIIVPKVE-  255

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARAL-KRLSSL  1064
             E +EI  +    ++     E      +S YVK    ++W ++ +   GP   L K +SS 
Sbjct  256   EPLEISEEFADQIEADIQLESKGLGFDSNYVKQLLKEIWNMVSQQTTGPLSLLIKNISSS  315

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITI  884
               +K  L + W  +++L  +           S     + ++   S  + +KPP +EEITI
Sbjct  316   VTIK--LKLSWTILSRLLHI-----------SPDDVINTEDEGSSTTSMNKPPLVEEITI  362

Query  883   PSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKG  704
             PSVTEL+N GV FIPT+  I +I FD      YLP ++LDIN+EVV RNL+AYE   A G
Sbjct  363   PSVTELSNCGVSFIPTRGNISTINFDKDKAAFYLPTISLDINTEVVFRNLIAYEISNASG  422

Query  703   PLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMN--KSVRLTKVAF  530
             PL+  RY E +NGI+DT+EDV  LRE+GIILNRLKSD EVAN+ NGM+  K++RLTK   
Sbjct  423   PLIFTRYIELLNGIIDTEEDVGLLRERGIILNRLKSDEEVANMLNGMSDCKAIRLTKAPI  482

Query  529   LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
             LDK I+DVNK++   W VK ++F +  +F SWQ+LTL A I L+LLM L+SFC+V+ C R
Sbjct  483   LDKVIEDVNKYHGSLWMVKIRKFTKRSVFSSWQYLTLFAAIFLMLLMALESFCTVFKCYR  542

Query  349   FFND  338
              F++
Sbjct  543   IFHN  546



>ref|XP_004152335.1| PREDICTED: putative UPF0481 protein At3g02645-like [Cucumis sativus]
 ref|XP_004165078.1| PREDICTED: putative UPF0481 protein At3g02645-like [Cucumis sativus]
 gb|KGN52921.1| hypothetical protein Csa_4G006280 [Cucumis sativus]
Length=536

 Score =   460 bits (1184),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 264/542 (49%), Positives = 351/542 (65%), Gaps = 29/542 (5%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenE--INVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE KWVI I++TLE ELE++ +  I V+IF VPK LM  DP  Y PQ VA+GPYH   PE
Sbjct  11    DELKWVIQIRRTLEEELEDDEDYGIPVAIFKVPKLLMESDPHSYTPQLVALGPYHCWRPE  70

Query  1783  LHEMERHKLDAAKIFQKQLRT-IKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAV  1607
             LH+MER KL AAK  +K   T ++ H L ++M K+E +IR  Y   L++  ETLAWMMA+
Sbjct  71    LHDMERLKLSAAKRAKKFSSTNLQFHELVQQMSKIEQKIRACYHGYLDINGETLAWMMAI  130

Query  1606  DASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFIL  1427
             DASFLLEFL VYA  E K++   +S++MSHL+D  G K +HNA+LRDIIMLENQIP F+L
Sbjct  131   DASFLLEFLLVYA-GEFKILRR-VSSRMSHLMDHAGTKPAHNAVLRDIIMLENQIPLFVL  188

Query  1426  RKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPE  1250
             RKM++ Q  S + SD++LL+M++GL  ELSPF   +G   +QI+D  HLL +L+Q I P+
Sbjct  189   RKMMEFQSESSQQSDEILLSMMIGLFTELSPFNTTDGIPEIQISDCAHLLDFLYQMIAPK  248

Query  1249  MESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLS  1070
                E  EI    N              +  S  +   F Q    LK+L     RA++   
Sbjct  249   -SKESSEINETPNE-------------IDQSPQISHRFKQ---FLKRLISFTKRAIQS--  289

Query  1069  SLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDEN--SDSKDNADKPPSIE  896
                 VKT+  +PW  ++ +P   V+K P E LF   Q+   +E    +   NA++PP  E
Sbjct  290   --QHVKTIARLPWTILSTIPPFTVLKQPAEILFFREQQEAKEEPEPQNPNSNANRPPLTE  347

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EI IPSV+EL+ AG+ F P+  GI +I FD++T TLYLP   LD+N+E  LRNLVAYEA 
Sbjct  348   EIAIPSVSELSKAGIHFSPSHGGISTINFDSQTGTLYLPTARLDVNTEATLRNLVAYEAS  407

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
                G LVL RYTE MNGIVDT+EDV+ LRE G+I+N LKSD E A +WNGM+KS+RL++V
Sbjct  408   SGIGALVLTRYTELMNGIVDTEEDVRLLREGGVIVNHLKSDEEGAWMWNGMSKSIRLSRV  467

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
               LDK I++VN++YN  W VK  RF++ YI+ SW  + L      L L+ LQ+FCS++ C
Sbjct  468   MELDKVIEEVNEYYNGLWRVKMGRFVKEYIYSSWPLIALTTVAWFLFLIGLQAFCSLFGC  527

Query  355   SR  350
              R
Sbjct  528   FR  529



>ref|XP_010904999.1| PREDICTED: putative UPF0481 protein At3g02645 [Elaeis guineensis]
Length=550

 Score =   459 bits (1181),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 257/546 (47%), Positives = 363/546 (66%), Gaps = 22/546 (4%)
 Frame = -3

Query  1957  DESKWVIHIQKT-lereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +W++H++    ++  EE+  I VSIF VPK+L+  +PE YVPQ  A+GPYH   PEL
Sbjct  17    DELRWLVHVRHAFAQKLDEEDRRIPVSIFDVPKSLLSTNPEAYVPQLFALGPYHKGRPEL  76

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             ++MER+K+ +AK     LR ++   + +  +++E +IR  Y + L+   +TLAWMMA+DA
Sbjct  77    YDMERYKIASAKRAANALRDLRFELIVDCFIELEHKIRAPYHRYLDYNGDTLAWMMAIDA  136

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
              FLLEF++ Y   +         +K+S +         +NA +RDI+MLENQIP F+LRK
Sbjct  137   CFLLEFIQKYHGDQEDKAVGNGFSKVSWV---------NNATVRDIMMLENQIPLFLLRK  187

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQTIVPEMES  1241
             +L+ QC S +++D++L  +L    KE+S FK  G+ +V I    HLL  L+  +VP+ + 
Sbjct  188   ILEFQCSSAQSADEVLSEILERFLKEVSAFKMIGN-IVDITQHVHLLQLLYNMLVPKFK-  245

Query  1240  EHVE-IEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSL  1064
             +H+E IE+       +  D +     +NS  VK  F  +W  +  LN  P R++K++ + 
Sbjct  246   DHIESIEVVIQDDESKPNDQQ----FENSSKVKRVFVIIWNNVSALNCVPIRSVKQVLTS  301

Query  1063  APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSD---SKDNADKPPSIEE  893
              P+K ++ +PWK ++KLP L+V     E  FS   + +GD  SD   S  N +KPP IEE
Sbjct  302   RPIKLLVQLPWKVLSKLPVLSVFTSFAEQFFSS--QTNGDSKSDELNSATNINKPPLIEE  359

Query  892   ITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACI  713
             I IPSVTEL +AGV+F+PT +GI  + FD K+   YLP VTLDIN++VVLRNLVAYEA  
Sbjct  360   IIIPSVTELVDAGVKFVPTHEGINGVSFDMKSAIFYLPTVTLDINTQVVLRNLVAYEASA  419

Query  712   AKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVA  533
               GPLV  RYTE MNGI+DT+EDVK LR+ GII N +KSD EVA++WNGM+KSVRLT+V 
Sbjct  420   IFGPLVFTRYTELMNGIIDTEEDVKLLRQSGIISNHMKSDKEVADIWNGMSKSVRLTRVP  479

Query  532   FLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCS  353
              LD+ I+DVNK+YN  W +KT + M++YIF SW+ LTLLA I+LLL+  LQ+FCSVYTCS
Sbjct  480   KLDRVIEDVNKYYNRNWRIKTSKLMKNYIFNSWKLLTLLAAILLLLMTALQAFCSVYTCS  539

Query  352   RFFNDV  335
             R+F D+
Sbjct  540   RWFGDL  545



>ref|XP_011084549.1| PREDICTED: putative UPF0481 protein At3g02645 [Sesamum indicum]
Length=554

 Score =   458 bits (1179),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 258/543 (48%), Positives = 346/543 (64%), Gaps = 22/543 (4%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenE--INVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE +W+I I++ L+ +  E+    + VSIF VPKTL +  PE YVPQ++A+GPYH+   E
Sbjct  18    DEQRWIIQIRRALDEDNLEQESDDVPVSIFTVPKTLTLASPESYVPQQLALGPYHHHRAE  77

Query  1783  LHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVD  1604
             L+EMER+KL AAK FQK L  +K H+L     K E R R  Y K LN   ETLAW+MAVD
Sbjct  78    LYEMERYKLSAAKRFQKHLPGLKFHNLVHHFTKFEPRFRACYHKFLNFNGETLAWVMAVD  137

Query  1603  ASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
             + FLLEFL    + E     + +S++MSHL+D  G+KS HN +LRDI+MLENQIP F L+
Sbjct  138   SCFLLEFLHHMVILEKDRATSRVSSRMSHLIDTTGRKSGHNVILRDILMLENQIPLFSLK  197

Query  1423  KMLQPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQTIVPE  1250
             + L  Q  S + +DD+L  ML+G  KE+ PFK   E   + Q+    HLL  ++  IVP 
Sbjct  198   QTLDFQLGSSDEADDVLYAMLIGFCKEVLPFKMVQELPDLDQVHRCAHLLDLVYNLIVPN  257

Query  1249  MESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLS  1070
             +     EI  +                  N    K  F ++   L+    GP   +KRL 
Sbjct  258   VGESVSEITSEAEKEDV------------NLNSEKKIFHKIMSKLRA--GGPMSLIKRLL  303

Query  1069  SLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNAD---KPPSI  899
                  K +L +  K ++ LPG+ ++K   E L    +K + +E  + K  ++   KPP +
Sbjct  304   VSRLAKFLLRLSCKIVSNLPGMILVK-QFEYLCFSQEKGEKNELENGKSCSEYNYKPPLM  362

Query  898   EEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEA  719
             EEI IPSVTEL+ AGV+F  T  GIL I FDAKT    +P+++LD+N+EVVLRNLVAYEA
Sbjct  363   EEIAIPSVTELSEAGVKFSVTNSGILGISFDAKTAMFCIPMISLDVNTEVVLRNLVAYEA  422

Query  718   CIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTK  539
             C A GPLV ARYTE MNGI+DT+ED K LREKGI+LN LKSD +VA+ WNGM+KSVRLTK
Sbjct  423   CNASGPLVFARYTELMNGIIDTEEDAKVLREKGIVLNHLKSDQDVADFWNGMSKSVRLTK  482

Query  538   VAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYT  359
             V FLDK I+DVN +Y  R  V+  +F++ ++FGSWQ +TLLA ++LL  M LQ+FCS++ 
Sbjct  483   VPFLDKVIEDVNCYYRGRMKVRIGKFLKRHVFGSWQSMTLLAAVLLLFFMSLQAFCSLFG  542

Query  358   CSR  350
             C+R
Sbjct  543   CAR  545



>ref|XP_003561017.1| PREDICTED: putative UPF0481 protein At3g02645 [Brachypodium distachyon]
Length=581

 Score =   456 bits (1174),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 264/568 (46%), Positives = 366/568 (64%), Gaps = 52/568 (9%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee---nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNP  1787
             DE +WV+ I+++L+    ++     I VSIF VPK L V+ PE YVPQ +A+GPYH+  P
Sbjct  27    DEVRWVVQIRESLQEVDADDEDDTGIPVSIFNVPKQLQVHKPEAYVPQLIALGPYHHWRP  86

Query  1786  ELHEMERHKLDAAKIFQKQLRT--------IKLHSL-AEEMMKVESRIRLSYDKQLNLRV  1634
             EL+EMER+KL +A+  Q++L +        +KL +L A+   ++E +IR  Y + L+L  
Sbjct  87    ELYEMERYKLASARRLQRRLCSTTPGGRGPLKLDALVAQFAARLERKIRAHYHRYLDLSG  146

Query  1633  ETLAWMMAVDASFLLEFLKVYAVKE---GKLMA--AMISAKMSHLVDLKGKKSSHNALLR  1469
             ETL+WMMAVD +FLLEFL++YA  E   G + A    +S++M+HLVD  G+KS+H  +LR
Sbjct  147   ETLSWMMAVDGAFLLEFLQIYAAAEDGDGPVPALRKRVSSRMAHLVDFAGRKSAHGLILR  206

Query  1468  DIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIAD  1295
             D++MLENQIP F+LR++L+PQC S + +  LL  M+ G+ KEL PFK  +   A V ++ 
Sbjct  207   DMVMLENQIPLFLLRRILEPQCASADEAAALLAAMVTGVMKELCPFKMMDTFPAAVDVSK  266

Query  1294  ATHLLGYLFQTIVPE------MESEHVE---IEIdenggmkekkdgeedEFLKNSGYVKS  1142
               HLL  L+  +VP+       E EH E   IE     G ++K           + +V+ 
Sbjct  267   HAHLLELLYYLLVPKPAESTPHEHEHDEGYDIEEQSPDGEEKKSPSSGSGGGSGAEHVQQ  326

Query  1141  AFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNV-MKGPIESLFSC  965
              F  +W +  KL +GP   +     + P+   +  PWK +  +PG++  +K P+ESLFS 
Sbjct  327   LFAALWAMASKLTRGPLHYI-----MKPIAFAVKAPWKMLAVVPGVSGGIKHPVESLFST  381

Query  964   GQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLY  785
                               PP IEEI +PSVTEL NAG++   T   I +I FDAKT TL+
Sbjct  382   ------------------PPLIEEIMVPSVTELINAGIQIAATTGDIATITFDAKTSTLH  423

Query  784   LPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNR  605
             LP VTLD ++EV +RNLVAYE+  A GPLVL RYTE MNGI+D DEDV  LR +G++LNR
Sbjct  424   LPAVTLDGSTEVTIRNLVAYESAAATGPLVLTRYTELMNGIIDADEDVSLLRARGVVLNR  483

Query  604   LKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFl  425
             +KSD +V  LWNGM++SVRLT+VA +DK ++++NK Y+ RW VK KRFMR Y+FGSWQ L
Sbjct  484   MKSDGDVTRLWNGMSRSVRLTRVAAIDKAVEEMNKCYDGRWRVKAKRFMRRYVFGSWQLL  543

Query  424   tllativllllmvLQSFCSVYTCSRFFN  341
             T LA I++LLL  LQ+FCSVYTCSR+F 
Sbjct  544   TFLAAILMLLLTTLQAFCSVYTCSRWFG  571



>ref|XP_011084585.1| PREDICTED: putative UPF0481 protein At3g02645 [Sesamum indicum]
Length=555

 Score =   454 bits (1167),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 252/523 (48%), Positives = 338/523 (65%), Gaps = 13/523 (2%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN+  DE +WV  I++ L+ ELEEE E  + IF VPK L    P+ Y+PQ+VAIGPYH T
Sbjct  12    PNLNFDEKRWVSQIRRALDEELEEETETPIRIFNVPKPLRAIHPDSYIPQQVAIGPYHCT  71

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
               E+ EMER+KL AA+  QK  + +KL  L   +M+ E +IR  Y+K LN   ETLAWMM
Sbjct  72    RSEIREMERYKLAAARRTQKDFQNLKLQRLVNHLMEFELKIRACYNKYLNFNGETLAWMM  131

Query  1612  AVDASFLLEFLKVYAVKEGK-LMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPF  1436
             AVDA+FL EFL+V AVK GK   + ++S+++ +L+ L G K++HNA+LRDI MLENQIP 
Sbjct  132   AVDATFLFEFLQVCAVKLGKETTSNVVSSRLPYLIGLAGNKAAHNAILRDISMLENQIPL  191

Query  1435  FILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK---NEGSAVVQIADATHLLGYLFQ  1265
             F+LRK+L+ Q  S E +D+ L  ML+ L +ELSPFK    +   V Q+ D  HLL  L+ 
Sbjct  192   FVLRKLLELQSSSSEKADETLFRMLIWLCEELSPFKMVEEDLPNVFQVRDCAHLLDVLYL  251

Query  1264  TIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLN-KGPAR  1088
               VP +E    +   +     +  +  E    + +  + K    +VW   K  N + P  
Sbjct  252   LCVPRLEGIPYK---NSGSVEEVVQVEEWCAAISDDHHDKQHLRRVWS--KVFNFQAPLN  306

Query  1087  ALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSC---GQKPDGDENSDSKDNA  917
              +K++    PVK +   P   ++ LP L   K P+E+  S     +K + D ++ +    
Sbjct  307   FIKKIIFSKPVKMIEKSPLMFLSNLPMLRATKEPVENFVSSLDQDEKKNEDGSTKNSITN  366

Query  916   DKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRN  737
              + P +EEI IPSVTEL+ AGVRF  TK GI +I FD K   LYLP ++LD+NSE VLRN
Sbjct  367   QQSPLLEEIKIPSVTELSKAGVRFESTKGGISTITFDNKNIVLYLPTISLDVNSEGVLRN  426

Query  736   LVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNK  557
             L AYEAC A GPLVLARY E MNGI+DT++DVKFLRE+GII N LKSD EVANLWNGM+K
Sbjct  427   LAAYEACTASGPLVLARYIELMNGIIDTEQDVKFLRERGIIKNHLKSDEEVANLWNGMSK  486

Query  556   SVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQF  428
              +RLTKV FLDK I+DVNK+++    VK  ++M+ Y+FGSW+F
Sbjct  487   CIRLTKVPFLDKVIEDVNKYHSGVGKVKCGKYMKKYVFGSWRF  529



>ref|XP_004136095.1| PREDICTED: putative UPF0481 protein At3g02645-like [Cucumis sativus]
 ref|XP_004158822.1| PREDICTED: putative UPF0481 protein At3g02645-like [Cucumis sativus]
 gb|KGN45239.1| hypothetical protein Csa_7G432200 [Cucumis sativus]
Length=573

 Score =   453 bits (1165),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 255/526 (48%), Positives = 359/526 (68%), Gaps = 9/526 (2%)
 Frame = -3

Query  1879  IFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKLHSLA  1700
             I  VP++LM  DP+ Y PQ VAIGPYH+   EL+ MER+K+ AA+  QKQL+++K H+L 
Sbjct  51    ICTVPRSLMAIDPDSYTPQEVAIGPYHHWRQELYVMERYKIAAARKAQKQLQSLKFHNLV  110

Query  1699  EEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMS  1520
             E++ K E + R  Y K LN   ET AWMMA+DASFLLE L+VY ++E K ++  +S+K+S
Sbjct  111   EKLAKYERKTRAFYHKYLNFNSETFAWMMAIDASFLLEVLQVYTIREEKSISR-VSSKLS  169

Query  1519  HLV--DLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSK  1346
              LV  D +G++S+ N +LRDI+MLENQIP F+LRKML+ Q P+ E ++ LLL+ML+GL +
Sbjct  170   CLVVVDNEGRRSAQNTILRDIVMLENQIPLFVLRKMLELQSPALEQTNQLLLSMLLGLCE  229

Query  1345  ELSPFKNEGSAVVQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkekkdgeedEFL  1166
             +LSPF+      V +++  HLL +L++ I P++      +E D+N     K++ E++   
Sbjct  230   DLSPFEM-LEPQVSVSECFHLLDFLYRMITPKLADPLEILENDQNQKESTKENFEDENAF  288

Query  1165  KNSGYVKSAFG-QVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKG  989
             K+     S  G ++W IL K NKGP    +R+ +  P++ +  +P   ++KLPG+ V+  
Sbjct  289   KHFCCSLSRLGSEIWKILSKFNKGPVHLFRRILNSRPLQVIFKLP-TIVSKLPGIVVLMK  347

Query  988   PIESLFSC---GQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILS  818
             P+  L S     ++ D ++ S  K    K P  EEI IPSV++L  +GV F     G+ +
Sbjct  348   PLNHLCSLRKGEEENDLEKGSSWKVGKIKLPLSEEIAIPSVSQLTKSGVHFSAIDGGVSA  407

Query  817   IEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVK  638
             + FD K    YLP + LD+NSEVVLRNLVAYEA  A GPLV  R+ E MNGI+D++EDVK
Sbjct  408   VAFDPKAVIFYLPTINLDVNSEVVLRNLVAYEASKASGPLVFTRFIELMNGIIDSEEDVK  467

Query  637   FLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFM  458
              L+EKGIILN LKSD+EVA+LWNGM+KS++LTKV FLDK I+DVNK+Y+ RW VK  +F+
Sbjct  468   LLKEKGIILNHLKSDAEVADLWNGMSKSIKLTKVPFLDKVIEDVNKYYSGRWKVKASKFV  527

Query  457   RSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFNDVTILGT  320
             + Y+FGSW  L  LATI+LL +  LQ+FCSVY+CSRFF+ +   GT
Sbjct  528   KKYVFGSWPLLAFLATILLLAMTALQAFCSVYSCSRFFHHLNADGT  573



>ref|XP_004136096.1| PREDICTED: uncharacterized protein LOC101205322 [Cucumis sativus]
Length=1559

 Score =   478 bits (1229),  Expect = 8e-147, Method: Compositional matrix adjust.
 Identities = 276/558 (49%), Positives = 368/558 (66%), Gaps = 26/558 (5%)
 Frame = -3

Query  1969  NIQNDESKWVIHI-QKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             N   DE +WVI I Q   E ELEE+  I V IF VPK+LMV DP+ Y+PQ VAIGPYH+ 
Sbjct  1020  NSDFDEERWVIQIRQSLDEEELEEDTGIPVCIFNVPKSLMVIDPDSYIPQEVAIGPYHHW  1079

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
               EL+EMER+K+ AAK  QKQL+++K H L E++ K E + R  Y K LN   ET AWMM
Sbjct  1080  RQELYEMERYKIAAAKRAQKQLQSLKFHDLVEKLTKHEQKTRACYHKYLNFNSETFAWMM  1139

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
             AVDASFLLE L+VY  +E  + +                 S+HNA+LRDI+MLENQIP F
Sbjct  1140  AVDASFLLEVLRVYTREETSISS-----------------SAHNAILRDIVMLENQIPLF  1182

Query  1432  ILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAV---VQIADATHLLGYLFQT  1262
             +LRKML+ Q  + E +D LLL+ML+GL + LSPFK     V   V +++  HLL +L++ 
Sbjct  1183  VLRKMLELQFSAVEPADQLLLSMLLGLYEHLSPFKVMEDLVELQVSVSECFHLLDFLYRI  1242

Query  1261  IVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARAL  1082
             I P++ ++ +E   D+    +   +  E  F      + S   ++W IL KLNKGP    
Sbjct  1243  ITPKL-ADTLETMEDDQNQQEPAIEIVESTFKHPCSPLSSLGSEIWKILSKLNKGPVHLF  1301

Query  1081  KRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSC--GQKPDGDE--NSDSKDNAD  914
             KR++   P+  +  +PW  ++ +PG+ ++  P+E +FS   G++ +  E   S  KD   
Sbjct  1302  KRIAGSRPLLVIFKLPWTIVSNIPGIGILMKPLEYIFSLKKGEEENDPEKGGSSRKDGKI  1361

Query  913   KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNL  734
             + P +EEITIPSV+EL  +GV F+P   G+ +I FD+K     LP + LD+NSEVVLRNL
Sbjct  1362  RLPLLEEITIPSVSELTKSGVLFLPIGGGVSAIAFDSKAVIFNLPTIKLDVNSEVVLRNL  1421

Query  733   VAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS  554
             VAYEA  + GPLV  R+ E MNGI+D++EDVK LREKGIILN LKSD+EVA LWNGM+KS
Sbjct  1422  VAYEASKSSGPLVFTRFIELMNGIIDSEEDVKLLREKGIILNHLKSDAEVAELWNGMSKS  1481

Query  553   VRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSF  374
             ++LTKV FLDK I+DVNK Y+ RW VK  +F+  Y+FGSW  L LLATI+LL +  LQ+F
Sbjct  1482  IKLTKVPFLDKVIEDVNKHYSNRWKVKAAKFVEKYVFGSWPLLALLATILLLAMNALQAF  1541

Query  373   CSVYTCSRFFNDVTILGT  320
             CSVY+CSRFFN ++  GT
Sbjct  1542  CSVYSCSRFFNHLSTAGT  1559



>ref|XP_008454198.1| PREDICTED: putative UPF0481 protein At3g02645 [Cucumis melo]
Length=543

 Score =   450 bits (1158),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 258/542 (48%), Positives = 347/542 (64%), Gaps = 29/542 (5%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenE--INVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE KWVI I++TLE E E++ +  I V+IF VPK LM  DP  Y+PQ VA+GPYH   PE
Sbjct  18    DELKWVIQIRRTLEEEQEDDEDYGIPVAIFKVPKLLMESDPHSYIPQLVALGPYHCWRPE  77

Query  1783  LHEMERHKLDAAKIFQKQLRT-IKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAV  1607
             LH+M R KL AAK  +K   T ++ H L E+++K+E  IR  Y   L+L  ETLAWMMA+
Sbjct  78    LHDMVRLKLSAAKRAKKFSSTNLQFHDLVEQLLKLEQNIRACYHGYLDLNGETLAWMMAI  137

Query  1606  DASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFIL  1427
             DASFLLEFL VYA K   L    + ++MSHL+D  G K +HNA+LRDIIMLENQIP F+L
Sbjct  138   DASFLLEFLHVYAGKFKILQR--VPSRMSHLMDHAGTKPAHNAVLRDIIMLENQIPLFVL  195

Query  1426  RKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPE  1250
             RKM++ Q  S + SD++LL+M++GL  ELSPF   +G   +QI+D  HLL +L+Q I P+
Sbjct  196   RKMMEFQFESSQQSDEILLSMMIGLFTELSPFNTTDGIPEIQISDCAHLLDFLYQMIAPK  255

Query  1249  MESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLS  1070
              +      EI                 ++ S  +   F Q    LK L     RA++   
Sbjct  256   SKEASEINEIPNE--------------IEQSPQISYRFKQ---FLKCLISYTKRAMQS--  296

Query  1069  SLAPVKTVLLMPWKAITKLPGLNVMKGPIESLF--SCGQKPDGDENSDSKDNADKPPSIE  896
                 +KT+  +PW  ++ +P   V+K P E LF     +  +  E  + K NA++PP  E
Sbjct  297   --QHIKTIARLPWTILSTIPPFTVLKQPAEILFFREQQEPREEPEPQNLKSNANRPPLTE  354

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EI IPSV+EL+ AG+RF P+  GI +I F+++T TLYLP   LD+N+E  LRNLVAYEA 
Sbjct  355   EIAIPSVSELSKAGIRFSPSHGGISTITFNSQTGTLYLPTARLDVNTEATLRNLVAYEAS  414

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
                G LVL RYTE MNGIVD++EDV+ LRE G+I+N LKSD E A +WNGM+KS+RL++V
Sbjct  415   SGIGALVLTRYTELMNGIVDSEEDVRLLREGGVIVNHLKSDEEGAWMWNGMSKSIRLSRV  474

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
               LDK I++VN++YN  W VK  RF++ YI+ SW  + L      L L+ LQ+FCS++ C
Sbjct  475   MELDKVIEEVNEYYNGLWRVKMGRFVKEYIYSSWPLIALTTVAWFLFLIALQAFCSLFGC  534

Query  355   SR  350
              R
Sbjct  535   FR  536



>ref|XP_010927029.1| PREDICTED: putative UPF0481 protein At3g02645 [Elaeis guineensis]
Length=532

 Score =   449 bits (1154),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 244/550 (44%), Positives = 351/550 (64%), Gaps = 27/550 (5%)
 Frame = -3

Query  1972  PNIQN---DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPY  1802
             P+ QN   DE +WVIHI++ LE E + ++E  +SI  VPK L+   PE Y+PQ +AIGPY
Sbjct  2     PSNQNHAFDEFQWVIHIRQVLEEEFDSDDEYPISITTVPKLLLCSKPENYIPQYIAIGPY  61

Query  1801  HYTNPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLA  1622
             H+   ELH+MER+KL AAK  Q QL  +K  +L + + K+E RIR  Y + L    ETLA
Sbjct  62    HHHREELHDMERYKLSAAKRTQNQLSNLKFQNLVDLIAKLEHRIRAHYYRYLKYSGETLA  121

Query  1621  WMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQI  1442
             WMMA+DASFLLEFL++Y+V EG  +    S+ M HL+D   + S+HN LLRDIIMLENQI
Sbjct  122   WMMAIDASFLLEFLQIYSVNEGNTLQRF-SSIMPHLMDSIRRASTHNMLLRDIIMLENQI  180

Query  1441  PFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQ  1265
             P F+L+ +L+ QC S + ++++L +ML+G  K+LSP K  E S+ + I + +HLL + + 
Sbjct  181   PLFLLQAILEVQCSSSKIANEILYSMLVGFLKDLSPLKMIESSSCIDITEYSHLLEFFYY  240

Query  1264  TIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARA  1085
             +IVP+ E E +E                     + + + + ++  V  I + +       
Sbjct  241   SIVPKTE-EQIETS-------------------EETDHDEKSYESVRRIKQLVGATRDFI  280

Query  1084  LKRLSSLAPVKTVLLM--PWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADK  911
              +R  +L     + LM  PW+ ++ LP L+++  P+E L S     + + N++  ++++ 
Sbjct  281   SRRTRALVSAIIMFLMKLPWRIVSSLPILSILMQPVEHLLSFKMNQNSEPNNEYLNHSNT  340

Query  910   PPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLV  731
              P +EEI IPSVTEL NAG++F PT   + +I+F+ +T   +LPV++LD NSEV+LRNLV
Sbjct  341   TPLLEEIVIPSVTELRNAGIKFSPTNGDLSTIDFNIRTAIFHLPVISLDDNSEVILRNLV  400

Query  730   AYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSV  551
             AYEA +   PLV +RY E MNGI+DT ED + LR  GIILN LKSD EVA LWNGM +S+
Sbjct  401   AYEASVGSRPLVFSRYVELMNGIIDTMEDARLLRGGGIILNHLKSDQEVAELWNGMTRSI  460

Query  550   RLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFC  371
             RLT+V  LDK I+DVN +Y  RW VK +RF++ Y+  SW+ L  LA I   L+M +Q FC
Sbjct  461   RLTRVRTLDKIIEDVNNYYCSRWRVKIRRFLKRYVVDSWECLVFLAIISFFLVMCMQVFC  520

Query  370   SVYTCSRFFN  341
               Y C+ +F+
Sbjct  521   VTYGCAPWFH  530



>ref|XP_008809769.1| PREDICTED: putative UPF0481 protein At3g02645 [Phoenix dactylifera]
Length=570

 Score =   449 bits (1155),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 250/548 (46%), Positives = 356/548 (65%), Gaps = 18/548 (3%)
 Frame = -3

Query  1969  NIQNDESKWVIHIQKT-lereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             N   DE +W++H++    +   EE+  + V+IF VPK+L+  +PE YVPQ  A+GPYH  
Sbjct  33    NSHFDELRWLVHVRHAFAQMLEEEDTSVPVAIFDVPKSLLSTNPEAYVPQLFALGPYHKG  92

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
              PEL++MER+K+ +A+   K LR ++   + +  +++E +IR  Y + L+   ETLAWMM
Sbjct  93    RPELYDMERYKIASAQRTAKALRDLRFELIVDCFIELEHKIRAPYHRYLDYNGETLAWMM  152

Query  1612  AVDASFLLEFLKVY-AVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPF  1436
             A+D  FLLEFL+ +   KE K +    S K++ +         +NA++RDI+MLENQ+P 
Sbjct  153   AIDVCFLLEFLQNHPGDKEVKAVGNGFS-KVNWV---------NNAIVRDIMMLENQVPL  202

Query  1435  FILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQTIV  1256
             F+L K+L+ QC S + +D++L  +L    KE+SPFK  G+ +V I    HLL  L+  +V
Sbjct  203   FLLGKILEFQCSSTQVADEVLSEILESFMKEVSPFKMVGN-IVDITQHVHLLQLLYHMVV  261

Query  1255  PEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             P+ + +   IE+       ++ D +     +N G VK  F  +W  +  LN  P R +K+
Sbjct  262   PKCKGQIESIEVVIRDDESKRNDQK----FENYGKVKRVFVTLWNNVSGLNCVPIRYVKQ  317

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDG-DENSDSKDNADKPPSI  899
             + +  P+K  + +PWK ++KLP L+V    +E  FS     D   E  +S  N +KPP I
Sbjct  318   VLTSRPIKLFVQLPWKVLSKLPVLSVFTNFVEQFFSSQTNADSKSEELNSTTNINKPPLI  377

Query  898   EEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEA  719
             EEI IPSVTEL +A V+F  T +GI  + FD K+   YLP VTLDIN+EVVLRNLVAYEA
Sbjct  378   EEIIIPSVTELVDASVKFARTHEGINGVSFDMKSGIFYLPTVTLDINTEVVLRNLVAYEA  437

Query  718   CIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTK  539
                 GPLV  RYTE MNGI+DT+EDVK LR+ GII NR+KSD EV+++WNGM+KSVRLT+
Sbjct  438   SGIFGPLVFTRYTELMNGIIDTEEDVKLLRQSGIISNRMKSDKEVSDIWNGMSKSVRLTR  497

Query  538   VAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYT  359
             V  LD+ I+DVNK+YN  W +KT + M+ Y+F SW+FLTLLA I+LLL+   Q+FCSVY 
Sbjct  498   VPKLDRVIEDVNKYYNKNWRIKTSKLMKKYVFNSWKFLTLLAAILLLLMTAFQAFCSVYA  557

Query  358   CSRFFNDV  335
             CSR+F ++
Sbjct  558   CSRWFGNL  565



>ref|XP_011010776.1| PREDICTED: putative UPF0481 protein At3g02645, partial [Populus 
euphratica]
Length=491

 Score =   441 bits (1134),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 237/495 (48%), Positives = 330/495 (67%), Gaps = 17/495 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeen-EINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +WV  I++TLERELE++  +I V IF VP+TLM   P+ Y P ++ +GPYHY  P+L
Sbjct  10    DEFQWVNTIRRTLERELEDDTDQIPVCIFTVPRTLMSSHPDFYTPHQLPLGPYHYWRPDL  69

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
              EME +KL A K  Q Q ++    +L E+++K+E +IR  Y K LNL  ETLAWMMA+DA
Sbjct  70    SEMESYKLSAVKKLQNQFQSNDFQNLVEQLVKLEPKIRACYHKYLNLNAETLAWMMALDA  129

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLEFL++Y+VKE ++++  IS++M+HL+D    KS+H  +LRDI+M+ENQIP F+LRK
Sbjct  130   SFLLEFLQIYSVKENEVLSR-ISSRMTHLLDYSKSKSAHYVILRDIVMMENQIPLFVLRK  188

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQTIVPEMES  1241
             +L+    S E++D++L++ML+GL KELSPFK       +  + +HLL  L+  +VP +E 
Sbjct  189   VLKFLLMSAESADEMLISMLLGLCKELSPFKTVELEKTKFLEHSHLLDSLYDIMVPRVEE  248

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
               +EI I++    + + + E +        VKS   ++W  + +LN GP R LK  S  A
Sbjct  249   LPIEITIEDVEENRSETEQENEGSGIELNLVKSFLSELWNTVSELNIGPMRFLKNAS--A  306

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIP  881
              + + L   W  + KL  L        S  +C  +P   EN   ++N   PP +EEI IP
Sbjct  307   SMTSKLGFYWTILNKLLNL--------SASNCVSEP---ENERVRNNQQLPPLVEEIAIP  355

Query  880   SVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGP  701
             SVT+L+N GVRF+PTK  I +I FD +T   Y+P+++LD NSE + RNLVAYE   A GP
Sbjct  356   SVTQLSNTGVRFLPTKGNISTINFDTETAAFYVPIISLDANSEFIFRNLVAYEISHASGP  415

Query  700   LVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMN--KSVRLTKVAFL  527
             ++  RY E MNGI+DT+EDV+ LRE+GII N LKSD EVANLWNGM+  KS+RLTK  F+
Sbjct  416   MIFVRYIELMNGIIDTEEDVRLLRERGIIFNHLKSDQEVANLWNGMSRCKSIRLTKAPFV  475

Query  526   DKTIDDVNKFYNCRW  482
             DK I+DVNK+YN RW
Sbjct  476   DKVIEDVNKYYNSRW  490



>gb|KDO43082.1| hypothetical protein CISIN_1g046834mg [Citrus sinensis]
Length=493

 Score =   435 bits (1118),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 244/508 (48%), Positives = 333/508 (66%), Gaps = 27/508 (5%)
 Frame = -3

Query  1855  MVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQ---KQLRTIKLHSLAEEMMK  1685
             M  DP+ Y PQ VAIGPYHY     +EM  +KL     FQ    QL+ +KL         
Sbjct  1     MSSDPDSYTPQEVAIGPYHYWRQGFYEMITYKL-----FQYVVDQLKELKL---------  46

Query  1684  VESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDL  1505
                +IR  Y K LN   ETLAWMMA++ASFLLEFL++YA+KEGKL A   S  M  L+D 
Sbjct  47    ---KIRACYLKFLNFSNETLAWMMAINASFLLEFLQIYAIKEGKLSATTSSISMLRLLDY  103

Query  1504  KGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN  1325
                K +HNA+ RD+++LENQIP F+LRK ++ Q  S E++DD+L  ML+G  +EL PF+ 
Sbjct  104   A--KGAHNAIRRDMVILENQIPLFVLRKKIEVQYSSLESADDMLQAMLLGFCEELLPFQI  161

Query  1324  -EGSAVVQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYV  1148
              +    + +++  HLL +L+ TIVP+ E +    EI+E    + +      ++  +  Y+
Sbjct  162   LKDIPKINVSERAHLLDFLYGTIVPKAEQKS---EINEVADDQGEDKQATQKYFGDQTYI  218

Query  1147  KSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIES-LF  971
             K  F ++W +L KLNKGP   +K+L    P+K    +PW  ++KLP ++++   I+  LF
Sbjct  219   KRLFREMWKLLLKLNKGPICLIKKLFLSKPLKLFFKLPWTVLSKLPLISILAQLIQYMLF  278

Query  970   SCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFT  791
                 K D + +  S  + +KPP +EEITIPSVTEL  + V F  T   IL+I FD  T T
Sbjct  279   PEENKSDDEGSYSSNSDMNKPPLVEEITIPSVTELYKSSVSFSATNGNILTISFDTNTAT  338

Query  790   LYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIIL  611
             L+LP V+LD+NS+V+LRNLVAYEA  A G LV  RYTE MNGI+DT+EDVK LR KGI+L
Sbjct  339   LHLPSVSLDVNSKVILRNLVAYEASNASGTLVFTRYTELMNGIIDTEEDVKLLRRKGILL  398

Query  610   NRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQ  431
             NRLKSD+EVA+LWNGM+KS++LTKV  L+K I+DVN +YN R  V+  ++ + Y+F SWQ
Sbjct  399   NRLKSDAEVADLWNGMSKSIKLTKVPHLNKVIEDVNNYYNNRLTVRFWKYTKLYVFSSWQ  458

Query  430   FltllativllllmvLQSFCSVYTCSRF  347
             F TLLAT +LLLLM+ Q+FCS+Y C +F
Sbjct  459   FFTLLATNMLLLLMIWQAFCSIYNCRKF  486



>ref|XP_008807192.1| PREDICTED: putative UPF0481 protein At3g02645 [Phoenix dactylifera]
Length=535

 Score =   429 bits (1104),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 250/551 (45%), Positives = 351/551 (64%), Gaps = 26/551 (5%)
 Frame = -3

Query  1972  PNIQN---DESKWVIHIQKTlereleeenEIN--VSIFGVPKTLMVYDPECYVPQRVAIG  1808
             P+ QN   DE +WVI I++ LE E E++++ +  ++I  VPK L+   PE Y PQ +AIG
Sbjct  2     PSDQNHSLDEFQWVIRIRRVLEEEFEDDDDDDHPITITTVPKPLLCSKPEAYTPQYIAIG  61

Query  1807  PYHYTNPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVET  1628
             PYH+   ELH+MER+KL AAK  Q QL  +K  +L + + K+E RIR +Y + LN   ET
Sbjct  62    PYHHRREELHDMERYKLSAAKRTQNQLSNLKFQNLVDLIAKLEHRIRANYYRYLNYNGET  121

Query  1627  LAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLEN  1448
             LAWMMA+DASFLLEFL++Y+V EG  +    SA    L+D   + S+ N LLRDIIMLEN
Sbjct  122   LAWMMAIDASFLLEFLQIYSVNEGNTLQRFSSAT-PRLIDSIRRTSTRNMLLRDIIMLEN  180

Query  1447  QIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYL  1271
             QIP F+L  +L+ QC S + + +LL +ML+G  K+LSP K  E S+ + I + +HLL ++
Sbjct  181   QIPLFLLEAILEVQCSSSKIAHELLHSMLVGFLKDLSPLKMIESSSCISIIEYSHLLEFV  240

Query  1270  FQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPA  1091
             +  +VP++E E +E               EE +  + S    S    + G  +      A
Sbjct  241   YYNLVPKIE-EQIE-------------TSEETDHDEKSHESASCIKWLAGATRDFISSRA  286

Query  1090  RALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNAD-  914
             RA       A +  ++ +PW+ ++ LP L+++  P+E L S     + + N++  ++ + 
Sbjct  287   RAF----VFAIIMFLVKLPWRIVSSLPILSILMQPVEHLLSFEMNQNSEPNNECPNHGNT  342

Query  913   KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNL  734
               P +EEI IPSVTEL NAG++F PT   + +I+F+ +T T  LPV+TLD NSEVVLRNL
Sbjct  343   TSPLLEEIVIPSVTELRNAGIKFSPTNGDLSTIDFNTRTATFRLPVITLDDNSEVVLRNL  402

Query  733   VAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS  554
             VAYE+ +   PL L+RY E MNGI+DT ED K LRE GI+LNRLKSD EVA LWNGM +S
Sbjct  403   VAYESSVGSRPLALSRYVELMNGIIDTMEDAKLLREGGIVLNRLKSDQEVAELWNGMTRS  462

Query  553   VRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSF  374
             +RLT+V  LDK I+DVN +Y  RW VK +RF++ YI  SW+ L  LA I   L+M LQ+F
Sbjct  463   IRLTRVRTLDKVIEDVNNYYCSRWRVKIRRFLKRYIVDSWECLVFLAIISFFLVMCLQAF  522

Query  373   CSVYTCSRFFN  341
             C  Y C+ +F+
Sbjct  523   CVTYGCAPWFH  533



>ref|XP_008461157.1| PREDICTED: putative UPF0481 protein At3g02645 [Cucumis melo]
Length=574

 Score =   429 bits (1102),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 258/526 (49%), Positives = 358/526 (68%), Gaps = 8/526 (2%)
 Frame = -3

Query  1879  IFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKLHSLA  1700
             I  VPK+L+V+DP+ Y PQ VAIGPYH+   EL+ MER+K+ AAK  QKQL+++K H+L 
Sbjct  51    ICTVPKSLIVFDPDSYTPQEVAIGPYHHWRQELYVMERYKIAAAKKAQKQLQSLKFHNLV  110

Query  1699  EEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMS  1520
             E++ K E +IR  Y K LN   ET  WMMA+DASFLLE L+VY ++E K ++  IS+K+S
Sbjct  111   EKLAKYERKIRAYYHKYLNFNSETFVWMMAIDASFLLEVLQVYTIREEKSISR-ISSKLS  169

Query  1519  HLV--DLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSK  1346
              LV  D +G++S+ N +LRDI+MLENQIP F+LRKML+ Q P+ E +D LLL+ML+GL +
Sbjct  170   CLVVVDNEGRRSAQNTILRDIVMLENQIPLFVLRKMLKLQSPALEQTDQLLLSMLLGLYE  229

Query  1345  ELSPFKNEGSAVVQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkekkdgeedEFL  1166
             +LSPF+      V +++  HLL +L++ I P++      +E D N     K++ E++   
Sbjct  230   DLSPFEML-EPQVSVSECFHLLDFLYRMITPKLAGPLEILENDRNQKESTKENAEDENAF  288

Query  1165  KNSGYVKSAFGQ-VWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKG  989
             K+     S  G  +W IL K NKGP    +R+ S  P++ +  +PW  ++KLPG+ ++  
Sbjct  289   KHFCRSLSELGSAIWKILSKFNKGPVHLFRRILSSRPLQVIFKLPWTIVSKLPGIVILMK  348

Query  988   PIESLFSC---GQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILS  818
             P+  L S     ++ D ++ S  K    K P  EEI IPSV++L  +GV F     G+ +
Sbjct  349   PLSHLCSLRKGEEENDIEKGSSWKVGKIKLPLSEEIAIPSVSQLTKSGVHFSSIDGGVSA  408

Query  817   IEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVK  638
             + FD      YLP + LD+NSEVVLRNLVAYEA  A GPLV  R+ E MNGI+D++EDV+
Sbjct  409   VAFDPNAVIFYLPTINLDVNSEVVLRNLVAYEASKASGPLVFTRFIELMNGIIDSEEDVR  468

Query  637   FLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFM  458
              L+EKGIILN LKSD+EVA+LWNGM+KS++LTKV FLDK I+DVNK+Y+ RW VK  +F+
Sbjct  469   LLKEKGIILNHLKSDAEVADLWNGMSKSIKLTKVPFLDKVIEDVNKYYSGRWKVKAAKFV  528

Query  457   RSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFNDVTILGT  320
             + Y+FGSW  L  LATI+LL L  LQ+FCSVY+CSRF + +   GT
Sbjct  529   KKYVFGSWPLLAFLATILLLALTALQAFCSVYSCSRFIHHLNADGT  574



>gb|KGN45237.1| hypothetical protein Csa_7G432180 [Cucumis sativus]
Length=578

 Score =   427 bits (1098),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 246/493 (50%), Positives = 332/493 (67%), Gaps = 11/493 (2%)
 Frame = -3

Query  1969  NIQNDESKWVIHI-QKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             N   DE +WVI I Q   E ELEE+  I V IF VPK+LMV DP+ Y+PQ VAIGPYH+ 
Sbjct  21    NSDFDEERWVIQIRQSLDEEELEEDTGIPVCIFNVPKSLMVIDPDSYIPQEVAIGPYHHW  80

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
               EL+EMER+K+ AAK  QKQL+++K H L E++ K E + R  Y K LN   ET AWMM
Sbjct  81    RQELYEMERYKIAAAKRAQKQLQSLKFHDLVEKLTKHEQKTRACYHKYLNFNSETFAWMM  140

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
             AVDASFLLE L+VY  +E     + +S+K+S+LVD +G+KS+HNA+LRDI+MLENQIP F
Sbjct  141   AVDASFLLEVLRVYTREET--SISSVSSKLSYLVDYEGRKSAHNAILRDIVMLENQIPLF  198

Query  1432  ILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAV---VQIADATHLLGYLFQT  1262
             +LRKML+ Q  + E +D LLL+ML+GL + LSPFK     V   V +++  HLL +L++ 
Sbjct  199   VLRKMLELQFSAVEPADQLLLSMLLGLYEHLSPFKVMEDLVELQVSVSECFHLLDFLYRI  258

Query  1261  IVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARAL  1082
             I P++ ++ +E   D+    +   +  E  F      + S   ++W IL KLNKGP    
Sbjct  259   ITPKL-ADTLETMEDDQNQQEPAIEIVESTFKHPCSPLSSLGSEIWKILSKLNKGPVHLF  317

Query  1081  KRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSC--GQKPDGDE--NSDSKDNAD  914
             KR++   P+  +  +PW  ++ +PG+ ++  P+E +FS   G++ +  E   S  KD   
Sbjct  318   KRIAGSRPLLVIFKLPWTIVSNIPGIGILMKPLEYIFSLKKGEEENDPEKGGSSRKDGKI  377

Query  913   KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNL  734
             + P +EEITIPSV+EL  +GV F+P   G+ +I FD+K     LP + LD+NSEVVLRNL
Sbjct  378   RLPLLEEITIPSVSELTKSGVLFLPIGGGVSAIAFDSKAVIFNLPTIKLDVNSEVVLRNL  437

Query  733   VAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS  554
             VAYEA  + GPLV  R+ E MNGI+D++EDVK LREKGIILN LKSD+EVA LWNGM+KS
Sbjct  438   VAYEASKSSGPLVFTRFIELMNGIIDSEEDVKLLREKGIILNHLKSDAEVAELWNGMSKS  497

Query  553   VRLTKVAFLDKTI  515
             ++LTKV FLDK I
Sbjct  498   IKLTKVPFLDKFI  510



>gb|KDO43084.1| hypothetical protein CISIN_1g044514mg [Citrus sinensis]
Length=512

 Score =   422 bits (1086),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 247/548 (45%), Positives = 332/548 (61%), Gaps = 59/548 (11%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN   DE +W+I+I++TLE  LE + +  V IF VPKTL   DP+ Y PQ+VAIGPYH  
Sbjct  7     PNPSFDECRWIINIRRTLEEALESDTDFPVCIFSVPKTLRSSDPDAYTPQQVAIGPYHSW  66

Query  1792  NPELHEMERHKLDAAKIFQKQLR-TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWM  1616
              PEL++ME +KL AAK  Q+ +    K   + +++ ++E +IR  Y K LN   E LAWM
Sbjct  67    RPELYDMEMYKLTAAKRAQRHINGDHKFQYVVDQLKELELKIRACYHKYLNFSNEALAWM  126

Query  1615  MAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPF  1436
             MA+DASFLLEFL++Y ++E KL     S  MSHL+D  G K++HNA+LRD+ M       
Sbjct  127   MAIDASFLLEFLQIYTIEEDKLSTTYSSRSMSHLLDNAGTKAAHNAILRDVDM-------  179

Query  1435  FILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQTIV  1256
                                                      ++ I++ THL  +L+ TIV
Sbjct  180   ----------------------------------------PMIDISECTHLQDFLYDTIV  199

Query  1255  PEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             P+ E      E+ E+   +      ++    +  Y+   F  +  +   L+ GP   +K+
Sbjct  200   PKAEQNS---EVTEDVHYQGDDKQPKEGCTDDPVYINYFFILICKLFSMLDIGPISLIKK  256

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNA-----DK  911
             L    PVK    +PW  ++KLPG ++   P++ L       D +EN    + +     +K
Sbjct  257   LLLSKPVKCFFKLPWTILSKLPGFSIFAKPLQYLVF---PEDNEENQSHAEGSSRRLMNK  313

Query  910   PPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLV  731
             PP +EEI IPSVTELA   V F  T   I ++ FD KT TL+LP ++ D+N+EV+LRNLV
Sbjct  314   PPLVEEIAIPSVTELAKVNVHFSATVGNISTVRFDTKTATLHLPTISFDVNTEVILRNLV  373

Query  730   AYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSV  551
             AYE   A GPLVLARYTE MNGI+DT+EDVK LREKGIILNRLKSD+EVANLWNGMNKS+
Sbjct  374   AYETSNASGPLVLARYTELMNGIIDTEEDVKLLREKGIILNRLKSDAEVANLWNGMNKSI  433

Query  550   RLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFC  371
             RLTKV  +DK I  VNK+YN +W VK ++ M+ Y+FGSW+ LTLLATI+LLLLM LQ+FC
Sbjct  434   RLTKVPQIDKVIGGVNKYYNSQWKVKFRKNMKVYVFGSWKCLTLLATIMLLLLMTLQAFC  493

Query  370   SVYTCSRF  347
             SVY+C  F
Sbjct  494   SVYSCRNF  501



>gb|EYU24625.1| hypothetical protein MIMGU_mgv1a019875mg [Erythranthe guttata]
Length=521

 Score =   422 bits (1086),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 250/553 (45%), Positives = 349/553 (63%), Gaps = 61/553 (11%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEIN------VSIFGVPKTLMVYDPECYVPQRVAI  1811
             PN   DE +W+IHI++ L+ + + + +++      VSIF VPKTL +  PE Y PQ+V++
Sbjct  10    PNF--DEQRWIIHIRRALDDDGDGDEDLDQESGNPVSIFNVPKTLTLASPESYTPQQVSL  67

Query  1810  GPYHYTNPELHEMERHKLDAAKIFQKQLR-TIKLHSLAEEMMKVESRIRLSYDKQLNLRV  1634
             GPYH+  P+L+EME+ K+ AA+  Q+QL  + K H   + + K E + R  Y K LN   
Sbjct  68    GPYHHWRPDLYEMEKFKISAARRSQRQLAGSRKFHDFVDRLSKFEIKFRSCYHKYLNFNG  127

Query  1633  ETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIML  1454
             ETLAWMMAVD+ FL+EFL+V+A                     +G+KS  +A++RD++ML
Sbjct  128   ETLAWMMAVDSCFLIEFLQVFAAAG------------------EGRKSGCDAVIRDMVML  169

Query  1453  ENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSA---VVQIADATH  1286
             ENQIP F LRKM++ Q  S + +DDLL TMLMG   E+SPFK N  S    V ++    H
Sbjct  170   ENQIPLFTLRKMVEFQLGSVDRADDLLYTMLMGFCNEVSPFKINRESMPNNVSRVLKCAH  229

Query  1285  LLGYLFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKL  1106
             LL +L+++IVP+ E   V  EI  +   +   + E+  F K                   
Sbjct  230   LLDFLYRSIVPKSE---VLTEIAVDAEKEGVSECEKISFRK-------------------  267

Query  1105  NKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSK  926
                   ++KRL    PVK +L++ WK ++ LPG+ V+K      FS  ++    EN +S 
Sbjct  268   ---IMSSIKRLVISKPVKFLLMISWKIVSVLPGMIVVKQIEYLCFSREREETNTENENS-  323

Query  925   DNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVV  746
                +K P +EEITIPSVT+L+ AGVRF  T +GI  I FD KT T  LP V LD+N+EVV
Sbjct  324   ---NKHPLMEEITIPSVTDLSMAGVRFSVTNEGIFGISFDRKTATFNLPTVRLDVNTEVV  380

Query  745   LRNLVAYEACIAK-GPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWN  569
             +RNLVAYEAC  + GPL+ ARYTE MNGI+DT+ED K +RE+GI+LN LKSD +VANLWN
Sbjct  381   MRNLVAYEACNHESGPLIFARYTELMNGIIDTEEDAKLMREQGIVLNHLKSDEDVANLWN  440

Query  568   GMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllm  389
             GM+KS+RLTKV FLD+ I+ VN +Y  RW V+  + ++ ++FGSWQ +T LA I+LL  M
Sbjct  441   GMSKSIRLTKVPFLDEVIEGVNSYYEGRWRVRIGKLLKRHVFGSWQSMTFLAAILLLSFM  500

Query  388   vLQSFCSVYTCSR  350
              LQ+FCS+++C+R
Sbjct  501   SLQTFCSLFSCAR  513



>ref|NP_001189794.1| uncharacterized protein [Arabidopsis thaliana]
 sp|P0C897.1|Y3264_ARATH RecName: Full=Putative UPF0481 protein At3g02645 [Arabidopsis 
thaliana]
 gb|AEE73843.1| uncharacterized protein AT3G02645 [Arabidopsis thaliana]
Length=529

 Score =   419 bits (1078),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 233/518 (45%), Positives = 322/518 (62%), Gaps = 46/518 (9%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee--nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE++WVI++QK+L+ ELEE    E+ VSIF VPK LM   P+ Y P RV+IGPYH   PE
Sbjct  17    DETRWVINVQKSLDAELEEHDLEEVTVSIFNVPKALMCSHPDSYTPHRVSIGPYHCLKPE  76

Query  1783  LHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVD  1604
             LHEMER+KL  A+  + Q  + + H L E++  +E +IR  Y K +    ETL W+MAVD
Sbjct  77    LHEMERYKLMIARKIRNQYNSFRFHDLVEKLQSMEIKIRACYHKYIGFNGETLLWIMAVD  136

Query  1603  ASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
             +SFL+EFLK+Y+ +           K+  L++  G    HN +LRDI+M+ENQIP F+LR
Sbjct  137   SSFLIEFLKIYSFR-----------KVETLINRVG----HNEILRDIMMIENQIPLFVLR  181

Query  1423  KMLQPQCPSPEASDDLLLTMLMGLSKELSP----FKNEGSAVVQIADATHLLGYLFQTIV  1256
             K L+ Q  S E++DDLLL++L GL K+LSP    F ++     Q  +  H+L +L+Q IV
Sbjct  182   KTLEFQLESTESADDLLLSVLTGLCKDLSPLVIKFDDDQILKAQFQECNHILDFLYQMIV  241

Query  1255  PEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             P +E E +E + +EN               +N G     F                  KR
Sbjct  242   PRIEEEELEEDDEENRAD------------ENGGNRAIRFMD----------EIKHQFKR  279

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKD--NADKPPS  902
             + +  P   +L  PW+ I+ LPG   +K   + LF+  +        +S    + +KPP 
Sbjct  280   VFASRPADLILRFPWRIISNLPGFMALKLSADYLFTRQENEATTTRQESVSILDIEKPPL  339

Query  901   IEEITIPSVTELANAGVRFIPTKKG-ILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAY  725
             +EE+TIPSV++L  AGVRF PT  G I ++ FD+ +   YLPV+ LDIN+E VLRNLVAY
Sbjct  340   VEELTIPSVSDLHKAGVRFKPTAHGNISTVTFDSNSGQFYLPVINLDINTETVLRNLVAY  399

Query  724   EACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRL  545
             EA    GPLV  RYTE +NGI+D++EDV+ LRE+G++++RLKSD E A +WNGM+KSVRL
Sbjct  400   EATNTSGPLVFTRYTELINGIIDSEEDVRLLREQGVLVSRLKSDQEAAEMWNGMSKSVRL  459

Query  544   TKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQ  431
             TKV FLDKTI+DVN++Y  RW VK  R +  Y++GSWQ
Sbjct  460   TKVGFLDKTIEDVNRYYTGRWKVKIGRLVEVYVYGSWQ  497



>ref|XP_006408397.1| hypothetical protein EUTSA_v10022378mg [Eutrema salsugineum]
 gb|ESQ49850.1| hypothetical protein EUTSA_v10022378mg [Eutrema salsugineum]
Length=532

 Score =   410 bits (1054),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 231/520 (44%), Positives = 322/520 (62%), Gaps = 49/520 (9%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee--nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE++WVI++QK+L+ ELEE    E+ VSI+ VPK LM   P+ Y P RV+IGPYH   PE
Sbjct  17    DEARWVINLQKSLDVELEEHDLEEVRVSIYTVPKALMCSHPDSYTPHRVSIGPYHCLKPE  76

Query  1783  LHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVD  1604
             LHEMER+KL  A+  + Q ++ + H L E++  +E++IR SY K +    ETL W+MAVD
Sbjct  77    LHEMERYKLMIARKIRDQTKSFRFHDLVEKIKSMETKIRASYHKYIGFDGETLMWIMAVD  136

Query  1603  ASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
             +SFL++FLK+Y+           S K+  L++  G    HN +LRDI+M+ENQIP F+LR
Sbjct  137   SSFLIQFLKIYS-----------SRKVEALINRVG----HNEILRDIMMVENQIPLFVLR  181

Query  1423  KMLQPQCPSPEASDDLLLTMLMGLSKELSP----FKNEGSAVVQIADATHLLGYLFQTIV  1256
             K L+ Q  S +++DDLL+++L GL ++LSP    F ++     Q+ D  H+L +L+Q IV
Sbjct  182   KTLEFQLGSTDSADDLLVSVLTGLCRDLSPLVIKFDDDEILKSQLQDYNHILDFLYQMIV  241

Query  1255  PEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             P +ESE  E E +                  N     S F Q   I             R
Sbjct  242   PRIESEDAEEEEENRAD-------------DNGENRASRFLQEIKI----------QFNR  278

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNA----DKP  908
             + +     ++L  PW+ I+ LPG   +K     LF+  +        +S   A    +KP
Sbjct  279   VFASRSADSILRFPWRIISNLPGFIALKLSANYLFTRQENEATATRQESSSAAIPDMEKP  338

Query  907   PSIEEITIPSVTELANAGVRFIPTKKG-ILSIEFDAKTFTLYLPVVTLDINSEVVLRNLV  731
             P +EE+TIPSV++L  AGVRF  T  G I ++ FD+ +   YLPV+ LDIN+E VLRNLV
Sbjct  339   PLVEELTIPSVSDLYKAGVRFKATINGNISTVTFDSNSGQFYLPVINLDINTETVLRNLV  398

Query  730   AYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSV  551
             AYEA    G LV  RYTE +NGI+D++EDV+ LRE+G++++RLKSD E A +WNGM+KSV
Sbjct  399   AYEASNTSGALVFTRYTELINGIIDSEEDVRLLREQGVLVSRLKSDQEAAEMWNGMSKSV  458

Query  550   RLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQ  431
             RLTKV FLDKTI+DVN++Y  RW VK  RF+  Y++GSWQ
Sbjct  459   RLTKVGFLDKTIEDVNRYYTGRWKVKIGRFVEVYLYGSWQ  498



>ref|XP_002882245.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58504.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1091

 Score =   424 bits (1090),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 236/522 (45%), Positives = 329/522 (63%), Gaps = 50/522 (10%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee--nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE++WVI++QK+L+ E+EE    E+ VSIF VPK LM   P+ Y P RV+IGPYH  NPE
Sbjct  17    DETRWVINVQKSLDAEIEEHDLEEVTVSIFNVPKALMCSHPDSYTPHRVSIGPYHCLNPE  76

Query  1783  LHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVD  1604
             LHEMER+KL  A+  + Q ++ K H L E++  +E +IR  Y K +    ETL W+MAVD
Sbjct  77    LHEMERYKLMIARKTRNQAKSFKFHDLVEKLQSIEIKIRACYHKYIGFNGETLLWIMAVD  136

Query  1603  ASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
             +SFL+EFLK+Y+ +           K+  L++  G    HN +LRDI+M+ENQIP F+LR
Sbjct  137   SSFLIEFLKIYSFR-----------KVETLINRVG----HNEILRDIMMIENQIPLFVLR  181

Query  1423  KMLQPQCPSPEASDDLLLTMLMGLSKELSP----FKNEGSAVVQIADATHLLGYLFQTIV  1256
             K L+ Q  S E++DDLL+++L GL ++LSP    F ++     Q  +  H+L +L+Q IV
Sbjct  182   KTLEFQLESTESADDLLVSVLTGLCRDLSPLVIKFDDDEILKAQFHECNHILDFLYQMIV  241

Query  1255  PEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             P +E E +E E DE     +        FL+    +K  F                  KR
Sbjct  242   PRIEEEELEEEEDEENRADDNGGNRAIRFLEE---IKHQF------------------KR  280

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDEN------SDSKDNAD  914
             + +  P   +L  PW+ I+ LPG   +K   + LF+ GQ+ +          S S  + +
Sbjct  281   VFASRPADLILRFPWRIISNLPGFMALKLSADYLFT-GQENEATTTRRESSSSVSASDIE  339

Query  913   KPPSIEEITIPSVTELANAGVRFIPTKKG-ILSIEFDAKTFTLYLPVVTLDINSEVVLRN  737
             KPP +EE+TIPSV++L  AGVRF PT  G I ++ FD+ +   +LPV+ LDIN+E VLRN
Sbjct  340   KPPLVEELTIPSVSDLHKAGVRFKPTANGNISTVTFDSNSGQFHLPVINLDINTETVLRN  399

Query  736   LVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNK  557
             LVAYEA    GPLV  RYTE +NGI+D++EDV+ LRE+G++++RLKSD E A +WNGM+K
Sbjct  400   LVAYEATNTSGPLVFTRYTELINGIIDSEEDVRLLREQGVLVSRLKSDQEAAEMWNGMSK  459

Query  556   SVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQ  431
             SVRLTKV FLDKTI+DVN++Y  RW VK  R +  Y++GSWQ
Sbjct  460   SVRLTKVGFLDKTIEDVNRYYTGRWKVKIGRLVEVYVYGSWQ  501



>ref|XP_006299858.1| hypothetical protein CARUB_v10016061mg [Capsella rubella]
 gb|EOA32756.1| hypothetical protein CARUB_v10016061mg [Capsella rubella]
Length=535

 Score =   408 bits (1048),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 224/521 (43%), Positives = 320/521 (61%), Gaps = 46/521 (9%)
 Frame = -3

Query  1957  DESKWVIHIQKT--lereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE++WVI ++K+   E E     E+ VSIF VPK LM   P+ Y P RV+IGPYH   PE
Sbjct  17    DETRWVIDVRKSLDAELEEHNLEEVTVSIFNVPKALMCSHPDSYTPHRVSIGPYHCLKPE  76

Query  1783  LHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVD  1604
             LHEMER+KL  A+ F+ Q  + + H L E++  +E +IR  Y K +    ETL W+MAVD
Sbjct  77    LHEMERYKLMIARKFRNQSSSFRFHDLVEKLQSIEIKIRACYHKYIGFNGETLLWIMAVD  136

Query  1603  ASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
             +SFL+EFLK+Y+ +           K+  L++  G    HN +LRDI+M+ENQIP F+LR
Sbjct  137   SSFLIEFLKIYSFR-----------KVETLINRVG----HNEILRDIMMIENQIPLFVLR  181

Query  1423  KMLQPQCPSPEASDDLLLTMLMGLSKELSP----FKNEGSAVVQIADATHLLGYLFQTIV  1256
             K L+ Q  S E +DDLL+++L GL ++LSP    F  +     Q+ +  H+L +L+Q IV
Sbjct  182   KTLEFQLESIELADDLLVSVLTGLCRDLSPLVINFNEDNILKAQLHECNHILDFLYQMIV  241

Query  1255  PEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             P++E E  E   +E+   + +          N G       +V   LK++        +R
Sbjct  242   PKIEEEEEEELEEEDEENRAE---------DNGG------NRVIRFLKEIK----HQFRR  282

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGD-----ENSDSKDNADK  911
             + +      +L  PW+ I+ LPG   +K   + LF+  +           +S S  + +K
Sbjct  283   VFASQTADLILRFPWRIISNLPGFMALKVSADYLFTRQENEATTTRREASSSVSDPDMEK  342

Query  910   PPSIEEITIPSVTELANAGVRFIPTKKG-ILSIEFDAKTFTLYLPVVTLDINSEVVLRNL  734
             PP +EE+ IPSV++L  AGVRF  T  G I ++ FD+ +   +LPV+ LDIN+E VLRNL
Sbjct  343   PPLVEELAIPSVSDLHKAGVRFKATTNGHISTVAFDSNSGQFHLPVINLDINTETVLRNL  402

Query  733   VAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS  554
             VAYEA    GPLV  RYTE +NGI+D++ED++ LRE+G++++RLKSD E A +WNGM+KS
Sbjct  403   VAYEASNTSGPLVFTRYTELINGIIDSEEDIRLLREQGVLVSRLKSDQEAAEMWNGMSKS  462

Query  553   VRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQ  431
             VRLTKV FLDKTI++VN++Y  RW VK  R +  Y+FGSWQ
Sbjct  463   VRLTKVGFLDKTIEEVNRYYTGRWKVKIGRLVEVYVFGSWQ  503



>ref|XP_010417325.1| PREDICTED: putative UPF0481 protein At3g02645 [Camelina sativa]
Length=530

 Score =   408 bits (1048),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 229/518 (44%), Positives = 317/518 (61%), Gaps = 45/518 (9%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee--nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE++WVI ++K+L+ ELEE    ++ VSIF VPK LM   P+ Y P RV+IGPYH   PE
Sbjct  17    DETRWVIDVRKSLDAELEEHDLEQVTVSIFNVPKALMCSHPDSYTPHRVSIGPYHCLKPE  76

Query  1783  LHEMERHKL-DAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAV  1607
             LHEMER+KL  A KI  +   + + H L E +  +E +IR  Y K +    ETL W+MAV
Sbjct  77    LHEMERYKLMIARKIRNQSNSSFRFHDLVERLQSMEVKIRACYHKYIAFNGETLLWIMAV  136

Query  1606  DASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFIL  1427
             D+SFL+EFLK+Y+ K           K+  L++  G    HN +LRDI+M+ENQIP F+L
Sbjct  137   DSSFLIEFLKIYSFK-----------KVETLINRVG----HNEILRDIMMIENQIPLFVL  181

Query  1426  RKMLQPQCPSPEASDDLLLTMLMGLSKELSP----FKNEGSAVVQIADATHLLGYLFQTI  1259
             RK L+ Q  S E++DD+L+++L GL ++LSP    F +      Q  +  H+L +L+Q I
Sbjct  182   RKTLEFQLESIESADDILVSVLTGLCRDLSPLVISFDDHEILKAQFHECNHILDFLYQMI  241

Query  1258  VPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALK  1079
             VP +E E  E   +E     +        FL   G +K  F                  K
Sbjct  242   VPRIEEEEEEEFEEEENRACDNGGNRAIRFL---GEIKQQF------------------K  280

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKD-NADKPPS  902
             R+ +      +L  PW+ I+ LPG   +K P + LF+  ++      +   D +  KPP 
Sbjct  281   RVFASQTADLILRFPWRIISNLPGFMALKLPADYLFTRQEQEAATTATAVSDPDIGKPPL  340

Query  901   IEEITIPSVTELANAGVRFIPTKKG-ILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAY  725
             +EE+ IPSV++L  AGVRF  T  G I ++ FD+ +   +LPV+ LDIN+E VLRNLVAY
Sbjct  341   VEELAIPSVSDLHKAGVRFKATTNGNISTVSFDSNSGQFHLPVINLDINTETVLRNLVAY  400

Query  724   EACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRL  545
             EA    GPLV  RYTE +NGI+D++EDV+ LRE+G+I++RLKSD E A +WNGM+KSVRL
Sbjct  401   EASNTSGPLVFTRYTELINGIIDSEEDVRLLREQGVIVSRLKSDKEAAEMWNGMSKSVRL  460

Query  544   TKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQ  431
             TKV FLDKTI+DVN++Y  RW VK  R +  Y++GSWQ
Sbjct  461   TKVGFLDKTIEDVNRYYTGRWKVKIGRLVEVYVYGSWQ  498



>ref|XP_006852811.1| hypothetical protein AMTR_s00033p00170840 [Amborella trichopoda]
 gb|ERN14278.1| hypothetical protein AMTR_s00033p00170840 [Amborella trichopoda]
Length=571

 Score =   408 bits (1049),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 246/554 (44%), Positives = 357/554 (64%), Gaps = 21/554 (4%)
 Frame = -3

Query  1957  DESKWVIHIQK--TlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE +WVI I++    +   E++N + VSIF VPK L    PE + PQ VAIGPYH+  PE
Sbjct  15    DEQRWVIQIRQHLDEDELEEDDNGVPVSIFTVPKLLSAIKPEAFKPQLVAIGPYHHWKPE  74

Query  1783  LHEMERHKLDAAKIFQKQLR---TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
             L+EM+R+KL AA+  QK+ R   + KL S+ +++ K E RIR  Y + L+L  ETLAWMM
Sbjct  75    LYEMQRYKLSAARRAQKKWRKSQSFKLQSVVDQISKFERRIRACYHRYLDLIGETLAWMM  134

Query  1612  AVDASFLLEFLKVYA--VKEGKLMAAM-ISAKMSHLVDLKGKKSSHNALLRDIIMLENQI  1442
             AVDA FLLEFLKVY   + EG+  + + +S++M+HLVD   +KS+HNA++RD++M+ENQI
Sbjct  135   AVDACFLLEFLKVYGPPIHEGEGRSLVRVSSRMAHLVDFTRRKSAHNAIVRDLMMMENQI  194

Query  1441  PFFILRKMLQPQCP-SPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQ  1265
             P F+LRK+L+ +       +++ L  M+ G   E+SP K    +  ++A++ HLL  L++
Sbjct  195   PLFLLRKLLELENNWGSSRAEEALAEMVSGFCAEISPMKIMAFSASEVAESGHLLDVLYR  254

Query  1264  TIVP------EMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLN  1103
              +VP      + +    E +  E         G    F K    +++ F  +      L+
Sbjct  255   MMVPWPNSKEDQDFAQDEPDGTEPESSGPSTTGHCHHFRKLLSSLRAFFSSI------LS  308

Query  1102  KGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKD  923
               P R L+RL +  P+K +L +P   +T LP  + +K P+E L    +  D   +S+ + 
Sbjct  309   SSPFRQLQRLLTSRPLKLLLKLPRMILTSLPLFSFLKAPLEFLVFSDENNDEGTSSNKEA  368

Query  922   NADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVL  743
             +  KPP +EE+ IPSVT+L NAGV       GI SI+FD  T +L LP ++LD+NSE+++
Sbjct  369   SISKPPLMEELHIPSVTDLCNAGVTLSLATGGISSIQFDPSTGSLSLPSISLDVNSEIII  428

Query  742   RNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGM  563
             RNLVA+EA  A GPL+  RYTE MNGI+DT++DV  +RE+GI+LNRLKSD E A LWNGM
Sbjct  429   RNLVAFEAASAPGPLIFTRYTELMNGIIDTEKDVALMRERGILLNRLKSDEEAAELWNGM  488

Query  562   NKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvL  383
             ++SVRLTKV  LD+ I++VNK+Y  RW V   +F+R Y++G W+ LT+LA + LLLL  +
Sbjct  489   SRSVRLTKVEGLDRVIEEVNKYYGRRWRVVMAKFVREYVYGWWRGLTVLAAVALLLLTAV  548

Query  382   QSFCSVYTCSRFFN  341
             Q+FCSVY CSR+ +
Sbjct  549   QAFCSVYICSRWLS  562



>emb|CDY68056.1| BnaAnng26050D [Brassica napus]
Length=523

 Score =   406 bits (1043),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 227/519 (44%), Positives = 323/519 (62%), Gaps = 57/519 (11%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee--nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DES+WVI+++K+L+ ELE+    ++ VSIF VPK LM    + Y PQRV+IGPYH   PE
Sbjct  18    DESRWVINVRKSLDAELEDHPLEQVTVSIFTVPKALMCTHRDSYTPQRVSIGPYHCLKPE  77

Query  1783  LHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVD  1604
             LHE ER+KL  A+ F+   ++ + H L E++  +E +IR  Y K + L  ETL W+MA+D
Sbjct  78    LHETERYKLTIARKFRNNSKSFRFHDLVEKLQSLEIKIRACYHKYIALSDETLLWIMAID  137

Query  1603  ASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
             +SFL+EFLKVY              K+  L++  G    HN +LRD++MLENQIP F+LR
Sbjct  138   SSFLIEFLKVYYG----------FGKVETLINRVG----HNEILRDVMMLENQIPLFVLR  183

Query  1423  KMLQPQCPSPEASDDLLLTMLMGLSKELSP----FKNEGSAVVQIADATHLLGYLFQTIV  1256
             K L+ Q  S E++D LL+++L GL ++LSP    F+N+     QI +  H+L +L+Q IV
Sbjct  184   KTLEVQLESKESADALLVSVLTGLCRDLSPLVIKFENDQILKAQIHEYNHILDFLYQMIV  243

Query  1255  PEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             P +E E  E E +                                   KL +      KR
Sbjct  244   PRIEEEEEEEESENRADENRAC--------------------------KLLRETKLKFKR  277

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNAD--KPPS  902
             + +  P  T+L +PW+ I+ LPG   +      LF+   + + +E S +   +D  KPP 
Sbjct  278   VFASRPADTILRLPWRVISNLPGFIALN----YLFT---RQENEETSPTVSVSDIEKPPL  330

Query  901   IEEITIPSVTELANAGVRFIPTKKG-ILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAY  725
             + E+TIPSV+EL  AGV+F PT+ G + ++ FD+ +   +LPV+ LDIN+E VLRNLVAY
Sbjct  331   VSELTIPSVSELHKAGVKFKPTQNGNVSTVSFDSNSGHFHLPVINLDINTETVLRNLVAY  390

Query  724   EAC-IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVR  548
             EA   + GPLV  RYTE +NGI+D+DEDV+ LRE+G++++RLKSD E A +WNGM+KSVR
Sbjct  391   EASNTSGGPLVFTRYTELINGIIDSDEDVRLLREQGVLVSRLKSDGEAAEMWNGMSKSVR  450

Query  547   LTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQ  431
             LT+V FLDKTI+DVN++Y  RW VK  RF+  Y++GSW+
Sbjct  451   LTRVGFLDKTIEDVNRYYTGRWKVKIGRFVEVYVYGSWK  489



>gb|AAF32472.1| hypothetical protein [Arabidopsis thaliana]
Length=1077

 Score =   421 bits (1081),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 233/518 (45%), Positives = 325/518 (63%), Gaps = 46/518 (9%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee--nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE++WVI++QK+L+ ELEE    E+ VSIF VPK LM   P+ Y P RV+IGPYH   PE
Sbjct  17    DETRWVINVQKSLDAELEEHDLEEVTVSIFNVPKALMCSHPDSYTPHRVSIGPYHCLKPE  76

Query  1783  LHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVD  1604
             LHEMER+KL  A+  + Q  + + H L E++  +E +IR  Y K +    ETL W+MAVD
Sbjct  77    LHEMERYKLMIARKIRNQYNSFRFHDLVEKLQSMEIKIRACYHKYIGFNGETLLWIMAVD  136

Query  1603  ASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
             +SFL+EFLK+Y+ +           K+  L++  G    HN +LRDI+M+ENQIP F+LR
Sbjct  137   SSFLIEFLKIYSFR-----------KVETLINRVG----HNEILRDIMMIENQIPLFVLR  181

Query  1423  KMLQPQCPSPEASDDLLLTMLMGLSKELSP----FKNEGSAVVQIADATHLLGYLFQTIV  1256
             K L+ Q  S E++DDLLL++L GL K+LSP    F ++     Q  +  H+L +L+Q IV
Sbjct  182   KTLEFQLESTESADDLLLSVLTGLCKDLSPLVIKFDDDQILKAQFQECNHILDFLYQMIV  241

Query  1255  PEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             P +E E +E + +EN               +N G     F      + ++        KR
Sbjct  242   PRIEEEELEEDDEENRAD------------ENGGNRAIRF------MDEIK----HQFKR  279

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKD--NADKPPS  902
             + +  P   +L  PW+ I+ LPG   +K   + LF+  +        +S    + +KPP 
Sbjct  280   VFASRPADLILRFPWRIISNLPGFMALKLSADYLFTRQENEATTTRQESVSILDIEKPPL  339

Query  901   IEEITIPSVTELANAGVRFIPTKKG-ILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAY  725
             +EE+TIPSV++L  AGVRF PT  G I ++ FD+ +   YLPV+ LDIN+E VLRNLVAY
Sbjct  340   VEELTIPSVSDLHKAGVRFKPTAHGNISTVTFDSNSGQFYLPVINLDINTETVLRNLVAY  399

Query  724   EACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRL  545
             EA    GPLV  RYTE +NGI+D++EDV+ LRE+G++++RLKSD E A +WNGM+KSVRL
Sbjct  400   EATNTSGPLVFTRYTELINGIIDSEEDVRLLREQGVLVSRLKSDQEAAEMWNGMSKSVRL  459

Query  544   TKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQ  431
             TKV FLDKTI+DVN++Y  RW VK  R +  Y++GSWQ
Sbjct  460   TKVGFLDKTIEDVNRYYTGRWKVKIGRLVEVYVYGSWQ  497



>ref|XP_010467974.1| PREDICTED: putative UPF0481 protein At3g02645 [Camelina sativa]
Length=530

 Score =   404 bits (1038),  Expect = 9e-129, Method: Compositional matrix adjust.
 Identities = 228/519 (44%), Positives = 322/519 (62%), Gaps = 47/519 (9%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee--nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE++WVI ++K+L+ ELEE    ++ VSIF VPK LM   P+ Y P RV+IGPY+   PE
Sbjct  17    DETRWVIDVRKSLDAELEEHDLEQVTVSIFNVPKALMCSHPDSYTPHRVSIGPYYCLRPE  76

Query  1783  LHEMERHKLDAAKIFQKQLR--TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMA  1610
             LHEMER+KL  A+  + Q    + + H L E +  +E +IR  Y K +    ETL W+MA
Sbjct  77    LHEMERYKLMIARKIRNQCNNSSFRFHDLVERLQSMEIKIRACYHKYIGFNGETLLWIMA  136

Query  1609  VDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFI  1430
             VD+SFL+EFLK+Y+ K           K+  L++  G    HN +LRDI+M+ENQIP F+
Sbjct  137   VDSSFLIEFLKIYSFK-----------KVETLINRVG----HNEILRDIMMIENQIPLFV  181

Query  1429  LRKMLQPQCPSPEASDDLLLTMLMGLSKELSP----FKNEGSAVVQIADATHLLGYLFQT  1262
             LRK L+ Q  S E++DDLL+++L GL K+LSP    F+++     Q  +  H+L +L+Q 
Sbjct  182   LRKTLEFQLGSIESADDLLVSVLTGLCKDLSPLVISFEDDEILKAQCHECNHILDFLYQM  241

Query  1261  IVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARAL  1082
             IVP +E E   IE +EN                N G     F      L+++ +      
Sbjct  242   IVPRIEEEEELIEEEENRVN------------DNGGNRAVRF------LREIKQ----QF  279

Query  1081  KRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKD-NADKPP  905
             KR+ +      +L  PW+ I+ LPG   +K   + LF+  +       +   D + +KPP
Sbjct  280   KRVFASQTADLILRFPWRIISNLPGFMALKLSADYLFTRQEHEAATTATSGSDPDIEKPP  339

Query  904   SIEEITIPSVTELANAGVRFIPTKKG-ILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVA  728
              +EE+ IPSV++L  AGVRF PT  G + ++ FD+ +   +LPV+ LDIN+E VLRNLVA
Sbjct  340   LVEELAIPSVSDLHKAGVRFKPTTNGNVSTVSFDSNSGQFHLPVINLDINTETVLRNLVA  399

Query  727   YEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVR  548
             YEA    GPLV  RYTE +NGI+D++EDV+ LRE+G++++RLKSD E A +WNGM+KSVR
Sbjct  400   YEASNTSGPLVFTRYTELINGIIDSEEDVRLLREQGVLVSRLKSDKEAAEMWNGMSKSVR  459

Query  547   LTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQ  431
             LTKV FLDKTI+DVN++Y  RW VK  R +  Y++GSWQ
Sbjct  460   LTKVGFLDKTIEDVNRYYTGRWKVKIGRLVEVYVYGSWQ  498



>ref|XP_009394006.1| PREDICTED: putative UPF0481 protein At3g02645 [Musa acuminata 
subsp. malaccensis]
Length=547

 Score =   404 bits (1039),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 238/540 (44%), Positives = 332/540 (61%), Gaps = 24/540 (4%)
 Frame = -3

Query  1963  QNDESKWVIHIQKTlereleeenEIN-VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNP  1787
             Q DE +WV  I++ LE ELE +++    SI  VPK L+   P+ Y+PQ +A+GPYH    
Sbjct  8     QFDEIQWVSRIRRVLEEELESDDDDRPASISDVPKALLCSKPDAYIPQILALGPYHRHRE  67

Query  1786  ELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAV  1607
             ELH+MER+KL AA+  Q +L  +K   +    +K+E  IR  Y + L    ETLAWMMA+
Sbjct  68    ELHDMERYKLAAARRMQSRLPGVKFLDVVALFIKLELPIRAHYHRYLKFNGETLAWMMAL  127

Query  1606  DASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFIL  1427
             D SFLLEFL++ A  +GK M     ++MSHLV L  + S++N LL D +MLENQIP F+L
Sbjct  128   DMSFLLEFLQIIATSKGK-MVGRAPSRMSHLVGLDRRTSAYNMLLCDALMLENQIPLFLL  186

Query  1426  RKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPE  1250
             +K L+ QC S + +  +  +ML+G   E+SPFK  + S  +      HLL  L+ T+ P 
Sbjct  187   QKALEMQCSSSQIAAQISSSMLIGFLIEVSPFKTLDISPWIDAGQHAHLLELLYHTVAPN  246

Query  1249  MESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLS  1070
              E     +E DE    + +       FL+      +AF          N+G  RAL    
Sbjct  247   PEELFETVEGDEETEQEPQVCVRIKFFLR----AIAAF--------IFNRG--RALVS--  290

Query  1069  SLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKP--PSIE  896
               A VK ++ +PW+ I  +P ++++  P+E L S  QK    E +      D+   P +E
Sbjct  291   --AVVKFLVTIPWRTIKSIPAVSIIAHPVEQLLS-SQKDQNSEPARGISTHDRSTTPLLE  347

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EI IPSVTEL  AGV+F      I +IEFDAKT TL+LP ++LD+N+EVVLRNLVAYEA 
Sbjct  348   EIAIPSVTELTKAGVKFSAMNGDISAIEFDAKTATLHLPTISLDVNAEVVLRNLVAYEAS  407

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
             I   PL+ +RY E MNGI+DT ED K LRE G++LN LKSD EVA LWN M +SVRLT+V
Sbjct  408   IGSRPLIFSRYVELMNGIIDTAEDAKLLREAGVVLNHLKSDEEVAELWNSMTRSVRLTRV  467

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
               LD+ I++VN +++ RW V+T+RFM++Y   SW+ L LLA ++L  ++ +Q+FC +Y C
Sbjct  468   PALDRVIEEVNSYHSSRWRVRTRRFMKNYAAASWECLVLLAVLLLFFIVSVQAFCVLYGC  527



>emb|CDY68015.1| BnaAnng25930D [Brassica napus]
Length=525

 Score =   403 bits (1036),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 224/520 (43%), Positives = 321/520 (62%), Gaps = 57/520 (11%)
 Frame = -3

Query  1957  DESKWVIHIQKT---lereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNP  1787
             DES+WVI+++K+      E     ++ VSIF VPK LM    + Y PQRV+IGPYH   P
Sbjct  18    DESRWVINVRKSLDAELEEQHSLEQVTVSIFTVPKALMCTHRDSYTPQRVSIGPYHCLKP  77

Query  1786  ELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAV  1607
             ELHE ER+KL  A+ F+   ++ + H L E++  +E +IR  Y K + L  ETL W+MA+
Sbjct  78    ELHETERYKLTIARKFRNNSKSFRFHDLVEKLHPMEVKIRACYHKYIALSEETLLWIMAI  137

Query  1606  DASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFIL  1427
             D+SFL+EFLKVY              K+  L++  G    HN +LRD++MLENQIP F+L
Sbjct  138   DSSFLIEFLKVYYG----------FGKVETLINRVG----HNEILRDVMMLENQIPLFVL  183

Query  1426  RKMLQPQCPSPEASDDLLLTMLMGLSKELSP----FKNEGSAVVQIADATHLLGYLFQTI  1259
             RK L+ Q  S E++D LL+++L GL ++LSP    F++  +   QI +  H+L +L+Q I
Sbjct  184   RKTLEFQLESTESADALLVSVLTGLCRDLSPLVIKFEDCETLKAQIHEYNHILDFLYQMI  243

Query  1258  VPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALK  1079
             VP +E E                        +N G    A G+      KL +      K
Sbjct  244   VPRIEEEEE----------------------ENRGDENRA-GENRAC--KLLREMKLQFK  278

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKD--NADKPP  905
             R+ +  P  T+L +PW+ I+ LPG   +      LF+   + + +E S +    + +KPP
Sbjct  279   RVFASRPADTILRLPWRVISNLPGFIALN----YLFT---RQENEETSPTVSVLDIEKPP  331

Query  904   SIEEITIPSVTELANAGVRFIPTKKG-ILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVA  728
              + E+TIPSV+EL  AGV+F PT+ G + ++ FD+ +   +LPV+ LDIN+E VLRNLVA
Sbjct  332   LVSELTIPSVSELHKAGVKFKPTQNGNVSTVSFDSNSGHFHLPVINLDINTETVLRNLVA  391

Query  727   YEAC-IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSV  551
             YEA   + GPLV  RYTE +NGI+D+DEDV+ LRE+G++++RLKSD E A +WNGM+KSV
Sbjct  392   YEASNTSGGPLVFTRYTELINGIIDSDEDVRLLREQGVLVSRLKSDEEAAEMWNGMSKSV  451

Query  550   RLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQ  431
             RLT+V FLDKTI+DVN++Y  RW VK  RF+  Y++GSW+
Sbjct  452   RLTRVGFLDKTIEDVNRYYTGRWKVKIGRFVEVYVYGSWK  491



>ref|XP_006852812.1| hypothetical protein AMTR_s00033p00171210 [Amborella trichopoda]
 gb|ERN14279.1| hypothetical protein AMTR_s00033p00171210 [Amborella trichopoda]
Length=569

 Score =   404 bits (1039),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 242/550 (44%), Positives = 349/550 (63%), Gaps = 15/550 (3%)
 Frame = -3

Query  1957  DESKWVIHIQK--TlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE +WVI I++        E++N   VSIF VPK L    PE + PQ VAIGPYH+  PE
Sbjct  15    DEQRWVIQIRQHLDEYDLEEDDNGFPVSIFTVPKPLSTIKPEAFTPQLVAIGPYHHWRPE  74

Query  1783  LHEMERHKLDAAKIFQKQLRT---IKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
             L+EM+R+KL AA   Q+Q +    IKL S+ +++ K E+RIR  Y + L+   ETL+WM 
Sbjct  75    LYEMQRYKLSAACRAQRQWQKSQGIKLQSVVDQISKFENRIRACYHRYLDFSCETLSWMT  134

Query  1612  AVDASFLLEFLKVYAV----KEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQ  1445
             AVDA FL+EFLKVY      +EGK +   +S++M HLVD   +KS+HNA++RD++M+ENQ
Sbjct  135   AVDACFLVEFLKVYGPPIHGEEGKSLV-RVSSRMQHLVDFTRRKSAHNAIVRDLMMMENQ  193

Query  1444  IPFFILRKMLQPQ--CPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYL  1271
             IP F+LRK+L+ +  C S +A ++    M+ G   E+SP K    +  + A++ HLL  L
Sbjct  194   IPLFLLRKLLELENNCVSNQA-EEAFAAMVSGFCAEISPLKIMAFSAKEFAESGHLLEVL  252

Query  1270  FQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPA  1091
             ++ +VP   ++  + E D+      +    E         ++S    +      +   P 
Sbjct  253   YRMMVPRPNAKE-DQEFDQEEPDGIEPQRSEPSTTDYCNQIRSLLSSLSSFFSSVISSPP  311

Query  1090  -RALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNAD  914
              R L+ L    P+K +L +PWK +T LP  + +K PIE L   G+K +   +S+   +  
Sbjct  312   FRRLRSLLISRPLKFLLKLPWKILTSLPLFSFLKTPIEFLALSGEKNEDGTSSNKDASIS  371

Query  913   KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNL  734
             KPP +EE+ IPSVT+L NAG+    +  GI SI+FD  T +L LP ++LD+NSE++LRNL
Sbjct  372   KPPLMEELHIPSVTDLCNAGITLSLSTGGISSIQFDPSTGSLSLPSISLDVNSEIILRNL  431

Query  733   VAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS  554
             VA+EA  A GPL+  RYTE MNGI+DTD+DV  +REKGI++NRLKSD EVA LWNG+++S
Sbjct  432   VAFEAASAPGPLIFTRYTELMNGIIDTDKDVALMREKGILVNRLKSDKEVAELWNGISRS  491

Query  553   VRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSF  374
             VRLT+V  LD+ I++VNK+Y   W V   + +R Y++G W+ LT+LA + LLLL  +Q+F
Sbjct  492   VRLTEVEGLDRVIEEVNKYYGRSWRVVMAKLVREYVYGWWRGLTVLAAVALLLLTGVQAF  551

Query  373   CSVYTCSRFF  344
             CSVY C R+ 
Sbjct  552   CSVYVCRRWL  561



>ref|XP_008809768.1| PREDICTED: putative UPF0481 protein At3g02645 [Phoenix dactylifera]
Length=434

 Score =   395 bits (1016),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 213/452 (47%), Positives = 299/452 (66%), Gaps = 29/452 (6%)
 Frame = -3

Query  1654  KQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNAL  1475
             + L+   ETLAWMM +DASFLLEFL+ Y+  +G++   +    MSH+VD    K ++N +
Sbjct  4     RHLDFNGETLAWMMTIDASFLLEFLRNYSNAKGRVFRKV--PTMSHMVDAARMKLAYNCI  61

Query  1474  LRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIA  1298
             LRDI+MLENQIP F++RK+L+ QCPS +++D  L  ML+G  KE+SPFK  E  + + + 
Sbjct  62    LRDIMMLENQIPLFLVRKILRFQCPSYQSADKELSNMLIGFVKEVSPFKMMENFSSIDVR  121

Query  1297  DATHLLGYLFQTIVPEMES-----EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFG  1133
                HLL  L+  IVP  +      +  E+ I        K          N  YVK  F 
Sbjct  122   RHAHLLQLLYLMIVPNAKEASETIDETEVHIGIPELNDTKPT-------GNPSYVKKFFN  174

Query  1132  QVWGILKKLNKGPARALKRLSSLA--PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQ  959
              VW             L+ L  LA  P+K ++ +PWK I+K PG++++   +  LF    
Sbjct  175   SVWS--------QTSGLQILGVLATRPIKFLVKIPWKIISKFPGVSILAARVAKLFFF--  224

Query  958   KPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLP  779
                GDE S+ +D++++PP +EEI IPSVTEL+NAGV+F  TK  + +I  +++T T +LP
Sbjct  225   --QGDEKSEDEDSSNEPPLVEEIMIPSVTELSNAGVKFSATKGDLTTISLNSRTATFHLP  282

Query  778   VVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLK  599
              V+LD+N+EV+LRNLVAYE  +  GP+V  RYTE MNGI+DT+EDVK LR++GIILNR+K
Sbjct  283   TVSLDVNTEVLLRNLVAYETTVESGPMVFTRYTELMNGIIDTEEDVKLLRQRGIILNRMK  342

Query  598   SDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltl  419
             +D EVA LWNGM+KSVRLTKV F+DK ++DVNKF++ RW+VK ++ M++Y+FGSWQ LT 
Sbjct  343   NDEEVAKLWNGMSKSVRLTKVGFIDKVLEDVNKFHSSRWSVKARKIMKTYVFGSWQILTF  402

Query  418   lativllllmvLQSFCSVYTCSRFFNDVTILG  323
             LA ++LLLL  +Q+FCSVY C    ++VT LG
Sbjct  403   LAAMLLLLLTCVQAFCSVYRCGSRRDNVTNLG  434



>gb|KCW70770.1| hypothetical protein EUGRSUZ_F03930 [Eucalyptus grandis]
Length=414

 Score =   394 bits (1011),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 204/394 (52%), Positives = 274/394 (70%), Gaps = 6/394 (2%)
 Frame = -3

Query  1891  INVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKL  1712
             + VSIF VP  LM  DP+ Y PQ+VAIGPYH+  PE++EM+R+KL A K +QKQL+ IK 
Sbjct  12    VPVSIFSVPAVLMSSDPDLYTPQQVAIGPYHHWRPEMYEMQRYKLAAVKRYQKQLQRIKF  71

Query  1711  HSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMIS  1532
              SL E+++K+E R+R  Y K L+   ETLAWMMA+DA FLLEFL++YA+KEGK+++  +S
Sbjct  72    QSLVEQLVKLEPRVRACYHKYLDFNGETLAWMMAIDALFLLEFLQIYAIKEGKMLSR-VS  130

Query  1531  AKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGL  1352
             ++MSHLVD+ G+KS+HNA+LRDI+MLENQIP FILRKML+ QC S + +DD+LLTMLMG 
Sbjct  131   SRMSHLVDIAGRKSAHNAILRDIVMLENQIPLFILRKMLEFQCASLDEADDMLLTMLMGF  190

Query  1351  SKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMESE-HVEIEIdenggmkekkdgee  1178
              KE+SPFK  E    +Q++   HLL +L+  +VP++E +  +  E       K+K     
Sbjct  191   YKEVSPFKPMEALPNIQVSVCAHLLDFLYDILVPKVEGQPEIIEEEGNGEDKKDKGLSPL  250

Query  1177  dEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNV  998
                   +  +K     +W +L KLN GP + LKRL    PVK +L +PW  ++KLP  +V
Sbjct  251   ASSSSGTSNIKQLCDAIWNLLSKLNNGPIKMLKRLLFSKPVKVLLKLPWTILSKLPFFSV  310

Query  997   MKGPIESLFSCGQKPDGD-ENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGIL  821
             +  P+ESLFS  +K DG  EN  S  N  KPPS+EEI IPSV++L+N GVRF+ T   + 
Sbjct  311   LAQPLESLFSSQEKEDGKAENEIS--NPSKPPSVEEIAIPSVSDLSNVGVRFVATNGNLS  368

Query  820   SIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEA  719
             SI FD K  TLYLP ++LD+NSE  +RNLVAYEA
Sbjct  369   SIGFDTKMATLYLPAISLDVNSEAFMRNLVAYEA  402



>gb|KDO52339.1| hypothetical protein CISIN_1g0411282mg, partial [Citrus sinensis]
Length=446

 Score =   394 bits (1013),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 224/482 (46%), Positives = 302/482 (63%), Gaps = 48/482 (10%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN   DE +W+I+I +TLE E E + +  V IF VPKTLM  DP+ Y P+ VAIGPYHY 
Sbjct  9     PNF--DEHRWIINILRTLEEEPETDTDFPVCIFSVPKTLMSSDPDSYTPKEVAIGPYHYW  66

Query  1792  NPELHEMERHKLDAAKIFQKQLR-TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWM  1616
              PEL+EMER+KL AAK  Q+      K   + +++ ++E +IR  Y   LN   E LAWM
Sbjct  67    RPELYEMERYKLAAAKSAQRHFNGDHKFQDVVDQLKELELQIRACYHNFLNFSNEALAWM  126

Query  1615  MAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPF  1436
             MA+ ASFLLEFL++YA+K+GKL     S  MSHL+D  G K++HNA+LRD++MLENQIP 
Sbjct  127   MAIGASFLLEFLQIYAIKDGKLSKTYSSRSMSHLLDYAGTKAAHNAILRDMVMLENQIPL  186

Query  1435  FILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTI  1259
             F+LRKML+ +  S E++D++L  MLMG  +ELSPFK  +   ++ I+++ HLLGYL+  +
Sbjct  187   FVLRKMLEFEYSSLESADEMLQAMLMGFCEELSPFKLMKDMPMINISESAHLLGYLYDMV  246

Query  1258  VPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALK  1079
             VP  +SE    EI E    + +    ++ +  +  Y    F +VW ++ KL   P R +K
Sbjct  247   VP--KSEQKASEIIEVVDDEGEAKQPQERYSTDLAYSNKLFREVWKLVSKLTIRPIRLIK  304

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKP--DGDENSDSKDNADKPP  905
                +L P+ ++L   ++ +               LF  G K   DG  +  S+ + +KPP
Sbjct  305   ---NLLPLLSILARQFQYL---------------LFREGNKSGDDGSSSHPSESDVNKPP  346

Query  904   SIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAY  725
              +EEITIPSVTEL  + V F                         LD+NS VVLRNLVAY
Sbjct  347   LVEEITIPSVTELYKSNVTF----------------------SALLDVNSNVVLRNLVAY  384

Query  724   EACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRL  545
             EA  A GPL+  RYTEFMNGI+DT+ED K LREKGIILNRLKSD+EVA+LWNGM++S+RL
Sbjct  385   EASNASGPLIFTRYTEFMNGIIDTEEDAKLLREKGIILNRLKSDAEVAHLWNGMSRSIRL  444

Query  544   TK  539
             TK
Sbjct  445   TK  446



>ref|XP_010489648.1| PREDICTED: putative UPF0481 protein At3g02645 [Camelina sativa]
Length=532

 Score =   396 bits (1018),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 226/522 (43%), Positives = 320/522 (61%), Gaps = 51/522 (10%)
 Frame = -3

Query  1957  DESKWVIHIQK--TlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE++WVI ++K    E E  +  ++ VSIF VPK LM   P+ Y P RV+IGPYH   PE
Sbjct  17    DETRWVIDVRKPLDAELEEHDLEQVTVSIFNVPKALMCSHPDKYTPHRVSIGPYHCLRPE  76

Query  1783  LHEMERHKLDAAKIFQKQLRT-IKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAV  1607
             LHEMER+KL  A+  + Q  +  + H L E++  +E +IR  Y K +    ETL W+MAV
Sbjct  77    LHEMERYKLMIARKIRNQCSSSFRFHDLVEKLQSMEVKIRACYHKYIAFNGETLLWIMAV  136

Query  1606  DASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFIL  1427
             D+SFL+EFLK+Y+ K           K+  L++  G    HN +LRDI+M+ENQIP F+L
Sbjct  137   DSSFLIEFLKIYSFK-----------KVETLINRVG----HNEILRDIMMIENQIPLFVL  181

Query  1426  RKMLQPQCP--SPEASDDLLLTMLMGLSKELSP----FKNEGSAVVQIADATHLLGYLFQ  1265
             R+ L+ Q P  S E++DDLL+++L GL ++LSP    F +      Q+ +  H+L +L+Q
Sbjct  182   RRTLEFQNPLDSIESADDLLVSVLTGLCRDLSPLVISFDDHEILKAQLHECNHILDFLYQ  241

Query  1264  TIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAF-GQVWGILKKLNKGPAR  1088
              IVP +E E  E+E +EN                N G     F G++            +
Sbjct  242   MIVPRIEEEEEEVEEEENRA------------CDNGGNRAVRFLGEI-----------KQ  278

Query  1087  ALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNAD--  914
               KR+ +      +L  PW+ I+ LPG   +K   + LF+  ++     +S S  + D  
Sbjct  279   QFKRVFASQTADLILRFPWRIISNLPGFMALKLSADYLFTRQEREAATTSSSSVSDQDIE  338

Query  913   KPPSIEEITIPSVTELANAGVRFIPTKKG-ILSIEFDAKTFTLYLPVVTLDINSEVVLRN  737
             KPP +EE+ IPSV++L  AGVRF  T  G + ++ FD+ +   +LPV+ LDIN+E VLRN
Sbjct  339   KPPLVEELAIPSVSDLHKAGVRFKATTNGNVSTVSFDSNSGHFHLPVINLDINTETVLRN  398

Query  736   LVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNK  557
             LVAYEA    GPLV  RYTE +NGI+D++EDV+ LRE+G++++RLKSD E A +WNGM+K
Sbjct  399   LVAYEASNTSGPLVFTRYTELINGIIDSEEDVRLLREQGVLVSRLKSDKEAAEMWNGMSK  458

Query  556   SVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQ  431
             SVRLTKV FLDKTI+DVN++Y  RW VK  R +  Y++GSWQ
Sbjct  459   SVRLTKVVFLDKTIEDVNRYYTGRWKVKIGRLVEVYVYGSWQ  500



>ref|XP_008809767.1| PREDICTED: putative UPF0481 protein At3g02645 [Phoenix dactylifera]
Length=471

 Score =   394 bits (1012),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 220/449 (49%), Positives = 306/449 (68%), Gaps = 19/449 (4%)
 Frame = -3

Query  1672  IRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKK  1493
             IR  Y + L+L  ETLAWMM +DASFLLEFL+ YA  EGK    + S  MSH+VD    K
Sbjct  31    IRSHYHRHLDLSGETLAWMMVIDASFLLEFLRNYADAEGKAFKKVPS--MSHMVDAARMK  88

Query  1492  SSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGS  1316
              ++N++LRDI+MLENQIP  ++R +L+ Q  S E +D  L TML+G  KE+SPFK  +  
Sbjct  89    LAYNSILRDIVMLENQIPLNLVRNILRLQSTSNEIADSQLSTMLIGFVKEVSPFKVMDNL  148

Query  1315  AVVQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAF  1136
             + +      HLL  L+  +VP+++ E    +I+++  + E    +    L +  YVK  F
Sbjct  149   SSIDTKRYAHLLQLLYGVVVPKVKEERGTNKIEDHIDVPESDKEKP---LTDPSYVKKLF  205

Query  1135  GQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESL-FSCGQ  959
               VW          +  +K L    P K ++ +PWK I+ LPG++++  PIE+L FS   
Sbjct  206   NSVWS-----RASDSNIVKNLIK-KPFKFIVKVPWKIISHLPGISILAAPIENLLFS---  256

Query  958   KPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLP  779
                GD  S+ +++ ++PP +EEI +PSVTEL  AGV+F  T   + +I FD KT TL+LP
Sbjct  257   ---GDGRSEDEESGNRPPLVEEIMVPSVTELTKAGVKFSRTSGDLTTIAFDVKTATLHLP  313

Query  778   VVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLK  599
              V+LDIN+EV+LRNLVAYE  +  GP+V  RYTE ++GI+DT+EDVK LR+KGIILNR+K
Sbjct  314   TVSLDINTEVLLRNLVAYEMSVESGPMVFTRYTELISGIIDTEEDVKLLRQKGIILNRMK  373

Query  598   SDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltl  419
             +D EVANLWNGM+KSVRLTKVAF+DK + DVNKFY  RW+VK+++F+++Y+FGSWQ LTL
Sbjct  374   NDEEVANLWNGMSKSVRLTKVAFIDKVLVDVNKFYGSRWSVKSRKFVKTYVFGSWQILTL  433

Query  418   lativllllmvLQSFCSVYTCSRFFNDVT  332
             LAT++LLLL  +Q+FCSVY+C    + +T
Sbjct  434   LATVLLLLLTCVQAFCSVYSCGNHLSVIT  462



>ref|XP_009118403.1| PREDICTED: putative UPF0481 protein At3g02645 [Brassica rapa]
Length=521

 Score =   394 bits (1013),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 224/519 (43%), Positives = 321/519 (62%), Gaps = 59/519 (11%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee--nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DES+WVI+++K+L+ ELE+    ++ VSIF VPK LM    + Y PQRV+IGPYH   PE
Sbjct  18    DESRWVINVRKSLDAELEDHPLEQVTVSIFTVPKALMCTHRDSYTPQRVSIGPYHCLKPE  77

Query  1783  LHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVD  1604
             LHE ER+KL  A+ F+   ++ + H L E++  +E +IR  Y K + L  ETL W+MA+D
Sbjct  78    LHETERYKLTIARKFRNNSKSFRFHDLVEKLQSLEIKIRACYHKYIALSEETLLWIMAID  137

Query  1603  ASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
             +SFL+EFLKVY              K+  L++  G    HN +LRD++MLENQIP F+LR
Sbjct  138   SSFLIEFLKVYYG----------FGKVETLINRVG----HNEILRDVMMLENQIPLFVLR  183

Query  1423  KMLQPQCPSPEASDDLLLTMLMGLSKELSP----FKNEGSAVVQIADATHLLGYLFQTIV  1256
             K L+ Q  S E++D LL+++L GL ++LSP    F+N+     QI +  H+L +L+Q IV
Sbjct  184   KTLEVQLESTESADALLVSVLTGLCRDLSPLVIKFENDQILKAQIHEYNHILDFLYQMIV  243

Query  1255  PEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             P +E E  E E  E                                  KL +      KR
Sbjct  244   PRIEEEDEEEENREGENRGC----------------------------KLLREMKLKFKR  275

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKD--NADKPPS  902
             + +  P   +L +P + I+ LPG   +      LF+   + + +E S +    + +KPP 
Sbjct  276   VFASRPADVILRLPMRIISNLPGFIALN----YLFT---RQENEETSPTVSVLDIEKPPL  328

Query  901   IEEITIPSVTELANAGVRFIPTKKG-ILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAY  725
             + E+TIPSV+EL  AGV+F PT+ G + ++ FD+ +   +LPV+ LDIN+E VLRNLVAY
Sbjct  329   VSELTIPSVSELHKAGVKFKPTQNGNVSTVSFDSNSGHFHLPVINLDINTETVLRNLVAY  388

Query  724   EAC-IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVR  548
             EA   + GPLV  RYTE +NGI+D++EDV+ LRE+G++++RLKSD E A +WNGM+KSVR
Sbjct  389   EASNTSGGPLVFTRYTELINGIIDSEEDVRLLREQGVLVSRLKSDEEAAEMWNGMSKSVR  448

Query  547   LTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQ  431
             LT+V FLDKTI+DVN++Y  RW VK  RF+  Y++GSW+
Sbjct  449   LTRVGFLDKTIEDVNRYYTGRWKVKIGRFVEVYVYGSWK  487



>gb|KDO52341.1| hypothetical protein CISIN_1g044918mg, partial [Citrus sinensis]
Length=425

 Score =   390 bits (1002),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 216/442 (49%), Positives = 295/442 (67%), Gaps = 31/442 (7%)
 Frame = -3

Query  1660  YDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHN  1481
             Y K L    ETLAWMMA+DASFLLEFL++YA+K+ KL A   S  + HLVD  G K++HN
Sbjct  2     YHKYLKFSSETLAWMMAIDASFLLEFLQIYAMKDDKLPATSSSLSILHLVDYAGMKAAHN  61

Query  1480  ALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQ  1304
             A+LRD+ MLENQIP F+LRKMLQ Q  S E++D LL  ML+G  +E+SPFK  +   ++Q
Sbjct  62    AILRDMSMLENQIPIFVLRKMLQVQYSSSESADYLLQAMLIGFCEEVSPFKMKKYKPMIQ  121

Query  1303  IADATHLLGYLFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVW  1124
              ++  HLL YL+ TIVP+ E       ID+                  S   K  F ++W
Sbjct  122   ASECAHLLDYLYNTIVPKAEQRAAITGIDDQEIY--------------SDDSKRFFTELW  167

Query  1123  GILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLF----SCGQK  956
              +L K+       L R     P++ +  +P   ++K+PG +++  P+++L     + G K
Sbjct  168   KLLSKM------ILSR-----PIQFLFKLPCFMLSKIPGFSILAQPVKNLIFPQDNEGNK  216

Query  955   PDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPV  776
              D  E S S  + +KPP +EEITIPSVTELA + VRF+PT   I ++ FDAK   L+LP 
Sbjct  217   SDA-ERSPSNKHMNKPPLVEEITIPSVTELAKSNVRFLPTVGDISTVSFDAKKAILHLPT  275

Query  775   VTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKS  596
             ++LD+N+E+VLRNLVAYEA  A GPLVL RY+E MN I+DT++DV+ LRE G++LNRL+S
Sbjct  276   ISLDVNTELVLRNLVAYEASNASGPLVLTRYSELMNRIIDTEKDVELLRENGVVLNRLRS  335

Query  595   DSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltll  416
             D+EVA LWNG++KS+RLTKV  +D  I+DVNK+YN RW VK  +  +  +FGSWQFLT +
Sbjct  336   DAEVAKLWNGISKSIRLTKVPHIDIVIEDVNKYYNSRWRVKCWKNKKLNVFGSWQFLTFM  395

Query  415   ativllllmvLQSFCSVYTCSR  350
             AT++LLLL  LQ+FCS+Y C +
Sbjct  396   ATVMLLLLTALQAFCSIYDCRK  417



>ref|XP_008666123.1| PREDICTED: putative UPF0481 protein At3g02645 [Zea mays]
 tpg|DAA45945.1| TPA: hypothetical protein ZEAMMB73_973776 [Zea mays]
Length=537

 Score =   391 bits (1004),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 227/546 (42%), Positives = 317/546 (58%), Gaps = 36/546 (7%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             P +  DE++W++ I++  + E+E   +  + +F VPK L++  PE YVPQ +A+GPYH+ 
Sbjct  6     PTLPFDEARWIVRIRRIFDEEIEVSEDQPICVFDVPKPLLITKPEAYVPQLLALGPYHHC  65

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
               E+ +MER+KL AAK  Q  L  +    L +   K+E  +R  Y + LNL  E L WMM
Sbjct  66    REEICDMERYKLSAAKRAQSHLPDMDFQKLVDVFTKLEHLVRAHYHRHLNLSNEALGWMM  125

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAM--ISAKMSHLVDLKGKKSSHNALLRDIIMLENQIP  1439
             A+D SFLLEFL+    + G    A+  I ++MSHLVD   + SSH+ LLRD++MLENQ+P
Sbjct  126   AIDVSFLLEFLETLKNRNGNQQRALQRIPSRMSHLVDPSRRTSSHSMLLRDVVMLENQVP  185

Query  1438  FFILRKMLQPQCPSPEAS----DDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYL  1271
              F+L K ++ +C +  A       +L +ML GL +E+S F+  G     +    HLL +L
Sbjct  186   LFLLLKAIEARCSTAAAQLPPPQSVLSSMLAGLFQEVSTFRGIGRPCTDVDRHVHLLDFL  245

Query  1270  FQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPA  1091
             +  +VP    E    E               D    + G  KSA      +L       +
Sbjct  246   YSNMVPRCTEESHGAE------------EGGDASCHDHG--KSALNSAMDLLV------S  285

Query  1090  RALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADK  911
             R  K +S +A    VL +  K +  LP L+V+  PIE L      P          + D 
Sbjct  286   RGSKIVSVMA--DFVLRVLLKFVASLPCLSVLGDPIEQLTQHAAAP-------GVPDKDA  336

Query  910   PPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLV  731
              P +EEI +PSV ELA  GVRF PT  G+ +++F   T TL+LPV+ +D+NSEVVLRNLV
Sbjct  337   SPLLEEIAVPSVAELAYTGVRFCPTVGGLSTVDFCPATATLHLPVIGVDVNSEVVLRNLV  396

Query  730   AYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSV  551
             AYEA    GPLVLARY E MNGIVDT ED + LRE G++LN LKSD EVA LWNGM +SV
Sbjct  397   AYEAAAGLGPLVLARYVELMNGIVDTAEDARVLRECGVVLNHLKSDGEVAELWNGMTRSV  456

Query  550   RLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSW-QFltllativllllmvLQSF  374
             RLTKV  LD+ IDD+N+ Y   W V+ + F+++ +FGS  + L  +A ++L L + LQS 
Sbjct  457   RLTKVPALDRVIDDLNRHYGSCWKVRVRTFVKARVFGSCRELLACVALLLLFLFVGLQSI  516

Query  373   CSVYTC  356
             C ++ C
Sbjct  517   CVLHGC  522



>ref|XP_010687822.1| PREDICTED: putative UPF0481 protein At3g02645 [Beta vulgaris 
subsp. vulgaris]
Length=529

 Score =   390 bits (1002),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 231/551 (42%), Positives = 328/551 (60%), Gaps = 59/551 (11%)
 Frame = -3

Query  1945  WVIHI----QKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             WVIH+    ++    +  + ++  V ++ VPK L    PE Y P  +A+GPYH+   +L+
Sbjct  12    WVIHLRSFFEEKKLEDDVDTDDTTVCVYHVPKPLRALKPEAYSPNIIALGPYHHWRQDLY  71

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             E ER+KL  AK  QK+ + +K   L ++++K E +IR  Y K L++  E LAWM+A+D  
Sbjct  72    ETERYKLICAKKVQKEFKHLKFEDLVKKLLKKEHKIRGCYHKHLDMDGEALAWMIAIDGL  131

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL VY +K   L +   SA+MS LV   G+K +++ +LRDI+MLENQIPFF+L+K+
Sbjct  132   FLLEFLHVYVIKISSLAS---SARMSFLVKSMGRKLAYDLILRDILMLENQIPFFVLKKI  188

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L+ QC S + +++LL +MLMG+ +ELSP   +EG  + +     HLL  L+  IVP++E 
Sbjct  189   LRIQCLSSDLAENLLPSMLMGVCRELSPLVLDEGYPMSEAIQCAHLLDLLYHLIVPKLEQ  248

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNS--------GYVKSAFGQVWGILKKLNKGPARA  1085
                EI++                FL N         G +K  F   W +  KL       
Sbjct  249   GEEEIQV---------------TFLPNKFDEEDPSFGEIKEVFTNSWEMASKL-------  286

Query  1084  LKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGD---ENSDSKDNAD  914
                               K I+K+P ++ +   +ES+F   +   G    +N   + +A 
Sbjct  287   ------------------KIISKMPIVSAIAPALESIFLGNKHEKGSSTVKNGSLQKDAQ  328

Query  913   KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNL  734
               P +EEI IPSV  L +AGV F PT   I +I+FD K    YL VV +D N+EV++RNL
Sbjct  329   VIPLVEEIMIPSVENLCDAGVEFCPTNGDISTIQFDKKLMKFYLHVVLIDGNTEVLMRNL  388

Query  733   VAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS  554
             VAYEA     PLVL RYTE MNGI+DT +DV+ LR+K II+ RL  D EVANLWNGM K+
Sbjct  389   VAYEASATPCPLVLERYTELMNGIIDTAKDVEILRKKKIIVCRLLRDEEVANLWNGMTKA  448

Query  553   VRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSF  374
             +RLTKV+F+DK I+DVN ++N     K  +  + Y++ SW+ L +LAT++LL LMVLQSF
Sbjct  449   IRLTKVSFIDKAIEDVNGYFNNTLKRKLHKLTKRYVYNSWRILVVLATLLLLGLMVLQSF  508

Query  373   CSVYTCSRFFN  341
             CSVY+C RFFN
Sbjct  509   CSVYSCPRFFN  519



>ref|XP_004986874.1| PREDICTED: putative UPF0481 protein At3g02645-like [Setaria italica]
Length=534

 Score =   387 bits (994),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 218/511 (43%), Positives = 297/511 (58%), Gaps = 25/511 (5%)
 Frame = -3

Query  1885  VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKLHS  1706
             + +F VPK L+V  P  Y+PQ VA+GPYH+   EL +MER+KL AAK  Q  L       
Sbjct  34    ICVFDVPKPLLVTKPAAYIPQLVALGPYHHCREELGDMERYKLSAAKRAQSHLPGTDFQQ  93

Query  1705  LAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEG-KLMAAMISA  1529
             L +   K+E  IR  Y + LNL  ETL WMMA+D SFLLEFL+ ++     +     I +
Sbjct  94    LVDAFTKLEHLIRAHYHRHLNLSNETLGWMMAIDVSFLLEFLQTFSTNNNQRATLQRIPS  153

Query  1528  KMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLS  1349
             +MSHLVD   + SSH+ LLRDI+MLENQIP  +L K L+ +C S + +  +L +ML+G  
Sbjct  154   RMSHLVDSSRRTSSHSMLLRDIVMLENQIPLILLLKALETRCSSAQPAQSVLSSMLIGFF  213

Query  1348  KELSPFKNEGSAVVQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkekkdgeedEF  1169
             +E+S F+  G     I    HLL +L+  +VP                         DE 
Sbjct  214   QEVSTFRGIGCPRTDINRHAHLLDFLYSNMVPRYAD--------------AATGEAGDES  259

Query  1168  LKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKG  989
                  Y K     V  +L K      R  + +S +       L+  K I  LP L+++  
Sbjct  260   CHRHDYRKRTLNSVMELLVK------RGSQIMSVIIDFMVRFLL--KFIASLPCLSILGE  311

Query  988   PIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEF  809
             PIE L     +P G   +    N +  P  EEI +PSVTELA  GVRF PT   + +++F
Sbjct  312   PIEQLTQQASEPRG--GASDVQNKNTSPLFEEIAVPSVTELAYTGVRFCPTVGDLSTVDF  369

Query  808   DAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLR  629
                T TL+LPV+ +D+NSEV+LRNLVAYEA +A GPL LARY E MNGI+DT+ED + LR
Sbjct  370   CPATATLHLPVIGVDVNSEVLLRNLVAYEASVAAGPLALARYVELMNGIIDTEEDARLLR  429

Query  628   EKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSY  449
             E G+ILN LKSD EVA LWNGM +SVRLT+V  LD+ ID++N+ +   W V+ + F+R+ 
Sbjct  430   ECGVILNHLKSDREVAELWNGMTRSVRLTRVPALDRVIDELNRHHGGCWKVRVRAFVRAR  489

Query  448   IFGSWQFltllativllllmvLQSFCSVYTC  356
             + GS + L  +A +VL+L + LQ+FC V  C
Sbjct  490   VLGSRELLACVALVVLVLFVGLQAFCVVRGC  520



>ref|XP_010250393.1| PREDICTED: putative UPF0481 protein At3g02645 [Nelumbo nucifera]
Length=390

 Score =   380 bits (975),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 204/388 (53%), Positives = 271/388 (70%), Gaps = 9/388 (2%)
 Frame = -3

Query  1489  SHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAV  1310
             +HNA+LRDI MLENQIP F LRK+L  QC SP+ +DDLL  +LMGL KELSP K E  ++
Sbjct  2     AHNAILRDITMLENQIPMFALRKILGFQCSSPDVADDLLSFILMGLCKELSPLKTENFSL  61

Query  1309  VQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQ  1130
             +Q++   HLL  L++ IVP  +     ++ +EN   +E K  E  +   +S  +K    +
Sbjct  62    LQVSQHAHLLDLLYRVIVPNSDEPQEVLDCEENEQNEETKVEEGSD--SSSSNIKQLLSE  119

Query  1129  VWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQ---  959
             +W ++   N G  R L+++  L P+K +  +PWK I  LPG++++K PI+  F   Q   
Sbjct  120   IWKLISAFNIGMVRLLEKILLLRPIKLIFALPWKMIPNLPGISIIKEPIDKFFVSHQDKE  179

Query  958   --KPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLY  785
               KPD +     K   +K P +EEI IPSV+EL N+GV F  T   I ++ FD KT +LY
Sbjct  180   TIKPDNESLRSQK--IEKHPLVEEIMIPSVSELHNSGVNFCKTNGNITTVGFDEKTTSLY  237

Query  784   LPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNR  605
             LP ++LD+N+EV++RNLVAYEA  A GPLV  RYTE MNGI+DT EDVK LREKGII+NR
Sbjct  238   LPTISLDVNTEVMMRNLVAYEASSASGPLVFTRYTELMNGIIDTVEDVKLLREKGIIVNR  297

Query  604   LKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFl  425
             LKSD EVA LWNGM+KS+RLT+V FLDKTI+DVNK+YN RW VK  +FM+ Y+FGSW+ L
Sbjct  298   LKSDREVAKLWNGMSKSIRLTRVLFLDKTIEDVNKYYNGRWKVKASKFMKKYVFGSWKLL  357

Query  424   tllativllllmvLQSFCSVYTCSRFFN  341
             TL+ATI+LLLL  LQ+FCSVY+C+R F+
Sbjct  358   TLVATILLLLLTTLQAFCSVYSCARAFH  385



>gb|KHN01305.1| Putative UPF0481 protein [Glycine soja]
Length=429

 Score =   380 bits (975),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 211/446 (47%), Positives = 283/446 (63%), Gaps = 53/446 (12%)
 Frame = -3

Query  1804  YHYTNPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETL  1625
             YHY  PEL+EM+R+KL AAK FQKQL+++KL +L +++ K+E R+R  Y K L+   ETL
Sbjct  34    YHYWRPELYEMQRYKLAAAKRFQKQLQSLKLDNLVDQLTKLEQRVRACYHKFLDFNGETL  93

Query  1624  AWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQ  1445
              WMMA+DASFLLEFL+V  +++              +  +   KS  NA+LRDI+MLENQ
Sbjct  94    VWMMAIDASFLLEFLEVCTIQD--------------VTKVPEGKSYQNAILRDIVMLENQ  139

Query  1444  IPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLF  1268
             IP F+LRKM++ +  S EASD +L    +GL KE+SPFK  E    +Q++ + HLL +L+
Sbjct  140   IPMFVLRKMMEFKFSSLEASDQMLKLKFIGLFKEISPFKMMEEYPTIQVSKSAHLLDFLY  199

Query  1267  QTIVPEM--ESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGP  1094
               IVP +    + +E+E  +    +E  +    +F      VK  + ++W  L KLNKGP
Sbjct  200   HMIVPNILEGQDTIEVEFKQGEEEEEGNEESNADF----SQVKQLYSELWKRLSKLNKGP  255

Query  1093  ARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNAD  914
                                            V+K P+E LFS     + + +S +    +
Sbjct  256   -------------------------------VLKQPLEYLFS-QNGGESENSSSNSSLKN  283

Query  913   KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNL  734
             KPPS+EEIT+PSVTEL N+GVRF+PT   IL+I FDAKT T YLP + LD N+EV L+NL
Sbjct  284   KPPSVEEITVPSVTELLNSGVRFLPTNGSILNITFDAKTCTFYLPTIGLDANTEVFLKNL  343

Query  733   VAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS  554
             VAYEA +A GPLV+ RYTE MNGI+D+DED K LREKGIILN LKSD EVANLW+GM+K 
Sbjct  344   VAYEASVASGPLVVTRYTELMNGIIDSDEDAKILREKGIILNHLKSDKEVANLWSGMSKL  403

Query  553   VRLTKVAFLDKTIDDVNKFYNCRWNV  476
             +RL++   LDK I+DVNK+YN R  V
Sbjct  404   LRLSREPLLDKVIEDVNKYYNGRMKV  429



>ref|XP_009410371.1| PREDICTED: putative UPF0481 protein At3g02645 [Musa acuminata 
subsp. malaccensis]
Length=531

 Score =   382 bits (981),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 230/553 (42%), Positives = 327/553 (59%), Gaps = 52/553 (9%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEIN-VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +WV+H+++TLE   EE+     VSIFGVPK+ +   PE Y+PQ VA+GPYH+ + +L
Sbjct  18    DEVRWVLHVKRTLETMNEEDYSRGPVSIFGVPKSFLSVKPEAYIPQIVALGPYHHWDRQL  77

Query  1780  HEMERHKLDAAKIFQKQLR--TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAV  1607
             ++ME +KL A K  Q QL+        + +  +  E  IR  Y + ++L V+TLAWMMA+
Sbjct  78    YQMEHYKLAATKRIQNQLQLHGFTFQQIVDYCVLKEHAIRSCYHRHIDLHVDTLAWMMAI  137

Query  1606  DASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFIL  1427
             DASFLLEFL+ ++ ++G          MS + DL G K + N++LRD++MLENQIP F++
Sbjct  138   DASFLLEFLRNFSCEKG--------PSMSQMTDLMGIKMACNSILRDVVMLENQIPLFLI  189

Query  1426  RKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGS--AVVQIADATHLLGYLFQTIVP  1253
             RKML  Q  S +A++D L  ML+   K +SPF    S   +VQ+    HLL  L+  IV 
Sbjct  190   RKMLCFQRSSSQAAEDELSMMLVRFLKAVSPFTATQSLARIVQVKRYAHLLQLLYCIIVA  249

Query  1252  EME------SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPA  1091
             + +      + + EIE   +      +  +      +S Y    F  VW      +   A
Sbjct  250   DAKDMCSSSNNNNEIECVIDAAESNNEQNKV-----DSQYSTQLFDSVW------SSASA  298

Query  1090  RALKRLSSLAPVKTVLLMPWKAITKL-PGLNVMKGPIESLFSCGQKPDGDENSDSKDNAD  914
               +  L  + P++ +L +PW  +T +  G++    PI                       
Sbjct  299   LHIMNLLIVKPIEFLLKVPWPVVTAVFRGVSRSYNPIPG---------------------  337

Query  913   KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNL  734
             +P   EEI IPSVTEL  +GV+F  T+  + +IEFD KT T YLP +  D NSEVVLRNL
Sbjct  338   EPLLAEEIEIPSVTELIKSGVKFAATEGDLRTIEFDTKTATFYLPTMLFDANSEVVLRNL  397

Query  733   VAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS  554
             VAYE     GPLV  RYTE +NGI+DT EDV+ LR  G++ + +K+D EVA LWNGM++S
Sbjct  398   VAYETVAEPGPLVFTRYTELVNGIIDTKEDVRLLRRSGVVQHWMKNDEEVAKLWNGMSRS  457

Query  553   VRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSF  374
              R TKV FLDK I DVN +YN RW+V+ +RF+++Y+ GSWQ LT LA I+LLLL  + +F
Sbjct  458   ARPTKVDFLDKVISDVNGYYNSRWSVRARRFIKNYVTGSWQVLTFLAAILLLLLTCVDAF  517

Query  373   CSVYTCSRFFNDV  335
             CSV+ CS  ++ +
Sbjct  518   CSVFLCSSLWSSL  530



>ref|XP_006852809.1| hypothetical protein AMTR_s00033p00169500 [Amborella trichopoda]
 gb|ERN14276.1| hypothetical protein AMTR_s00033p00169500 [Amborella trichopoda]
Length=557

 Score =   383 bits (983),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 233/552 (42%), Positives = 338/552 (61%), Gaps = 29/552 (5%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee--nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE  WVI I+  LE+E  E   N + VSIF VPK L    PE + PQ V IGPYH+  PE
Sbjct  15    DEEAWVIQIRHHLEQEEIEGDDNGVPVSIFTVPKPLSNIKPEAFTPQLVGIGPYHHCRPE  74

Query  1783  LHEMERHKLDAAKIFQKQ---LRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
             L+EM+R+KL AA+  QKQ   L   KL S+ + + K ESR+R  Y + L+   ETLAWMM
Sbjct  75    LYEMQRYKLSAARRAQKQWGKLHCYKLQSVVDHISKFESRVRACYHRYLDFSGETLAWMM  134

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
             AVDA FLLEFLK Y  +      A +S++M +LVD   +KS+HNA++RD++M+ENQIP F
Sbjct  135   AVDACFLLEFLKAYGRRGEGESFARVSSRMENLVDFTRRKSAHNAIIRDLMMMENQIPLF  194

Query  1432  ILRKMLQPQCP--SPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQTI  1259
             +LRK L+ +    S +  +DL  +M+ G   E+SP K +  +  +++ + HLL  L++ +
Sbjct  195   LLRKRLELENSWGSNQVEEDLA-SMVSGFCAEISPLKVKPFSDKEVSQSGHLLEVLYRMM  253

Query  1258  VP------EMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKG  1097
             VP      + E +  E +  E    +    G  D  L +S  ++  F  V      ++  
Sbjct  254   VPWPNSQEDQEFDQAEPDCIEPESYEPSTAGCCDRELLSS--LRELFSSV------MSSP  305

Query  1096  PARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNA  917
             P R L+ L +  P+K +L +PW     +P L  +   I  L    +  +   +S+ + + 
Sbjct  306   PFRPLQSLLNSRPLKVLLKLPWN----IPFLKTL---IVYLIFSDKSNEERASSNVEGSI  358

Query  916   DKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRN  737
              K P +EE+ IPSVT+L NAGV   P+  GI SI+FD  + +L LP ++LD NSE+++RN
Sbjct  359   SKAPLMEELHIPSVTDLCNAGVTLSPSTGGISSIQFDPASGSLSLPSISLDCNSEIIIRN  418

Query  736   LVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNK  557
             LVA+E   A GPL+  RYTE MNGI+DT  DV  +RE+GI+++ LKSD  VA LWNGM++
Sbjct  419   LVAFEEASAPGPLIFTRYTELMNGIIDTKRDVALMRERGILVHHLKSDKVVAELWNGMSR  478

Query  556   SVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQS  377
             +V   KV  LD+ I++VNK+Y   W V   +F+R Y++G W+ LT++AT+VLLL   +Q+
Sbjct  479   TVSHNKVEGLDRVIEEVNKYYGRSWRVVMAKFLRRYVYGWWRGLTVVATVVLLLFTGMQA  538

Query  376   FCSVYTCSRFFN  341
             FCSVY C R+ +
Sbjct  539   FCSVYVCRRWLS  550



>ref|XP_008809765.1| PREDICTED: putative UPF0481 protein At3g02645 [Phoenix dactylifera]
Length=422

 Score =   373 bits (958),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 207/426 (49%), Positives = 291/426 (68%), Gaps = 17/426 (4%)
 Frame = -3

Query  1615  MAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPF  1436
             M +DASFLLEFL+ YA  EGK      S  MSH+VD +  K ++N++LRDI+MLENQIP 
Sbjct  1     MVIDASFLLEFLRNYADAEGKAFKKATS--MSHMVDAERMKLAYNSILRDIVMLENQIPL  58

Query  1435  FILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTI  1259
              I+RK+L+ Q  S E +D  L TML+G  KE+SPFK  +  + +      HLL  L+  +
Sbjct  59    NIVRKILRFQSTSCEIADRQLSTMLIGFVKEVSPFKVMDNLSSIDTKRYAHLLQLLYFVV  118

Query  1258  VPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALK  1079
             VP+++ E    EI+++  + E  + +      +  YVK  F  VW      +   ++ +K
Sbjct  119   VPKVKEESKTNEIEDHVDVPESNEEKPPT---DPSYVKQLFNSVWS-----SASDSKIVK  170

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSI  899
              L  + P K +  +PWK IT LPG++++  PI +LF  G     D  S+ +++ ++PP +
Sbjct  171   VLI-IKPFKFIAKVPWKIITHLPGISILAAPIGNLFFSG-----DGKSEDEESGNRPPLV  224

Query  898   EEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEA  719
             EEI +PSVTEL  AGV+F PT   + +I FD KT TL+LP V+LD N+EV+LRNLVAYE 
Sbjct  225   EEIMVPSVTELTKAGVKFSPTSGDLTTIAFDVKTATLHLPTVSLDTNTEVLLRNLVAYEM  284

Query  718   CIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTK  539
              +  GP+V  RYTE +NGI+DT EDVK LR+KGIILNR+K+D EVA LWNGM+KSVRLTK
Sbjct  285   SVESGPMVFTRYTELINGIIDTKEDVKLLRQKGIILNRMKNDEEVAKLWNGMSKSVRLTK  344

Query  538   VAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYT  359
             VAF+DK + DVNKFY+ RW+VK+++F ++Y+FGSWQ LTLLAT++LL+L  +++FCSVY+
Sbjct  345   VAFIDKVLVDVNKFYDSRWSVKSRKFAKAYVFGSWQILTLLATVLLLVLTCVEAFCSVYS  404

Query  358   CSRFFN  341
             C   ++
Sbjct  405   CGNHWS  410



>ref|XP_007135784.1| hypothetical protein PHAVU_010G1581000g, partial [Phaseolus vulgaris]
 gb|ESW07778.1| hypothetical protein PHAVU_010G1581000g, partial [Phaseolus vulgaris]
Length=414

 Score =   371 bits (952),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 202/399 (51%), Positives = 281/399 (70%), Gaps = 6/399 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI+I+KTLE ELEE+ E  VSIF VPK LM  DP+ YVPQ+VAIGPYHY  PEL+
Sbjct  18    DEHRWVINIRKTLEEELEEDGEFAVSIFSVPKLLMASDPDSYVPQQVAIGPYHYWRPELY  77

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EM+R+K+ AAK FQK+L++ KL +L +++  +E R+R  Y K L+   ETL WMMAVDA 
Sbjct  78    EMQRYKIAAAKRFQKRLQSCKLETLVDQLTNLEQRVRACYHKFLDFNGETLVWMMAVDAL  137

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+V+A++EG      +S+ MSHLVD  GKKS+HNA+LRDI+MLENQIP F+LRKM
Sbjct  138   FLLEFLQVFAMQEGA-KVQRVSSSMSHLVDYAGKKSAHNAILRDIVMLENQIPLFVLRKM  196

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPEMES  1241
             L+ +  S EA+D++L+ M +GL KE+SPFK  E    +++A++ HLL +L+  IVP++E 
Sbjct  197   LEFKFSSLEAADEMLILMFIGLFKEISPFKMMEEFPNIRVAESVHLLDFLYDVIVPKLE-  255

Query  1240  EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLA  1061
             +  +   +E    +E++    +E   +S +VK  F ++W IL KLNKGP + +K++S   
Sbjct  256   QQPDTVENEVEQEEEQQKEGNEEESADSSHVKQFFNELWKILSKLNKGPMKLMKKVSVSK  315

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNA---DKPPSIEEI  890
             P+K    +PWK ++ LPGL ++K P+E++F   +K D    S S  +    +KPPS+EEI
Sbjct  316   PLKVFAQLPWKIVSNLPGLKLLKQPVENMFFSQEKGDEKGESGSSSSKSLMNKPPSVEEI  375

Query  889   TIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVV  773
             TIPSVT+L N G+RF+ T   I SI FDAKT T YLP +
Sbjct  376   TIPSVTDLLNCGIRFVATTGSISSISFDAKTRTFYLPTI  414



>gb|EEE59435.1| hypothetical protein OsJ_11607 [Oryza sativa Japonica Group]
Length=529

 Score =   374 bits (961),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 219/541 (40%), Positives = 328/541 (61%), Gaps = 23/541 (4%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN+Q DE++W+I I++ L+ E+E  +   +SIF VPK L+   PE Y PQ VA+GPYH+ 
Sbjct  5     PNLQFDEAQWIIRIKRILDEEIEVHDSQPISIFDVPKPLLCTKPEAYTPQLVALGPYHHC  64

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
               EL +ME +KL AA+  Q+ L  +    L      +E  IR  Y + L L  + LAWMM
Sbjct  65    REELRDMEMYKLSAARRAQRHLPGMSFQQLVAVFATLEFEIRAYYHRHLGLSNDALAWMM  124

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAM--ISAKMSHLVDLKGKKSSHNALLRDIIMLENQIP  1439
             A+D SFLLEFL+ ++ ++    AA+  I ++MSHLVD   + SSH  +L D++MLENQIP
Sbjct  125   AIDVSFLLEFLQTFS-QDSSQRAALQRIPSRMSHLVDPSRRTSSHTMVLHDVVMLENQIP  183

Query  1438  FFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQTI  1259
              F+L K  + +  S   ++ +L ++L G  +E+S     GS         HLL +L+  +
Sbjct  184   LFLLLKATEMRGSSRATAESVLSSVLSGFFQEVSSLVATGSPCTDTTRHAHLLDFLYSNM  243

Query  1258  VPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALK  1079
              P     +VE     +     ++  ++D+  ++  ++KS    +  +L K      R  K
Sbjct  244   APC----YVE---GLDLDDATEQADDDDDDDQSKHHMKSTLRSLTDLLIK------RVTK  290

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGD-ENSDSKDNADKPPS  902
              LS L  +   +++  K +T++P L+++   + S  + GQ+P  D +N+ S  +    P 
Sbjct  291   FLSVLVDLGVRIIL--KLLTRIPCLSMIAQQLNSQPTQGQQPIKDFQNNKSCVS----PL  344

Query  901   IEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYE  722
             +EEI +P V ELA +GVRF+P   GI +IEF A+  TL LPV+ +D+NSEVVLRN+VA+E
Sbjct  345   LEEIAVPCVAELAYSGVRFVPANGGISTIEFCAEAATLRLPVIRVDVNSEVVLRNMVAFE  404

Query  721   ACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLT  542
             A   +  LVLARY E MNGI+DTDED + LRE G+ILN LKSD EVA LWNGM +SVRLT
Sbjct  405   ASTGRRALVLARYVELMNGIIDTDEDARLLRESGVILNHLKSDREVAELWNGMTRSVRLT  464

Query  541   KVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVY  362
             +V  LD+ IDD+N+ ++  W V+  RF+++ + GS + +  +   +L+L M LQ+FC   
Sbjct  465   RVPALDRVIDDLNRHHDSCWKVRINRFLKARVLGSRELVACITMALLILFMSLQAFCIAR  524

Query  361   T  359
             T
Sbjct  525   T  525



>gb|AAT81750.1| hypothetical protein [Oryza sativa Japonica Group]
Length=553

 Score =   374 bits (961),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 218/540 (40%), Positives = 325/540 (60%), Gaps = 21/540 (4%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN+Q DE++W+I I++ L+ E+E  +   +SIF VPK L+   PE Y PQ VA+GPYH+ 
Sbjct  29    PNLQFDEAQWIIRIKRILDEEIEVHDSQPISIFDVPKPLLCTKPEAYTPQLVALGPYHHC  88

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
               EL +ME +KL AA+  Q+ L  +    L      +E  IR  Y + L L  + LAWMM
Sbjct  89    REELRDMEMYKLSAARRAQRHLPGMSFQQLVAVFATLEFEIRAYYHRHLGLSNDALAWMM  148

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAM-ISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPF  1436
             A+D SFLLEFL+ ++    +  A   I ++MSHLVD   + SSH  +L D++MLENQIP 
Sbjct  149   AIDVSFLLEFLQTFSQDSSQRAALQRIPSRMSHLVDPSRRTSSHTMVLHDVVMLENQIPL  208

Query  1435  FILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQTIV  1256
             F+L K  + +  S   ++ +L ++L G  +E+S     GS         HLL +L+  + 
Sbjct  209   FLLLKATEMRGSSRATAESVLSSVLSGFFQEVSSLVATGSPCTDTTRHAHLLDFLYSNMA  268

Query  1255  PEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
             P     +VE     +     ++  ++D+  ++  ++KS    +  +L K      R  K 
Sbjct  269   PC----YVE---GLDLDDATEQADDDDDDDQSKHHMKSTLRSLTDLLIK------RVTKF  315

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGD-ENSDSKDNADKPPSI  899
             LS L  +   +++  K +T++P L+++   + S  + GQ+P  D +N+ S  +    P +
Sbjct  316   LSVLVDLGVRIIL--KLLTRIPCLSMIAQQLNSQPTQGQQPIKDFQNNKSCVS----PLL  369

Query  898   EEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEA  719
             EEI +P V ELA +GVRF+P   GI +IEF A+  TL LPV+ +D+NSEVVLRN+VA+EA
Sbjct  370   EEIAVPCVAELAYSGVRFVPANGGISTIEFCAEAATLRLPVIRVDVNSEVVLRNMVAFEA  429

Query  718   CIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTK  539
                +  LVLARY E MNGI+DTDED + LRE G+ILN LKSD EVA LWNGM +SVRLT+
Sbjct  430   STGRRALVLARYVELMNGIIDTDEDARLLRESGVILNHLKSDREVAELWNGMTRSVRLTR  489

Query  538   VAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYT  359
             V  LD+ IDD+N+ ++  W V+  RF+++ + GS + +  +   +L+L M LQ+FC   T
Sbjct  490   VPALDRVIDDLNRHHDSCWKVRINRFLKARVLGSRELVACITMALLILFMSLQAFCIART  549



>gb|AAR06336.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF97402.1| pentatricopeptide, putative [Oryza sativa Japonica Group]
Length=582

 Score =   374 bits (961),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 219/541 (40%), Positives = 328/541 (61%), Gaps = 23/541 (4%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN+Q DE++W+I I++ L+ E+E  +   +SIF VPK L+   PE Y PQ VA+GPYH+ 
Sbjct  58    PNLQFDEAQWIIRIKRILDEEIEVHDSQPISIFDVPKPLLCTKPEAYTPQLVALGPYHHC  117

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
               EL +ME +KL AA+  Q+ L  +    L      +E  IR  Y + L L  + LAWMM
Sbjct  118   REELRDMEMYKLSAARRAQRHLPGMSFQQLVAVFATLEFEIRAYYHRHLGLSNDALAWMM  177

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAM--ISAKMSHLVDLKGKKSSHNALLRDIIMLENQIP  1439
             A+D SFLLEFL+ ++ ++    AA+  I ++MSHLVD   + SSH  +L D++MLENQIP
Sbjct  178   AIDVSFLLEFLQTFS-QDSSQRAALQRIPSRMSHLVDPSRRTSSHTMVLHDVVMLENQIP  236

Query  1438  FFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQTI  1259
              F+L K  + +  S   ++ +L ++L G  +E+S     GS         HLL +L+  +
Sbjct  237   LFLLLKATEMRGSSRATAESVLSSVLSGFFQEVSSLVATGSPCTDTTRHAHLLDFLYSNM  296

Query  1258  VPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALK  1079
              P     +VE     +     ++  ++D+  ++  ++KS    +  +L K      R  K
Sbjct  297   APC----YVE---GLDLDDATEQADDDDDDDQSKHHMKSTLRSLTDLLIK------RVTK  343

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGD-ENSDSKDNADKPPS  902
              LS L  +   +++  K +T++P L+++   + S  + GQ+P  D +N+ S  +    P 
Sbjct  344   FLSVLVDLGVRIIL--KLLTRIPCLSMIAQQLNSQPTQGQQPIKDFQNNKSCVS----PL  397

Query  901   IEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYE  722
             +EEI +P V ELA +GVRF+P   GI +IEF A+  TL LPV+ +D+NSEVVLRN+VA+E
Sbjct  398   LEEIAVPCVAELAYSGVRFVPANGGISTIEFCAEAATLRLPVIRVDVNSEVVLRNMVAFE  457

Query  721   ACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLT  542
             A   +  LVLARY E MNGI+DTDED + LRE G+ILN LKSD EVA LWNGM +SVRLT
Sbjct  458   ASTGRRALVLARYVELMNGIIDTDEDARLLRESGVILNHLKSDREVAELWNGMTRSVRLT  517

Query  541   KVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVY  362
             +V  LD+ IDD+N+ ++  W V+  RF+++ + GS + +  +   +L+L M LQ+FC   
Sbjct  518   RVPALDRVIDDLNRHHDSCWKVRINRFLKARVLGSRELVACITMALLILFMSLQAFCIAR  577

Query  361   T  359
             T
Sbjct  578   T  578



>ref|XP_008809764.1| PREDICTED: putative UPF0481 protein At3g02645 [Phoenix dactylifera]
Length=422

 Score =   367 bits (943),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 205/431 (48%), Positives = 280/431 (65%), Gaps = 21/431 (5%)
 Frame = -3

Query  1615  MAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPF  1436
             M +DASFLLEFL+ YA  EGK    + S  MSH+ D    K ++N++LRDI+MLENQIP 
Sbjct  1     MVIDASFLLEFLRNYADAEGKAFKKVPS--MSHMEDAARMKLAYNSILRDIVMLENQIPL  58

Query  1435  FILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTI  1259
              ++RK+L+ Q  S E +D  L TML+G  KE+SPFK  +  + +      HLL  L+  +
Sbjct  59    NLVRKILRFQSTSNEIADSQLSTMLIGFVKEVSPFKVMDNLSSIDTKRYAHLLQLLYSVV  118

Query  1258  VPEM--ESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARA  1085
             VP++  ESE  EIE   +      +         +  YVK  F  VW      N      
Sbjct  119   VPKVKEESETNEIEDHVDVPQSNGEKPPT-----DPSYVKKLFNSVWSSASDSN------  167

Query  1084  LKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPP  905
             + ++  + P K ++ +PWK I+ LPG++++  PI +LF  G     DE S      D+PP
Sbjct  168   IVKVLIIKPFKFIVKVPWKIISHLPGISILAAPIGNLFISGDGKSKDEES-----GDRPP  222

Query  904   SIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAY  725
              +EEI +PSVTEL  AGV+F PT   + +I FD K  TL+LP V+LDIN+EV+LRNLVAY
Sbjct  223   LVEEIMVPSVTELTRAGVKFSPTSGDLTTIAFDVKAATLHLPTVSLDINTEVLLRNLVAY  282

Query  724   EACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRL  545
             E  +  GP+V  RYTE +NGI+DT++DVK LR+KGIILNR+K+D EVA LWNGM+KSV L
Sbjct  283   EMSVESGPMVFTRYTELINGIIDTEKDVKLLRQKGIILNRMKNDEEVAKLWNGMSKSVSL  342

Query  544   TKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSV  365
             TKVAF+DK + DVNKFY+ RW+VK+++F ++Y+ GSWQ LT LAT +LLLL  +Q+FCSV
Sbjct  343   TKVAFIDKVLVDVNKFYDSRWSVKSRKFGKTYMIGSWQILTFLATGLLLLLTCVQAFCSV  402

Query  364   YTCSRFFNDVT  332
             Y C +  + + 
Sbjct  403   YGCGKHLSAIA  413



>ref|XP_006427516.1| hypothetical protein CICLE_v10027162mg [Citrus clementina]
 gb|ESR40756.1| hypothetical protein CICLE_v10027162mg [Citrus clementina]
Length=471

 Score =   365 bits (937),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 219/510 (43%), Positives = 302/510 (59%), Gaps = 53/510 (10%)
 Frame = -3

Query  1855  MVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTI----KLHSLAEEMM  1688
             M  DP+ Y PQ VAIGPYHY    L+EM  +KL   K   +  R I    K   + E++ 
Sbjct  1     MSSDPDSYTPQEVAIGPYHYWRQGLYEMITYKLVQRKELVQAQRHIDGDHKFQYVVEQLK  60

Query  1687  KVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVD  1508
             ++E +IR  Y K LN                             KL A   S  M  L+D
Sbjct  61    ELELKIRACYLKFLNF---------------------------SKLSATTSSISMLRLLD  93

Query  1507  LKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK  1328
               G K++HNA+LRD+++LENQIP F+LRK ++ Q  S E++DD+L  ML+G  +EL PF+
Sbjct  94    YAGTKAAHNAILRDMVILENQIPLFVLRKKIKVQYSSLESADDILQAMLLGFCQELLPFQ  153

Query  1327  N-EGSAVVQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGY  1151
               +    + +++  HLL +L+ TIVP+ E +    EI E    + +      ++  +  Y
Sbjct  154   ILKDIPKINVSERAHLLDFLYGTIVPKAEQKS---EITEVADDQGEDKQATQKYFGDQTY  210

Query  1150  VKSAF-GQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIES-  977
             +K    G V   L K                P+K    +PW  ++KLP ++++   I+  
Sbjct  211   IKKIIQGDVELFLSK----------------PLKLFFKLPWTVLSKLPLISILAQLIQYM  254

Query  976   LFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKT  797
             LF    K D + +  S  + +KPP +EEITIPSVTEL  + V F  T   IL+I FD  T
Sbjct  255   LFPEENKSDDEGSYSSNSDMNKPPLVEEITIPSVTELYKSSVSFSATNGNILTISFDTNT  314

Query  796   FTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGI  617
              TL+LP V+LD+NS+V+LRNLVAYEA  A G LV  RYTE MNGI+DT+EDVK LR KGI
Sbjct  315   ATLHLPSVSLDVNSKVILRNLVAYEASNASGTLVFTRYTELMNGIIDTEEDVKLLRRKGI  374

Query  616   ILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGS  437
             +LNRLKSD+EVA+LWNGM+KS++LTKV  L+K I+DVN +YN R  V+  ++ + Y+F S
Sbjct  375   LLNRLKSDAEVADLWNGMSKSIKLTKVPHLNKVIEDVNNYYNNRLTVRFWKYTKLYVFSS  434

Query  436   WQFltllativllllmvLQSFCSVYTCSRF  347
             WQF TLLAT +LLLLM+ Q+FCS+Y C +F
Sbjct  435   WQFFTLLATNMLLLLMIWQAFCSIYNCRKF  464



>gb|EMT27622.1| hypothetical protein F775_15946 [Aegilops tauschii]
Length=576

 Score =   368 bits (945),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 248/577 (43%), Positives = 340/577 (59%), Gaps = 74/577 (13%)
 Frame = -3

Query  1945  WVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMER  1766
             WV  I+++L  E EE+ +  VS+F VPK L V+ PE Y PQ + +GPYH+ +PEL+ MER
Sbjct  25    WVKLIRESLTVEEEEDVDTRVSVFDVPKQLQVHKPEAYCPQFIGLGPYHHRHPELYGMER  84

Query  1765  HKLDAAKIFQKQLRTIK-------LHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAV  1607
             +K+DAA+   K+L           L  L  E+M  + ++R  Y + L L  E L+ MM +
Sbjct  85    YKIDAARRALKRLLCAAAGPSHDVLDELVNELMGHDLKVRAHYHRYLELSREALSLMMIM  144

Query  1606  DASFLLEFLKVY------AVKEGKLMAAMISAKMSHLVDL----KGKKSSHNALLRDIIM  1457
             D +FLLEFL ++        +EG+  ++  + +M HLVDL     G+KS+H  +LRD++M
Sbjct  145   DGAFLLEFLTIHHHTAAEGEREGEGASSSWTKRMEHLVDLGGSGTGRKSAHGLILRDMLM  204

Query  1456  LENQIPFFILRKMLQPQCPS---PEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADAT-  1289
             LENQIP F+L  M++ +C S    EAS  L L M+  L +EL PFK EG       D T 
Sbjct  205   LENQIPLFVL-AMIKAKCSSVSVDEASRRLTL-MVTELMRELCPFKMEGHFPETSCDVTK  262

Query  1288  --HLLGYLFQTIVP-------EMESEHVEIEIdenggmkekkdgeedEFLKNSGYV--KS  1142
               HLL  L+  +VP         E+ H       +     + +G      K S     + 
Sbjct  263   HAHLLELLYHLVVPVVPTPTDTTENAHTTPPFSGHIVEMPEPEGGGQGQEKPSACTGNEH  322

Query  1141  AFGQVWGILK-KLNKGPARALKRLSS-LAPVKTVLLMPWKAITKLPGLNVMKGPIESLFS  968
             A  Q++  +  KL  G      RL   + P++ V+  PW  +  +PG       +ES  S
Sbjct  323   AMMQLFEFIALKLKGG------RLGKVMKPIELVVKAPWNKLAGIPG-------VESFMS  369

Query  967   CGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILS----IEFDAK  800
                             AD   S +EITIPSV+EL ++GV+F PT  G LS    I FD K
Sbjct  370   ----------------ADA--SQQEITIPSVSELVSSGVKFKPTS-GDLSTASTIAFDRK  410

Query  799   TFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKG  620
             T TL LPVVTLD N+EVVLRNLVAYE+  A GPLVL RYTE MNGI+DTD+DV  LR++G
Sbjct  411   TATLRLPVVTLDGNTEVVLRNLVAYESSAASGPLVLTRYTELMNGIIDTDDDVALLRKRG  470

Query  619   IILNRLKS-DSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIF  443
             ++LN +K  D E A LWNGM++SV+ ++V  LDK I++VN++Y+ RW+VKTKRFMR Y+ 
Sbjct  471   VVLNHMKKRDGEAAKLWNGMSRSVQHSRVPALDKVIEEVNRYYDGRWSVKTKRFMRKYVL  530

Query  442   GSWQFltllativllllmvLQSFCSVYTCSR-FFNDV  335
              SW+ LT LATI +LLL  +Q+FCSVYTCSR +F D+
Sbjct  531   SSWKMLTFLATISMLLLTTVQAFCSVYTCSRWWFGDL  567



>ref|XP_006427510.1| hypothetical protein CICLE_v10027325mg, partial [Citrus clementina]
 gb|ESR40750.1| hypothetical protein CICLE_v10027325mg, partial [Citrus clementina]
Length=441

 Score =   363 bits (931),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 224/514 (44%), Positives = 304/514 (59%), Gaps = 88/514 (17%)
 Frame = -3

Query  1870  VPKTLMVYDP-ECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKLHSLAEE  1694
             VPKTLM  DP   Y PQ VAIGPYH+  PELHEMER+KL AA+  Q+Q            
Sbjct  1     VPKTLMSSDPVSLYTPQEVAIGPYHHLRPELHEMERYKLAAARRAQRQFYG---------  51

Query  1693  MMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHL  1514
                         D +L    +TLAWMMA+DASFLLEFL++YA+K+ KL+A   S  +SHL
Sbjct  52    ------------DHKL---YDTLAWMMAIDASFLLEFLQIYAMKDDKLLATSSSISISHL  96

Query  1513  VDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSP  1334
              D    K++HNA+LRD+ +           K+LQ +  S E++DDLL  MLMG  +E+S 
Sbjct  97    FDYAVMKAAHNAILRDMSI-----------KILQLRYLSSESADDLLQAMLMGFCEEVST  145

Query  1333  FK-NEGSAVVQIADATHLLGYLFQTIVP-EMESEHVEIEIdenggmkekkdgeedEFLKN  1160
             FK  +   ++Q +++ HLL YL+ T+VP + ++E  EI+  E                  
Sbjct  146   FKMKKNKPMIQASESAHLLDYLYNTVVPKQQQAEVTEIDGQEIY----------------  189

Query  1159  SGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIE  980
             S  +K  F ++W +  K+             L P+K +   P   ++K+PG +++  P++
Sbjct  190   SDDLKKFFSELWKLFSKM-----------ILLGPIKFLFKFPCFMLSKIPGFSILAQPVQ  238

Query  979   SLF----SCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIE  812
             +L     +   K D  E S S  + +KPP +EEITI SVT+LA                 
Sbjct  239   NLIFPQDNEENKSDA-ERSPSNKHMNKPPLVEEITILSVTDLAKV---------------  282

Query  811   FDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFL  632
                +T TL++  V+ D+ +EVVLRNLVAYEA  A GPLVL RY+EFMNGIVDT++DVK L
Sbjct  283   ---ETVTLHIHTVSFDVYTEVVLRNLVAYEASNASGPLVLTRYSEFMNGIVDTEKDVKLL  339

Query  631   REKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRS  452
             RE GI LNRL +D+E ANLW G+ KS+RLTKV  +D  I+DVNK+YN RW V   +  + 
Sbjct  340   RENGIFLNRLNNDAEFANLWKGITKSIRLTKVPHIDIVIEDVNKYYNSRWRVNYWKNKKL  399

Query  451   YIFGSWQFltllativllllmvLQSFCSVYTCSR  350
              +FGSWQFLT +ATI+LLLL  LQ+FCSVY C +
Sbjct  400   NVFGSWQFLTFMATIMLLLLTALQAFCSVYDCRK  433



>ref|XP_002465056.1| hypothetical protein SORBIDRAFT_01g031420 [Sorghum bicolor]
 gb|EER92054.1| hypothetical protein SORBIDRAFT_01g031420 [Sorghum bicolor]
Length=540

 Score =   363 bits (933),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 213/517 (41%), Positives = 299/517 (58%), Gaps = 33/517 (6%)
 Frame = -3

Query  1885  VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKLHS  1706
             + +F VPK L+   PE Y+PQ VAIGPYH+   +L +M+R KL AAK  Q  L  +    
Sbjct  35    ICVFDVPKPLLSTKPEAYIPQLVAIGPYHHCREQLCDMDRCKLSAAKRAQSHLPAMDFQH  94

Query  1705  LAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEG---KLMAAMI  1535
             L +    +E  +R  Y + LNL  E L WMMA+D SFLLEFL+ ++   G   ++    I
Sbjct  95    LVDVFTNLEHLVRAHYHRHLNLSNEALGWMMAIDVSFLLEFLQTFSKNGGNQQRVALQRI  154

Query  1534  SAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQ-CPSPEASDDLLLTMLM  1358
              ++MSHLVD   + SSH+ LLRD++MLENQ+P F+L K ++ + CP   A   +L +ML+
Sbjct  155   PSRMSHLVDPSRRTSSHSMLLRDVVMLENQVPLFLLLKAIESRRCPQSPAQT-VLSSMLV  213

Query  1357  GLSKELSPFKNEGSAVVQIADATHLLGYLFQTIVPEM-ESEHVEIEIdenggmkekkdge  1181
             G  +E+S F+  G          HLL +L+  +VP   E  H E   +            
Sbjct  214   GFFQEVSTFRGIGRPCTDANRHAHLLDFLYSNMVPRCAEESHGEAGDE------------  261

Query  1180  edEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLN  1001
                      + KS    V  +L       +R  K +S +  V  +L +  K I  LP L+
Sbjct  262   -----SCHDHRKSTLNSVMDLLV------SRGSKIVSVV--VDFLLRILLKFIASLPCLS  308

Query  1000  VMKGPIESLFSCGQKPDGDENSDS--KDNADKPPSIEEITIPSVTELANAGVRFIPTKKG  827
             V+  PIE L     +P G   +    +D   + P +EEI +PSV ELA  GVRF PT   
Sbjct  309   VLGEPIEQLTQHAAEPSGGAGAPGGVEDKNSRSPLLEEIAVPSVAELAYTGVRFCPTVGD  368

Query  826   ILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDE  647
             + +++F A T TL+LPVV +D+N+EVVLRNLVAYEA    GPL LARY E MNGI+DT+E
Sbjct  369   LSAVDFCAATATLHLPVVGVDVNTEVVLRNLVAYEAAAGLGPLALARYVELMNGIIDTEE  428

Query  646   DVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTK  467
             D + LRE G++LN L+SD EVA LWNGM +SVRLTKV  LD+ IDD+N+ Y   W V+ +
Sbjct  429   DARVLRECGVVLNYLRSDREVAELWNGMTRSVRLTKVPALDRVIDDLNRHYGGCWKVRVR  488

Query  466   RFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
              F+++ + GS +    +A ++L L + LQ+FC +  C
Sbjct  489   AFVKARLLGSRELFACVAVVLLFLFVGLQAFCVLRGC  525



>gb|EYU21692.1| hypothetical protein MIMGU_mgv1a019845mg [Erythranthe guttata]
Length=454

 Score =   356 bits (914),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 202/439 (46%), Positives = 282/439 (64%), Gaps = 16/439 (4%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +W+ HI+KTL+ ELEEE E  V+IFGVPK LM YDP  Y+PQ+VAIGPYH+  PE++
Sbjct  17    DEKEWINHIRKTLDEELEEETETPVTIFGVPKALMAYDPNSYIPQQVAIGPYHHLKPEVY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             +MER+K+ AAK  Q+ L+  +     + +MK E RIR SY + L    E LAWMMAVD S
Sbjct  77    DMERYKVAAAKRNQRDLQKSRFQDFIDHLMKFELRIRASYHRPLGFGCEALAWMMAVDVS  136

Query  1597  FLLEFLKVYAVKEGKLMAAMIS--AKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
             FL EF +V  VKEG     +    ++++ LVDL G K++H A+LRDI+M+ENQIP F++R
Sbjct  137   FLFEFFQVCGVKEGVYNKVLTKTPSRLARLVDLSGNKTAHGAILRDIVMMENQIPLFVMR  196

Query  1423  KMLQPQCPSPEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQTIVPE  1250
              +L+ Q  S + +D+ LL ML G+ +ELSPFK   EG   V + +  HLL +++  IVP 
Sbjct  197   MLLEFQFSSLDLADETLLAMLNGVGRELSPFKMAGEGPQKVAVNEYAHLLDFMYHFIVPF  256

Query  1249  MES-----EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARA  1085
              E+       +  E +E    ++    +   F K S +++    ++W IL  L +GP + 
Sbjct  257   KENLSSEIIEIHGEEEEVEEDEKGDTIKGGSFSKPS-HMRQLLNELWRILSTLKQGPVQW  315

Query  1084  LKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGD------ENSDSKD  923
             +KR+    P+K V+ +PW  +TK+P + +MK PIE +F+   K D        E+S +  
Sbjct  316   IKRIIFSKPLKFVVKLPWTILTKIPIIKMMKEPIEHMFAIFNKDDDKKNEDKLESSLTSS  375

Query  922   NADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVL  743
                KPP +EEITIPSVT+L+  GV+F+PT +GI SI FD KT T Y PV+ LD+NSEVVL
Sbjct  376   ILHKPPLLEEITIPSVTQLSKVGVQFLPTNEGIASISFDEKTLTFYFPVIKLDVNSEVVL  435

Query  742   RNLVAYEACIAKGPLVLAR  686
             RNLVAYEA   +GPL+L R
Sbjct  436   RNLVAYEASSVRGPLILTR  454



>gb|EMT20139.1| hypothetical protein F775_14017 [Aegilops tauschii]
Length=544

 Score =   358 bits (920),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 222/553 (40%), Positives = 315/553 (57%), Gaps = 50/553 (9%)
 Frame = -3

Query  1969  NIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN  1790
             N+  DE++W+I I++ LE E+E E++  +SIF V K L+   PE YVPQ VA+GPYH+  
Sbjct  6     NLPFDETQWIIRIRRILEEEIELEDDQPISIFHVLKPLLCTKPEAYVPQLVALGPYHHCR  65

Query  1789  PELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMA  1610
               L +ME +KL AAK  Q  L ++    L +     E RIR  Y +QLNL  ETLAWMMA
Sbjct  66    EGLRDMEMYKLSAAKRAQSHLTSMNFQQLVDVFATFEHRIRSHYHRQLNLTNETLAWMMA  125

Query  1609  VDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFI  1430
             +D SFLLEFL+ +   + +     + ++MSHLVD   + S H+ LLRDI+MLENQIP F+
Sbjct  126   IDMSFLLEFLQTFCETKNQRTLQRMPSRMSHLVDPSHRTSVHSMLLRDIVMLENQIPMFL  185

Query  1429  LRKMLQPQCPS----PEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQT  1262
             L K+++  C S    P  S   L ++L G  +E+   K   S         HLL +L+  
Sbjct  186   LVKLVEMWCSSGHGVPRPS---LSSILSGFFQEVCLLKGISSPCTDATRHAHLLDFLYSN  242

Query  1261  IVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARA-  1085
             ++P                                  V+ + G        L+  P R+ 
Sbjct  243   MLP-------------------------------CDCVEESDGGTEEAGDGLSDHPQRST  271

Query  1084  --------LKRLSSLAPVKT--VLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENS  935
                     +KR   LA + T  ++ M  K +  LP L++++ PIE L +     +    S
Sbjct  272   MSSITELLVKRGLKLASLVTDFMVRMFLKFLATLPCLSMVRQPIEQLATQRGALEPKGAS  331

Query  934   DSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINS  755
             D + N +  P +EEI +PS++ELA  GV F PT  GI +IEF A+T  L+LPV+++D+ +
Sbjct  332   DVQ-NRNISPLLEEIAVPSISELAYVGVTFTPTTGGISTIEFCARTAMLHLPVISIDMTT  390

Query  754   EVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANL  575
             EVVLRNLVAYEA I    LV ARY E MNGI+DTDED + LRE GIILN LKSD EVA L
Sbjct  391   EVVLRNLVAYEASIGSRALVFARYVELMNGIIDTDEDARLLREHGIILNHLKSDQEVAEL  450

Query  574   WNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativlll  395
             WNGM +SVRLT+V  LD+ ID++N+++   W V+   F+++++ GS   +     ++LLL
Sbjct  451   WNGMTRSVRLTRVPALDRVIDELNRYHGACWKVRAGTFVKAHLLGSRDMVACAMMVLLLL  510

Query  394   lmvLQSFCSVYTC  356
              + +Q+FC    C
Sbjct  511   FVGVQAFCLSRGC  523



>ref|XP_003581086.1| PREDICTED: putative UPF0481 protein At3g02645 [Brachypodium distachyon]
Length=562

 Score =   355 bits (910),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 226/545 (41%), Positives = 320/545 (59%), Gaps = 32/545 (6%)
 Frame = -3

Query  1969  NIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN  1790
             N   DE++W+I I++ L+ E+E  ++  +SIF VPK L+   PE YVPQ VA+GPYH+  
Sbjct  6     NCPFDETQWIIRIRRILDEEIELGDDQPISIFDVPKPLLCTKPEAYVPQLVALGPYHHCR  65

Query  1789  PELHEMERHKLDAAKIFQKQLR-TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
              EL + E +K+ AAK  Q  L  ++  H L +     E RIR  Y + LNL  ETLAWMM
Sbjct  66    EELRDTEMYKISAAKRAQSHLLPSMNFHQLVDVFATFEHRIRAHYHRHLNLSNETLAWMM  125

Query  1612  AVDASFLLEFLKVYAVKEG---KLMAAMISAKMSHLVDLKGKKSSHNA--LLRDIIMLEN  1448
             A+D SFL+EFL+          + +   I  +MSH V    + SS ++  LLRD +MLEN
Sbjct  126   AIDVSFLVEFLQTLCKTNNDNQRTVLERIPLRMSHQVGPSRRTSSSHSMLLLRDTVMLEN  185

Query  1447  QIPFFILRKMLQPQCPS-PEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADAT---HLL  1280
             QIP F++ K ++  C S  + ++ +L +ML    +E S  K   S +    DAT   HLL
Sbjct  186   QIPMFLIVKAVELMCSSRGQTAESVLSSMLSAFFQEASALKGISSPLC--TDATQHAHLL  243

Query  1279  GYLFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNK  1100
              +L+  IVP    E     ++E  G  E           +  +  SA      +L K   
Sbjct  244   HFLYNNIVPSFVEEESNGTVEEEDGDDEPC---------DHPHGSSAVNSTAELLVK---  291

Query  1099  GPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDN  920
                R LK  +SLA    ++ M  + +T LP L+V++ PIE L     +P+G  +SD +D 
Sbjct  292   ---RGLK-FASLA-TDFMVRMLLRLVTSLPCLSVLRHPIEHLLRQQNQPNG-ASSDVQDK  345

Query  919   ADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLR  740
              +  P +EEI +PS++ELA AGV F PT   + +IEF A+T TL+L V+++D  +EVVL+
Sbjct  346   NNMSPLLEEIAVPSISELAYAGVLFSPTNGDLSTIEFCAETSTLHLAVISIDTTTEVVLQ  405

Query  739   NLVAYEACI--AKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNG  566
             NLVAYEA I  +K PL+LARY E MNGI+DT ED + LRE+GII+N LKSD +VA LWNG
Sbjct  406   NLVAYEASIGSSKTPLILARYIELMNGIIDTGEDARLLRERGIIVNHLKSDQQVAELWNG  465

Query  565   MNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmv  386
             M +SVRLTKV  LD+ ID +N+ Y   W V+ + F++  + GS   +     + L LL+ 
Sbjct  466   MTRSVRLTKVPALDRVIDQLNRHYGSCWKVRIRMFVKRSLIGSRDLVACTVVVFLFLLVG  525

Query  385   LQSFC  371
             LQ+FC
Sbjct  526   LQAFC  530



>ref|XP_011042073.1| PREDICTED: putative UPF0481 protein At3g02645 isoform X2 [Populus 
euphratica]
Length=552

 Score =   338 bits (868),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 212/542 (39%), Positives = 310/542 (57%), Gaps = 25/542 (5%)
 Frame = -3

Query  1948  KWVIHIQKTlereleeenE-INVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEM  1772
             +WVIHI++TLE  +++E+  + V IF V K ++    E Y+PQ VAIGPYH+   EL EM
Sbjct  12    EWVIHIKRTLEEGIDDEDVGVPVCIFSVSKAMVSTKQEAYIPQLVAIGPYHHRRVELFEM  71

Query  1771  ERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFL  1592
             ER+KL  A+  QK+ R ++   +AE + + ++ +R  Y   L+   E LAW  A+DASFL
Sbjct  72    ERYKLIEAERVQKKYRNVRFSDIAEHLEENDANVRACYHAYLDFDREELAWTFAIDASFL  131

Query  1591  LEFLKVYAVKEGKLMAAMISAKMSHLVD-LKGKKSSHNALLRDIIMLENQIPFFILRKM-  1418
             L +L+ + ++  +  +   S+ ++ +V+ L  KK+   A+L D++MLENQIP F+LRK+ 
Sbjct  132   LGYLRTFIIRTEEPSSNRSSSSLADMVNHLAKKKTIRQAILGDMLMLENQIPLFVLRKVN  191

Query  1417  --LQPQCPSPEASDDLLLTMLMGLSKELSPFK---NEGSAVVQIADATHLLGYLFQTIVP  1253
                Q + P     D+ L  MLM   K  SP K    +     +     H+L  ++ T+ P
Sbjct  192   RYFQYENP-----DEALAMMLMKFCKHASPIKIVDGQQHVSEECLQKNHILDLIYCTVAP  246

Query  1252  EMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
             + E    EIE  +    +           + +G  K  +  +W  L  +   P R L R+
Sbjct  247   KFEDIGREIEESKERNEEH----------EENGCFKKTWKSIWSFLCFIIVVPLRFLIRI  296

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEE  893
                  VK  + +PWK I  +  L      I +L S  +    +  S S  N D    IE+
Sbjct  297   LKSKAVKAAVTLPWKLIKSVCHLKPT-SEITNLVSTAETVAAEIESVSALN-DASLLIEK  354

Query  892   ITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACI  713
             ++IPS T+L   GV+FIPTK G+ +I FD      YLPVV LD NSEV+LRNL+AYE C+
Sbjct  355   LSIPSATKLFGIGVKFIPTKGGLKTISFDKPRGAFYLPVVNLDDNSEVLLRNLLAYEDCL  414

Query  712   AKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVA  533
             A    V  RY E M+GI+DT EDVK LR+ GI+LNRLKSD E ANLW+G+ K + +TKV 
Sbjct  415   APECTVFTRYVELMSGILDTKEDVKILRDSGIVLNRLKSDEEAANLWHGITKFMNITKVP  474

Query  532   FLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCS  353
              LDK I+D + +Y+  W V+     + Y++ SW  LT LA  +L+LL  L++FCSVY CS
Sbjct  475   ILDKAIEDASAYYSNNWRVRISTSFKKYVYSSWPILTFLAADLLILLSALEAFCSVYDCS  534

Query  352   RF  347
             ++
Sbjct  535   KW  536



>ref|XP_002304763.2| hypothetical protein POPTR_0003s20490g [Populus trichocarpa]
 gb|EEE79742.2| hypothetical protein POPTR_0003s20490g [Populus trichocarpa]
Length=552

 Score =   338 bits (867),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 216/542 (40%), Positives = 315/542 (58%), Gaps = 25/542 (5%)
 Frame = -3

Query  1948  KWVIHIQKTlereleeenE-INVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEM  1772
             +WVIHI++TL+  +++E+  + V IF V K ++    E Y+PQ VAIGPYH+   EL EM
Sbjct  12    EWVIHIKRTLDEGIDDEDVGVPVCIFSVSKAIVSTKQEAYIPQLVAIGPYHHRRVELFEM  71

Query  1771  ERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFL  1592
             ER+KL  A+  QK+ + I+   + E + + ++ +R  Y   L+   E LAW  A+DASFL
Sbjct  72    ERYKLIEAERVQKKYQNIRFSDIVEHLEENDATVRACYHAYLDFDREELAWTFAIDASFL  131

Query  1591  LEFLKVYAVKEGKLMAAMISAKMSHLVD-LKGKKSSHNALLRDIIMLENQIPFFILRKM-  1418
             L +L+ + ++  +      S+ ++ +V+ L  KK+   A+L D++MLENQIPFF+LRK+ 
Sbjct  132   LGYLRTFTIRTEEPSRNRSSSSLADMVNHLAKKKTIRQAILGDMLMLENQIPFFVLRKVN  191

Query  1417  --LQPQCPSPEASDDLLLTMLMGLSKELSPFK---NEGSAVVQIADATHLLGYLFQTIVP  1253
                Q + P     D+ L  MLM   K  SP K    +     +     HLL  ++ T+ P
Sbjct  192   RYFQYENP-----DEALAMMLMKFCKHASPIKIVDGQQRVSEECLQKNHLLDLIYCTVAP  246

Query  1252  EMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
             +  SE +E         + ++  E +E  + +G  K  +  +W  L  +   P R L R+
Sbjct  247   K--SEDIE--------REIEESNEGNEEHEENGCFKKTWKSIWSFLCFIIVVPLRFLIRI  296

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEE  893
                  VK  + +PWK I  +  L      I +L S  +    +  S S  N D    IEE
Sbjct  297   LKSKAVKAAVTLPWKLIKSVCHLKPT-SEITNLVSTAETVAAEIESVSALN-DASLLIEE  354

Query  892   ITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACI  713
             ++IPS T+L   GV+FIPTK G+ +I FD      YLPVV LD +SEV+LRNLVAYEA +
Sbjct  355   LSIPSATKLFGIGVKFIPTKGGLKTISFDKPRGAFYLPVVNLDDDSEVLLRNLVAYEASL  414

Query  712   AKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVA  533
             A    VLARY E M+GI+DT EDVK LR+ GI+LNRLKSD E ANLW+G+ K ++LTKV 
Sbjct  415   APECTVLARYVELMSGILDTKEDVKILRDSGIVLNRLKSDEEAANLWHGITKFMKLTKVP  474

Query  532   FLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCS  353
              LD  I++ N +Y+  W V+     + Y++ SW  LT LA  +L+LL  L++FCSVY CS
Sbjct  475   ILDNAIEEANSYYSNNWKVRMSTSFKKYVYSSWPVLTFLAANLLILLSALEAFCSVYGCS  534

Query  352   RF  347
             ++
Sbjct  535   KW  536



>ref|XP_011042071.1| PREDICTED: putative UPF0481 protein At3g02645 isoform X1 [Populus 
euphratica]
 ref|XP_011042072.1| PREDICTED: putative UPF0481 protein At3g02645 isoform X1 [Populus 
euphratica]
Length=552

 Score =   337 bits (863),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 213/542 (39%), Positives = 312/542 (58%), Gaps = 25/542 (5%)
 Frame = -3

Query  1948  KWVIHIQKTlereleeenE-INVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEM  1772
             +WVIHI++TLE  +++E+  + V IF V K ++    E Y+PQ VAIGPYH+   EL EM
Sbjct  12    EWVIHIKRTLEEGIDDEDVGVPVCIFSVSKAMVSTKQEAYIPQLVAIGPYHHRRVELFEM  71

Query  1771  ERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFL  1592
             ER+KL  A+  QK+ R ++   +AE + + ++ +R  Y   L+   E LAW  A+DASFL
Sbjct  72    ERYKLIEAERVQKKYRNVRFSDIAEHLEENDANVRACYHAYLDFDREELAWTFAIDASFL  131

Query  1591  LEFLKVYAVKEGKLMAAMISAKMSHLVD-LKGKKSSHNALLRDIIMLENQIPFFILRKM-  1418
             L +L+ + ++  +  +   S+ ++ +V+ L  KK+   A+L D++MLENQIP F+LRK+ 
Sbjct  132   LGYLRTFIIRTEEPSSNRSSSSLADMVNHLAKKKTIRQAILGDMLMLENQIPLFVLRKVN  191

Query  1417  --LQPQCPSPEASDDLLLTMLMGLSKELSPFK---NEGSAVVQIADATHLLGYLFQTIVP  1253
                Q + P     D+ L  MLM   K  SP K    +     +     H+L  ++ T+ P
Sbjct  192   RYFQYENP-----DEALAMMLMKFCKHASPIKIVDGQQHVSEECLQKNHILDLIYCTVAP  246

Query  1252  EMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
             + E    EIE  +    +           + +G  K  +  +W  L  +   P R L R+
Sbjct  247   KFEDIGREIEESKERNEEH----------EENGCFKKTWKSIWSFLCFIIVVPLRFLIRI  296

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEE  893
                  VK  + +PWK I  +  L      I +L S  +    +  S S  N D    IE+
Sbjct  297   LKSKAVKAAVTLPWKLIKSVCHLKPT-SEITNLVSTAETVAAEIESVSALN-DASLLIEK  354

Query  892   ITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACI  713
             ++IPS T+L   GV+FI TK G+ +I FD      YLPVV LD +SEV+LRNLVAYEA +
Sbjct  355   LSIPSATKLFGIGVKFILTKGGLQTISFDRPRGAFYLPVVNLDDDSEVLLRNLVAYEASL  414

Query  712   AKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVA  533
             A    VLARY E M+GI+DT EDVK LR+ GI+LNRLKSD E ANLW+G+ K ++LT+V 
Sbjct  415   APECTVLARYVELMSGILDTKEDVKILRDSGIVLNRLKSDEEAANLWHGITKFMKLTEVP  474

Query  532   FLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCS  353
              LDK I++ N +Y+  W V+     + Y++ SW  LT LA  +L+LL  L++FCSVY CS
Sbjct  475   ILDKAIEEANSYYSNNWKVRISTSFKKYVYSSWPILTFLAANLLILLSALEAFCSVYGCS  534

Query  352   RF  347
             ++
Sbjct  535   KW  536



>ref|XP_011015933.1| PREDICTED: putative UPF0481 protein At3g02645 [Populus euphratica]
Length=552

 Score =   335 bits (859),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 212/542 (39%), Positives = 312/542 (58%), Gaps = 25/542 (5%)
 Frame = -3

Query  1948  KWVIHIQKTlereleeenE-INVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEM  1772
             +WVIHI++TLE  +++E+  + V IF V K ++    E Y+PQ VAIGPYH+   EL EM
Sbjct  12    EWVIHIKRTLEEGIDDEDVGVPVCIFSVSKAMVSTKQEAYIPQLVAIGPYHHRRVELFEM  71

Query  1771  ERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFL  1592
             ER+KL  A+  QK+ R ++   +AE + + ++ +R  Y   L+   E LAW  A+DASFL
Sbjct  72    ERYKLIEAERVQKKYRNVRFSDIAEHLEENDANVRACYHAYLDFDREELAWTFAIDASFL  131

Query  1591  LEFLKVYAVKEGKLMAAMISAKMSHLVD-LKGKKSSHNALLRDIIMLENQIPFFILRKM-  1418
             L +L+ + ++  +  +   S+ ++ +V+ L  KK+   A+L D++MLENQIP F+LRK+ 
Sbjct  132   LGYLRTFIIRTEEPSSNRSSSSLADMVNHLAKKKTIRQAILGDMLMLENQIPLFVLRKVN  191

Query  1417  --LQPQCPSPEASDDLLLTMLMGLSKELSPFK---NEGSAVVQIADATHLLGYLFQTIVP  1253
                Q + P     D+ L  MLM   K  SP K    +     +     H+L  ++ T+ P
Sbjct  192   RYFQYENP-----DEALAMMLMKFCKHASPIKIVDGQQHVSEECLQKNHILDLIYCTVAP  246

Query  1252  EMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
             + E    EIE  +    +           + +G  K  +  +W  L  +   P R L R+
Sbjct  247   KFEDIGREIEESKERNEEH----------EENGCFKKTWKSIWSFLCFIIVVPLRFLIRI  296

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEE  893
                  VK  + +PWK I  +  L      I +L S  +    +  S S  N D    IE+
Sbjct  297   LKSKAVKAAVTLPWKLIKSVCHLKPT-SEITNLVSTAETVAAEIESVSALN-DASLLIEK  354

Query  892   ITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACI  713
             ++IPS T+L   GV+FI TK G+ +I FD      YLPVV LD +SEV+LRNLVAYEA +
Sbjct  355   LSIPSATKLFGIGVKFILTKGGLQTISFDRPRGAFYLPVVNLDDDSEVLLRNLVAYEASL  414

Query  712   AKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVA  533
             A    VLARY E M+GI+DT EDVK LR+ GI+LNRLKSD + ANLW+G+ K ++LT+V 
Sbjct  415   APECTVLARYVELMSGILDTKEDVKILRDSGIVLNRLKSDEDAANLWHGITKFMKLTEVP  474

Query  532   FLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCS  353
              LDK I++ N +Y+  W V+     + Y++ SW  LT LA  +L+LL  L++FCSVY CS
Sbjct  475   ILDKAIEEANSYYSNNWKVRISTSFKKYVYSSWPILTFLAANLLILLSALEAFCSVYGCS  534

Query  352   RF  347
             ++
Sbjct  535   KW  536



>dbj|BAJ99504.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=553

 Score =   335 bits (858),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 204/547 (37%), Positives = 298/547 (54%), Gaps = 34/547 (6%)
 Frame = -3

Query  1966  IQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNP  1787
             ++  +S+WV  +++ +E   EE   +   +F VP+ L    PE Y PQ  A+GPYHY  P
Sbjct  26    LEEHQSRWVSQVRRRMEAGAEELGAV-AKVFDVPRLLRATRPEAYAPQHFALGPYHYQRP  84

Query  1786  ELHEMERHKLDAAKIFQKQLRT-IKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMA  1610
             EL +MER+KL AAK  +K      +   L ++ +K++  IR  Y++ L+L  +TLAWMMA
Sbjct  85    ELRDMERYKLAAAKRAEKLFTGDRRFDDLVQKFVKMQETIRAPYNRFLDLNGQTLAWMMA  144

Query  1609  VDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFI  1430
             +D  FLL+FL+ Y V    +   M+S+  + +          NA++RD +MLENQIP F+
Sbjct  145   IDTCFLLDFLESYHVD---VATDMVSSATNWI----------NAMVRDAMMLENQIPLFL  191

Query  1429  LRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVV-QIADATHLLGYLFQTIVP  1253
                 LQ +  S EA+ + + ++L    +++ P K    A+   IA   HLL  L+  +VP
Sbjct  192   FAGALQLRHASEEAAANAMHSVLHRFIRDVCPIKTTALAIAGDIAKHAHLLELLYHFLVP  251

Query  1252  EMESEHVE-IEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKR  1076
                    +  E+      +       ++ + +   VK A  QV       +  P R +K+
Sbjct  252   ASAVFAADGAELPPLVPEEVLSLDALEQQIPDYDKVKQACMQV----SSFDVAPVRFIKK  307

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIE  896
                  P+     +P   + K+P L+ M  P+   F      +      +       P  +
Sbjct  308   NLISKPMSAASSLPGLIMRKVPLLSAM-APLFGKFMASTDVEARLKGVNLATIINSPLAQ  366

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EI IPSV +LA  GVRF+P  +G+  I FDA T TL LPV+ LD N+EV+LRNLVAYE  
Sbjct  367   EIMIPSVAQLAACGVRFVPAPEGMAGIGFDAATATLTLPVLHLDSNTEVILRNLVAYETA  426

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
               +GPLVLARYTE MNGI+DT +DVK LRE  II N +KSD E A++WNGM ++VR TKV
Sbjct  427   AVRGPLVLARYTELMNGIIDTPKDVKILRECKIIFNAMKSDKEAADMWNGMCRAVRPTKV  486

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
               LD  I +VN   N R  VK +RF++ Y+F SW+             + LQ+FC+VY C
Sbjct  487   PLLDGVIREVNAHRNRRVAVKARRFLKRYVFRSWRL------------LTLQTFCTVYDC  534

Query  355   SRFFNDV  335
              R+F  +
Sbjct  535   KRWFGGI  541



>gb|KDO39093.1| hypothetical protein CISIN_1g036543mg [Citrus sinensis]
Length=417

 Score =   329 bits (843),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 211/509 (41%), Positives = 286/509 (56%), Gaps = 107/509 (21%)
 Frame = -3

Query  1855  MVYDP-ECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVE  1679
             M  DP   Y PQ VAIGPYH+  PELHEMER+KL AA+  Q+Q                 
Sbjct  1     MSSDPVSLYTPQEVAIGPYHHLRPELHEMERYKLAAARRAQRQFYG--------------  46

Query  1678  SRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKG  1499
                    D +L    +TLAWMMA+DASFLLEFL++YA+K+ KL+A   S  +SHL     
Sbjct  47    -------DHKL---YDTLAWMMAIDASFLLEFLQIYAMKDDKLLATSSSISISHL-----  91

Query  1498  KKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NE  1322
                                      K+LQ +  S E++DDLL  MLMG  +E+S FK  +
Sbjct  92    -------------------------KILQLRYLSSESADDLLQAMLMGFCEEVSTFKMKK  126

Query  1321  GSAVVQIADATHLLGYLFQTIVP-EMESEHVEIEIdenggmkekkdgeedEFLKNSGYVK  1145
                ++Q +++ HLL YL+ T+VP + ++E  EI+  E                  S  +K
Sbjct  127   NKPMIQASESAHLLDYLYNTVVPKQQQAEVTEIDGQEIY----------------SDDLK  170

Query  1144  SAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLF--  971
               F ++W +  K           +  L P+K +   P   ++K+PG +++  P+++L   
Sbjct  171   KFFSELWKLFSK-----------MILLGPIKFLFKFPCFMLSKIPGFSILAQPVQNLIFP  219

Query  970   --SCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKT  797
               +   K D  E S S  + +KPP +EEITI SVT+LA                    +T
Sbjct  220   QDNEENKSDA-ERSPSNKHMNKPPLVEEITILSVTDLAK------------------VET  260

Query  796   FTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGI  617
              TL++  V+ D+ +EVVLRNLVAYEA  A GPLVL RY+EFMNGIVDT++DVK LRE GI
Sbjct  261   VTLHIHTVSFDVYTEVVLRNLVAYEASNASGPLVLTRYSEFMNGIVDTEKDVKLLRENGI  320

Query  616   ILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGS  437
              LNRL +D+E ANLW G+ KS+RLTKV  +D  I+DVNK+YN RW V   +  +  +FGS
Sbjct  321   FLNRLNNDAEFANLWKGITKSIRLTKVPHIDIVIEDVNKYYNSRWRVNYWKNKKLNVFGS  380

Query  436   WQFltllativllllmvLQSFCSVYTCSR  350
             WQFLT +ATI+LLLL  LQ+FCSVY C +
Sbjct  381   WQFLTFMATIMLLLLTALQAFCSVYDCRK  409



>ref|XP_008678249.1| PREDICTED: putative UPF0481 protein At3g02645 [Zea mays]
 gb|AFW61124.1| hypothetical protein ZEAMMB73_302215 [Zea mays]
Length=571

 Score =   332 bits (852),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 225/565 (40%), Positives = 313/565 (55%), Gaps = 47/565 (8%)
 Frame = -3

Query  1969  NIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN  1790
             ++  DE +W+  +++TLER+  E       +  VP  L    PE Y+P   A+GPYH   
Sbjct  23    HLHFDEERWLSRVRRTLERDTAEALGAAAKVLEVPPVLRATRPEAYLPHHFALGPYHCDR  82

Query  1789  PELHEMERHKLDAAKIFQKQL-RTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
             PEL +MER+KL AAK  ++      KL  L + +++ + +IR  Y + L L  +TLAWMM
Sbjct  83    PELRDMERYKLAAAKRAERLFAEGHKLDHLVQCLLQEQDKIRAPYHRFLELSDQTLAWMM  142

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
             A+D  FLL+FL+ Y  +  +  A M+S+  +H +D         A +RD +MLENQIP F
Sbjct  143   AIDTCFLLDFLESYDHRH-EATAGMVSSA-THWID---------ATVRDAMMLENQIPLF  191

Query  1432  ILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGS-AVVQIADATHLLGYLFQTIV  1256
             +  + L  +   P A+ D L  +L    KE+SP K     AV  +A   H+L  L+  +V
Sbjct  192   LFSQALALR--HPNAAADALHAVLGRFIKEVSPIKTTAELAVADVARHAHMLELLYHFLV  249

Query  1255  PEMES-------------EHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGIL  1115
             P  +              E V I++ +    +++        L +   VK A  QV G  
Sbjct  250   PGFDGDDGAREPPPMVPEEFVTIDMLDPSQQQQQ--------LPDYDKVKQACMQVSG--  299

Query  1114  KKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENS  935
               L+  P R +K+     P++    +P K   K+P L  +  P+ +        DGD  +
Sbjct  300   --LDVAPVRFIKKNLISRPMRVASSLPGKITRKVPLLAAV-APLVTKLMASSSTDGDAEA  356

Query  934   DSKDNADKPPSI-----EEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVT  770
               K   D    I     +EITIPSV+ LA  GVRF P  +GI  I FDA T TL LPVVT
Sbjct  357   RLK-GVDLGSIISSALAQEITIPSVSTLARWGVRFAPAPEGIAGICFDAATATLRLPVVT  415

Query  769   LDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDS  590
             LD N+EVVLRNLVAYEA   +GPLVLARYTE MNGIVDT +DVK LR+ G+++N LKSD 
Sbjct  416   LDGNTEVVLRNLVAYEAVAVRGPLVLARYTELMNGIVDTPKDVKILRQSGVVVNHLKSDK  475

Query  589   EVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllat  410
             E A+LWNGM ++ RL KV  LD  I  VN   + R   + ++ ++ Y+F SW+ LTLLA 
Sbjct  476   EAADLWNGMCRATRLCKVPRLDAAIRAVNAHRSRRAASRARKLLKKYVFRSWRILTLLAA  535

Query  409   ivllllmvLQSFCSVYTCSRFFNDV  335
             +VLLL+   Q+FCSVY C+R    V
Sbjct  536   LVLLLMTATQTFCSVYPCTRSLGSV  560



>ref|XP_004974401.1| PREDICTED: putative UPF0481 protein At3g02645-like [Setaria italica]
Length=564

 Score =   326 bits (836),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 211/563 (37%), Positives = 310/563 (55%), Gaps = 49/563 (9%)
 Frame = -3

Query  1969  NIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN  1790
              +  DE +W+  ++++LERE  E       +F VP+ L    PE Y+PQ  A+GPYH   
Sbjct  21    GVNFDEERWLKRVRQSLEREAAEALGAAAKVFDVPRVLRATRPEAYLPQHFALGPYHCNR  80

Query  1789  PELHEMERHKLDAAKIFQKQL-RTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
             PEL +MER+KL AAK  +K      K   L + +++ + ++R  Y + L L  +TLAWMM
Sbjct  81    PELRDMERYKLAAAKRAEKLFAEGRKFDDLVQRLLEAQGKMRAPYHRFLELSDQTLAWMM  140

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
             A+D  FLL+FL+ Y  +E   +  M+S+  + +          NA  RD +MLENQ+P F
Sbjct  141   AIDTCFLLDFLESYHREE---VTDMVSSATNWI----------NATARDAMMLENQLPLF  187

Query  1432  ILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVV-QIADATHLLGYLFQTIV  1256
             +  + L  + P+ +A+ D L  +L    +E+SP K     VV  +A   H+L  L+  +V
Sbjct  188   LFSQALSLRHPAEQAATDALHAVLGRFIREVSPIKTAAELVVADVARHAHMLELLYHFLV  247

Query  1255  PE--------------MESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGI  1118
             P+              M  E   I++ +               L +   VK    Q    
Sbjct  248   PDASVFDGDADREPPPMVPEEFTIDMLDPSQQ-----------LPDYDKVK----QACVA  292

Query  1117  LKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDEN  938
             +  L+  P R +K+     P+     +P   + K+P L+ +   +  L S    PD +  
Sbjct  293   MSSLDVAPVRFIKKNLISRPMGLASSLPGMIMRKVPLLSAVAPLVTKLMS---SPDVEAR  349

Query  937   SDSKDNAD--KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLD  764
                 +       P  +EI IPSV+ LA  GVRF+P  +GI  I FDA T T+ LP++TLD
Sbjct  350   LKGVNFGTILNSPLAQEIMIPSVSTLARWGVRFVPAPEGIAGISFDAATTTMSLPIITLD  409

Query  763   INSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEV  584
              N+EVVLRNLVAYEA   +GPLVLARYTE MNGI+DT  DVK LR+ G+++N+LKSD E 
Sbjct  410   ANTEVVLRNLVAYEAVAVRGPLVLARYTELMNGIIDTARDVKILRQGGVVVNQLKSDREA  469

Query  583   ANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativ  404
             A++WNGM ++ RL+KV  LD  I +VN   + R   + ++ ++ Y+F SW+ LTLLA +V
Sbjct  470   ADMWNGMCRATRLSKVPRLDAAIREVNAHRSRRAAARAQKLLKRYVFRSWRILTLLAAVV  529

Query  403   llllmvLQSFCSVYTCSRFFNDV  335
             LLL+  +Q+FCSVY C  +F  V
Sbjct  530   LLLMTAMQTFCSVYPCKSWFGAV  552



>ref|XP_003573433.1| PREDICTED: putative UPF0481 protein At3g02645 [Brachypodium distachyon]
Length=566

 Score =   326 bits (835),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 213/547 (39%), Positives = 302/547 (55%), Gaps = 26/547 (5%)
 Frame = -3

Query  1960  NDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
              ++S+WV  +++ +E   EE   +   +F VP+ L    PE Y PQ  A+GPYHY  PEL
Sbjct  27    TEQSRWVSRVRQRMEAGAEELGAV-AKVFDVPRVLRATRPEAYAPQHFAVGPYHYQRPEL  85

Query  1780  HEMERHKLDAAKIFQKQLRTI-KLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVD  1604
              +MER+KL AAK  +K      K   L  + + ++  IR  Y + L L  + LAWMMA+D
Sbjct  86    RDMERYKLAAAKRAEKLFAGDNKFDDLVHKFVGMQDMIRAPYHRFLELNEQMLAWMMAID  145

Query  1603  ASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
               FLL+FL+ Y V        M+S+  S +          NA++RD +MLENQIP F+  
Sbjct  146   TCFLLDFLESYHVDSA---TDMVSSATSWI----------NAVVRDAMMLENQIPLFLFA  192

Query  1423  KMLQ-PQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVV-QIADATHLLGYLFQTIVPE  1250
               LQ     S +A+ D +  +     KE+ P K    A+   I+   HLL  L+  +VPE
Sbjct  193   GALQLRHYASEQAAADAMRGVFDRFIKEVCPIKTAALAIAGDISKHAHLLELLYHFLVPE  252

Query  1249  MESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLS  1070
              +    E         +E      ++ + +   VK A  QV      L+  P R +K+  
Sbjct  253   SDVFTAEDRELPPLVPEEICIDMLEQQVPDYDKVKQACFQV----SSLDVAPIRFIKKNL  308

Query  1069  SLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPD--GDENSDSKDNADKPPSIE  896
                P+     +P K + K+P L+ M   +  L S           N +S  N+   P + 
Sbjct  309   VSKPMSVASSLPGKIMRKVPLLSAMAPLVGKLMSSTDVESRLKGVNLNSIINS---PLMH  365

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             EI IPSVT+LA  GVRF P  +G+  I FDA T TL LP++ LD N+EV+LRNLVAYE  
Sbjct  366   EIMIPSVTQLAACGVRFAPALEGMAGISFDAVTATLTLPILHLDGNTEVILRNLVAYETA  425

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
               +GPLV+ARYTE MNGI+DT +DVK LRE  II+N +KSD E A++WNGM +++R +KV
Sbjct  426   AVRGPLVMARYTELMNGIIDTAKDVKILREAEIIVNGMKSDKEAADMWNGMCRAIRPSKV  485

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
               LD  I  VN   N +  V+ ++ ++ Y+F SW+ LTLLA +VLLL+  +Q+FC+VY C
Sbjct  486   PMLDGVIRGVNAHRNAKAAVRARKLLKKYVFRSWRILTLLAAVVLLLMTAMQTFCTVYDC  545

Query  355   SRFFNDV  335
              R F  V
Sbjct  546   KRLFGGV  552



>emb|CBI29170.3| unnamed protein product [Vitis vinifera]
Length=440

 Score =   319 bits (818),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 160/275 (58%), Positives = 206/275 (75%), Gaps = 4/275 (1%)
 Frame = -3

Query  1162  NSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPI  983
             +S YV+  F  +W ++    +GP R LKRL    PVK +L +PW  ++KLPG +++K P+
Sbjct  164   DSNYVQQLFQIIWNLVSTCTQGPIRLLKRLLLSDPVKVILKLPWTIVSKLPGFSILKQPV  223

Query  982   ESLFSCGQKPDGDENS-DSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFD  806
             E +F    K   +EN  ++ +N  KPP IEEI IPSV+EL+ +GVRF+PT   I SI FD
Sbjct  224   EDIFFSQNK---EENKPENGNNIIKPPLIEEIAIPSVSELSKSGVRFLPTNGSISSITFD  280

Query  805   AKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLRE  626
             AK  TLYLP V+L++N+EV+LRNLVAYEA  A GPL++ARYTE MNGI+DT ED +FLRE
Sbjct  281   AKMATLYLPTVSLEVNTEVILRNLVAYEASNASGPLIIARYTELMNGIIDTKEDAQFLRE  340

Query  625   KGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYI  446
             +GIILNRLKSD EVA+LWNGMNK++RLTKV FLDK I+DVN ++   W VK  +FM+ Y+
Sbjct  341   RGIILNRLKSDEEVADLWNGMNKTIRLTKVPFLDKVIEDVNNYHTGIWQVKAGKFMKRYV  400

Query  445   FGSWQFltllativllllmvLQSFCSVYTCSRFFN  341
             FGSWQFLT LAT+ +L LM LQ+FCSVY+C R FN
Sbjct  401   FGSWQFLTFLATVCILWLMALQAFCSVYSCPRMFN  435


 Score =   166 bits (419),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 118/157 (75%), Gaps = 5/157 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I++TL+ ELEE++E+ V+I+ VPKTLM   P+CYVPQ VA+GPYH+  PEL+
Sbjct  10    DELRWVIEIRRTLDEELEEDSEVPVNIYNVPKTLMATKPDCYVPQEVALGPYHHWRPELY  69

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL AAK  QK L+ +K  SL +++ K E RIR  Y K L    +TLAWMMA+DAS
Sbjct  70    EMERYKLAAAKRTQKHLQRVKFESLVDQLTKHEPRIRACYHKFLEFNGDTLAWMMAIDAS  129

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSS  1487
             FLLEFL+VYA+K G+++   +S++MSHL    GK+ S
Sbjct  130   FLLEFLQVYAIKAGRVLTR-VSSRMSHL----GKEES  161



>ref|XP_011015934.1| PREDICTED: putative UPF0481 protein At3g02645 [Populus euphratica]
Length=558

 Score =   322 bits (826),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 210/541 (39%), Positives = 305/541 (56%), Gaps = 26/541 (5%)
 Frame = -3

Query  1948  KWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEME  1769
             +WVIHI++TL+  +E+E+ + V IF VPK ++    E Y+PQ VAIGPYH+    L EME
Sbjct  12    EWVIHIKRTLDEGIEDED-VPVCIFIVPKAIVSTKQEAYIPQLVAIGPYHHRRVVLFEME  70

Query  1768  RHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLL  1589
             R+KL  A+  QK L   +   + E + + +  +R  Y   L+   E LAW  A+DASFLL
Sbjct  71    RYKLIEAERVQKYLNN-RFSDIVEHLEENDDSVRACYPSYLDFDREELAWTFAIDASFLL  129

Query  1588  EFLKVYAVKEGKLMAAMISAKMSHLVD-LKGKKSSHNALLRDIIMLENQIPFFILRKM--  1418
               L+ +  +  +      S+ ++ +V+    KK+ HN +LRD++MLENQIP F+LR++  
Sbjct  130   GRLQTFISRTEEPSRNRSSSSLADMVNHFAKKKTIHNGILRDMVMLENQIPLFVLREVNT  189

Query  1417  -LQPQCPSPEASDDLLLTMLMGLSKELSPFK---NEGSAVVQIADATHLLGYLFQTIVPE  1250
               Q + P     D+ L  MLM   + +SP K    +     +     HLL  L+  +  +
Sbjct  190   YFQYENP-----DEALARMLMKFFQHVSPIKIVDCQQHVSEECLQKKHLLDLLYCKVAAK  244

Query  1249  MESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLS  1070
             ++    EIE  + G   +          +  G  K A+  +WG L  +   P R L R+ 
Sbjct  245   LQDVEREIEDSKEGKENQ----------EEIGCFKKAWKSIWGFLCFIIVVPLRFLIRIL  294

Query  1069  SLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEI  890
                 VK  + +PW+ I  L  L  +K  I +L S  +    +   +S  N      IE++
Sbjct  295   KSKAVKAAVTIPWQLIKSLRLLK-LKSQITNLVSTAETVAAEIECESGLNG-ASLLIEQL  352

Query  889   TIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIA  710
              IPS T+L   GV+FIPTK G+ +I FD      YLPVV LD NSEV+LRNL+AYE C+A
Sbjct  353   LIPSATKLYGFGVKFIPTKGGLKTISFDKPRGAFYLPVVNLDDNSEVLLRNLLAYEDCLA  412

Query  709   KGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAF  530
                 V  RY E M+GI+DT EDVK LR+ GI+LNRLKSD E ANLW+G+ K + +TKV  
Sbjct  413   PECTVFTRYVELMSGILDTKEDVKILRDSGIVLNRLKSDEEAANLWHGITKFMNITKVPI  472

Query  529   LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
             L K I+D + +Y+  W V+     + Y++ SW  LT LA  +L+LL  L++FCSVY CS+
Sbjct  473   LVKAIEDASAYYSNNWRVRISTSFKKYVYSSWPILTFLAADLLILLSALEAFCSVYDCSK  532

Query  349   F  347
             +
Sbjct  533   W  533



>ref|XP_006659870.1| PREDICTED: putative UPF0481 protein At3g02645-like [Oryza brachyantha]
Length=577

 Score =   318 bits (815),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 209/554 (38%), Positives = 305/554 (55%), Gaps = 31/554 (6%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINV-SIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +W+  +++++     EE    V  +F VPK L    PE Y P   A+GPYH   PEL
Sbjct  31    DEGRWLSRVRESMAERAAEELGAAVVRVFDVPKVLRSTRPEAYAPHHFALGPYHCRRPEL  90

Query  1780  HEMERHKLDAAKIFQKQLRT-IKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVD  1604
              +MER+KL AAK  +K      K   L +    +  RI   Y + + L   TLAWMMA+D
Sbjct  91    RDMERYKLAAAKRAEKLFAAGKKFDDLVQRFYDIHERILAPYHRLVELNEHTLAWMMAID  150

Query  1603  ASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
               FLL+FL+ Y   E      M+S+  + +          NA++RD +MLENQIP F+  
Sbjct  151   TCFLLDFLEGYHRDEAT---DMVSSATNWI----------NAVVRDAMMLENQIPLFLFA  197

Query  1423  KMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIAD----ATHLLGYLFQTIV  1256
               L+ +  + +A+ D L  +L     E+SP     +A + +A       HLL  L+  +V
Sbjct  198   CALELRHDAEQAAADALRGVLGRFITEVSPITPPANAAMAVAGDLSRHAHLLELLYHFLV  257

Query  1255  P-EMESEHVEIE---IdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPAR  1088
             P +  +E    E   +            +  + L +   VK A  QV      LN  P R
Sbjct  258   PTDAVAEAAGDEPPPLVPEDFSAVDVFDQMQQELPDYDKVKQACVQV----SSLNVAPVR  313

Query  1087  ALKRLSSLAPVKTVLLMPWKA---ITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNA  917
              +K+     P+  +  +P  A   + ++P L+ +   +  L+S  Q  +      +    
Sbjct  314   FIKKNLISRPMSLMTSLPGTAGKLVNRVPLLSAVAPLVGKLWS-SQDVEARLKGVNLGTI  372

Query  916   DKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRN  737
                P  +E+ IPSV +LA  GVRF P  +GI  I FDA T TL LPV+TLD N+EV+LRN
Sbjct  373   INSPLAQELMIPSVAQLAACGVRFAPAVEGIAGIAFDAATATLSLPVITLDGNTEVILRN  432

Query  736   LVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNK  557
             LVAYEA   +GPLVLARYTE MNGI+DT +DVK LR+ G+++NR+KSD E A +WNGM +
Sbjct  433   LVAYEAVAVRGPLVLARYTELMNGIIDTAKDVKILRQSGVVVNRMKSDGEAAEMWNGMCR  492

Query  556   SVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQS  377
             + RL++V  LD  I  VN+  + R  V+ ++ ++ Y+F +W+ LTLLA +VLLL+  LQ+
Sbjct  493   ATRLSRVPRLDGAIRAVNEHRSRRATVRLRKMLKRYVFRAWRVLTLLAAVVLLLMTALQT  552

Query  376   FCSVYTCSRFFNDV  335
             FCSVY C+R+F ++
Sbjct  553   FCSVYQCNRWFGNM  566



>ref|NP_001169081.1| uncharacterized protein LOC100382923 [Zea mays]
 gb|ACN31602.1| unknown [Zea mays]
Length=565

 Score =   317 bits (811),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 214/564 (38%), Positives = 307/564 (54%), Gaps = 48/564 (9%)
 Frame = -3

Query  1969  NIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN  1790
              ++ DE +W+  ++++LERE  E       +  VP+ L    PE Y+PQ  A+GPYH + 
Sbjct  21    GLRFDEERWLSRVRQSLEREAAEALGAAAKVLDVPRVLRATRPEAYLPQHFALGPYHSSR  80

Query  1789  PELHEMERHKLDAAKIFQKQLRT-IKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
             PEL +MER+KL AAK  +K      +   L ++++  + RIR  Y + L L  +TLAWMM
Sbjct  81    PELRDMERYKLAAAKRAEKLFAGGRRFDHLVQQLLLAQDRIRAPYHRFLELSDQTLAWMM  140

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
             A+D  FLL+FL+ Y   E   +  M+S+  + +          NA +RD +MLENQIP F
Sbjct  141   AIDTCFLLDFLESYHRDE---VTDMVSSATNWI----------NATVRDAMMLENQIPLF  187

Query  1432  ILRKMLQPQCPSPEASDDLLLTMLMG-LSKELSPFKNEGSAVV-QIADATHLLGYLFQTI  1259
             +  + L  + P  E +    L  ++    KE+SP K     VV  +A   HLL  L+  +
Sbjct  188   LFSQALALRHPDAEQAAAAALHAVLDRFIKEVSPVKTTAELVVADVARHAHLLELLYHFL  247

Query  1258  VPE----------------MESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQV  1127
             VP+                M  E   I++ +               L +   VK A  QV
Sbjct  248   VPDATVFDGDGDGGREPPPMVPEEFTIDMLDPSQQ-----------LPDYDKVKQACMQV  296

Query  1126  WGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDG  947
                   L+  P R +++     P+     +P K + K+P L+ +  P+ S        + 
Sbjct  297   ----SSLDVAPVRFVRKNLISRPLSLASSLPGKIMRKVPLLSAV-APLVSRLMASTDVEA  351

Query  946   DENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTL  767
                  +       P  +EI IPSV  L   GVRF P  +G++ I FDA T TL LP++TL
Sbjct  352   QLKGVNLGGIINSPLAQEIMIPSVATLERWGVRFAPAPEGVVGISFDAATATLSLPIITL  411

Query  766   DINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSE  587
             D N+EVVLRNLVAYEA   +GPLVLARYTE MNGI+DT +DVK LR  G+++NRLKSD E
Sbjct  412   DGNTEVVLRNLVAYEAVAVRGPLVLARYTELMNGIIDTPKDVKILRRSGVVVNRLKSDKE  471

Query  586   VANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllati  407
              A++WNGM ++ RL KV  LD  I +VN   N R   + ++ ++ Y+F SW+ LTLLA +
Sbjct  472   AADMWNGMCRATRLGKVPRLDAAIREVNAHRNRRAAARAQKLLKKYVFRSWRILTLLAAV  531

Query  406   vllllmvLQSFCSVYTCSRFFNDV  335
             VLLL+  +Q+FCSVY C+R+F  V
Sbjct  532   VLLLMTAMQTFCSVYPCTRWFGSV  555



>gb|EAZ41643.1| hypothetical protein OsJ_26177 [Oryza sativa Japonica Group]
Length=583

 Score =   314 bits (805),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 213/560 (38%), Positives = 302/560 (54%), Gaps = 36/560 (6%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee-nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +W+  +++++     EE     V +F VP+ L    PE Y P   A+GPYH   PEL
Sbjct  30    DEGRWLSRVRESMAERAAEELGAAAVKVFDVPRVLRSTRPEAYAPHHFALGPYHCRRPEL  89

Query  1780  HEMERHKLDAAKIFQKQLRTIK-LHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVD  1604
              +MER+KL AAK  +K     K    L      +  +I   Y + L L  +TLAWMMA+D
Sbjct  90    RDMERYKLAAAKRAEKLFAAGKRFDDLVRRFSDIHDKILAPYHRLLELNEQTLAWMMAID  149

Query  1603  ASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
               FLL+FL+ Y   E      M+S+  + +          NA++RD IMLENQIP F+  
Sbjct  150   TCFLLDFLESYHRDEAT---DMVSSAANWI----------NAVVRDAIMLENQIPLFLFA  196

Query  1423  KMLQPQCPSPEASDDL-----LLTMLMGLSKELSPFKNEGSAVVQIAD-----ATHLLGY  1274
               L+ +  + +A         L  +L     E+SP K   SA + +A        HLL  
Sbjct  197   AALELRHGTDQAQAASAAADALRGVLGRFITEVSPIKTTASAALAVAGDDLARHAHLLEL  256

Query  1273  LFQTIVP-EMESEHVEIE---IdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKL  1106
             L+  +VP +  +E V  E   +            +  + + +   VK A  QV      L
Sbjct  257   LYHFLVPTDAVAEAVGNEPPPLVPEDFSAVDVFDQMQKEIPDYDKVKQACVQV----SSL  312

Query  1105  NKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSK  926
             +  P R +K+     P+     +P K + K+P L+ +   +  L+S        E     
Sbjct  313   DMAPIRFIKKNLISRPMGLAASLPGKLMRKVPLLSAVAPLVGKLWSSSSSAADMEARLKG  372

Query  925   DNAD---KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINS  755
              N       P  +E+ IPSV +LA  GVRF P  +GI  IEFDA   TL LPV+T+D N+
Sbjct  373   VNLGTIINSPLAQELMIPSVAQLAACGVRFAPAPEGIAGIEFDAPAATLKLPVITVDGNT  432

Query  754   EVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANL  575
             E VLRNLVAYEA   +GPLVLARYTE MNGI+DT +DVK LR+ G+++NR+KSD E A +
Sbjct  433   ETVLRNLVAYEAVAVRGPLVLARYTELMNGIIDTAKDVKILRQSGVVVNRMKSDGEAAEM  492

Query  574   WNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativlll  395
             WNGM ++ RL++V  LD  I  VN+  + R  V+ +R M+ Y+F SW+ LTLLA +VLLL
Sbjct  493   WNGMCRATRLSRVPRLDGVIRAVNEHRSRRAAVRLRRMMKRYVFRSWRVLTLLAAVVLLL  552

Query  394   lmvLQSFCSVYTCSRFFNDV  335
             +  LQ+FCSVY C+R+F ++
Sbjct  553   MTALQTFCSVYQCNRWFGNM  572



>gb|EAZ05725.1| hypothetical protein OsI_27952 [Oryza sativa Indica Group]
Length=583

 Score =   314 bits (804),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 212/560 (38%), Positives = 302/560 (54%), Gaps = 36/560 (6%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee-nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +W+  +++++     EE     V +F VP+ L    PE Y P   A+GPYH   PEL
Sbjct  30    DEGRWLSRVRESMAERAAEELGAAAVKVFDVPRVLRSTRPEAYAPHHFALGPYHCRRPEL  89

Query  1780  HEMERHKLDAAKIFQKQLRTIK-LHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVD  1604
              +MER+KL AAK  +K     K    L      +  +I   Y + L L  +TLAWMMA+D
Sbjct  90    RDMERYKLAAAKRAEKLFAAGKRFDDLVRRFSDIHDKILAPYHRLLELNEQTLAWMMAID  149

Query  1603  ASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
               FLL+FL+ Y   E      M+S+  + +          NA++RD IMLENQIP F+  
Sbjct  150   TCFLLDFLESYHRDEA---TDMVSSAANWI----------NAVVRDAIMLENQIPLFLFA  196

Query  1423  KMLQPQCPSPEASDDL-----LLTMLMGLSKELSPFKNEGSAVVQIAD-----ATHLLGY  1274
               L+ +  + +A         L  +L     E+SP K   SA + +A        HLL  
Sbjct  197   AALELRHGTDQAQAASAAADALRGVLSRFITEVSPIKTTASAALAVAGDDLARHAHLLEL  256

Query  1273  LFQTIVP-EMESEHVEIE---IdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKL  1106
             L+  +VP +  +E V  E   +            +  + + +   VK A  QV      L
Sbjct  257   LYHFLVPTDAVAEAVGNEPPPLVPEDFSAVDVFDQMQKEIPDYDKVKQACVQV----SSL  312

Query  1105  NKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSK  926
             +  P R +K+     P+     +P K + K+P L+ +   +  L+S        E     
Sbjct  313   DMAPIRFIKKNLISRPMGLAASLPGKLMRKVPLLSAVAPLVGKLWSSSSSAADMEARLKG  372

Query  925   DNAD---KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINS  755
              N       P  +E+ IPSV +LA  GVRF P  +GI  IEFDA   TL LPV+T+D N+
Sbjct  373   VNLGTIINSPLAQELMIPSVAQLAACGVRFAPAPEGIAGIEFDAAAATLKLPVITVDGNT  432

Query  754   EVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANL  575
             E VLRNLVAYEA   +GPLVLARYTE MNGI+DT +DVK LR+ G+++NR+KSD E A +
Sbjct  433   ETVLRNLVAYEAVAVRGPLVLARYTELMNGIIDTAKDVKILRQSGVVVNRMKSDGEAAEM  492

Query  574   WNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativlll  395
             WNGM ++ RL++V  LD  I  VN+  + R  V+ ++ M+ Y+F SW+ LTLLA +VLLL
Sbjct  493   WNGMCRATRLSRVPRLDGVIRAVNEHRSRRAAVRLRKMMKRYVFRSWRVLTLLAAVVLLL  552

Query  394   lmvLQSFCSVYTCSRFFNDV  335
             +  LQ+FCSVY C+R+F ++
Sbjct  553   MTALQTFCSVYQCNRWFGNM  572



>ref|XP_006427506.1| hypothetical protein CICLE_v10027406mg, partial [Citrus clementina]
 gb|ESR40746.1| hypothetical protein CICLE_v10027406mg, partial [Citrus clementina]
Length=406

 Score =   308 bits (788),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 178/387 (46%), Positives = 244/387 (63%), Gaps = 45/387 (12%)
 Frame = -3

Query  1498  KKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEG  1319
             +K++HN +LRD+ MLENQIP F+LRKML+ QC S +++DD+L++ML G  KELSP K + 
Sbjct  55    RKAAHNVILRDLGMLENQIPLFVLRKMLEIQCSSLKSADDMLMSMLKGFCKELSPLKMKD  114

Query  1318  SAVVQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSA  1139
               +++I++  HLL  L+   V + E +   IEI                    S   K  
Sbjct  115   QPMIKISERAHLLNILYDRFVSKAEQK---IEIT------------------KSDDTKRL  153

Query  1138  FGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKL--PGLNVMKGPIESLFSC  965
             F Q+W +L  L+KGP + +++L    P+K +  +PWK I  +  P  NV           
Sbjct  154   FSQLWKLLLTLDKGPIKVIRKLVVSKPIKLLFKLPWKTIQNVVFPQENV-----------  202

Query  964   GQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLY  785
              +K   DE+S    + + P  +E++TIPSVTE A + VRF+PT   I ++ FDAK   L+
Sbjct  203   -EKKSDDESSPLSKHMNNPLFVEKMTIPSVTEPAKSNVRFLPTVGDISTVSFDAKKAILH  261

Query  784   LPVVTLDINSEVVLRNLVAYEACIAKGPLVLA-RYTEFMNGIVDTDEDVKFLREKGIILN  608
             LP ++LD+N+EVVL+N+VAYEA  A GPL L  RYTE            K LREKGII+ 
Sbjct  262   LPTISLDVNTEVVLKNVVAYEASSASGPLALTTRYTEM---------HAKMLREKGIIVI  312

Query  607   RLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQF  428
             RLK D+EVANLWNGMNKS+R+TKV  LD+ ++DVNK+Y  RW VK  ++M+ Y+FGSW+F
Sbjct  313   RLKIDAEVANLWNGMNKSIRMTKVPHLDRVMEDVNKYYYNRWKVKFGKYMKLYVFGSWKF  372

Query  427   ltllativllllmvLQSFCSVYTCSRF  347
             LTLLA IVLLLL  LQ+FCS Y C +F
Sbjct  373   LTLLAAIVLLLLTTLQAFCSDYNCRKF  399



>ref|NP_001175401.1| Os08g0167400 [Oryza sativa Japonica Group]
 dbj|BAH94129.1| Os08g0167400 [Oryza sativa Japonica Group]
Length=662

 Score =   315 bits (808),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 213/560 (38%), Positives = 302/560 (54%), Gaps = 36/560 (6%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee-nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +W+  +++++     EE     V +F VP+ L    PE Y P   A+GPYH   PEL
Sbjct  30    DEGRWLSRVRESMAERAAEELGAAAVKVFDVPRVLRSTRPEAYAPHHFALGPYHCRRPEL  89

Query  1780  HEMERHKLDAAKIFQKQLRTIK-LHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVD  1604
              +MER+KL AAK  +K     K    L      +  +I   Y + L L  +TLAWMMA+D
Sbjct  90    RDMERYKLAAAKRAEKLFAAGKRFDDLVRRFSDIHDKILAPYHRLLELNEQTLAWMMAID  149

Query  1603  ASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
               FLL+FL+ Y   E      M+S+  + +          NA++RD IMLENQIP F+  
Sbjct  150   TCFLLDFLESYHRDEAT---DMVSSAANWI----------NAVVRDAIMLENQIPLFLFA  196

Query  1423  KMLQPQCPSPEASDDL-----LLTMLMGLSKELSPFKNEGSAVVQIAD-----ATHLLGY  1274
               L+ +  + +A         L  +L     E+SP K   SA + +A        HLL  
Sbjct  197   AALELRHGTDQAQAASAAADALRGVLGRFITEVSPIKTTASAALAVAGDDLARHAHLLEL  256

Query  1273  LFQTIVP-EMESEHVEIE---IdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKL  1106
             L+  +VP +  +E V  E   +            +  + + +   VK A  QV      L
Sbjct  257   LYHFLVPTDAVAEAVGNEPPPLVPEDFSAVDVFDQMQKEIPDYDKVKQACVQV----SSL  312

Query  1105  NKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSK  926
             +  P R +K+     P+     +P K + K+P L+ +   +  L+S        E     
Sbjct  313   DMAPIRFIKKNLISRPMGLAASLPGKLMRKVPLLSAVAPLVGKLWSSSSSAADMEARLKG  372

Query  925   DNAD---KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINS  755
              N       P  +E+ IPSV +LA  GVRF P  +GI  IEFDA   TL LPV+T+D N+
Sbjct  373   VNLGTIINSPLAQELMIPSVAQLAACGVRFAPAPEGIAGIEFDAPAATLKLPVITVDGNT  432

Query  754   EVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANL  575
             E VLRNLVAYEA   +GPLVLARYTE MNGI+DT +DVK LR+ G+++NR+KSD E A +
Sbjct  433   ETVLRNLVAYEAVAVRGPLVLARYTELMNGIIDTAKDVKILRQSGVVVNRMKSDGEAAEM  492

Query  574   WNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativlll  395
             WNGM ++ RL++V  LD  I  VN+  + R  V+ +R M+ Y+F SW+ LTLLA +VLLL
Sbjct  493   WNGMCRATRLSRVPRLDGVIRAVNEHRSRRAAVRLRRMMKRYVFRSWRVLTLLAAVVLLL  552

Query  394   lmvLQSFCSVYTCSRFFNDV  335
             +  LQ+FCSVY C+R+F ++
Sbjct  553   MTALQTFCSVYQCNRWFGNM  572



>gb|KDO43086.1| hypothetical protein CISIN_1g0428682mg, partial [Citrus sinensis]
Length=392

 Score =   306 bits (785),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 169/384 (44%), Positives = 242/384 (63%), Gaps = 17/384 (4%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DES+W+I I++TLE  LE   +  VSIF VPKTL   DP+ Y PQ+VAIGPYHY  PEL+
Sbjct  16    DESRWIIRIRRTLEEALENNTDFPVSIFSVPKTLRSSDPDAYTPQQVAIGPYHYWRPELY  75

Query  1777  EMERHKLDAAKIFQKQLR-TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             +ME +KL AAK  Q+ +    KL  + +++ ++E +IR  Y K LN   ET+AWMMA+D+
Sbjct  76    DMEMYKLAAAKRAQRHINGNHKLKYVVDQLKELELKIRACYHKFLNFSNETVAWMMAIDS  135

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
             SFLLEFL++Y ++E KL     S  MSHL+D  G K++HNA+LRD++MLENQIP F++RK
Sbjct  136   SFLLEFLQIYTIEEDKLSTTYSSRSMSHLLDCAGIKAAHNAILRDVVMLENQIPLFVMRK  195

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPEME  1244
             ML+ Q  S E++DD+L  MLMG  +E+SPFK  +   ++ I++  HLL Y + TIVP+ +
Sbjct  196   MLEIQYSSLESADDMLQAMLMGFYEEVSPFKMKKDMPMIDISEGAHLLDYFYHTIVPKAD  255

Query  1243  -----SEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALK  1079
                  +E VE E        +     ++ +  +  Y+K  F ++W +L KL+KGP R +K
Sbjct  256   KRSEVTEAVENE-------GDDDKQPKERYSGDPTYIKYLFIEIWKLLSKLDKGPIRFIK  308

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLF---SCGQKPDGDENSDSKDNADKP  908
             +L    PVK    +PW  ++KLPG  ++  PI+ L       +     E S S+ + + P
Sbjct  309   KLLLSEPVKFFFKLPWTILSKLPGYPILARPIQYLVFPEVNEENKSHAERSPSRKHMNMP  368

Query  907   PSIEEITIPSVTELANAGVRFIPT  836
             P +EEI IPSVTELA   + F  T
Sbjct  369   PLVEEIAIPSVTELAKINIHFSAT  392



>emb|CBI31681.3| unnamed protein product [Vitis vinifera]
Length=421

 Score =   307 bits (787),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 153/243 (63%), Positives = 192/243 (79%), Gaps = 3/243 (1%)
 Frame = -3

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLF-SCGQKPDGDENSDSKDNAD--KPPSIEEI  890
             PVK +L +PW  ++ LPG  ++K P+E  F S  ++ +  EN +SK N+   KPP IEEI
Sbjct  175   PVKVILKLPWTIVSNLPGFAILKQPVEYFFFSQDKEENKPENGNSKSNSSIVKPPLIEEI  234

Query  889   TIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIA  710
             TIPSV+EL+ +GVRF+PT  GI SI FDAK  TLYLP V+LD+N+EV LRNLVAYE+  A
Sbjct  235   TIPSVSELSKSGVRFLPTNGGISSITFDAKMVTLYLPTVSLDVNTEVTLRNLVAYESSNA  294

Query  709   KGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAF  530
              GPLV+ RYTE MNGI+DT ED KFLRE+GI+LNRLKSD EVANLWNGM++S+RLTKV F
Sbjct  295   SGPLVITRYTELMNGIIDTKEDAKFLRERGIVLNRLKSDEEVANLWNGMSRSIRLTKVPF  354

Query  529   LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
             LDK I+DVNK+++ RW VK  +FM+ Y+FGSWQFLT LA I+++LLM LQ+FCSVY+C R
Sbjct  355   LDKVIEDVNKYHSGRWKVKAGKFMKRYVFGSWQFLTFLAAILIVLLMTLQAFCSVYSCPR  414

Query  349   FFN  341
              FN
Sbjct  415   IFN  417


 Score =   172 bits (437),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 120/161 (75%), Gaps = 4/161 (2%)
 Frame = -3

Query  1969  NIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN  1790
             N   DE +WVI I++TL+ ELE+ +E+ V IF VPKTLM   P+CYVPQ VA+GPYH   
Sbjct  6     NSSFDELEWVIQIRRTLDEELEDNSEVPVCIFNVPKTLMATKPDCYVPQEVALGPYHRWR  65

Query  1789  PELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMA  1610
             PEL+EMER+KL AAK  QK L+++K HSL +++ K E RIR  Y K L    ETLAWMMA
Sbjct  66    PELYEMERYKLAAAKRIQKNLQSLKFHSLVDQLTKHEPRIRACYHKFLEFNGETLAWMMA  125

Query  1609  VDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSS  1487
             +DASFLLEFL+VYA+KEG+++   +S++MSH   L+GK+ S
Sbjct  126   IDASFLLEFLQVYAMKEGRMLTR-VSSRMSH---LEGKEES  162



>ref|XP_002445120.1| hypothetical protein SORBIDRAFT_07g004430 [Sorghum bicolor]
 gb|EES14615.1| hypothetical protein SORBIDRAFT_07g004430 [Sorghum bicolor]
Length=567

 Score =   309 bits (791),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 216/572 (38%), Positives = 307/572 (54%), Gaps = 62/572 (11%)
 Frame = -3

Query  1969  NIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN  1790
              +  DE +W+  ++++LERE  +       +F VP+ L    P+ Y+PQ  A+GPYH   
Sbjct  21    GLHFDEDRWLSRVRQSLEREAADALGAAAKVFDVPRLLRATRPDAYLPQHFALGPYHCGR  80

Query  1789  PELHEMERHKLDAAKIFQKQLRT-IKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
              EL +MER+KL AAK  +K      K   L + +++ + +IR  Y + L L  +TLAWMM
Sbjct  81    AELRDMERYKLAAAKRAEKLFADGRKFDHLVQRLLQDQDKIRAPYHRFLELSDQTLAWMM  140

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
             A+D  FLL+FL+ Y   E   +  M+S+  + +          NA +RD +MLENQIP F
Sbjct  141   AIDTCFLLDFLESYHRDE---VTDMVSSATNWI----------NATVRDAMMLENQIPLF  187

Query  1432  ILRKMLQPQCPSPE-ASDDLLLTMLMGLSKELSPFKNEGSAVV-QIADATHLLGYLFQTI  1259
             +  + L  + P  E A+   L  +L    KE+SP K     +   +A   H+L  L+  +
Sbjct  188   LFSQALALRHPKAEQAAAGALHAVLDRFIKEVSPIKTTAELIAADVARHAHMLELLYHFL  247

Query  1258  VPE----------------MESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQV  1127
             VP+                M  E   I + +               L +   VK A  QV
Sbjct  248   VPDATVFDGGDGGGREPPPMVPEEFTIAMLDPSQQ-----------LPDYDKVKQACMQV  296

Query  1126  WGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSC------  965
                   L+  P R +++     P+     +P K + K+P L+ M   +  L +       
Sbjct  297   ----SSLDVAPVRFIRKNLISRPMSMASSLPGKIMRKVPLLSAMAPLVTKLMASTDMEAR  352

Query  964   --GQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFT  791
               G    G  +S S       P  +EI IPSV  LA  GVRF+P  +GI  I FDA   T
Sbjct  353   LKGVNLGGIISSSS-------PLAQEIMIPSVATLARWGVRFVPAPEGIAGIAFDAAAAT  405

Query  790   LYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIIL  611
             L LP++TLD N+EVVLRNLVAYEA   +GPLVLARYTE MNGIVDT +DVK LR+ G+++
Sbjct  406   LSLPIITLDGNTEVVLRNLVAYEAVAVRGPLVLARYTELMNGIVDTAKDVKILRQSGVVV  465

Query  610   NRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQ  431
             N LKSD E A++WNGM ++ RL KV  LD  I +VN   + R   + ++ +R Y+F SW+
Sbjct  466   NHLKSDREAADMWNGMCRATRLGKVPRLDAAIREVNAHRSRRAAARAQKLLRKYVFRSWR  525

Query  430   FltllativllllmvLQSFCSVYTCSRFFNDV  335
              LTLLA +VLLL+  +Q+FC+VY CSR+F  V
Sbjct  526   ILTLLAAVVLLLMTAMQTFCTVYPCSRWFGSV  557



>emb|CBI36449.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   304 bits (778),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/282 (56%), Positives = 201/282 (71%), Gaps = 3/282 (1%)
 Frame = -3

Query  1162  NSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPI  983
             +S YV+  F  +W +L   N+GP   LKRL S  PVK +L +PWK I  LPG +++K P+
Sbjct  164   DSSYVQQLFQIIWNLLSTSNQGPISLLKRLLSSDPVKVILKLPWKIIFNLPGFSILKRPV  223

Query  982   ESLFSCGQKPDGDENSDSKDNAD---KPPSIEEITIPSVTELANAGVRFIPTKKGILSIE  812
             E +F   +K + +  + + ++     KPP IEEI IPSV++L  +GVRF+P    I SI 
Sbjct  224   EYIFFSQKKEESNPENGNSNSNSNIIKPPLIEEIAIPSVSKLYKSGVRFLPANGSISSIT  283

Query  811   FDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFL  632
             FDAK  TLYLP V+LD+N+EV LRNLVAYEA  A GPLV+ RYTE MNGI+DT+ED K L
Sbjct  284   FDAKMATLYLPTVSLDVNTEVTLRNLVAYEASNASGPLVMTRYTELMNGIIDTEEDAKIL  343

Query  631   REKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRS  452
             RE+GIILNRLKSD EVANLWNGM+KS+RLTKV FLDK I+DVN ++   W VK  +FM+ 
Sbjct  344   RERGIILNRLKSDEEVANLWNGMSKSIRLTKVPFLDKVIEDVNNYHTGIWKVKAGKFMKR  403

Query  451   YIFGSWQFltllativllllmvLQSFCSVYTCSRFFNDVTIL  326
             Y+ GSWQ LT +AT+++ LLM LQ+FCSVY C R F   T L
Sbjct  404   YVIGSWQLLTFVATVLIFLLMTLQAFCSVYNCPRMFRVTTDL  445


 Score =   166 bits (421),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 133/194 (69%), Gaps = 14/194 (7%)
 Frame = -3

Query  1969  NIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN  1790
             N + DE +WVI I++TL+ ELEE++E+ V+I+ VPKTLM   P+CYVPQ VA+GPYH+  
Sbjct  6     NPRFDELRWVIEIRRTLDEELEEDSEVPVNIYNVPKTLMAAKPDCYVPQEVALGPYHHWQ  65

Query  1789  PELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMA  1610
             PEL+EMER+KL AAK  QK L+ +K  SL +++ K E RIR  Y K L    +TLAWMMA
Sbjct  66    PELYEMERYKLAAAKRTQKHLQRVKFESLVDQLNKHEPRIRACYHKFLQFNGDTLAWMMA  125

Query  1609  VDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHN---------ALLRDIIM  1457
             +DASFLLEFL+VY++K G L+   +S++MSHL    GK+ S            ++ +++ 
Sbjct  126   IDASFLLEFLQVYSIKAGWLLTR-VSSRMSHL----GKEGSFGDSSYVQQLFQIIWNLLS  180

Query  1456  LENQIPFFILRKML  1415
               NQ P  +L+++L
Sbjct  181   TSNQGPISLLKRLL  194



>ref|XP_002436598.1| hypothetical protein SORBIDRAFT_10g005390 [Sorghum bicolor]
 gb|EER87965.1| hypothetical protein SORBIDRAFT_10g005390 [Sorghum bicolor]
Length=601

 Score =   306 bits (785),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 158/281 (56%), Positives = 196/281 (70%), Gaps = 13/281 (5%)
 Frame = -3

Query  1153  YVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESL  974
             YVK     V  +   LN G  R + R     P+   +  PWK +T +PG + MK P+E+ 
Sbjct  324   YVKQLLVTVSSMASGLNSGRMRYVTR-----PLAFAVKAPWKMLTVVPGFSAMKQPVEAF  378

Query  973   FSCGQKPDG------DENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIE  812
             F+ G   DG      D N        +PP IEEI IPSV+ELAN G++F PT   + +I 
Sbjct  379   FTSGA--DGGSTHPHDANGGGAGYLTRPPLIEEIMIPSVSELANVGIQFCPTSGDLSTIA  436

Query  811   FDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFL  632
             FDA+T T  LPVVTLD N+EVVLRNLVAYEA  A  PLVLARYTE MNGI+DTDEDV  L
Sbjct  437   FDARTVTFQLPVVTLDSNTEVVLRNLVAYEASAASTPLVLARYTELMNGIIDTDEDVALL  496

Query  631   REKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRS  452
             R +G++LNR+KSD EVA LWNGM++SVRLTKVAF+D+ +++VN++YN RW VKTKRFMR 
Sbjct  497   RRRGVVLNRMKSDGEVAKLWNGMSRSVRLTKVAFMDRAVEEVNRYYNSRWRVKTKRFMRK  556

Query  451   YIFGSWQFltllativllllmvLQSFCSVYTCSRFFNDVTI  329
             Y+F SWQ LT LA I++LLL  LQ+FCSVYTCSR+F  VT+
Sbjct  557   YVFSSWQLLTFLAAIMMLLLTTLQAFCSVYTCSRWFGTVTV  597


 Score =   211 bits (537),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 156/229 (68%), Gaps = 20/229 (9%)
 Frame = -3

Query  1957  DESKWVIHIQKTlerel----eeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN  1790
             DE +WV+ I+++LE +     +++  I VS+F VPK L VY PE Y PQ +A+GPYH+  
Sbjct  19    DEVRWVVQIRQSLEEDAPGDDDDDTGIPVSVFNVPKPLQVYKPEAYTPQFIALGPYHHWR  78

Query  1789  PELHEMERHKLDAAKIFQKQLRT--IKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWM  1616
             PEL+EMER+KL AA+  QK+L    +KL +L ++  ++E +IR  Y + L+   ETLAWM
Sbjct  79    PELYEMERYKLAAARRAQKRLSAAGLKLDALVQQFARLERKIRAYYHRYLDFNGETLAWM  138

Query  1615  MAVDASFLLEFLKVYAVK-------------EGKLMAAMISAKMSHLVDLKGKKSSHNAL  1475
             M VD +FLLEFL+VYAV              +GK +   ++++M HLVD  G+KS+H+ +
Sbjct  139   MLVDGAFLLEFLQVYAVAAANDGGDVATAAGDGKALR-RVTSRMQHLVDFAGRKSAHSLI  197

Query  1474  LRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK  1328
             LRD++MLENQ+P F+LR++L+PQC SP  + +LL  M+ GL KEL PFK
Sbjct  198   LRDMLMLENQVPLFLLRRILEPQCASPGEAGELLPRMVTGLMKELCPFK  246



>gb|EMT33160.1| hypothetical protein F775_13626 [Aegilops tauschii]
Length=403

 Score =   299 bits (766),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 151/285 (53%), Positives = 198/285 (69%), Gaps = 6/285 (2%)
 Frame = -3

Query  1162  NSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPI  983
              S YV   F  +WG+  KL KGP   + R     P+   +  PWK +T +PG++ MK P+
Sbjct  124   GSEYVAQLFAALWGMASKLGKGPLHYVMR-----PIAFAVKAPWKMLTVVPGMSGMKHPV  178

Query  982   ESLFSCGQKPDGDENSDS-KDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFD  806
             ES F  G    GD +S S   +  +PP IEEI +PSV+EL NAGV+   T   + +I FD
Sbjct  179   ESFFMSGADGRGDPSSSSTAGHLSRPPLIEEIMVPSVSELVNAGVQVAATTGDLSTICFD  238

Query  805   AKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLRE  626
              KT TL+LPVVTLD N+EV++RNLVAYE+  A GPLVL RYTE MNGI+DTD DV  LR+
Sbjct  239   CKTATLHLPVVTLDGNTEVMIRNLVAYESSAASGPLVLTRYTELMNGIIDTDTDVALLRQ  298

Query  625   KGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYI  446
             +G++LNRLKSD EV  LWN M++S RLTKV  +D+ ++++N++Y+ RW VKTKRFMR Y+
Sbjct  299   RGVVLNRLKSDGEVTKLWNSMSRSTRLTKVPAVDRAVEEMNRYYDGRWRVKTKRFMRRYV  358

Query  445   FGSWQFltllativllllmvLQSFCSVYTCSRFFNDVTILGTNEQ  311
             F SWQ LT LA I++LLL  LQ+FCSVYTCSR+F  VT+   + +
Sbjct  359   FSSWQLLTFLAAIMMLLLTTLQAFCSVYTCSRWFGAVTVTAASGE  403



>ref|NP_001143080.1| hypothetical protein [Zea mays]
 ref|XP_008681618.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACG28812.1| hypothetical protein [Zea mays]
 gb|AFW70685.1| hypothetical protein ZEAMMB73_651411 [Zea mays]
Length=587

 Score =   304 bits (778),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 211/580 (36%), Positives = 311/580 (54%), Gaps = 54/580 (9%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WV  ++K+L  E  E       +F VP++L   +P+ Y P   ++GPYH   PEL 
Sbjct  26    DEKRWVGWVEKSLRHETAEALGAAAKVFSVPRSLRDTNPDAYAPHVFSLGPYHQARPELM  85

Query  1777  EMERHKLDAAKIFQKQL---RTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAV  1607
             +M+R KL  AK F+  L    TI+       +  +E +IR  Y + L+L   TL WMMA+
Sbjct  86    DMQRFKLAGAKRFEMLLTGGHTIEHIKDRFLVGGLELKIRAIYHRFLDLNDTTLVWMMAI  145

Query  1606  DASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFIL  1427
             DA FLL+F++ Y  +E      ++S+  + +          NA++RD +MLENQIP F+ 
Sbjct  146   DACFLLDFIENYHRREA---TDVVSSSANWI----------NAVVRDAMMLENQIPLFVF  192

Query  1426  RKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGS--AVVQIADATHLLGYLFQTIVP  1253
              + L+ +  +   +   L  +++    ++ PFK++    A+  +A   HLL  L+  +VP
Sbjct  193   ARTLELRHSTRHEAAKALHAVVLRFIMDVCPFKDKRGEVAIGDLAKHAHLLEVLYHFLVP  252

Query  1252  EM-------------ESEHVEIEIdenggmkekkdgeedEFLK---------NSGYVKSA  1139
             +              +   VE EI        ++  ++ E  +         +   VK A
Sbjct  253   DATLLDDSTTGGGGDQGVMVEEEIPATAAADGEEVDDDVEAQQAMKPPLEEEDCEKVKQA  312

Query  1138  FGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLN----VMKGPIESLF  971
               Q      +LN  P R +K+     P+  V     K   K+P L     V+   ++S+ 
Sbjct  313   LSQA----SRLNVAPLRFIKKNLIARPMALV----GKIAHKVPALAALVPVLSKLMQSVN  364

Query  970   SCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFT  791
                Q   G E +  +D A   P  +EI IPSV ELA  GVRF P  +GI  I FD  + T
Sbjct  365   VEAQLNGGAEQA-PEDGAITAPRADEIRIPSVEELARCGVRFTPAPEGIEGIAFDRASAT  423

Query  790   LYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIIL  611
             L LPV+TLD N+EVVLRNLVAYEA   +GPLVLARYTE MNGI+DT +DVK LR  G+++
Sbjct  424   LRLPVITLDANTEVVLRNLVAYEAVAVRGPLVLARYTELMNGIIDTSKDVKILRRSGVLV  483

Query  610   NRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQ  431
             N +KS+ E A +WNGM ++ RLTKV  LD  I  VN   +     + ++  R Y+F SW+
Sbjct  484   NHMKSNKEAAGMWNGMARATRLTKVPRLDAVISAVNAHRSRSAAARVRKLFRKYVFRSWK  543

Query  430   FltllativllllmvLQSFCSVYTC-SRFFNDVTILGTNE  314
              LTLLA+I LLL+  LQ+FCS Y C + +F+ + + GT +
Sbjct  544   MLTLLASIGLLLMTALQTFCSAYPCENHWFSGMVLPGTTD  583



>gb|KDO37854.1| hypothetical protein CISIN_1g043783mg [Citrus sinensis]
Length=313

 Score =   291 bits (746),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 170/386 (44%), Positives = 226/386 (59%), Gaps = 81/386 (21%)
 Frame = -3

Query  1615  MAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPF  1436
             MA+DASFLLEFL++YA+K+ KL A   S  +SHLVD  G K++HNA+LRD+ MLENQIP 
Sbjct  1     MAIDASFLLEFLQIYAMKDDKLPATSSSISISHLVDYAGMKATHNAILRDMSMLENQIPV  60

Query  1435  FILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTI  1259
              +LRKMLQ +  S E++DDLL  MLMG  +E+SPFK  +   ++Q ++  HLL YL+ TI
Sbjct  61    LMLRKMLQLRYLSSESADDLLQAMLMGFCEEVSPFKMKKNKPMIQASECAHLLDYLYNTI  120

Query  1258  VPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALK  1079
             +                                             + K +  GP + L 
Sbjct  121   L---------------------------------------------LSKMILSGPIKFLF  135

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLF----SCGQKPDGDENSDSKDNADK  911
             +L            P   ++K+PG +++  P+++L     +   K DG E S S  + +K
Sbjct  136   KL------------PCFMLSKIPGFSILAQPVQNLIFPQDNEENKSDG-ERSPSNKHMNK  182

Query  910   PPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLV  731
             PP +EEITIPSVT LA                    +T TL++  V+ D+ +EVVLRNLV
Sbjct  183   PPLVEEITIPSVTNLAK------------------VETATLHIRTVSFDVYTEVVLRNLV  224

Query  730   AYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSV  551
             AYEA  A GPLVL RY+E MNGIVDT++DVK LRE GIILNRL SD+EVANLWNG+ KS+
Sbjct  225   AYEASNASGPLVLTRYSELMNGIVDTEKDVKLLRENGIILNRLNSDAEVANLWNGITKSI  284

Query  550   RLTKVAFLDKTIDDVNKFYNCRWNVK  473
             RLTKV  +D  I+DVNK+YN  +  K
Sbjct  285   RLTKVPHIDIVIEDVNKYYNSHYKKK  310



>gb|EAY99899.1| hypothetical protein OsI_21895 [Oryza sativa Indica Group]
Length=466

 Score =   296 bits (758),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 151/281 (54%), Positives = 188/281 (67%), Gaps = 11/281 (4%)
 Frame = -3

Query  1153  YVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESL  974
             YVK     VWGI+  L  GP + + +     P+   +  PWK +T +PG + MK P+ES 
Sbjct  187   YVKQLLAAVWGIVSSLKSGPMQYVAK-----PISFAVKAPWKMLTVVPGFSAMKHPVESF  241

Query  973   F-----SCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEF  809
             F                 D      +PP IEEI IPSVTELA AGV+F PT     ++ F
Sbjct  242   FMSGGGGDPSSSSTAAGQDHHHAISRPPLIEEIMIPSVTELAAAGVQFAPTNGDATTVSF  301

Query  808   DAKTFTLYLPVVTLD-INSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFL  632
             DAKT TL+LPVVTLD   +EVVLRNLVAYEA  A GPLVLARYTE MNGI+DT EDV  L
Sbjct  302   DAKTATLHLPVVTLDGSTTEVVLRNLVAYEASAATGPLVLARYTELMNGIIDTGEDVAAL  361

Query  631   REKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRS  452
             R +G++LNR+KSD E A LWNGM++SVRLTKVA +D  ++ VN+++  RW VK +RFMR 
Sbjct  362   RRRGVVLNRMKSDGEAARLWNGMSRSVRLTKVAAMDAAVEGVNRYHGARWRVKARRFMRR  421

Query  451   YIFGSWQFltllativllllmvLQSFCSVYTCSRFFNDVTI  329
             Y+FGSWQ LT LA +++LLL  LQ+FCSVYTCSR+F  V +
Sbjct  422   YVFGSWQLLTFLAAVLMLLLTTLQAFCSVYTCSRWFGAVAV  462


 Score =   130 bits (327),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 103/159 (65%), Gaps = 11/159 (7%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEIN---VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNP  1787
             DE +WVI I+++L+ +  ++++ N   VS+F VPK L  + PE YVPQ +A+GPYH+  P
Sbjct  19    DELRWVIQIRRSLQEDGGDDDDDNGIPVSVFNVPKQLQAHKPEAYVPQFIALGPYHHWRP  78

Query  1786  ELHEMERHKLDAAKIFQKQLR-TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMA  1610
             EL+EMER+KL AA+  Q+ LR  +KL  L E+  + E ++R  Y + L+   ETLAWMM 
Sbjct  79    ELYEMERYKLAAARRAQRHLREGVKLEHLVEQFARAERKVRAHYHRYLDFSGETLAWMMV  138

Query  1609  VDASFLLEFLKVYAVKEGKLMAAM-------ISAKMSHL  1514
             VD +FLLEFL+++A  E              +S++M+HL
Sbjct  139   VDGAFLLEFLQIFAAAEAAASGGGGKPELRRVSSRMAHL  177



>ref|XP_004975089.1| PREDICTED: putative UPF0481 protein At3g02645-like [Setaria italica]
Length=569

 Score =   297 bits (761),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 206/575 (36%), Positives = 308/575 (54%), Gaps = 57/575 (10%)
 Frame = -3

Query  1966  IQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN-  1790
             +  +E +W+  ++ TLE    EE      +F VP+ L    PE Y PQ  A+GPYH+   
Sbjct  13    LSEEEMRWLRRVRDTLEERSAEELGAAAKVFDVPRALRDTKPEAYAPQHFALGPYHHQRR  72

Query  1789  PELHEMERHKLDAAKIFQKQL---RTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAW  1619
             PEL +MER+KL AAK  ++     RTI+   L E +  ++  ++  Y + L L  ETLAW
Sbjct  73    PELRDMERYKLAAAKRAERHFAGGRTIE--HLVERLRDLQDEMQAPYHRILELNRETLAW  130

Query  1618  MMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIP  1439
             MMA+D  FLL+FL+ Y   E      M+S+  + +          NA +RD +M+ENQ+P
Sbjct  131   MMAIDTCFLLDFLEGYHRDE---TTDMVSSAANWI----------NATVRDAMMIENQLP  177

Query  1438  FFILRKMLQPQCPSPE----ASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYL  1271
               +  + L+ +  + E     +  ++ T+L    K +SP K    A V IA+  HLL  L
Sbjct  178   LCLFTEALELRRHAAEQHVTTARAMMCTVLDRFIKHVSPIKMR--ADVTIAEEVHLLELL  235

Query  1270  FQTIVP----------------------EMESEHVEIEIdenggmkekkdgeedEFLKNS  1157
             +  +VP                      +   +    +++E       +         + 
Sbjct  236   YHFLVPPGAVFDENTGGGGGKNPTAHQDDQAQDRSLYDVEEQLLDAAPELAGVQPPQGDE  295

Query  1156  GYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIES  977
               VK A  QV      LN G       L    P+++V  +  K   +LP L  +   +  
Sbjct  296   NTVKKACSQV---SSHLNMGS------LLVSWPMRSVSKLYGKMTRRLPALPGVVSVVRK  346

Query  976   LFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKT  797
             L +           +++  A   P  +EI IPSV +LA  GVRF+PT +GI  I F+A  
Sbjct  347   LVASVDVEGILSGMNTEGVAGSAPLAKEIKIPSVEQLAKCGVRFLPTTEGIHGIAFNAAA  406

Query  796   FTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGI  617
              TL+LPV+TLD  +EVVLRNLVAYEA   +GPLVLARYTE MNGI+DT  DVK LR  G+
Sbjct  407   ATLWLPVITLDATTEVVLRNLVAYEAVAVRGPLVLARYTEMMNGIIDTTRDVKILRRSGV  466

Query  616   ILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGS  437
             ++NR+KS+ EVA++WNGM ++ R++KV+ LD  I  VN   +    V+ ++ ++ Y+FGS
Sbjct  467   LVNRMKSNREVADMWNGMCRAARVSKVSRLDGVIRAVNAHRDRTPAVRVQKMLKRYVFGS  526

Query  436   WQFltllativllllmvLQSFCSVYTC-SRFFNDV  335
             W+ LTLLA++VLL++  L++FCS Y C + +F +V
Sbjct  527   WKILTLLASVVLLVMTGLEAFCSAYPCHNSWFGNV  561



>ref|XP_010687780.1| PREDICTED: putative UPF0481 protein At3g02645 [Beta vulgaris 
subsp. vulgaris]
Length=535

 Score =   295 bits (755),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 207/552 (38%), Positives = 312/552 (57%), Gaps = 52/552 (9%)
 Frame = -3

Query  1945  WVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMER  1766
             WVI +QK L+ E  ++ +I   I  V K L    PE Y PQ + +GPYH+   +L+EM++
Sbjct  17    WVIKMQKMLQDEDVDDTQI--CIHKVSKILRAVKPEAYTPQLIGLGPYHHWREDLYEMQQ  74

Query  1765  HKLDAAKIFQKQL-----RTIKLHSLAEEMMKVE-SRIRLSYDKQLNLRVETLAWMMAVD  1604
             +K  A+K  QK          KL+ L + ++K + ++IR  YD+ L+   +TLAWMM VD
Sbjct  75    YKFIASKRSQKDCCNDKEAVEKLNQLVDSLVKHDIAQIRACYDRFLDEDDQTLAWMMLVD  134

Query  1603  ASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
             + FLL+FL+ + +     +  + S + S+L+D    +S+++++LRDI+ LENQIP F+L 
Sbjct  135   SLFLLQFLQGFMIPNKSCL--LNSPRTSYLLD--SYQSAYHSILRDIMKLENQIPIFLLE  190

Query  1423  KMLQPQCPSPEASD-DLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPE  1250
              +L    PS E +D DLL TML+   K LSP   ++ +    +    HLL  ++  IVP 
Sbjct  191   LIL----PSCEIADEDLLPTMLLETCKRLSPLNYSKDNLSRDVIKHAHLLELMYYLIVP-  245

Query  1249  MESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLS  1070
                      I         K  +    L +    +         + + N   A+ L  + 
Sbjct  246   ---------IRTVPTDSSNKPEDHAGVLSDIEEEQRRKCFPVDNIPQPNFELAKILDVVP  296

Query  1069  SLAPVKTVLLMPWKAITKL-----PGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPP  905
              LA  K     P K I K+     P L+  KG +E + S          S+ +D+A   P
Sbjct  297   FLANSK-----PLKVIHKMVRSVSPVLSSSKGKVEQMLS----------SNDQDDA---P  338

Query  904   SIEEITIPSVTELANAGVRFIPTKKGILS-IEFDAKTFTLYLPVVTLDINSEVVLRNLVA  728
             ++EEITIPSV++L   G+ F P +  +++ +EFD ++  LYLP ++++ N+EV+LRNLVA
Sbjct  339   TLEEITIPSVSKLLKVGIHFCPKEDSLITCVEFDKQSRKLYLPSISINANTEVILRNLVA  398

Query  727   YEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVR  548
             YEA    GP +LARYTE MNGI+DT EDV+ LRE+ II + +KSD +VA  WNGMN+S R
Sbjct  399   YEAEAISGPSILARYTELMNGIIDTKEDVRLLRERKIIKSYMKSDEDVAQFWNGMNRSTR  458

Query  547   LTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCS  368
             LT V  +DK I +VN+FY+ +  VK  +F +  +F  W+ + LL  +VL++LM +QSFC 
Sbjct  459   LTHVPPMDKVIKEVNEFYDNKRRVKFYKFTKDCLFYCWKIVMLLLALVLMVLMCIQSFCD  518

Query  367   VYTCSRFFNDVT  332
             VY C R    V 
Sbjct  519   VYRCPRVLGPVN  530



>ref|XP_009385543.1| PREDICTED: putative UPF0481 protein At3g02645, partial [Musa 
acuminata subsp. malaccensis]
Length=347

 Score =   282 bits (721),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 164/336 (49%), Positives = 219/336 (65%), Gaps = 11/336 (3%)
 Frame = -3

Query  1969  NIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTN  1790
             N   DE +WVI I+ TLE E +++  I VS+F VPK L V  PE YVPQ +A+GPYH+  
Sbjct  17    NPHFDELRWVIQIRHTLEEEHDDDMGIPVSVFNVPKCLQVTKPEAYVPQLIAVGPYHHWR  76

Query  1789  PELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMA  1610
             PEL+EMER+KL AA+  QKQ  TIKL  L E+  K+E +IR  Y + L+   +TLAWMMA
Sbjct  77    PELYEMERYKLAAARRTQKQFHTIKLQHLIEQFTKLEHKIRAHYHRYLDFNGDTLAWMMA  136

Query  1609  VDASFLLEFLKVYAVK-----EGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQ  1445
             VDASFLLEFL+VYAV+     EGK++  + S++MSHLVD  G+KS+HN +LRDI+MLENQ
Sbjct  137   VDASFLLEFLQVYAVQEEGEGEGKVLRRL-SSRMSHLVDYTGRKSAHNVILRDIMMLENQ  195

Query  1444  IPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLF  1268
             IP F+LRK+L+ QC S E +D  L  ML GL KELSPFK  +    + +A   HLL  L+
Sbjct  196   IPLFLLRKILELQCSSIEVADGTLTKMLTGLLKELSPFKLMDNFPCIDVAQHAHLLELLY  255

Query  1267  QTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPAR  1088
               +VP+ + +  + EI+E       K+ +      NSGYV+     VW I   LN  P R
Sbjct  256   YVLVPKSDDDGDDNEIEEQNDEAAPKEQK----YGNSGYVRQLLDAVWKIGSSLNGAPIR  311

Query  1087  ALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIE  980
              +K +    PVK V+ +PWK +T LPG +++K P+E
Sbjct  312   FIKGVIVSRPVKLVVQVPWKILTSLPGFSIVKQPVE  347



>ref|XP_010025908.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis]
 gb|KCW57621.1| hypothetical protein EUGRSUZ_H00384 [Eucalyptus grandis]
Length=536

 Score =   286 bits (733),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 199/563 (35%), Positives = 289/563 (51%), Gaps = 60/563 (11%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             P+   D   W  H+Q     EL+++   NV +F VPK++    P+ Y PQ V +GPYH+ 
Sbjct  2     PSSSKDMRDWFHHVQTNFNEELKKDIPSNVCVFQVPKSVSSTKPQAYTPQLVGLGPYHHL  61

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
              P+L EMER KLD  K  QK+ + +    L   + K++  IR  Y K L +  + L W+M
Sbjct  62    QPQLREMERVKLDVVKNLQKEFQHLSFAELKSTLSKLDIYIRTCYHKFLVMETDMLLWIM  121

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
              VDA FL + L  + + +  L +   S  +  L D  GKK + +A+LRD++MLENQIP F
Sbjct  122   TVDALFLFDLLCQHGINKKTLQS---SPYLQGLADHAGKKLTEDAILRDVMMLENQIPIF  178

Query  1432  ILRKMLQPQCPSPEASDDLLLT------MLMGLSKELSPFKNE-GSAVVQIADATHLLGY  1274
                KML   C   + ++   +       ML+G  K LSP K      + ++    HLL  
Sbjct  179   FTEKMLTVGCLPLQVAERKTIVEGTFPLMLVGFCKALSPLKETIDYDLAKVLKRAHLLDL  238

Query  1273  LFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGP  1094
             L+  +VP  +   + I  D                                 ++K + GP
Sbjct  239   LYSMVVPRQDEFKISIPADIID------------------------------MEKHDSGP  268

Query  1093  ARALKRLSSLAPV-------KTVLLMPWKAI--TKLPGLNVMKGPIESLFSCGQKPDGDE  941
             AR    L S  PV        + LL     +  T +P   ++KG +  L+          
Sbjct  269   ARP--ELMSARPVCYSVEISTSTLLGSTSTLLETIMPHAQMLKG-LADLYH-----QLKS  320

Query  940   NSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDI  761
             + DS  N +  P  E+  IP+ + LA AGV+F  T+  I  I F+ +T TL LP + L +
Sbjct  321   SLDSSRNEEASPE-EKALIPTASSLAKAGVKFSQTR-FIKDIRFEERTCTLQLPEIQLGV  378

Query  760   NSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVA  581
             NSEVV+RNLVAYEA    GPLV AR+ E M+G++DT +DVK LR+  II   LK D +V 
Sbjct  379   NSEVVIRNLVAYEAMAISGPLVFARFVELMDGLIDTPDDVKLLRKGSIITGHLK-DDDVT  437

Query  580   NLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativl  401
              L+NGM+ S+ +     LDKTI  VN+FYN   ++KT+  +  Y++ +W+ L ++ATI+ 
Sbjct  438   RLFNGMSDSIEVNGDCELDKTIKKVNEFYNAAPSIKTQNMIERYVYRAWKVLVMVATILF  497

Query  400   lllmvLQSFCSVYTCSRFFNDVT  332
              LLM LQ+FCS Y CS   N  T
Sbjct  498   FLLMALQTFCSAYGCSSSSNKTT  520



>ref|XP_002453500.1| hypothetical protein SORBIDRAFT_04g006910 [Sorghum bicolor]
 gb|EES06476.1| hypothetical protein SORBIDRAFT_04g006910 [Sorghum bicolor]
Length=610

 Score =   286 bits (732),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 203/582 (35%), Positives = 300/582 (52%), Gaps = 67/582 (12%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHY-TNPEL  1781
             DE +WV  ++K+L  E  E       +F VP++L   +PE Y P   ++GPYH+   PEL
Sbjct  27    DEKRWVGWVEKSLRHETAEALGAAAKVFTVPRSLRETNPEAYAPHVFSLGPYHHDARPEL  86

Query  1780  HEMERHKLDAAKIFQ---KQLRTIKLHSLAEEMMK------VESRIRLSYDKQLNLRVET  1628
              +M+R KL  AK F+           H+  E +        +E RIR  Y + L+L   T
Sbjct  87    MDMQRFKLAGAKRFEMLFSGGGGGGGHTTIEHLKDRFLAGGLELRIRAVYHRFLDLNDTT  146

Query  1627  LAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLEN  1448
             LAWMMA+DA FLL+F++ Y  +E      ++S+  + +          NA++RD +MLEN
Sbjct  147   LAWMMAIDACFLLDFIENYRRREAT---DVVSSSANWI----------NAVVRDAMMLEN  193

Query  1447  QIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGS----------AVVQIA  1298
             QIP F+  + L+ +  +   +   L  ++     ++SPFKN  S          A+  +A
Sbjct  194   QIPLFVFARALELRHSTRHEAAKALHAVVFRFIMDVSPFKNSASDAANNKRGAAAIGDLA  253

Query  1297  DATHLLGYLFQTIVPE---------------------MESEHVEIEIdenggmkekkdge  1181
                HLL  L+  +VP+                       +     E+  +  ++ ++  +
Sbjct  254   KHAHLLEVLYHFLVPDATLLDDVDDQVVVEEEEESPATAAADGGEEVFSDDDVEAQQATK  313

Query  1180  edEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKL-PGL  1004
                  +   Y K    +   +  +LN  P R +K+  +LA V   +     A+  L P L
Sbjct  314   PTLEQEEEDYDK--VKEAASMASRLNVAPVRFIKK--NLAKVVGTISRKAPALAALLPVL  369

Query  1003  NVMKGPIE---SLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPT-  836
               +   ++    L   G +   +E   +   A   P  +EI IPSV  LA  GVRF P  
Sbjct  370   GKLMQSVDVEAQLNGGGAEHPAEEGGGA--TAMTAPRADEIRIPSVEALARCGVRFTPAP  427

Query  835   -KKGIL-SIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGI  662
              + GI   I FD  T TL LPV+TLD N+EVVLRNLVAYEA   +GPLVLARYTE MNGI
Sbjct  428   PEVGIEEGIAFDRATATLRLPVITLDANTEVVLRNLVAYEAVAVRGPLVLARYTELMNGI  487

Query  661   VDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRW  482
             +DT +DVK LR  G+++N +KS+ E A +WNGM ++ RLTKV  LD  I  VN   +   
Sbjct  488   IDTSKDVKILRRSGVVVNHMKSNKEAAGMWNGMARATRLTKVPRLDAVISAVNAHRSRSL  547

Query  481   NVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
               + ++ +R Y+F SW+ LTL+A++ LLL+  LQ+FCS Y C
Sbjct  548   PARLRKLLRRYVFRSWKMLTLVASVGLLLMTALQTFCSAYPC  589



>ref|XP_007152483.1| hypothetical protein PHAVU_004G134500g [Phaseolus vulgaris]
 gb|ESW24477.1| hypothetical protein PHAVU_004G134500g [Phaseolus vulgaris]
Length=527

 Score =   279 bits (714),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 201/549 (37%), Positives = 286/549 (52%), Gaps = 39/549 (7%)
 Frame = -3

Query  1969  NIQNDESKWVIHI-QKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             N ++DE  WVI I Q + E        I V I+ VPK+L    PE + PQ +AIGPY++ 
Sbjct  8     NSESDEENWVIQINQMSSEANHSILKIIPVCIYQVPKSLSSAKPEAFAPQLIAIGPYNHF  67

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
              P+L+ MER K+ +AK      +   L  + EE     + IR SY K L+L+ ETL + +
Sbjct  68    CPKLYPMERFKVLSAKAVLDHFQKHDLKQIVEEFRNTATFIRASYHKYLDLKDETLLYTV  127

Query  1612  AVDASFLLEFLKVYAVKE--GKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIP  1439
             A+DA FLL F   Y  ++  G  MA      +   V L+G K + +A++RDI+M+ENQIP
Sbjct  128   AIDALFLLNFFHNYLNEKFSGSFMAG-----LEDRVRLRGVKLTKDAIIRDILMVENQIP  182

Query  1438  FFILRKMLQPQCPS-PEASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLF  1268
              + L K+L  Q    P    D L +ML+   ++ SP    +  +    ++   H+L  ++
Sbjct  183   TYSLLKILVLQSSEPPHLVQDYLGSMLLSFCRQHSPLNLTHVPTCSEAVSKHHHVLDLMY  242

Query  1267  QTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPAR  1088
               +V   E     I +   G    +K    +    +   VK A       +KKL      
Sbjct  243   HLVVSNAEKPETPIPVQSQGTSVSQKSSTSEAITISFKKVKCALTWTLNSMKKLKDVNIP  302

Query  1087  ALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKP  908
              +K      P+K  L    K  ++L  L           S   K  G+E        ++ 
Sbjct  303   LVK------PIKRHLDPVLKVSSQLKTL-----------SSHPKLSGEE--------EEA  337

Query  907   PSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVA  728
             P +  + IP V EL + GV F P + G ++IEFD K   LYLPV+ LD+NSEV++RNLVA
Sbjct  338   PLV--VKIPCVRELHSVGVFFQPLEGGNMAIEFDEKMGILYLPVLKLDVNSEVIMRNLVA  395

Query  727   YEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLK-SDSEVANLWNGMNKSV  551
             YEA      L+  RYTE M GIVDT EDVK L + GII +    S  E   L+NGM+KS+
Sbjct  396   YEALTKPDFLIFTRYTELMRGIVDTVEDVKLLMKAGIIESSSSLSVQETEELFNGMSKSI  455

Query  550   RLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFC  371
               TK   LD+TI  VNK+Y CR  +   R +  Y++ SW+F TLLAT VLL +  +++FC
Sbjct  456   GPTKTQKLDETIKKVNKYYQCRRKINFFRVLTEYVYKSWKFFTLLATFVLLAMTAIETFC  515

Query  370   SVYTCSRFF  344
             SVY C R+F
Sbjct  516   SVYDCHRYF  524



>gb|EEE65203.1| hypothetical protein OsJ_20332 [Oryza sativa Japonica Group]
Length=564

 Score =   280 bits (715),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 141/250 (56%), Positives = 174/250 (70%), Gaps = 6/250 (2%)
 Frame = -3

Query  1060  PVKTVLLMPWKAITKLPGLNVMKGPIESLF-----SCGQKPDGDENSDSKDNADKPPSIE  896
             P+   +  PWK +T +PG + MK P+ES F                 D      +PP IE
Sbjct  311   PISFAVKAPWKMLTVVPGFSAMKHPVESFFMSGGGGDPSSSSTAAGQDHHHAISRPPLIE  370

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLD-INSEVVLRNLVAYEA  719
             EI IPSVTELA AGV+F PT     ++ FDAKT TL+LPVVTLD   +EVVLRNLVAYEA
Sbjct  371   EIMIPSVTELAAAGVQFAPTNGDATTVSFDAKTATLHLPVVTLDGSTTEVVLRNLVAYEA  430

Query  718   CIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTK  539
               A GPLVLARYTE MNGI+DT EDV  LR +G++LNR+KSD E A LWNGM++SVRLTK
Sbjct  431   SAATGPLVLARYTELMNGIIDTGEDVAALRRRGVVLNRMKSDGEAARLWNGMSRSVRLTK  490

Query  538   VAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYT  359
             VA +D  ++ VN+++  RW VK +RFMR Y+FGSWQ LT LA +++LLL  LQ+FCSVYT
Sbjct  491   VAAMDAAVEGVNRYHGARWRVKARRFMRRYVFGSWQLLTFLAAVLMLLLTTLQAFCSVYT  550

Query  358   CSRFFNDVTI  329
             CSR+F  V +
Sbjct  551   CSRWFGAVAV  560


 Score =   212 bits (540),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 152/221 (69%), Gaps = 11/221 (5%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEIN---VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNP  1787
             DE +WVI I+++L+ +  ++++ N   VS+F VPK L  + PE YVPQ +A+GPYH+  P
Sbjct  19    DELRWVIQIRRSLQEDGGDDDDDNGIPVSVFNVPKQLQAHKPEAYVPQFIALGPYHHWRP  78

Query  1786  ELHEMERHKLDAAKIFQKQLR-TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMA  1610
             EL+EMER+KL AA+  Q+ LR  +KL  L E+  + E ++R  Y + L+   ETLAWMM 
Sbjct  79    ELYEMERYKLAAARRAQRHLREGVKLEHLVEQFARAERKVRAHYHRYLDFSGETLAWMMV  138

Query  1609  VDASFLLEFLKVYAVKEGKLMAAM-------ISAKMSHLVDLKGKKSSHNALLRDIIMLE  1451
             VD +FLLEFL+++A  E              +S++M+HLVD  G+KS+HN +LRD++MLE
Sbjct  139   VDGAFLLEFLQIFAAAEAAASGGGGKPELRRVSSRMAHLVDFAGRKSAHNLILRDMLMLE  198

Query  1450  NQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK  1328
             NQIP F+LRK+L+PQC S E + +LL  M+ GL KEL PFK
Sbjct  199   NQIPLFLLRKLLEPQCSSAEEASELLGRMVTGLMKELCPFK  239



>ref|XP_006584162.1| PREDICTED: putative UPF0481 protein At3g02645-like [Glycine max]
Length=350

 Score =   271 bits (694),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 160/344 (47%), Positives = 223/344 (65%), Gaps = 20/344 (6%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I++TLE EL E++E  VSIF VPK L   DP  Y+PQ+VA+GPYHY  PEL+
Sbjct  17    DELQWVIQIRRTLEEELGEDDEFPVSIFSVPKLLRACDPASYIPQQVALGPYHYWRPELY  76

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EM+R+KL AAK FQKQL+++K  ++ +++ K+E RIR  + K L+   ETL WMMAVDAS
Sbjct  77    EMQRYKLAAAKRFQKQLQSLKFDNIIDQLTKLEQRIRACHHKFLDFNGETLVWMMAVDAS  136

Query  1597  FLLEFLKVY--AVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
             FLLEFL+V+  A+++G  +              KG KS HNA+LRDI+MLENQIP F+LR
Sbjct  137   FLLEFLQVFDCAIQDGTKVP-------------KG-KSYHNAILRDIVMLENQIPMFVLR  182

Query  1423  KMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPEM  1247
             KM++ +  S EASD +L    +GL KE+SPFK  E    +Q++ + HLL +L+  IVP +
Sbjct  183   KMMEFKFSSLEASDQMLKLKFIGLFKEISPFKMMEEYPTIQVSKSAHLLDFLYHIIVPNI  242

Query  1246  ESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSS  1067
                   IE++   G +EK+  EE     +S  VK  F ++W +L KLNKGP   +K+L  
Sbjct  243   LERQDTIEVETQQGDEEKEGNEESN--ADSSQVKQLFSELWKLLSKLNKGPVNIIKKLLV  300

Query  1066  LAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENS  935
               P+K  + +PWK I  LPG+ ++K P+E  F C Q    +E+ 
Sbjct  301   SRPMKVFVKLPWKIIINLPGIKILKQPLEYFF-CSQNEGENESQ  343



>gb|KCW57618.1| hypothetical protein EUGRSUZ_H00382 [Eucalyptus grandis]
Length=529

 Score =   273 bits (697),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 192/546 (35%), Positives = 291/546 (53%), Gaps = 31/546 (6%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             D   W  H+      ELE++   NV IF VPK+L    PE Y PQ V +GPYH+  P+L 
Sbjct  7     DMRDWFNHVHNNFNEELEKDIPSNVCIFQVPKSLSSAKPEAYTPQLVGLGPYHHLQPQLT  66

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER KLD AK   K+   + +  LA ++  ++  +R  Y K L++    L+W+M VD+ 
Sbjct  67    EMERVKLDVAKKLHKEFNHLSVAELASKLSDLDLSVRACYHKFLDMDSNMLSWIMTVDSL  126

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FL   +  + + +  L +   S  +  L D  GKK +   + RD++MLENQIP F + KM
Sbjct  127   FLFYQVCQHGINKSFLKS---SPFLEGLADNTGKKLADATIRRDVMMLENQIPIFFVEKM  183

Query  1417  LQPQCPSPEASD------DLLLTMLMGLSKELSPFKNE-GSAVVQIADATHLLGYLFQTI  1259
             L   C   + ++      ++L  ML+G  K LSP K        +     HLL  L+  +
Sbjct  184   LTLGCEPLQVAEQKTIVEEILPRMLVGFCKALSPLKETINCPAAKALKCAHLLDLLYSMV  243

Query  1258  VPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALK  1079
             V    S   E++I       + ++ + +     +  + +   +V    + +N   A +  
Sbjct  244   V----SREDEVKIAIPADTIKIEEHKIEVHGSLNLVISTDVQEVLIPPQNVNH-VAESTV  298

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSI  899
              L   + ++ +  M        P + ++KG ++ L+S    P     +DS    D+ P+ 
Sbjct  299   ELVENSNLRILRNMK-------PHVQMLKGLMD-LYSKLSSP-----TDSL-GVDEAPAE  344

Query  898   EEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEA  719
             E+  IP+ + LA AGV+F   K  I  I F+ KT T  LP +   INSEVV+RNLVAYEA
Sbjct  345   EKALIPTASSLAKAGVKFSKIK-FIKDISFNEKTHTFQLPTIKFVINSEVVIRNLVAYEA  403

Query  718   CIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTK  539
                 GPLV AR+ E M+G+++T +DV+ L++ GII  RLK D EV +L+NGM+ S+ +  
Sbjct  404   MAISGPLVFARFVELMDGLINTLDDVRLLKKHGIITGRLK-DDEVTHLFNGMSDSIEVNG  462

Query  538   VAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYT  359
                LD+TI  VN+FYN    +KT   M  Y++G+W+ L + AT+ L LLM LQ+FCS Y+
Sbjct  463   DCPLDETIKKVNEFYNAAPTIKTHNMMERYVYGAWKVLAMAATVFLFLLMGLQTFCSAYS  522

Query  358   CSRFFN  341
             CS   N
Sbjct  523   CSSLVN  528



>ref|XP_003533280.1| PREDICTED: putative UPF0481 protein At3g02645-like [Glycine max]
Length=534

 Score =   270 bits (691),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 190/549 (35%), Positives = 299/549 (54%), Gaps = 28/549 (5%)
 Frame = -3

Query  1969  NIQNDESKWVIHI-QKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             N ++DE  WVI I Q   E  L   N++ V I+ VPK+L    PE + PQ +AIGPY++ 
Sbjct  8     NSESDEDSWVIQINQLVSETNLSILNKMPVCIYQVPKSLSCVKPEAFSPQLIAIGPYNHF  67

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
              PEL+ MER K+ +AK          L  L E++      IR  Y K L+L+ +TL + M
Sbjct  68    RPELYSMERLKISSAKRVLDHFNKHDLKQLVEQLHNTGPFIRACYHKYLDLKEDTLLYTM  127

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
              +D  FLL+F   Y   + K+ ++ ++  +   + +   K + +A++RD+IM+ENQIP +
Sbjct  128   TLDGLFLLDFFHNYL--DEKVSSSFMTG-IEEQIRISSVKLTKDAIIRDMIMVENQIPTY  184

Query  1432  ILRKMLQPQCPSP-EASDDLLLTMLMGLSKELSPFK--NEGSAVVQIADATHLLGYLFQT  1262
             +L ++L  Q   P ++  + L +ML+   ++ SP K  +  +    +    H+L  ++  
Sbjct  185   MLLRILVLQSSKPIDSVQEYLGSMLLSFCEKHSPLKLTHTPTCSEAVTKHYHILDLMYHL  244

Query  1261  IVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARAL  1082
             +V    SEH ++E          K         N     +   +  GI+  LNK      
Sbjct  245   VV----SEHEKLETPTPESEGMCKPN------SNCSNTPTRSSKSEGIVTFLNKVKGLLT  294

Query  1081  KRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPS  902
               L++L  +K         +T +P    +K P++++ +         +S++  +  + P+
Sbjct  295   WTLATLKRLK---------VTNIPLPQPVKRPLDAILNMPTTFQKFSSSETPPSETEAPA  345

Query  901   IEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYE  722
             +  +T PSV EL + G+ F P+K GI +IEFD K    YLPV+ LD+NSEV++RNLVA+E
Sbjct  346   VV-VTFPSVRELHSVGIHFQPSKGGITTIEFDEKKGIFYLPVLKLDVNSEVIMRNLVAHE  404

Query  721   ACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGII-LNRLKSDSEVANLWNGMNKSVRL  545
             A      L+  RYTE M GI+DT EDVK L+ +GI+  +   S  E   L+NGM+KS+  
Sbjct  405   ALSKPDFLIFTRYTELMRGIIDTVEDVKLLKNEGILESSSSLSVEETEELFNGMSKSIGP  464

Query  544   TKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSV  365
             TK   LD+T+  VNK++  +   K  R + +Y++ SW+FLTLLAT VLL + +LQSFCSV
Sbjct  465   TKTEKLDETVKKVNKYFRDKQKAKPYRILNNYVYSSWRFLTLLATFVLLAMTILQSFCSV  524

Query  364   YTCSRFFND  338
             Y C   F +
Sbjct  525   YDCPSHFRN  533



>ref|XP_009413524.1| PREDICTED: putative UPF0481 protein At3g02645 [Musa acuminata 
subsp. malaccensis]
Length=482

 Score =   267 bits (683),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 154/331 (47%), Positives = 208/331 (63%), Gaps = 10/331 (3%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE +WVI I+ TLE E +++  I VS+F VP+ L V  PE YVPQ +A+G YH+  PEL+
Sbjct  19    DELRWVIQIRHTLEEEHDDDVGIPVSVFNVPRCLQVTKPEAYVPQLIAVGSYHHWRPELY  78

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL AA+  QKQ  TIKL  L E+  K+E +IR  Y + L+    TLAW+MAVD S
Sbjct  79    EMERYKLAAARRTQKQFHTIKLQHLIEQFTKLEHKIRAHYHRYLDFNGNTLAWLMAVDVS  138

Query  1597  FLLEFLKVYAVKE----GKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFI  1430
             FLLEFL+VYA++E    GK++  + S++MSHLVD  G+KS+HN +LRDI+MLENQIP F+
Sbjct  139   FLLEFLQVYAIQEEEGKGKVLRRL-SSRMSHLVDYTGRKSAHNVILRDIMMLENQIPLFL  197

Query  1429  LRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVP  1253
             LR +L+ QC S E +D  L  ML GL KE+SPFK  E    + +A   HLL  L+  +VP
Sbjct  198   LRNILELQCSSIEVADGTLTKMLTGLLKEISPFKLMENFPCIDVAQHAHLLELLYNVVVP  257

Query  1252  EMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRL  1073
             + + +  + EI+E       K+        NSGYV+     V  I   LN  P R +K +
Sbjct  258   KADDDGDDNEIEEQNDEAAAKEQT----YGNSGYVRQLLDAVSKIGSSLNGAPIRFIKSV  313

Query  1072  SSLAPVKTVLLMPWKAITKLPGLNVMKGPIE  980
                  VK V+ +P K +T LPG ++ K P E
Sbjct  314   IVSRLVKFVVQVPRKILTSLPGFSIAKQPDE  344



>emb|CDY28699.1| BnaCnng05850D [Brassica napus]
Length=462

 Score =   263 bits (673),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 186/516 (36%), Positives = 267/516 (52%), Gaps = 116/516 (22%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee--nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPE  1784
             DE++WVI+++K+L+ ELE+    E+ V IF VPK LM    + Y PQRV+IGPYH   PE
Sbjct  18    DEARWVINVRKSLDAELEQHPLEEVTVCIFTVPKALMSTHRDSYTPQRVSIGPYHCLKPE  77

Query  1783  LHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVD  1604
             LHE ER+KL  A+  + Q ++ K H L E +  +E                         
Sbjct  78    LHETERYKLMIARKSRNQSKSFKFHDLVENLQPME-------------------------  112

Query  1603  ASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
                    +K+Y           I  K+  L+D  G    HN +LRD++M+ENQIP F+LR
Sbjct  113   -------VKIY-----------IFRKVETLIDRVG----HNEILRDVMMIENQIPLFVLR  150

Query  1423  KMLQPQCPSPEASDDLLLTMLMGLSKELSP----FKNEGSAV-VQIADATHLLGYLFQTI  1259
             K L+ Q    E++D LLL++L  L + LSP    F ++   V  Q  +  H+L +L+Q I
Sbjct  151   KTLEFQLELTESADALLLSVLKWLCRVLSPLLIKFDDDDEIVKAQFHECNHILDFLYQMI  210

Query  1258  VPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALK  1079
             VP +E E  E + D                 +N G           +L+K+     R   
Sbjct  211   VPRIEEEEEENKAD-----------------ENRG---------CKLLRKIKLQFKRVFA  244

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKD-NADKPPS  902
                      T+L +P + I+ LPG   +      LF+  +K     +S     + +KPP 
Sbjct  245   S-------DTILRLPRRVISNLPGFIALN----YLFTRQEKEAASSSSSVSVFDIEKPPL  293

Query  901   IEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYE  722
             +  +T  S +++         TK+   +                 DIN+E  LRNLVAYE
Sbjct  294   VSLLTPQSRSQIQTN------TKRQRFN-----------------DINTETALRNLVAYE  330

Query  721   ACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS-VRL  545
             A    GPLV  RYTE +NGI+D+DEDV+ LRE+G++++RLKSD E A +WNGM+KS VRL
Sbjct  331   ASNTSGPLVFTRYTELINGIIDSDEDVRLLREQGVLVSRLKSDQEAAEMWNGMSKSVVRL  390

Query  544   TKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGS  437
             TKV FLDKTI++VN++Y  RW VK  RF+  Y++GS
Sbjct  391   TKVGFLDKTIEEVNRYYTGRWKVKIGRFVEVYVYGS  426



>ref|XP_006427509.1| hypothetical protein CICLE_v10027364mg [Citrus clementina]
 gb|ESR40749.1| hypothetical protein CICLE_v10027364mg [Citrus clementina]
Length=378

 Score =   260 bits (665),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 146/275 (53%), Positives = 188/275 (68%), Gaps = 22/275 (8%)
 Frame = -3

Query  1162  NSGYVKSAFGQVWGIL-KKLNKGPARALKRLSSLAPVKTVLLMPWKAITKL--PGLNVMK  992
             +S Y K    Q+W +L  ++NKGP + +K+L    P K +  +PWK    +  P  NV  
Sbjct  116   HSDYTKRLISQLWKLLLSRVNKGPIKLIKKLVVSKPTKLLSKLPWKTFQDVVFPQQNV--  173

Query  991   GPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIE  812
                       +K   DE+S S  + +KPP +EEITIPSVTELA + VRF+PT   I ++ 
Sbjct  174   ----------EKKSDDESSTSSKHMNKPPLVEEITIPSVTELAKSNVRFLPTVGNISTVR  223

Query  811   FDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFL  632
             FDAK   L+LP ++LD+N+ VVLRN+VAYEA  A GPLVL RYTE MNGI+DT+ED K L
Sbjct  224   FDAKKAILHLPTISLDVNTVVVLRNVVAYEASSASGPLVLTRYTELMNGIIDTEEDAKLL  283

Query  631   REKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRS  452
             REKG       SD+ VANLWNGMNKS+++TKV  LD+ I+DVNK+Y  RW VK  ++M+ 
Sbjct  284   REKG-------SDAGVANLWNGMNKSIKMTKVPRLDRVIEDVNKYYYNRWKVKFGKYMKF  336

Query  451   YIFGSWQFltllativllllmvLQSFCSVYTCSRF  347
             Y+FGSW+FLTLLATIVLLLL  LQ+FCSVY C +F
Sbjct  337   YVFGSWKFLTLLATIVLLLLTTLQAFCSVYNCRKF  371


 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN   DE +W+I+I+ TL+ ELE E +    IF V KTLM  DP  Y PQ VAIGPY++ 
Sbjct  5     PNPSFDERQWIINIRHTLKAELENETDFPACIFNVTKTLMSTDPASYTPQEVAIGPYYFW  64

Query  1792  NPELHEMERHKLDAAKIFQKQL  1727
              PEL+ ME +KL AAK  QKQL
Sbjct  65    RPELYGMESYKLAAAKRAQKQL  86



>ref|XP_010025903.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis]
 gb|KCW57615.1| hypothetical protein EUGRSUZ_H00378 [Eucalyptus grandis]
Length=530

 Score =   265 bits (677),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 192/543 (35%), Positives = 282/543 (52%), Gaps = 39/543 (7%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             D   W  H+      ELE++   NV IF VPK+L    PE Y PQ V +GPYH+  P+L 
Sbjct  7     DMRDWFNHVHTNFNEELEKDIPSNVCIFQVPKSLSSAKPEAYTPQLVGLGPYHHLQPQLT  66

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER KLD AK   K+   + +  LA ++  ++  +R  Y K L++    L+W+M VD+ 
Sbjct  67    EMERVKLDVAKKLHKEFNHLSVAELASKLSDLDLSVRACYHKFLDMDSNMLSWIMTVDSL  126

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FL   +  + + +  L +   S  +  L D  GKK +   + RD++MLENQIP F + KM
Sbjct  127   FLFYQVCQHGINKSFLES---SPFLEDLADNTGKKLADATIRRDVMMLENQIPIFFVEKM  183

Query  1417  LQPQCPSPEASD------DLLLTMLMGLSKELSPFKNE-GSAVVQIADATHLLGYLFQTI  1259
             L+  C   + ++      ++L  ML+G  K LSP K        +     HLL  L+  +
Sbjct  184   LKLGCEPLQVAEQKTIVEEILPRMLVGFCKALSPLKETINCPPAKALKCAHLLDLLYSMV  243

Query  1258  VPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAF---GQVWGILKKLNKGPAR  1088
             V   +   + I  D       K +      L  S  V         V  +   + +  A 
Sbjct  244   VSREDEVKIAIPADTIKIEGHKIEVHGSLDLVISTDVPEVLIPPQNVNHVADSMVELVAN  303

Query  1087  A-LKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADK  911
             + L+ L ++ P   +L       +KLP       P +SL                   D+
Sbjct  304   SNLRILRNIKPQAQMLKSMMDLYSKLPS------PTDSL-----------------GVDE  340

Query  910   PPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLV  731
              P+ E+  IP+ + LA AGV+F   K  I  I F+ KT T  LP +   INSEVV+RNLV
Sbjct  341   APAEEKALIPTASSLAKAGVKFSKIK-FIKDISFNEKTHTFQLPTIKFVINSEVVIRNLV  399

Query  730   AYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSV  551
             AYEA    GPLV AR+ E M+G+++T +DVK L++ GII  RLK D EVA L+NGM+ S+
Sbjct  400   AYEAMAISGPLVFARFVELMDGLINTLDDVKLLKKHGIITGRLK-DGEVARLFNGMSHSI  458

Query  550   RLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFC  371
              +   + LDKTI  VN+FYN   N+KT++ +  Y++  W+ + L+ATI+  L++VLQ+FC
Sbjct  459   DVHGPSQLDKTIKKVNEFYNAAPNIKTQKMIERYVYRLWKGVVLVATILFFLVIVLQTFC  518

Query  370   SVY  362
             S Y
Sbjct  519   SAY  521



>gb|KHM99773.1| Putative UPF0481 protein [Glycine soja]
Length=500

 Score =   262 bits (669),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 179/520 (34%), Positives = 284/520 (55%), Gaps = 27/520 (5%)
 Frame = -3

Query  1885  VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKLHS  1706
             V I+ VPK+L    PE + PQ +AIGPY++  PEL+ MER K+ +AK          L  
Sbjct  3     VCIYQVPKSLSCVKPEAFSPQLIAIGPYNHFRPELYSMERLKISSAKRVLDHFNKHDLKQ  62

Query  1705  LAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAK  1526
             L E++      IR  Y K L+L+ +TL + M +D  FLL+F   Y   + K+ ++ ++  
Sbjct  63    LVEQLHNTGPFIRACYHKYLDLKEDTLLYTMTLDGLFLLDFFHNYL--DEKVSSSFMTG-  119

Query  1525  MSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSP-EASDDLLLTMLMGLS  1349
             +   + +   K + +A++RD+IM+ENQIP ++L ++L  Q   P ++  + L +ML+   
Sbjct  120   IEEQIRISSVKLTKDAIIRDMIMVENQIPTYMLLRILVLQSSKPIDSVQEYLGSMLLSFC  179

Query  1348  KELSPFK--NEGSAVVQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkekkdgeed  1175
             ++ SP K  +  +    +    H+L  ++  +V    SEH ++E          K     
Sbjct  180   EKHSPLKLTHTPTCSEAVTKHYHILDLMYHLVV----SEHEKLETPTPESEGMCKPN---  232

Query  1174  EFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVM  995
                 N     +   +  GI+  LNK        L++L  +K         +T +P    +
Sbjct  233   ---SNCSNTPTRSSKSEGIVTFLNKVKGLLTWTLATLKRLK---------VTNIPLPQPV  280

Query  994   KGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSI  815
             K P++++ +         +S++  +  + P++  +T PSV EL + G+ F P+K GI +I
Sbjct  281   KRPLDAILNMPTTFQKFSSSETPPSETEAPAVV-VTFPSVRELHSVGIHFQPSKGGITTI  339

Query  814   EFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKF  635
             EFD K    YLPV+ LD+NSEV++RNLVA+EA      L+  RYTE M GI+DT EDVK 
Sbjct  340   EFDEKKGIFYLPVLKLDVNSEVIMRNLVAHEALSKPDFLIFTRYTELMRGIIDTVEDVKL  399

Query  634   LREKGII-LNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFM  458
             L+ +GI+  +   S  E   L+NGM+KS+  TK   LD+T+  VNK++  +   K  R +
Sbjct  400   LKNEGILESSSSLSVEETEELFNGMSKSIGPTKTEKLDETVKKVNKYFRDKQKAKPYRIL  459

Query  457   RSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFND  338
              +Y++ SW+FLTLLAT VLL + +LQSFCSVY C   F +
Sbjct  460   NNYVYSSWRFLTLLATFVLLAMTILQSFCSVYDCPSHFRN  499



>gb|EAY90837.1| hypothetical protein OsI_12441 [Oryza sativa Indica Group]
Length=445

 Score =   259 bits (662),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 163/432 (38%), Positives = 252/432 (58%), Gaps = 23/432 (5%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN+Q DE++W+I I++ L+ E+E  +   +SIF VPK L+   PE Y PQ VA+GPYH+ 
Sbjct  5     PNLQFDEAQWIIRIKRILDEEIEVHDSQPISIFDVPKPLLCTKPEAYTPQLVALGPYHHC  64

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
               EL +ME +KL AA+  Q+ L  +    L      +E  IR  Y + L L  + LAWMM
Sbjct  65    REELRDMEMYKLSAARRAQRHLPGMSFQQLVAVFATLEFEIRAYYHRHLGLSNDALAWMM  124

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAM--ISAKMSHLVDLKGKKSSHNALLRDIIMLENQIP  1439
             A+D SFLLEFL+ ++ ++    AA+  I ++MSHLVD   + SSH  +L D++MLENQIP
Sbjct  125   AIDVSFLLEFLQTFS-QDSSQRAALQRIPSRMSHLVDPSRRTSSHTMVLHDVVMLENQIP  183

Query  1438  FFILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQTI  1259
              F+L K  + +  S   ++ +L ++L G  +E+S     GS         HLL +L+  +
Sbjct  184   LFLLLKATEMRGSSRATAESVLSSVLSGFFQEVSSLVATGSPCTDTTRHAHLLDFLYSNM  243

Query  1258  VPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALK  1079
              P     +VE     +     ++  ++D+  ++  ++KS    +  +L K      R  K
Sbjct  244   AP----CYVE---GLDLDDATEQADDDDDDDQSKHHMKSTLRSLTDLLIK------RVTK  290

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGD-ENSDSKDNADKPPS  902
              LS L  +   +++  K +T++P L+++   + S  + GQ+P+ D +N+ S  +    P 
Sbjct  291   FLSVLVDLGVRIIL--KLLTRIPCLSMIAQQLNSQPTQGQQPNKDFQNNKSCVS----PL  344

Query  901   IEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYE  722
             +EEI +P V ELA +GVRF+P   GI +IEF A+  TL LPV+ +D+NSEVVLRN+VA+E
Sbjct  345   LEEIAVPCVAELAYSGVRFVPANGGISTIEFCAEAATLRLPVIRVDVNSEVVLRNMVAFE  404

Query  721   ACIAKGPLVLAR  686
             A   +  LVLAR
Sbjct  405   ASTGRRALVLAR  416



>ref|XP_010068366.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis]
 gb|KCW63600.1| hypothetical protein EUGRSUZ_G01227 [Eucalyptus grandis]
Length=530

 Score =   262 bits (669),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 194/558 (35%), Positives = 286/558 (51%), Gaps = 64/558 (11%)
 Frame = -3

Query  1954  ESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHE  1775
             E +WV HI+  L+  ++ E    VS+  VP+++    PE YVP  VA+GPYH+  P+L++
Sbjct  15    EEQWVKHIRDALDHGIDIETP--VSVHCVPQSISSAKPEAYVPHHVALGPYHHFRPQLYQ  72

Query  1774  MERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASF  1595
              E  KLD A+  Q +L+      +A  +   E++IR SY   L +  +TL W+M +D+ F
Sbjct  73    TENPKLDTARRAQAELKLPAFDWMANLLQAEEAKIRASYQLHLEVGTDTLKWIMTIDSLF  132

Query  1594  LLEFLKVYAVKEGKL---MAAMISAKMSHLVDLKGKK--SSHNALLRDIIMLENQIPFFI  1430
             LL+ L  Y  K+  +     A I  + S   D +G     + +++++D++M+ENQIP F+
Sbjct  133   LLDLLHSYKHKQENMDPDKPANIGQEDSIGEDDRGGSPPKTRHSIVKDVMMVENQIPTFV  192

Query  1429  LRK-MLQP--------QCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLL  1280
             LRK MLQ         +    E+ D+ L  M M   + +SP +    S    +    HLL
Sbjct  193   LRKIMLQTKNSMNEVRENEEDESIDEDLGMMSMRFCEAISPLELKRCSPSEAVRQHKHLL  252

Query  1279  GYLFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNK  1100
                +  I+     E  + +                   KN        G  +  + K+  
Sbjct  253   DLFYNLILGRTVPEAAQTK-------------------KNE-----PRGATFSYMIKMVP  288

Query  1099  GPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFS----CGQKPDGDENSD  932
              P+  +                W  ++K   +  +K P+E +F       Q   G     
Sbjct  289   NPSSKVTE-------------AWNELSKFSFMKKLKVPVELVFKLIKLVMQLIPGCSECL  335

Query  931   SKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSE  752
              KD     PS E + IP+V+ L + G++      GI +I FD KT TL LP + L+  +E
Sbjct  336   KKD-----PSQESVMIPTVSRLHSVGIKLRLAVGGIRTIGFDPKTATLNLPRIVLNAPTE  390

Query  751   VVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLW  572
             V+LRNLVAYE    +G  VL RYTE M GI+DT EDVK LRE  II N L  D +V  L+
Sbjct  391   VLLRNLVAYEMISQRGSSVLTRYTELMYGIIDTSEDVKLLREASIISNHLNCDDKVVELF  450

Query  571   NGMNKSVRLTKVAF-LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativlll  395
             NGM KS+     A  LDKTI DVN++YN    VK    MR Y++ SW+FLT++ T+VL+L
Sbjct  451   NGMIKSIGSKSTASELDKTIQDVNRYYNNTRKVKGYNLMRKYVYSSWKFLTMVTTVVLIL  510

Query  394   lmvLQSFCSVYTCSRFFN  341
             LMVLQ+FCSV++C + FN
Sbjct  511   LMVLQTFCSVWSCPQLFN  528



>ref|XP_007152487.1| hypothetical protein PHAVU_004G134800g [Phaseolus vulgaris]
 gb|ESW24481.1| hypothetical protein PHAVU_004G134800g [Phaseolus vulgaris]
Length=495

 Score =   258 bits (658),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 183/528 (35%), Positives = 279/528 (53%), Gaps = 52/528 (10%)
 Frame = -3

Query  1885  VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKLHS  1706
             V I+ VPK+L    PE + PQ +AIGPY++ +P+L+ MER K+ AAK        + L  
Sbjct  3     VCIYQVPKSLSCAKPEAFAPQLIAIGPYNHFSPQLYPMERFKIFAAKRVLDHFNKLDLKQ  62

Query  1705  LAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAK  1526
             L +++      IR  Y + L+L+ +TL + MA+D  FLL+F   Y  +EG  M       
Sbjct  63    LVQKLHNTAPFIRACYHRYLDLKEDTLLYTMALDGLFLLDFFHSYLNEEGSFMTGP----  118

Query  1525  MSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEAS-DDLLLTMLMGLS  1349
                 V + G K + +A++RD+IM+E+QIP +IL ++L  +   P+ S  + L +ML+   
Sbjct  119   -EDQVQISGVKLTKDAIIRDMIMVESQIPTYILMRILVLESSEPDDSVREYLGSMLLSFC  177

Query  1348  KELSPF--KNEGSAVVQIADATHLLGYLFQTIVPEMES-EHVEIEIdenggmkekkdgee  1178
              + SP    +  +    ++   H+L  ++  +V E E  E + +E +             
Sbjct  178   GKHSPLMLTHTPTCSDAVSKHYHVLDLMYHLVVSEQEKVETLALESEGLCKTY-------  230

Query  1177  dEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNV  998
                  N     +   +  GI+  LNK              VK  L      + +L G+N+
Sbjct  231   ----SNCSNTATTSSKYEGIVLFLNK--------------VKGPLTWILGTLKRLKGMNI  272

Query  997   -----MKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEE----ITIPSVTELANAGVRF  845
                  +K P++++ +         ++  K +++ PP   E    +T+PSV EL + GVRF
Sbjct  273   PLPQQIKRPLDAILNV--------SNFQKFSSETPPVQTEAPVVVTMPSVHELHSVGVRF  324

Query  844   IPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNG  665
              P+K GI+ IEFD K    YLPV+ LD+NSEV++RNLVA+EA      L+  RYTE M G
Sbjct  325   QPSKGGIMGIEFDEKKGLFYLPVLKLDVNSEVIMRNLVAHEALTKPDFLIFTRYTELMRG  384

Query  664   IVDTDEDVKFLREKGII-LNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNC  488
             I+DT EDVK LR +GII  +   S  E   L+NGM+KS+  TK   LD+TI  VNK++  
Sbjct  385   IIDTVEDVKVLRTEGIIESSSSLSVEETEELFNGMSKSIGPTKTEKLDETIKKVNKYFCD  444

Query  487   RWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFF  344
             +        + SY++ SW+ LT LAT VLL +  LQ+FC+VY C   F
Sbjct  445   KKKANPYTNLTSYVYSSWRLLTFLATFVLLAMTALQTFCTVYDCPSNF  492



>gb|KHN24465.1| Putative UPF0481 protein [Glycine soja]
Length=529

 Score =   258 bits (660),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 192/556 (35%), Positives = 283/556 (51%), Gaps = 51/556 (9%)
 Frame = -3

Query  1969  NIQNDESKWVIHI-QKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             N ++DE  WVI I Q   E  L   N++ V I+ VPK+L    PE + PQ +AIGPY + 
Sbjct  8     NSESDEDSWVIQINQLVSETNLSILNKMPVCIYQVPKSLSCAKPEAFSPQLIAIGPYTHF  67

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
             +P+L+ MER K+ AAK      +      L E++      IR SY K L+ + +TL +++
Sbjct  68    HPDLYPMERFKVFAAKGVLDHFKKHDFKQLIEQLRSTGQFIRASYHKYLDFKEDTLLYII  127

Query  1612  AVDASFLLEFLKVYAVKE--GKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIP  1439
             A+D  FLL+F   Y  +E  G  M  +        V L G K + +A++RDIIM+ENQIP
Sbjct  128   AIDGLFLLDFFHNYLNEEVSGSFMTGLQDQ-----VQLSGVKLTKDAIIRDIIMVENQIP  182

Query  1438  FFILRKMLQPQCPSPEASD-DLLLTMLMGLSKELSPFK----NEGSAVVQIADATHLLGY  1274
              +IL ++L  +   P  S  + L +ML+   K+ SP K      GS  V  +   H+L  
Sbjct  183   TYILVRILVLESSKPADSVLEFLGSMLLSFCKKHSPLKVTHIPTGSEAV--SKHYHILDL  240

Query  1273  LFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGP  1094
             ++  +V   E                          K+         +    LKK +K  
Sbjct  241   MYHLVVSHTE--------------------------KSETPTTPDQSEGTSTLKKSSKSE  274

Query  1093  ARALKRLSSLAPVKTVLLMPWKAITKLPGLNV-----MKGPIESLFSCGQKPDGDENSDS  929
               A    +    VK VL    ++  KL  +N+     +K  I+++ +     +   +   
Sbjct  275   GTAAS--NHFKKVKNVLSWTLESAKKLKDVNIPLVQPIKRHIDTILNMSSHLESLSSHPK  332

Query  928   KDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEV  749
                 ++ P +  + IP V EL + GV F P + G ++I+FD K    YLPV+ LD+NSEV
Sbjct  333   LSEEEETPVV--VNIPCVRELHSVGVYFQPVEGGNMAIDFDEKKGIFYLPVLKLDVNSEV  390

Query  748   VLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLK-SDSEVANLW  572
             ++RNLVA+EA      L+  RYTE M GI+DT EDVK L+  GII +    S  E   L+
Sbjct  391   IMRNLVAHEALTKPDFLIFTRYTELMRGIIDTVEDVKLLKNAGIIDSSSSLSVEETEELF  450

Query  571   NGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllll  392
             NGM+KS+  TK   LD+TI  VNK+Y+ +      R +  Y++ SW+  TLLAT VLL +
Sbjct  451   NGMSKSIGPTKTEKLDETIKKVNKYYHDKRKANLYRTLTEYVYNSWKLFTLLATFVLLAM  510

Query  391   mvLQSFCSVYTCSRFF  344
               LQ+FCS Y C  +F
Sbjct  511   TALQTFCSAYDCPSYF  526



>ref|XP_010025902.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis]
 gb|KCW57614.1| hypothetical protein EUGRSUZ_H00377 [Eucalyptus grandis]
Length=532

 Score =   257 bits (657),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 193/551 (35%), Positives = 297/551 (54%), Gaps = 52/551 (9%)
 Frame = -3

Query  1969  NIQNDESK-WVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             ++ + E+K W+  +QK  E E E++   NV +F VPK+L    PE Y PQ + +GPYH+ 
Sbjct  2     SLSSTETKEWLDRVQKYFEEEFEKDIAPNVCVFKVPKSLSSAKPEAYTPQLIGLGPYHHL  61

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
              P+L EMER KL   K   ++        L  ++ K++  +R  Y K L++  + L+W+M
Sbjct  62    QPQLREMERVKLSVVKRLHRKSDRWSFSELTSKLSKLDLYVRACYHKFLDIDAKALSWIM  121

Query  1612  AVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFF  1433
              +DA FL   L ++A+  GK +    S+ +  L +  GKK + +A+LRD++MLENQIP F
Sbjct  122   TLDALFLFYLLCLHAM--GKKIEP--SSPLWGLANSVGKKLAEDAILRDVMMLENQIPLF  177

Query  1432  ILRKMLQPQCPSPEASDDLLLT-----MLMGLSKELSPFKNEGSAVVQIADA-----THL  1283
              L  M++    + E ++   +      ML+G  K +SP +      ++  D       HL
Sbjct  178   FLENMVKVGSAALEDAERKTIEENFPGMLVGFCKAVSPLEE----TIKEPDPKGLKHAHL  233

Query  1282  LGYLFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLN  1103
             L  L+  +V   + +  +I+I  +    E+      + +  S  ++S       + K   
Sbjct  234   LDLLYSMVV--RKEDEFKIDIPADTIDVEEDLYHPRDMVPTSNNIESTARM--ALTKSGF  289

Query  1102  KGPARALK-RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSK  926
             K P+   K R  +L     + ++P K   +L  L+         F  G+ P         
Sbjct  290   KLPSFKDKIRPHALLLQDIMKILPQK--IELSTLDS--------FGRGEAP---------  330

Query  925   DNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVV  746
                    ++E+  IP+ + LA AGVRF  TK  I    FD KT T  LPV+ L INSEVV
Sbjct  331   -------AVEKGLIPTASSLAKAGVRFGKTKY-IEETSFDEKTRTFRLPVIKLSINSEVV  382

Query  745   LRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNG  566
             +RNLVAYEA    GPLVLAR+ E M+ ++DT +DVK LR+ GII   LK D EVA+L+NG
Sbjct  383   IRNLVAYEAMAISGPLVLARFMEMMDSLLDTPQDVKLLRKHGIITGHLK-DDEVAHLFNG  441

Query  565   MNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmv  386
             M++S+       L+KTI+ VN+FYN R ++K  + +  Y++G+W+ L   AT++ LLL  
Sbjct  442   MSRSMEAHGHCQLNKTIEKVNQFYNARPSIKALKMIEQYVYGAWKVLVTAATLLFLLLTA  501

Query  385   LQSFCSVYTCS  353
             LQ+FCS Y+ S
Sbjct  502   LQTFCSAYSYS  512



>ref|XP_003548274.1| PREDICTED: putative UPF0481 protein At3g02645-like [Glycine max]
Length=529

 Score =   257 bits (656),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 191/557 (34%), Positives = 283/557 (51%), Gaps = 53/557 (10%)
 Frame = -3

Query  1969  NIQNDESKWVIHI-QKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             N ++DE  WVI I Q   E  L   N++ V I+ VPK+L    PE + PQ +AIGPY + 
Sbjct  8     NSESDEDSWVIQINQLVSETNLSILNKMPVCIYQVPKSLSCAKPEAFSPQLIAIGPYTHF  67

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
             +P+L+ MER K+ AAK      +      L E++      IR SY K L+ + +TL +++
Sbjct  68    HPDLYPMERFKVFAAKGVLDHFKKHDFKQLIEQLRSTGQFIRASYHKYLDFKEDTLLYII  127

Query  1612  AVDASFLLEFLKVYAVKE--GKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIP  1439
             A+D  FLL+F   Y  +E  G  M  +        V L G K + +A++RDIIM+ENQIP
Sbjct  128   AIDGLFLLDFFHNYLNEEVSGSFMTGLQDQ-----VQLSGVKLTKDAIIRDIIMVENQIP  182

Query  1438  FFILRKMLQPQCPSPEASD-DLLLTMLMGLSKELSPFK-----NEGSAVVQIADATHLLG  1277
              +IL ++L  +   P  S  + L +ML+   K+ SP K      +  AV   +   H+L 
Sbjct  183   TYILVRILVLESSKPADSVLEFLGSMLLSFCKKHSPLKVTHIPTDSEAV---SKHYHILD  239

Query  1276  YLFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKG  1097
              ++  +V   E                          K+         +    LKK +K 
Sbjct  240   LMYHLVVSHPE--------------------------KSETPTTPDQSEGTSTLKKSSKS  273

Query  1096  PARALKRLSSLAPVKTVLLMPWKAITKLPGLNV-----MKGPIESLFSCGQKPDGDENSD  932
                A    +    VK VL    ++  KL  +N+     +K  I+++ +     +   +  
Sbjct  274   EGTAAS--NHFKKVKNVLSWTLESAKKLKDVNIPLVQPIKRHIDTILNMSSHLESLSSHP  331

Query  931   SKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSE  752
                  ++ P +  + IP V EL + GV F P + G ++I+FD K    YLPV+ LD+NSE
Sbjct  332   KLSEEEEAPVV--VNIPCVRELHSVGVYFQPVEGGNMAIDFDEKKGIFYLPVLKLDVNSE  389

Query  751   VVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLK-SDSEVANL  575
             V++RNLVA+EA      L+  RYTE M GI+DT EDVK L+  GII +    S  E   L
Sbjct  390   VIMRNLVAHEALTKPDFLIFTRYTELMRGIIDTVEDVKLLKNAGIIDSSSSLSVEETEEL  449

Query  574   WNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativlll  395
             +NGM+KS+  TK   LD+TI  VNK+Y+ +      R +  Y++ SW+  TLLAT VLL 
Sbjct  450   FNGMSKSIGPTKTEKLDETIKKVNKYYHDKRKANLYRTLTEYVYNSWKLFTLLATFVLLA  509

Query  394   lmvLQSFCSVYTCSRFF  344
             +  LQ+FCS Y C  +F
Sbjct  510   MTALQTFCSAYDCPSYF  526



>gb|KCW57617.1| hypothetical protein EUGRSUZ_H00381 [Eucalyptus grandis]
Length=510

 Score =   256 bits (654),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 186/551 (34%), Positives = 277/551 (50%), Gaps = 60/551 (11%)
 Frame = -3

Query  1960  NDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
              +  +W IH++   + EL+++   +V +F VP++L    P+ Y PQ V +GPYH+  P L
Sbjct  6     TETREWFIHVKTNFKEELQKDINSHVCVFQVPRSLSSAKPQAYAPQLVGLGPYHHLQPHL  65

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
              EMER KLD  K   K+   +    L  ++  +   +R  Y K L++  + L+W+M VDA
Sbjct  66    LEMERVKLDVVKKLHKESSGMSFMELVRKLTDLHLYVRACYHKFLDIDADVLSWIMTVDA  125

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
              FL   L                    H  D  GKK + +A+LRD++MLENQIP F L K
Sbjct  126   QFLFHLL------------------CQHDPDHAGKKLAEDAILRDVMMLENQIPIFFLAK  167

Query  1420  MLQPQCPSPEASDDLLLT-----MLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTI  1259
             M+   C   E ++   +      ML+G  K LSP K      V +     HLL  L+  +
Sbjct  168   MVTVACSPLEVTEQKKIEENFPHMLVGFCKFLSPLKETRRYQVDKTLKRAHLLDLLYSMV  227

Query  1258  VPEMESEHVEIEIdenggmkekkdgeedEFLKNSG-----YVKSAFGQVWGILKKLNKGP  1094
             V E E E  +I+I  N  + E+          +SG     ++ S    V G+L+  N   
Sbjct  228   V-EREDE-FKIDIPANIILIEEDKTGAVPTSNDSGRTAPQHLVSMTENVLGLLQSPNLPC  285

Query  1093  ARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNAD  914
                ++  +          M  + I ++    +    ++S                    +
Sbjct  286   TEKIRPHA----------MMVQGIMRILSQQIGPSVLDSF-----------------GYE  318

Query  913   KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNL  734
             + P+ E+  I   + LA AGV+F  T   I    FD KT T  LP + L +NSEVV+RNL
Sbjct  319   EAPAEEKGLISRASSLAKAGVKFRKTDY-IEETSFDEKTHTFQLPAIKLSVNSEVVIRNL  377

Query  733   VAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS  554
             VAYEA    GPL+  R+ E M+G++DT  DV+ L++ GII   LK D EVA L+NGM+ S
Sbjct  378   VAYEAMATSGPLLFTRFVELMDGLLDTPHDVRLLKKHGIITGHLK-DGEVARLFNGMSHS  436

Query  553   VRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSF  374
             +     + LDKTI  VN+FY+    +KT+  +  Y++  W+FL ++ATI+  LLMVLQ+F
Sbjct  437   IDGHCPSQLDKTIKKVNEFYHAAPKIKTQNMIERYVYNFWKFLAMVATILFFLLMVLQTF  496

Query  373   CSVYTCSRFFN  341
             CS Y+CS   N
Sbjct  497   CSAYSCSTLLN  507



>gb|ACU23293.1| unknown [Glycine max]
Length=529

 Score =   255 bits (652),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 191/557 (34%), Positives = 282/557 (51%), Gaps = 53/557 (10%)
 Frame = -3

Query  1969  NIQNDESKWVIHI-QKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             N ++DE  WVI I Q   E  L   N++ V I+ VPK+L    PE + PQ +AIGPY + 
Sbjct  8     NSESDEDSWVIQINQLVSETNLSILNKMPVCIYQVPKSLSCAKPEAFSPQLIAIGPYTHF  67

Query  1792  NPELHEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMM  1613
             +P+L+ MER K+ AAK      +      L E++      IR SY K L+ + +TL +++
Sbjct  68    HPDLYPMERFKVFAAKGVLDHFKKHDFKQLIEQLRSTGQFIRASYHKYLDFKEDTLLYII  127

Query  1612  AVDASFLLEFLKVYAVKE--GKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIP  1439
             A+D  FLL+F   Y  +E  G  M  +        V L G K + +A++RDIIM+ENQIP
Sbjct  128   AIDGLFLLDFFHNYLNEEVSGSFMTGLQDQ-----VQLSGVKLTKDAIIRDIIMVENQIP  182

Query  1438  FFILRKMLQPQCPSPEASD-DLLLTMLMGLSKELSPFK-----NEGSAVVQIADATHLLG  1277
              +IL ++L  +   P  S  + L +ML+   K+ SP K      +  AV   +   H+L 
Sbjct  183   TYILVRILVLESSKPADSVLEFLGSMLLSFCKKHSPLKVTHIPTDSEAV---SKHYHILD  239

Query  1276  YLFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKG  1097
              ++  +V   E                          K+         +    LKK  K 
Sbjct  240   LMYHLVVSHPE--------------------------KSETPTTPDQSEGTSTLKKSPKS  273

Query  1096  PARALKRLSSLAPVKTVLLMPWKAITKLPGLNV-----MKGPIESLFSCGQKPDGDENSD  932
                A    +    VK VL    ++  KL  +N+     +K  I+++ +     +   +  
Sbjct  274   EGTAAS--NHFKKVKNVLSWTLESAKKLKDVNIPLVQPIKRHIDTILNMSSHLESLSSHP  331

Query  931   SKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSE  752
                  ++ P +  + IP V EL + GV F P + G ++I+FD K    YLPV+ LD+NSE
Sbjct  332   KLSEEEEAPVV--VNIPCVRELHSVGVYFQPVEGGNMAIDFDEKKGIFYLPVLKLDVNSE  389

Query  751   VVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLK-SDSEVANL  575
             V++RNLVA+EA      L+  RYTE M GI+DT EDVK L+  GII +    S  E   L
Sbjct  390   VIMRNLVAHEALTRPDFLIFTRYTELMRGIIDTVEDVKLLKNAGIIDSSSSLSVEETEEL  449

Query  574   WNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativlll  395
             +NGM+KS+  TK   LD+TI  VNK+Y+ +      R +  Y++ SW+  TLLAT VLL 
Sbjct  450   FNGMSKSIGPTKTEKLDETIKKVNKYYHDKRKANLYRTLTEYVYNSWKLFTLLATFVLLA  509

Query  394   lmvLQSFCSVYTCSRFF  344
             +  LQ+FCS Y C  +F
Sbjct  510   MTALQTFCSAYDCPSYF  526



>dbj|BAC99540.1| pentatricopeptide (PPR) repeat-containing protein-like [Oryza 
sativa Japonica Group]
Length=654

 Score =   258 bits (660),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 178/455 (39%), Positives = 251/455 (55%), Gaps = 34/455 (7%)
 Frame = -3

Query  1648  LNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLR  1469
             L L  +TLAWMMA+D  FLL+FL+ Y   E      M+S+  + +          NA++R
Sbjct  206   LELNEQTLAWMMAIDTCFLLDFLESYHRDEA---TDMVSSAANWI----------NAVVR  252

Query  1468  DIIMLENQIPFFILRKMLQPQCPSPEASDDL-----LLTMLMGLSKELSPFKNEGSAVVQ  1304
             D IMLENQIP F+    L+ +  + +A         L  +L     E+SP K   SA + 
Sbjct  253   DAIMLENQIPLFLFAAALELRHGTDQAQAASAAADALRGVLGRFITEVSPIKTTASAALA  312

Query  1303  IAD-----ATHLLGYLFQTIVP-EMESEHVEIE---IdenggmkekkdgeedEFLKNSGY  1151
             +A        HLL  L+  +VP +  +E V  E   +            +  + + +   
Sbjct  313   VAGDDLARHAHLLELLYHFLVPTDAVAEAVGNEPPPLVPEDFSAVDVFDQMQKEIPDYDK  372

Query  1150  VKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLF  971
             VK A  QV      L+  P R +K+     P+     +P K + K+P L+ +   +  L+
Sbjct  373   VKQACVQV----SSLDMAPIRFIKKNLISRPMGLAASLPGKLMRKVPLLSAVAPLVGKLW  428

Query  970   SCGQKPDGDENSDSKDNAD---KPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAK  800
             S        E      N       P  +E+ IPSV +LA  GVRF P  +GI  IEFDA 
Sbjct  429   SSSSSAADMEARLKGVNLGTIINSPLAQELMIPSVAQLAACGVRFAPAPEGIAGIEFDAP  488

Query  799   TFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKG  620
               TL LPV+T+D N+E VLRNLVAYEA   +GPLVLARYTE MNGI+DT +DVK LR+ G
Sbjct  489   AATLKLPVITVDGNTETVLRNLVAYEAVAVRGPLVLARYTELMNGIIDTAKDVKILRQSG  548

Query  619   IILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFG  440
             +++NR+KSD E A +WNGM ++ RL++V  LD  I  VN+  + R  V+ +R M+ Y+F 
Sbjct  549   VVVNRMKSDGEAAEMWNGMCRATRLSRVPRLDGVIRAVNEHRSRRAAVRLRRMMKRYVFR  608

Query  439   SWQFltllativllllmvLQSFCSVYTCSRFFNDV  335
             SW+ LTLLA +VLLL+  LQ+FCSVY C+R+F ++
Sbjct  609   SWRVLTLLAAVVLLLMTALQTFCSVYQCNRWFGNM  643


 Score = 63.2 bits (152),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 44/76 (58%), Gaps = 1/76 (1%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleee-nEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             DE +W+  +++++     EE     V +F VP+ L    PE Y P   A+GPYH   PEL
Sbjct  30    DEGRWLSRVRESMAERAAEELGAAAVKVFDVPRVLRSTRPEAYAPHHFALGPYHCRRPEL  89

Query  1780  HEMERHKLDAAKIFQK  1733
              +MER+KL AAK  +K
Sbjct  90    RDMERYKLAAAKRAEK  105



>gb|KCW44214.1| hypothetical protein EUGRSUZ_L02360, partial [Eucalyptus grandis]
Length=502

 Score =   251 bits (642),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 175/517 (34%), Positives = 272/517 (53%), Gaps = 36/517 (7%)
 Frame = -3

Query  1891  INVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKL  1712
             I+V +F VP++L    P+ Y+PQ V +GPYH+   +L +MER KLD AK   K+   +  
Sbjct  15    IHVCVFQVPRSLSSAKPQAYIPQLVGLGPYHHLQSQLLQMERVKLDVAKKLHKESNGLSF  74

Query  1711  HSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMIS  1532
               L E++  +   +R  Y K L++  +  +W+M+VDA FL   L  +A+  GK  A   S
Sbjct  75    TELVEKLTDLHLYVRACYHKFLDIDADVFSWIMSVDAQFLFHLLCQHAI--GK-RAPESS  131

Query  1531  AKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASD-----DLLLT  1367
               +  L D  GKK + +A+LRD++MLENQIP F+L +M+   C   E ++     +    
Sbjct  132   PFLGGLADHAGKKLAEDAILRDVMMLENQIPIFLLAQMVTVMCAPLEVAERKKIQENFPH  191

Query  1366  MLMGLSKELSPFKNEGSAVVQIA-DATHLLGYLFQTIVPEMESEHVEIEIdenggmkekk  1190
             ML+   K LSP K      V  A    HLL  L+  +V   +   ++I  D     ++K 
Sbjct  192   MLLRFCKSLSPLKETRQYPVDKALKRAHLLNLLYSMVVEREDEFKIDIPADIIVIEEDKT  251

Query  1189  dgeedEFLKNSGYVKSA-FGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKL  1013
             +  +     ++   ++A   ++ GIL  +        +++   A       M  + I K+
Sbjct  252   ESLDGAVPASNDNRRTARLHRIGGILTAVQSSDLPFTEKIRPHA-------MMAQKIMKI  304

Query  1012  PGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTK  833
                 +    ++SL                   ++ P+ E+  IP+ + LA AG++F  T 
Sbjct  305   LSQQIGPSALDSL-----------------GYEEAPAEEKGLIPTASSLAKAGIKFRKTD  347

Query  832   KGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDT  653
               I    FD KT T  LP + L +NSEVV+RNLVAYEA    GPL+  R+ E M+G++D 
Sbjct  348   Y-IEETSFDEKTHTFQLPAIKLSVNSEVVIRNLVAYEAMATSGPLLFTRFVELMDGLLDH  406

Query  652   DEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVK  473
               DV+ L++ GII   LK D EVA L+NGM+ S+ +   + LDKTI  VN+FY+    +K
Sbjct  407   PRDVRLLKKHGIITGHLK-DGEVACLFNGMSHSIDVHGPSQLDKTIKKVNEFYHAAPKIK  465

Query  472   TKRFMRSYIFGSWQFltllativllllmvLQSFCSVY  362
             T+  +  Y++  W+ L ++ATI+   LMVLQ+FCS Y
Sbjct  466   TQNMIERYVYNFWKVLVMVATILFFPLMVLQTFCSSY  502



>ref|XP_006584163.1| PREDICTED: putative UPF0481 protein At3g02645-like [Glycine max]
Length=262

 Score =   242 bits (617),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 139/297 (47%), Positives = 183/297 (62%), Gaps = 41/297 (14%)
 Frame = -3

Query  1363  LMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkekkd  1187
              +GL KE+SPFK  E    +Q++ + HLL +L+  IVP +      IE++   G +E++ 
Sbjct  6     FIGLFKEISPFKMMEEYPTIQVSKSAHLLDFLYHMIVPNILEGQDTIEVEFKQGEEEEEG  65

Query  1186  geedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPG  1007
              EE           + F Q                              +PWK ++ LPG
Sbjct  66    NEES---------NADFSQ------------------------------LPWKTVSNLPG  86

Query  1006  LNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKG  827
               V+K P+E LFS     + + +S +    +KPPS+EEIT+PSVTEL N+GVRF+PT   
Sbjct  87    FKVLKQPLEYLFSQNGG-ESENSSSNSSLKNKPPSVEEITVPSVTELLNSGVRFLPTNGS  145

Query  826   ILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDE  647
             IL+I FDAKT T YLP + LD N+EV L+NLVAYEA +A GPLV+ RYTE MNGI+D+DE
Sbjct  146   ILNITFDAKTCTFYLPTIGLDANTEVFLKNLVAYEASVASGPLVVTRYTELMNGIIDSDE  205

Query  646   DVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNV  476
             D K LREKGIILN LKSD EVANLW+GM+K +RL++   LDK I+DVNK+YN R  V
Sbjct  206   DAKILREKGIILNHLKSDKEVANLWSGMSKLLRLSREPLLDKVIEDVNKYYNGRMKV  262



>ref|XP_010068365.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis]
Length=550

 Score =   247 bits (630),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 195/559 (35%), Positives = 290/559 (52%), Gaps = 50/559 (9%)
 Frame = -3

Query  1954  ESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHE  1775
             E +WV HI+  L   ++ E    VS+  VP+++    PE YVP  VA+GPYH+  P+L++
Sbjct  15    EEQWVKHIRDALHHGIDIETP--VSVHCVPESISSAKPEAYVPHHVALGPYHHLRPQLYQ  72

Query  1774  MERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASF  1595
              E  KL AA+  Q+ L+       A  +   E++IR SY   L +  +TL W+M +D+ F
Sbjct  73    TEHPKLAAARRAQETLKLPAFDRTAGLLQAEEAKIRASYQLHLEVGTDTLKWIMTIDSLF  132

Query  1594  LLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK-M  1418
             LL+ L  Y        +  I  K   + D        ++ ++D++M+ENQIP F+LRK M
Sbjct  133   LLDLLYRYK-------SPNIGIKEDSIWD-----DDPDSTVKDVMMVENQIPTFVLRKIM  180

Query  1417  LQPQ--------CPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQT  1262
             LQ +            E+ D  L  ML    + +SP   E     +     HLL  L+  
Sbjct  181   LQTENSMNEVREYEEDESIDRKLGEMLTRFCEGISPLGLEMCLPSEAIQRKHLLDLLYNL  240

Query  1261  IVPEMESEHVEIEIdenggmkekkdgeedEFLKN-SGYVKSAFGQVWGILKKLN-----K  1100
             I+     E  + +       K +        LK+ S    S   + W  L K +     K
Sbjct  241   ILGTPGPEAAQTK-------KNELRSARFCPLKDMSSTQASKVTEAWNELSKCSFMKKLK  293

Query  1099  GPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQK-----PDGDENS  935
              P + +  + S+    +++   WK ++K   +  +K  IE +F   Q      P   E  
Sbjct  294   VPIKLIFNMVSIPA--SIVTAAWKELSKFSFMKKLKVRIELIFKIIQLAMRLIPRCSEYL  351

Query  934   DSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINS  755
              +       P  E + IP+ ++L + G++      GI +  FD KT TL LP + LD  +
Sbjct  352   SND------PFQEIVMIPTASKLRSVGIKLSLATGGIKTTAFDKKTATLKLPHIDLDATT  405

Query  754   EVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANL  575
             EV+LRNLVAYE    +G L+L RYTE M GI+DT ED+K LRE  I+LNRL SD++V  L
Sbjct  406   EVLLRNLVAYEMISQRGSLILTRYTELMYGIIDTSEDLKLLREASIVLNRLNSDNKVVEL  465

Query  574   WNGMNKSVRLTKVAF-LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativll  398
             +NG+ KS+     A  LD+TI DVN++YN    VK    MR Y++ SW+FLT++AT+VL+
Sbjct  466   FNGVIKSIGSKSTASELDETIRDVNEYYNSTRKVKVYNLMRKYVYSSWKFLTVVATVVLI  525

Query  397   llmvLQSFCSVYTCSRFFN  341
             LLM LQ+FCSV +C + FN
Sbjct  526   LLMALQTFCSVLSCPQLFN  544



>gb|EMT15612.1| hypothetical protein F775_19815 [Aegilops tauschii]
Length=357

 Score =   236 bits (601),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 156/368 (42%), Positives = 211/368 (57%), Gaps = 47/368 (13%)
 Frame = -3

Query  1366  MLMGLSKELSPFKNEGSAVVQ-----IADATHLLGYLFQTIVPEME---------SEHVE  1229
             M+ GL KEL PFK EG+   +     IA  +HLL  L++ +VP+ +         S  VE
Sbjct  1     MVTGLMKELCPFKMEGNIPEKQIERDIAKHSHLLELLYRLLVPKPKPSEDAAPAWSGTVE  60

Query  1228  IEIdenggmkekkdgeedEFL-KNSGYVKSAFGQVWGILKKLNKGPARALKRLSS-LAPV  1055
              +I+E     +     E       S YV      +  +  +L  G      RL   + P+
Sbjct  61    DDIEEQRPDGDGGQEGEGPSAGTGSEYVMQLLSAMLSMASRLKGG------RLGHVMKPI  114

Query  1054  KTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSV  875
             +     PWK +  +PG++ +              D D +             +EI IPSV
Sbjct  115   EFAAKAPWKMLAGIPGISALS----------MHADADMS-------------QEIAIPSV  151

Query  874   TELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLV  695
             TELA++GVRF PT   + +I F+ KT TL+LP VTLD N+EVVLRNLVAY +  A GPLV
Sbjct  152   TELASSGVRFKPTNGNLSTISFNRKTATLHLPAVTLDCNTEVVLRNLVAYGSSAASGPLV  211

Query  694   LARYTEFMNGIVDTDEDVKFLREKGIILNRL-KSDSEVANLWNGMNKSVRLTKVAFLDKT  518
               RY E MNGI+DTD+DV  LR++G+++NR+ KSD E A LWNGM++SV+ +KV  LD  
Sbjct  212   FTRYMELMNGIIDTDDDVTLLRKRGVVINRMKKSDGEAAKLWNGMSRSVQHSKVPDLDAV  271

Query  517   IDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR-FFN  341
             I+DVN++Y  RW+VK KRFMR Y+  SW+ LT  ATI +LLL  LQ+FCSVYTCSR +F+
Sbjct  272   IEDVNRYYGRRWSVKAKRFMRKYVLSSWKMLTFFATISMLLLTTLQAFCSVYTCSRWYFS  331

Query  340   DVTILGTN  317
                  G N
Sbjct  332   GAAFYGAN  339



>ref|XP_011084181.1| PREDICTED: putative UPF0481 protein At3g02645 [Sesamum indicum]
Length=498

 Score =   238 bits (608),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 176/558 (32%), Positives = 283/558 (51%), Gaps = 89/558 (16%)
 Frame = -3

Query  1954  ESKWVIHIQKTlereleeenEINV--SIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             E +WV+ ++K   ++   + + ++   +F V K L    PE Y PQ + +GPYH+  P+L
Sbjct  13    EQRWVLAMEKNFPQQHVLDIDFDIPSCVFRVSKILTEAKPEAYAPQHLGLGPYHHLRPDL  72

Query  1780  HEMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDA  1601
             + M++ KL A + F  Q +  K   + E++++ E  +R  YD+ L+L ++TLAW++A+D 
Sbjct  73    YIMQKQKLAAVRKFLGQEKLQKFRQVVEDLVQWEPVLRACYDEYLDLDIQTLAWILAIDG  132

Query  1600  SFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK  1421
              +L++FLK Y              +M HL               DI+MLENQIP  +L+K
Sbjct  133   LYLVQFLKNYP-------------EMEHLAG-------------DILMLENQIPVILLKK  166

Query  1420  MLQPQCPSPEASDDL-LLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPE-  1250
             +LQ     P   +D  L      L +  SP + N+  A++      HLL  ++  IV   
Sbjct  167   ILQVLELVPNDQNDCSLFEEFETLCQAHSPLRLNKQRAIIGDVSQAHLLNRMYYLIVNNR  226

Query  1249  --MESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAF-GQVWGILKKLNKGPARALK  1079
                E E+V +       +      E  +FL   G+  +   GQ+   ++K          
Sbjct  227   GIQEEEYVSMFSAAVTRIGLNDVVEGVQFLAERGFPGAGIAGQILSAVQK----------  276

Query  1078  RLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSI  899
                          +PW  I               LF  G        +D ++     PS+
Sbjct  277   -------------VPWDKIL-------------GLFKKG-------GTDEEN-----PSV  298

Query  898   EEITIPSVTELAN-AGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYE  722
             +EI IPSVT++   AG++F  T  GI  I+F+ K F  YLPV+ ++  +EVVLRNLVAYE
Sbjct  299   QEIDIPSVTQMTEIAGIKFTLTPGGIRDIDFEEKNF--YLPVIRVNATTEVVLRNLVAYE  356

Query  721   ACIAK--GPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVR  548
             A   +    L LA Y + M GI+D+ +DV+ LR +GII + L  D E+A+++NG+ KS +
Sbjct  357   AATTEPGSTLELAEYVDLMCGIIDSSKDVEILRNEGIIESEL-PDDEIAHIFNGIGKSTK  415

Query  547   LT-KVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFC  371
                  + +++ +D+VN  Y    +VK KR ++ Y + S +FL +L TI +L+L+ LQ+FC
Sbjct  416   KNDNKSNIEEAVDNVNSRYGNLLSVKVKRLLKKYGYASLKFLGVLITIAVLVLLTLQAFC  475

Query  370   SVYTCSRFFNDVTILGTN  317
             SV+ C R+F  +T    N
Sbjct  476   SVFGCGRWFGKITAQSQN  493



>ref|XP_010068363.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis]
Length=546

 Score =   236 bits (603),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 194/559 (35%), Positives = 288/559 (52%), Gaps = 50/559 (9%)
 Frame = -3

Query  1954  ESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHE  1775
             E +WV HI+  L   ++ EN   VS+  VP+++    PE YVP  VA+GPYH+  P+L++
Sbjct  15    EEEWVKHIRDALHHGIDIENP--VSVHCVPESISSAKPEAYVPHHVALGPYHHLRPQLYQ  72

Query  1774  MERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASF  1595
              E  KL AA+  Q  L+       A  +   E++IR SY   L +  +TL W+M +D+ F
Sbjct  73    TEHPKLAAARRAQAALKLPAFDRTAGLLQAEEAKIRASYQLHLEVGTDTLKWIMTIDSLF  132

Query  1594  LLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK-M  1418
             LL+ L  Y        +  I  K   + D        ++ ++D++M+ENQIP F+LR+ M
Sbjct  133   LLDLLYRYK-------SPNIGIKEDSIWD-----DDPDSTVKDVMMVENQIPTFVLREIM  180

Query  1417  LQPQCPS--------PEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQT  1262
             LQ +  +         E+ D  L  ML    K +SP   E     Q     HLL  L+  
Sbjct  181   LQIENSANEVRENEEDESIDRKLGEMLTRFCKGMSPLGLEMCLPSQAIQRKHLLDLLYNL  240

Query  1261  IVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGP-ARA  1085
             I+     E  + +         K +     F +      +   +V     KL+K    + 
Sbjct  241   ILGTTGPEAAQTK---------KNELRSASFFRLIDMASTQTSKVTKAWNKLSKCSFMKK  291

Query  1084  LKRLSSL-----APVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQK-----PDGDENS  935
             LK L  L     + + +++   W  ++K   +  +K  IE +F   Q      P   E  
Sbjct  292   LKVLIKLFFNMVSILASIVTAAWNELSKFSFMKELKERIELIFKIIQVAMQLIPRCSEY-  350

Query  934   DSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINS  755
                      P  E + IP+ ++L N G++      GI +I FD +T TL LP + LD  +
Sbjct  351   -----LSNDPFQEIVMIPTASKLRNVGIKLSLATGGIKTIAFDKRTATLKLPHIDLDATT  405

Query  754   EVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANL  575
             EV+LRNLVAYE    +G L+L RYTE M GI+DT ED+K LRE  I+LNRL SD++V  L
Sbjct  406   EVLLRNLVAYEMISQRGSLILTRYTELMYGIIDTSEDLKLLREASIVLNRLNSDNKVVEL  465

Query  574   WNGMNKSVRLTKVAF-LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativll  398
             +NG+ KS+     A  LD+TI DVN++YN    VK    MR Y++ SW+FLT++AT+VL+
Sbjct  466   FNGVIKSIGSKSTASELDETIRDVNEYYNSTRKVKAYNLMRKYVYSSWKFLTVVATVVLI  525

Query  397   llmvLQSFCSVYTCSRFFN  341
             LLMVL++ CS+ +C R  N
Sbjct  526   LLMVLETSCSILSCPRLIN  544



>gb|KCW44407.1| hypothetical protein EUGRSUZ_L02105 [Eucalyptus grandis]
Length=490

 Score =   231 bits (589),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 187/547 (34%), Positives = 272/547 (50%), Gaps = 80/547 (15%)
 Frame = -3

Query  1948  KWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEME  1769
             +W+IH++   + EL+++   +V +F VP++L    P+ Y PQ V +GPYH+  P L EME
Sbjct  10    EWLIHVKTNFKEELQKDINSHVCVFQVPRSLSSAKPQAYAPQLVGLGPYHHLQPHLLEME  69

Query  1768  RHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLL  1589
             R KLD  K         KLH  +  M  +E                           FL 
Sbjct  70    RVKLDVVK---------KLHKESSGMSFMEL--------------------------FLF  94

Query  1588  EFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQP  1409
               L  +AV +  L ++  S     L D  GKK + +A+LRD++MLENQIP F L KM+  
Sbjct  95    HLLCQHAVGKKTLESSPFSGV---LADHAGKKLAEDAILRDVMMLENQIPIFFLAKMVTV  151

Query  1408  QCPSPEASDDLLLT-----MLMGLSKELSPFKNEGSAVVQIA-DATHLLGYLFQTIVPEM  1247
              C   E ++   +      ML+G  K LSP K      V  A    HLL  L+  +V E 
Sbjct  152   TCSPLEVAEQKKIEENFPHMLVGFCKFLSPLKETRRYQVDKALKRAHLLDLLYSMVV-ER  210

Query  1246  ESEHVEIEIdenggmkekkdgeedEFLKNSG-----YVKSAFGQVWGILKKLNKGPARAL  1082
             E E  +I+I  N  + E+          +SG     ++ S   +V G+L+  N       
Sbjct  211   EDE-FKIDIPANIILIEEDKTGAVPTSNDSGRTDPQHLVSMTEKVLGLLQSPN-------  262

Query  1081  KRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPS  902
                           +P+    K P   +++G +  L     +  G    DS    + P  
Sbjct  263   --------------LPFTEKIK-PHAMMVQGIMRIL----SQQIGPSVLDSFSYEEAPAE  303

Query  901   IEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYE  722
              +E+ IP  + LA AGV+F  T   I    FD KT T  LP + L +NSEVV+RNLVAYE
Sbjct  304   EKEL-IPGASSLARAGVKFHKTDY-IEQTSFDEKTHTFQLPAIKLSVNSEVVIRNLVAYE  361

Query  721   ACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLT  542
             A    GPL+  R+ E M+G++D   DV+ L++ GII   LK D EVA L+NGM+ S+ + 
Sbjct  362   AMATSGPLLFTRFVELMDGLLDHPRDVRLLKKHGIITGHLK-DDEVARLFNGMSHSIDVH  420

Query  541   KVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVY  362
               + +DKTI  VN+FY+    +KT+  +  Y++  W+ L ++ATI+  LLMVLQ+FCS Y
Sbjct  421   GTSQVDKTIKKVNEFYHAAPKIKTQNMIERYVYNFWKVLAMVATILFFLLMVLQTFCSAY  480

Query  361   TCSRFFN  341
             +CS   N
Sbjct  481   SCSTLLN  487



>emb|CDP10499.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   228 bits (582),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 171/536 (32%), Positives = 271/536 (51%), Gaps = 66/536 (12%)
 Frame = -3

Query  1885  VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKL-H  1709
             VS+F VPKTL +  PE Y PQ +A+GPYH+  PEL++MER+KL A K      +     H
Sbjct  41    VSVFEVPKTLTLQKPEAYTPQLIAMGPYHHLRPELYQMERYKLAAVKEISTPEQIFNFQH  100

Query  1708  SLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISA  1529
              +   + +++   R  Y+K ++   +TLAW++A+D+ F L  L  Y V++         A
Sbjct  101   IVINRLKEMDPSTRACYNKFMDYDQDTLAWIVAIDSCFFLHVLHSYLVQD--------EA  152

Query  1528  KMSHLVDLKGKKSSHNALLRDIIMLENQIPFFIL---RKMLQPQCPSPEASDDLLLTMLM  1358
                 L+D       +  + RDI+MLENQIP  +L   RK L+   P+ +  D  L++ML+
Sbjct  153   TDRRLLD-------NTIVTRDIMMLENQIPLILLKEVRKSLEVSPPN-DQDDTELISMLL  204

Query  1357  GLSKELSP--FKNEGSAVVQIADATHLLGYLFQTIVPE-------------MESEHVEIE  1223
              L +  SP  F  + +   +     HLL  +++ IV               +++  V  E
Sbjct  205   QLCEAQSPVKFSIDKTNQDRYRRPLHLLDMMYRVIVNSPGCVVSGSLENRPVQTVPVYTE  264

Query  1222  IdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVL  1043
                +               ++   V +    +  +++ +    A+ L R     PVK V 
Sbjct  265   FKNSLTSSSSTSSSSSSDGEDPDVVHNNLEAILDVVETIGTKRAQDLLR-----PVKAVS  319

Query  1042  LMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELA  863
              +PW A++              LF  G    G+ N          P  +EI IPSV+ L 
Sbjct  320   SIPWSALS-------------GLFRKGNLSTGERN----------PEDDEIAIPSVSRLW  356

Query  862   N-AGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLAR  686
             + AGV+  P    I  I F     TLYLPV+ L+ +SEV++RNLVAYEA + K  L  AR
Sbjct  357   HYAGVQCKPFIGCINEINFVEGEATLYLPVMNLNASSEVIMRNLVAYEAAMCKSTLEFAR  416

Query  685   YTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLT-KVAFLDKTIDD  509
             Y   MNGI+DT EDVK L++ G+I   L  D E+A+ +NGM +    + + + ++  ID 
Sbjct  417   YVNLMNGIIDTAEDVKLLKQNGVIKGALM-DDEIADQFNGMKRCYAGSDQKSNIEVAIDK  475

Query  508   VNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFN  341
             VN FY+ +  V   R ++  ++ SW+ L +++T+ LL+++ +Q+FC  Y CS+ +N
Sbjct  476   VNDFYSKKLLVMMVRRLKKDLYASWKCLAVVSTVALLVVLSMQTFCEFYQCSKIWN  531



>emb|CDP16198.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   228 bits (580),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 174/529 (33%), Positives = 271/529 (51%), Gaps = 64/529 (12%)
 Frame = -3

Query  1885  VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQ--KQLRTIKL  1712
             VS+F VPK L +  PE Y P  +A+GPYH+ +PEL+ MERHKL A K      QL   + 
Sbjct  41    VSVFEVPKILKLQKPEAYTPHLIAMGPYHHLHPELYHMERHKLAAIKEISTPDQLSNFQ-  99

Query  1711  HSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMIS  1532
             H +   + +++  IR  Y+K ++   +TLAW++A+D  F L  L  Y V++      ++ 
Sbjct  100   HVVINRLKEMDPSIRACYNKFMDYDQDTLAWIVAIDGCFFLHILHSYLVQDENTDRRLLD  159

Query  1531  AKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM-----LQPQCPSPEASDDL-LL  1370
               +               + RDI+MLENQIPF +L+K+     + P     E  DD+ L+
Sbjct  160   NTI---------------VTRDIVMLENQIPFVLLKKIRKSLQVSPNSNGQEEGDDIELI  204

Query  1369  TMLMGLSKELSP--FKNEGSAVVQIADATHLLGYLFQTIV--PEMESEHVEIEIdenggm  1202
              ML  L +  SP  F ++ +   +     HLL  ++  IV  P + + + E         
Sbjct  205   LMLFQLCEAQSPVKFSSDKTNQDRYRRPLHLLDMMYHLIVNVPAIPT-YTEFRNSLTSSS  263

Query  1201  kekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAI  1022
                         +N G  ++    +  IL+ +     +  + L  L PVK V  +PW  I
Sbjct  264   SSSSTDG-----ENPGVFRN--NNLEAILELVETFGNKRTQDL--LRPVKLVSSIPWSTI  314

Query  1021  TKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELAN-AGVRF  845
             +              LF  G     ++NS+           +EI IPSV+ L   A V+ 
Sbjct  315   S-------------GLFRKGNVGTKEQNSED----------DEIEIPSVSHLWRYAKVQC  351

Query  844   IPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNG  665
              P    I  I+F  +   LYLPV+ L+ +SEV++RNLVAYEA ++K  L  ARY   MNG
Sbjct  352   KPFIGSIKEIKFVEEEAALYLPVMNLNASSEVIMRNLVAYEAAMSKPTLEFARYVNLMNG  411

Query  664   IVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLT-KVAFLDKTIDDVNKFYNC  488
             I+DT EDVK L++ G+I   L +D E+A+ +NGM +    +   + ++  ++ VNKFY  
Sbjct  412   IIDTAEDVKLLKQNGVIKGGL-TDDEIADQFNGMKRCYAGSDHKSNIEVAVEKVNKFYGK  470

Query  487   RWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFN  341
             +  V+T R +   +F SW+ L L++T+VLL+++ LQ+FC  Y CS+ +N
Sbjct  471   KLLVRTVRRLNRSLFASWKHLALVSTVVLLVVLSLQTFCEFYQCSKIWN  519



>gb|KDP37018.1| hypothetical protein JCGZ_06074 [Jatropha curcas]
Length=161

 Score =   216 bits (549),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -3

Query  793  TLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGII  614
            T YLP+V++D+N+EVVLRNLVAYEA  A GPLV  RYTE MNGI+DTDEDVK LREKGII
Sbjct  3    TFYLPIVSIDVNTEVVLRNLVAYEASNASGPLVFTRYTELMNGIIDTDEDVKLLREKGII  62

Query  613  LNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSW  434
            LNRLKSD E A+LWNGM+KS+RLTKV FLDK I+DVNK+Y+ RW +K   F++ Y+FGSW
Sbjct  63   LNRLKSDQEAADLWNGMSKSIRLTKVPFLDKVIEDVNKYYDGRWKIKVGNFVKHYVFGSW  122

Query  433  QFltllativllllmvLQSFCSVYTCSRFFN  341
            QFLTL+A I LLLLM LQ+FCSVY C+R F+
Sbjct  123  QFLTLVAAIFLLLLMTLQAFCSVYNCARIFH  153



>ref|XP_006465279.1| PREDICTED: putative UPF0481 protein At3g02645-like [Citrus sinensis]
Length=383

 Score =   223 bits (568),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 151/216 (70%), Gaps = 3/216 (1%)
 Frame = -3

Query  1972  PNIQNDESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYT  1793
             PN   DE +W+I+I +TLE E E +    V IF VPKTLM  DP+ Y P+ VAIGPYHY 
Sbjct  9     PNF--DEHRWIINILRTLEEEPETDTGFPVCIFSVPKTLMSSDPDSYTPKEVAIGPYHYW  66

Query  1792  NPELHEMERHKLDAAKIFQKQLR-TIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWM  1616
              PEL+EMER+KL AAK  Q+      K   + +++ ++E +IR  Y   LN   E LAWM
Sbjct  67    RPELYEMERYKLAAAKSAQRHFNGDHKFQDVVDQLKELELQIRACYHNFLNFSNEALAWM  126

Query  1615  MAVDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPF  1436
             MA+ ASFLLEFL++YA+K+GKL     S  MSHL+D  G K++HNA+LRD++MLENQIP 
Sbjct  127   MAIGASFLLEFLQIYAIKDGKLSKTYSSRSMSHLLDYAGTKAAHNAILRDMVMLENQIPL  186

Query  1435  FILRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK  1328
             F+LRKML+ +  S E++D++L  MLMG  +ELSPFK
Sbjct  187   FVLRKMLEFEYSSLESADEMLQAMLMGFCEELSPFK  222


 Score =   183 bits (464),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  763  INSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEV  584
            IN   +LRNLVAYEA  A GPLVLARYTE MNGI+D++EDV+ LREKGIILNRLKSD+EV
Sbjct  230  INISEILRNLVAYEASNASGPLVLARYTELMNGIIDSEEDVRLLREKGIILNRLKSDAEV  289

Query  583  ANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativ  404
            AN WNGMNKS+RLTKV  +DK I+ VNK YN +W VK  + M+ Y+FGSWQFLTLLATI+
Sbjct  290  ANSWNGMNKSIRLTKVPHIDKVIEGVNKHYNSQWKVKFWKSMKHYVFGSWQFLTLLATIM  349

Query  403  llllmvLQSFCSVYTCSR  350
            LLLLM LQ+FCSVY C +
Sbjct  350  LLLLMTLQAFCSVYNCRK  367



>ref|XP_010068362.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis]
Length=538

 Score =   226 bits (577),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 189/560 (34%), Positives = 280/560 (50%), Gaps = 64/560 (11%)
 Frame = -3

Query  1954  ESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHE  1775
             E +WV HI+  +   ++ E    VS+  VP ++    PE YVP  VA+GPYH+  P L+ 
Sbjct  15    EEQWVKHIRDAINHGIDIETP--VSVHCVPVSISSAKPEAYVPHHVALGPYHHLRPHLYH  72

Query  1774  MERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASF  1595
              E  KL AA+  Q  L+       A  +   E++IR SY   L +  +TL W+M +D+ F
Sbjct  73    TEHPKLAAARRAQAALKLPAFDRTAGLLQAEEAKIRASYQLHLQVGTDTLKWIMTIDSLF  132

Query  1594  LLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK-M  1418
             LL+ L  Y        +  I  K   + D        ++ ++D++M+ENQIP F+LR+ M
Sbjct  133   LLDLLYRYK-------SPNIGIKEDSIWD-----DDPDSTVKDVMMVENQIPTFVLREIM  180

Query  1417  LQPQCPS--------PEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQT  1262
             LQ +  +         E+ D  L  ML    K +SP + E     +     HLL  L+  
Sbjct  181   LQIENSANEVRENEEDESIDRKLGEMLTRFCKGISPLELEMCLPSEAIQRKHLLDLLYNL  240

Query  1261  IVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVW------GILKKLNK  1100
             I+     E  + +        E +       +  +    S   + W        +KKL  
Sbjct  241   ILGTTGPEAAQTK------KNELRSASFFRLIDMASTQASKVTKAWNKLSKCSFMKKLKV  294

Query  1099  GPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFS-----------CGQKP  953
                   K +S LA + T     W  ++K   +  +K  +E +F            C +  
Sbjct  295   LIKLFFKMVSILASIVTA---AWNELSKFSFMKDLK--VELIFKIIPLAMQLIPRCSEYL  349

Query  952   DGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVV  773
               D            P  E + IP+ ++L + G++      GI +I FD KT TL LP +
Sbjct  350   SND------------PFQEIVMIPTASKLCSVGIKLSLATGGIKTIAFDKKTATLKLPHI  397

Query  772   TLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSD  593
              LD  +EV+LRNLVAYE    +G L+L RYTE M GI+DT ED+K LRE  I+LNRL SD
Sbjct  398   DLDATTEVLLRNLVAYEMISPRGSLILTRYTELMYGIIDTSEDLKLLREASIVLNRLNSD  457

Query  592   SEVANLWNGMNKSVRLTKVAF-LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltll  416
             ++V  L+NG+ KS+     A  LD+TI DVN++YN    VK    M+ Y++ SW+FLT++
Sbjct  458   NKVVELFNGVIKSIGSKSTASELDETIRDVNEYYNSTRKVKAYNLMKKYVYSSWKFLTVV  517

Query  415   ativllllmvLQSFCSVYTC  356
             AT+VL+LLMVL++FCSV  C
Sbjct  518   ATVVLILLMVLETFCSVLNC  537



>ref|XP_007139216.1| hypothetical protein PHAVU_008G011100g [Phaseolus vulgaris]
 gb|ESW11210.1| hypothetical protein PHAVU_008G011100g [Phaseolus vulgaris]
Length=267

 Score =   213 bits (543),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 121/281 (43%), Positives = 174/281 (62%), Gaps = 20/281 (7%)
 Frame = -3

Query  1525  MSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSK  1346
             MSH +D  G++ +HNA+L+DI+MLENQIP F+LRK+L+ +  S E +DD+L+ ML+GL K
Sbjct  1     MSHFMDYAGRRIAHNAILKDILMLENQIPLFVLRKLLEFKFSSMELADDMLVAMLIGLWK  60

Query  1345  ELSPFKNEGSAVVQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkekkdgeedEFL  1166
             +LSPFK           +  LL +L+  IVP++E +    ++ +     +  +  E+ FL
Sbjct  61    QLSPFK-----------SADLLDFLYAMIVPKLEEQS---DVVQLEDQHKDNEDNEESFL  106

Query  1165  KNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGP  986
                 Y K    ++W  L KL       +K+      +K +  +PW  I+ LPG+ ++K P
Sbjct  107   ---NYAKQFLCEIWSFLSKLVTAFVNLIKKFQQCRTMKVITWLPWTIISNLPGVGLIKQP  163

Query  985   IESLF-SCGQKPDGDENSD-SKDNA-DKPPSIEEITIPSVTELANAGVRFIPTKKGILSI  815
             +E LF S  ++    EN + S DNA +KPP +EEI IPSVTEL+ +GV F+ T   I +I
Sbjct  164   VEYLFFSEDKEASTAENGNLSSDNATNKPPLMEEIAIPSVTELSKSGVCFMTTNGDISTI  223

Query  814   EFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVL  692
              FD KT TLYLP + LD+NSEV+LRNLVAYEA  A G LV+
Sbjct  224   GFDVKTVTLYLPTIGLDVNSEVLLRNLVAYEASTASGSLVI  264



>gb|EMS64820.1| hypothetical protein TRIUR3_27080 [Triticum urartu]
Length=383

 Score =   215 bits (548),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 127/272 (47%), Positives = 166/272 (61%), Gaps = 5/272 (2%)
 Frame = -3

Query  1150  VKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLF  971
             VK A  QV      L+  P R +K+     P+     +P   + K+P L+ M  P+   F
Sbjct  105   VKQACMQV----SSLDVAPVRFIKKNLISKPMSAASSLPGMIMRKVPLLSAM-APLLGKF  159

Query  970   SCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFT  791
                   +      +       P  +EI IPSV +LA  GVRF+P  +G+  I FDA T  
Sbjct  160   MASTDVEARLKGVNLSTIINSPLAQEIMIPSVAQLAACGVRFMPAPEGMAGIGFDAATAP  219

Query  790   LYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIIL  611
             L LPV+ LD N+EV+LRNLVAYE    +GPLVLARYTE MNGI+DT +DVK LRE GII 
Sbjct  220   LTLPVLHLDSNTEVILRNLVAYETAAVRGPLVLARYTELMNGIIDTPKDVKILRECGIIF  279

Query  610   NRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQ  431
             N +KSD E A++WNGM ++VR +KV  LD  I DVN   N R  VK +RF++ Y+F SW+
Sbjct  280   NTMKSDKEAADMWNGMCRAVRPSKVPLLDSVIRDVNAHRNRRAAVKARRFLKRYVFRSWR  339

Query  430   FltllativllllmvLQSFCSVYTCSRFFNDV  335
              LTLLA +VLLL+  LQ+FC+VY C R+F  +
Sbjct  340   LLTLLAAVVLLLMTALQTFCTVYDCKRWFGGI  371


 Score = 60.1 bits (144),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 61/113 (54%), Gaps = 14/113 (12%)
 Frame = -3

Query  1774  MERHKLDAAKIFQKQLRT-IKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             MER+KL AAK  +K      +   L ++ +K++  IR  Y++ L L  +TLAWMMA+D  
Sbjct  1     MERYKLAAAKRAEKLFTGDRRFDDLVQKFVKMQEMIRTPYNRFLELNGQTLAWMMAIDTC  60

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIP  1439
             FLL+FL+ Y V        M+S+  + +          NA++  +  LE QIP
Sbjct  61    FLLDFLESYHVDGA---TDMVSSATNWI----------NAMVLSLGALEQQIP  100



>ref|XP_009615475.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana tomentosiformis]
Length=521

 Score =   219 bits (557),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 169/530 (32%), Positives = 290/530 (55%), Gaps = 62/530 (12%)
 Frame = -3

Query  1885  VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKL-H  1709
             V +  VPKTL    PE Y PQ + +GPYH+  P+L++MER+KL A K   +  + +   H
Sbjct  38    VCVLQVPKTLSDQKPEAYTPQLIGMGPYHHLRPDLYQMERYKLAAIKEILEPAQILNFKH  97

Query  1708  SLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISA  1529
              L +++ + +  +R  +++ +++  ETLAW++A+D  FLL  L+               +
Sbjct  98    LLIDKLRENDLVVRACHNRFMDIDEETLAWIVAIDGLFLLNILR---------------S  142

Query  1528  KMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQC-PSPEASDDL-LLTMLMG  1355
                ++ D   ++       RD++MLENQIPFF+L+++ +  C  SPE  +D  L++M   
Sbjct  143   SYDNVHD--HQEIIDTIFTRDLMMLENQIPFFVLKQIRKFLCLSSPEDREDSELVSMFRR  200

Query  1354  LSKELSPF---KNEGSAVVQIADATHLLGYLFQTIVPE-MESEHVEIE----Idenggmk  1199
               +  SP     N+ S  VQ     HLL  +++ I+ + ++   + +E    I ++  + 
Sbjct  201   FCEMHSPLALPTNDHSKKVQGTQPFHLLDLMYRLILNDRVDYASIPMEMPAIIIKHDNIN  260

Query  1198  ekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLL-MPWKAI  1022
             E++D  + +     G +   F  +  +++  N GP R ++++  + P+  V+  MPW  I
Sbjct  261   EEEDDGDHQDRDTHGGIIHNFETILEVVE--NIGP-RNVQKI--VKPIDQVVANMPWSTI  315

Query  1021  TKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELAN-AGVRF  845
             +              LF  G + + D     K+N       E ITIPS + L + A +R 
Sbjct  316   S-------------GLFRKGTQRNED-----KEN-------EMITIPSASRLWHCARIRC  350

Query  844   IPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNG  665
              P  +GI  I+F+    TLYLPV+T++  SEV+LRNLV YEA ++K  L  ARY   MNG
Sbjct  351   SPIHEGISRIKFEQAASTLYLPVITVNAGSEVILRNLVIYEAAMSKSKLEFARYINLMNG  410

Query  664   IVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS-VRLTKVAFLDKTIDDVNKFYNC  488
             I DT E+V+ L++ G+I   L +D+EVA L++ M  S VR ++ + ++  +++VNK+Y+ 
Sbjct  411   IADTAENVRLLKQNGVIKGDL-TDNEVACLFSTMQMSFVRSSRSSNVEIAMEEVNKYYDQ  469

Query  487   RWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFND  338
                V+  R ++  I+ SW+FLT   +I ++LL++ Q+FCS+Y C   + +
Sbjct  470   MLIVRAHRGLKKNIYLSWKFLTAALSISVVLLLIFQTFCSLYGCHNVWGN  519



>gb|EMT06592.1| hypothetical protein F775_03624 [Aegilops tauschii]
Length=403

 Score =   213 bits (542),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 140/191 (73%), Gaps = 0/191 (0%)
 Frame = -3

Query  907  PSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVA  728
            P  +EI IPSV +LA  GVRF+P+ +G+  I FDA T TL LPV+ LD N+EV+LRNLVA
Sbjct  201  PLAQEIMIPSVAQLAACGVRFMPSPEGMAGIGFDAATATLTLPVLHLDSNTEVILRNLVA  260

Query  727  YEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVR  548
            YE    +GPLVLARYTE MNGI+DT +DVK LRE GII N +KSD E A++WNGM ++VR
Sbjct  261  YETAAVRGPLVLARYTELMNGIIDTPKDVKILRECGIIFNTMKSDKEAADMWNGMCRAVR  320

Query  547  LTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCS  368
             +KV  LD  I DVN   N R  VK +RF++ Y+F SW+ LTLLA +VLLL+  LQ+FC+
Sbjct  321  PSKVPLLDGVIRDVNAHRNRRVAVKARRFLKRYVFRSWRLLTLLAAVVLLLMTALQTFCT  380

Query  367  VYTCSRFFNDV  335
            VY C R+F  +
Sbjct  381  VYDCKRWFGGI  391



>ref|XP_004243017.1| PREDICTED: putative UPF0481 protein At3g02645 [Solanum lycopersicum]
Length=513

 Score =   214 bits (545),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 160/519 (31%), Positives = 274/519 (53%), Gaps = 60/519 (12%)
 Frame = -3

Query  1885  VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKL-H  1709
             V +  +PKTL  + PE Y PQ + +GPYH+  P+L++MER+KL A K   + ++ +   H
Sbjct  38    VCVLHIPKTLTHHKPEAYTPQLIGMGPYHHLRPDLYQMERYKLAALKHILQPVQILNFEH  97

Query  1708  SLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISA  1529
              L +++   +  IR  Y++ +++  ETLAW++A+D  FLL  L+                
Sbjct  98    LLIDKLRDNDLVIRACYNRFMDIDEETLAWIVAIDGLFLLNILR----------------  141

Query  1528  KMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQC-PSPEASDDL-LLTMLMG  1355
               S+  ++       N   RD +MLENQIPF  ++++ +  C  SPE  +D  L++M   
Sbjct  142   -SSYGNNVHDDSIDDNVFTRDFMMLENQIPFVAVKQIRKFLCFSSPEDREDTELVSMFRR  200

Query  1354  LSKELSPF---KNEGSAVVQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkekkdg  1184
               +  SP    +N       +    HLL  ++  I+ +   + V I I  +  + +  D 
Sbjct  201   FCEMHSPLPLPRNNAKETRPL----HLLDLMYHLILDD-HVDFVSIPIQMSSIVIKHDDK  255

Query  1183  eedEFLKNSGY-VKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPG  1007
             +E+   +++   +   F  V  + + +  GP    K L S+  V  V  +PW  I+    
Sbjct  256   DEENVYQDTHEDIIHNFETVLEVFEPI--GPRNVQKLLKSINQV--VENVPWSMIS----  307

Query  1006  LNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTEL-ANAGVRFIPTKK  830
                       LF  G + +GDE  D+             TIPS + L   A V+  P  +
Sbjct  308   ---------GLFRKGMEINGDEERDNTS-----------TIPSASCLWCYARVKCSPIHE  347

Query  829   GILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTD  650
             G+  I+F+  + TLYLPV+T++  SEV++RNL+ YEA ++K  L  ARY   M+GI DT 
Sbjct  348   GLSRIKFEQASSTLYLPVITMNAGSEVIIRNLMVYEAAMSKSKLEFARYINLMSGIADTT  407

Query  649   EDVKFLREKGIILNRLKSDSEVANLWNGMNKS-VRLTKVAFLDKTIDDVNKFYNCRWNVK  473
             +DVK LR+ G++   L +D+E++ L++ + +S VR +  + ++  ++ VNK+YN R  V+
Sbjct  408   KDVKLLRQAGVVKGDL-TDNEISTLFSTIQRSFVRSSGSSNVEIAMEKVNKYYNQRLIVR  466

Query  472   TKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
              +R ++ +I+ S + L +  +I ++LL++ Q+FCSVY C
Sbjct  467   ARRGLKKHIYVSRKLLPVAMSISIVLLLIFQAFCSVYGC  505



>ref|XP_010041633.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis]
Length=447

 Score =   206 bits (524),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 146/455 (32%), Positives = 229/455 (50%), Gaps = 36/455 (8%)
 Frame = -3

Query  1774  MERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASF  1595
             MER KLD AK   K+   +    L E++  +   +R  Y K L++  +  +W+M+VDA F
Sbjct  1     MERVKLDVAKKLHKESNGLSFTELVEKLTDLHLYVRACYHKFLDIDADVFSWIMSVDAQF  60

Query  1594  LLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKML  1415
             L   L  +A+  GK  A   S  +  L D  GKK + +A+LRD++MLENQIP F+L +M+
Sbjct  61    LFHLLCQHAI--GK-RAPESSPFLGGLADHAGKKLAEDAILRDVMMLENQIPIFLLAQMV  117

Query  1414  QPQCPSPEASD-----DLLLTMLMGLSKELSPFKNEGSAVVQIA-DATHLLGYLFQTIVP  1253
                C   E ++     +    ML+   K LSP K      V  A    HLL  L+  +V 
Sbjct  118   TVMCAPLEVAERKKIQENFPHMLLRFCKSLSPLKETRQYPVDKALKRAHLLNLLYSMVVE  177

Query  1252  EMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSA-FGQVWGILKKLNKGPARALKR  1076
               +   ++I  D     ++K +  +     ++   ++A   ++ GIL  +        ++
Sbjct  178   REDEFKIDIPADIIVIEEDKTESLDGAVPASNDNRRTARLHRIGGILTAVQSSDLPFTEK  237

Query  1075  LSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIE  896
             +   A       M  + I K+    +    ++SL                   ++ P+ E
Sbjct  238   IRPHA-------MMAQKIMKILSQQIGPSALDSL-----------------GYEEAPAEE  273

Query  895   EITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
             +  IP+ + LA AG++F  T   I    FD KT T  LP + L +NSEVV+RNLVAYEA 
Sbjct  274   KGLIPTASSLAKAGIKFRKTDY-IEETSFDEKTHTFQLPAIKLSVNSEVVIRNLVAYEAM  332

Query  715   IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
                GPL+  R+ E M+G++D   DV+ L++ GII   LK D EVA L+NGM+ S+ +   
Sbjct  333   ATSGPLLFTRFVELMDGLLDHPRDVRLLKKHGIITGHLK-DGEVACLFNGMSHSIDVHGP  391

Query  535   AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQ  431
             + LDKTI  VN+FY+    +KT+  +  Y++  W+
Sbjct  392   SQLDKTIKKVNEFYHAAPKIKTQNMIERYVYNFWK  426



>gb|EMT04415.1| hypothetical protein F775_21123 [Aegilops tauschii]
Length=254

 Score =   197 bits (502),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 137/185 (74%), Gaps = 4/185 (2%)
 Frame = -3

Query  898  EEITIPSVTELANAGVRFIPTKKGILS---IEFDAKTFTLYLPVVTLDINSEVVLRNLVA  728
            +EITIP V EL ++GV+F  T   + S   I F+ KT TLYLP VTLD N+EVVL+NL+A
Sbjct  69   KEITIPPVFELVSSGVKFASTNGNMSSASTIAFNRKTATLYLPAVTLDGNTEVVLQNLIA  128

Query  727  YEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKS-DSEVANLWNGMNKSV  551
            +E+  A GPLVL RYTE MNGIVDTD+DV  LR++GI+LN +K  DSE AN  NGM++SV
Sbjct  129  FESSAASGPLVLTRYTELMNGIVDTDDDVALLRKRGIVLNHMKKRDSEGANPCNGMSRSV  188

Query  550  RLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFC  371
            + +KV  +DK I+DVN++Y+ RW VKTKRFM  Y+  SW+ LT LA I +LLL  LQ F 
Sbjct  189  QHSKVPTMDKVIEDVNRYYDGRWRVKTKRFMHKYVLSSWKILTFLAAISILLLTTLQVFS  248

Query  370  SVYTC  356
            S+YTC
Sbjct  249  SIYTC  253



>ref|XP_009760731.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana sylvestris]
Length=518

 Score =   205 bits (521),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 178/557 (32%), Positives = 265/557 (48%), Gaps = 75/557 (13%)
 Frame = -3

Query  1954  ESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHE  1775
             E +W+     + +   E   + +  +  VPKT+     + Y+PQ++ +GPYH   PE   
Sbjct  13    EKRWLTQCANSFKLNKEIAIDFSPYVCQVPKTIKETKIQAYIPQKIGLGPYHCFRPEFFV  72

Query  1774  MERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASF  1595
              ERHKL  AK       +I  H + E ++  E RIR  YDK L++   TL W++ +D+ +
Sbjct  73    TERHKLTIAKNCMD--FSIVQHLITETLIFFEPRIRAQYDKFLDIDTHTLCWILTIDSLY  130

Query  1594  LLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKK--SSHNALLRDIIMLENQIPFFILRK  1421
             LL FL  Y   +       I +++  L   K ++  S   ++ +DIIMLENQIP  +L  
Sbjct  131   LLHFLNSYIPHQE------IDSQVQSLPQEKNQEINSERRSMAQDIIMLENQIPSIVL--  182

Query  1420  MLQPQCPSPEASDDLLLTMLMGLSKELSPF-----KNEGSAVVQIADATHLLGYLFQTIV  1256
              ++ Q    +    L   +     K  SP      K   S V     + HLL Y+ Q IV
Sbjct  183   -IEIQMSLSQHFSKLFKDLFFNFCKAHSPLQLSETKKFRSFVFCKDRSPHLLDYMHQLIV  241

Query  1255  PEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWG---ILKKLNKGPARA  1085
                                     EE+E   +S Y      + +    ++K +       
Sbjct  242   -----------------NNRAIIEEEEEEYDDSKYYDDTCNRTFEDHIVVKVVRNIAGII  284

Query  1084  LKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPP  905
                     P+  +  +PW  IT L                            K   +  P
Sbjct  285   PGGGIVEKPLSLMSQLPWDQITGL---------------------------IKKEDESKP  317

Query  904   SIEEITIPSVTELAN-AGVRFIPTKKGILSIEF--DAKTFTLYLPVVTLDINSEVVLRNL  734
              IEEI IPSV EL   A ++F  T+ GI  I+F  +      YLP +TL+ +SEV+LRNL
Sbjct  318   KIEEIEIPSVAELEEIAKIKFKLTEGGIRDIKFIEEGGEHRFYLPQITLNSDSEVILRNL  377

Query  733   VAYEACIA--KGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLK-SDSEVANLWNGM  563
             VAYEA  A  +  L LA Y +FM GIVDT +DV  L++  II +    +D E+A L+NG+
Sbjct  378   VAYEAATASPESSLELAEYVDFMCGIVDTPKDVNILKKANIIKDGSSLNDEEIAELFNGI  437

Query  562   NKSV---RLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllll  392
              K+       K + L+K I+ VN+ ++    VKT RF++ YI+ SW+FLTL +T++L+LL
Sbjct  438   TKTTGKFNKKKKSDLEKAIETVNEKFDNTLRVKTYRFIKKYIYTSWKFLTLFSTVLLILL  497

Query  391   mvLQSFCSVYTCS-RFF  344
             + LQ FC VY CS R+F
Sbjct  498   ICLQVFCQVYGCSNRWF  514



>gb|KHM99774.1| Putative UPF0481 protein [Glycine soja]
Length=419

 Score =   202 bits (513),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 147/446 (33%), Positives = 221/446 (50%), Gaps = 37/446 (8%)
 Frame = -3

Query  1885  VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKLHS  1706
             V I+ VPK+L    PE + PQ +AIGPY + +PEL+ MER K+ AAK      +      
Sbjct  3     VCIYQVPKSLCCAKPEAFSPQLIAIGPYTHFHPELYPMERFKVFAAKGVLDHFKKHDFKQ  62

Query  1705  LAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAK  1526
             L E +      IR SY K L+ + +TL +++A+D  FLL+F   Y  +E   ++      
Sbjct  63    LVELLRNTGQFIRASYHKYLDFKEDTLLYVIAIDGLFLLDFFHNYLNEE---VSCSFMTG  119

Query  1525  MSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASD-DLLLTMLMGLS  1349
             +   V L G K + +A++RDIIM+ENQIP ++L ++L  +   P  S  + L +ML+   
Sbjct  120   LQDQVQLSGVKLTRDAIIRDIIMVENQIPTYMLLRILVLESSKPADSVLEYLGSMLLSFC  179

Query  1348  KELSPFK--NEGSAVVQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkekkdgeed  1175
             K+ SP K  +  +    ++   H+L  ++  +V   E                 +     
Sbjct  180   KKHSPLKLTHIPTCSEAVSKHYHILDLMYHLVVSHTEKSETP---------TPDQSEGTS  230

Query  1174  EFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVM  995
                K+S    +A    + I        +  L  +  L  V   LL P K    +  +  M
Sbjct  231   TLKKSSKSEATAASNHFKI--------SWTLGSVKKLKDVNIPLLKPIKR--HIDTILKM  280

Query  994   KGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKKGILSI  815
                +ESL           +S+ K + ++  ++E + IP V EL + GV F P + G ++I
Sbjct  281   SSHLESL-----------SSNPKLSEEEEEALEVVNIPCVRELHSVGVYFQPVEGGNMAI  329

Query  814   EFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKF  635
             EFD K    YLPV+ LD+NSEV++RNLVA+EA      L+  RYTE M GI+DT EDVK 
Sbjct  330   EFDEKKGIFYLPVLKLDLNSEVIMRNLVAHEALTKPDFLIFTRYTELMRGIIDTVEDVKL  389

Query  634   LREKGII-LNRLKSDSEVANLWNGMN  560
             L+  GII  N      E   L+NGM 
Sbjct  390   LKNAGIIESNSSLGVEETEELFNGMT  415



>ref|XP_004243020.1| PREDICTED: putative UPF0481 protein At3g02645 [Solanum lycopersicum]
Length=524

 Score =   203 bits (516),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 157/527 (30%), Positives = 269/527 (51%), Gaps = 67/527 (13%)
 Frame = -3

Query  1885  VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKL-H  1709
             V +  VPKTL    PE Y PQ + +GPYH+  P+L++MER+KL A K   +  + I   H
Sbjct  38    VCVLQVPKTLTHEKPEAYTPQLIGMGPYHHLRPDLYQMERYKLAAIKDILEPAQIINFEH  97

Query  1708  SLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISA  1529
              L +++ + +  +R+ Y++ +++  ETLAW++A+D  FL+   +              SA
Sbjct  98    LLIDKLRENDLVVRVCYNRFMDIDEETLAWIVAIDGLFLINIFR--------------SA  143

Query  1528  KMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQ-PQCPSPEASDDL-LLTMLMG  1355
               S+L +        +   RD +MLENQIPF +LR++ +     SPE  +D  L++M   
Sbjct  144   YSSNLHNDPENNVDDSIFTRDFMMLENQIPFVVLRQIRKFLHLSSPEDREDAELISMFRR  203

Query  1354  LSKELSPF----KNE--GSAVVQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkek  1193
               +  SP      NE  G+ + +     HLL  +++ I+     +HV+            
Sbjct  204   FCEMHSPLPLPANNEYHGNNIKE-TQPLHLLDLMYRLIL----DDHVDFASVPIQTSHII  258

Query  1192  kdgeedEFLKNSGYVKSAFGQVWGILKKLNK-----GPARALKRLSSLAPVKTVLL-MPW  1031
                 +D   K+  + +   G +    + + K     GP +  K    + P+  +L  +PW
Sbjct  259   NIKHDD---KDEAHDQDTHGDIIHKFETMLKVLEPIGPRKVQK---VVKPINQILSNVPW  312

Query  1030  KAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTEL-ANAG  854
               I+              LF    + + D+ S +            ITIPS ++L   A 
Sbjct  313   SKIS-------------GLFREAMERNEDQESKNI-----------ITIPSASQLWCYAS  348

Query  853   VRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEF  674
             V+ IP ++GI  I+F+  +  LYLPV+T+D  SEV+LRNL+ YEA ++K  L  A Y   
Sbjct  349   VKCIPIREGICKIKFEQASSALYLPVITMDAGSEVILRNLMIYEAAMSKSKLEFATYINL  408

Query  673   MNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKS-VRLTKVAFLDKTIDDVNKF  497
             M+G  +T EDV+ LR+ G+I   L +D E+A L++ M +S VR ++++ ++  +  VN++
Sbjct  409   MSGTANTTEDVRVLRQAGVIKGDL-TDKEIATLFSTMQRSFVRSSEISNVEIVMKKVNEY  467

Query  496   YNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
             Y+ R  V+ +R  +  I+ S + L +  +I  +LL++ ++ CS+Y C
Sbjct  468   YDQRLIVRARRGFKKSIYVSLKLLPVALSIFFVLLLIFKTVCSLYDC  514



>ref|XP_010111081.1| hypothetical protein L484_015136 [Morus notabilis]
 gb|EXC29943.1| hypothetical protein L484_015136 [Morus notabilis]
Length=539

 Score =   203 bits (516),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 160/531 (30%), Positives = 253/531 (48%), Gaps = 53/531 (10%)
 Frame = -3

Query  1891  INVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKL  1712
             + +SIF VP ++    PE Y PQ V +GP H+   EL  M+ +K+  AK   K  +++  
Sbjct  23    VPISIFKVPNSITSSKPEAYAPQLVGLGPVHHLRHELQNMQMYKVVEAKRIHKGFQSLDF  82

Query  1711  HSLAEEMMKVE-SRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMI  1535
               L E + ++    +R SY+  L++  E LA +MAVD  FL   L    +    + A   
Sbjct  83    EKLVEFLKQIAVPSVRASYNIYLDMEDEVLACVMAVDGLFLFGLLCCCGIN---MEALAN  139

Query  1534  SAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPS----PEASDDLLLT  1367
             S+ + HLV+  G+  +    +++ +MLENQIP F+L+ +L  +C       E   +L   
Sbjct  140   SSSLCHLVNFVGRILAQETAIQEAMMLENQIPIFVLKVILIAECSQVSHRNEIVSNLFPK  199

Query  1366  MLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkekk  1190
             +L G  +  SPFK  E   + +     HLL  L+  +  +  SE                
Sbjct  200   ILFGFCEFFSPFKIVENYPLYKAIKRAHLLDLLYHLVTLKHSSEW---------------  244

Query  1189  dgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAIT---  1019
                      NS   +     +  + KK+         R   L PV   + M    I+   
Sbjct  245   ---------NSKEEEEELRSIEELYKKV---------RSEILVPVIFPMCMKTAVISDQI  286

Query  1018  ----KLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGV  851
                 K      ++ PIE +    + P  D  S     A +    +EI+ P  +EL  +GV
Sbjct  287   VDLVKEIAPPELQKPIELVQGLLELPWSDLMSSIPLAAKEEVPAKEISFPRASELNKSGV  346

Query  850   RFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACI--AKGPLVLARYTE  677
             +F      I +I FD  T + +LP   L++N EVVLRNL AYEA +   K PL+L  + E
Sbjct  347   KFF-VADHITTIRFDPNTVSFHLPFTRLNVNFEVVLRNLGAYEAMVKSEKEPLILNGFVE  405

Query  676   FMNGIVDTDEDVKFLREKGIILN-RLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNK  500
              MNG++ + +DV  L+++GII      +D +VA +++ MNK + LT    LD  I+ V  
Sbjct  406   LMNGLIKSADDVMVLKDQGIISKPESINDEKVAKIFSEMNKLIELTNTPDLDMAIEGVTN  465

Query  499   FYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRF  347
             +YN  W V   +FM  +     ++  + A +++LLLM +Q+FCSV+ C RF
Sbjct  466   YYNSLWKVSACKFMNKWRRTVRKWCKVFAVLLILLLMNIQTFCSVFECPRF  516



>gb|EYU38309.1| hypothetical protein MIMGU_mgv1a017744mg [Erythranthe guttata]
Length=499

 Score =   201 bits (512),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 167/557 (30%), Positives = 271/557 (49%), Gaps = 100/557 (18%)
 Frame = -3

Query  1954  ESKWVIHIQKTlereleeenEINV--SIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPEL  1781
             E +WV+ ++K    +   + + N    +F +PKTL    PE Y PQ + +GPYH+  P+L
Sbjct  13    EKRWVLAMEKNFPHDHILDIDFNTPPCVFTLPKTLSQSKPEAYTPQLLGLGPYHHLRPDL  72

Query  1780  HEMERHKLDAAKIFQKQLRTIKLH---SLAEEMMKVESRIRLSYDKQLNLRVETLAWMMA  1610
             +    H L  A +  + L T  LH    + + +++ E  +R  YD+ ++L + TL+W++A
Sbjct  73    YSTTTHNLKLAAV-TEFLGTENLHKFPHVVDALVQSEPLLRSCYDQYIDLDIRTLSWILA  131

Query  1609  VDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFI  1430
             +DA FLL  LK Y+ ++ K+                           DI+M+ENQIP  +
Sbjct  132   IDAVFLLHLLKSYSPRDAKMET-------------------------DILMVENQIPAVL  166

Query  1429  LRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFK-NEGSAVVQIADATHLLGYLFQTIVP  1253
             LRK+ Q   P     +  L        +  SP + NE   +    +  HLL +++  IV 
Sbjct  167   LRKIRQVLEPPDADGNSTLYEEFHFFCQNHSPLQLNE--HIKGDINQVHLLHHMYYLIV-  223

Query  1252  EMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFG----QVWGILKKLNKGPARA  1085
                                           N+  ++S F     Q+  ++   +    + 
Sbjct  224   ------------------------------NNVTIQSPFSTYSLQLTDVIDGAHFLADQG  253

Query  1084  LKRLSSLAPVKTVLL-MPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKP  908
             L      A V T +  +PW  I               +F  G       NSD ++N    
Sbjct  254   LPGAGITAQVLTFMQKIPWDKIL-------------GMFKKG-------NSDEQNNN---  290

Query  907   PSIEEITIPSVTELAN-AGVRFIP-TKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNL  734
             PS+EEI IPSV+ ++  AG++F   T  GI  I FD      YLP++ L  +SEVVLRNL
Sbjct  291   PSVEEIDIPSVSRMSRLAGIKFAQLTSGGIREIRFDEGEKKFYLPIIKLTASSEVVLRNL  350

Query  733   VAYEACIAKGP---LVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGM  563
             VAYEA     P   L  A Y + M GIVD+ +DV  L+ + I+ + L SD EVA ++NG+
Sbjct  351   VAYEAASITEPGSTLEFAEYVDLMCGIVDSAKDVDILKRENIVESEL-SDEEVARIFNGI  409

Query  562   NKSVRLTK-VAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmv  386
             +KS++ ++  + +++ ID VN  Y+    V+ KRF   Y    ++F++L+ +IV+L+L++
Sbjct  410   SKSMKKSENKSNIEEAIDSVNTRYDNVCGVRVKRFAVKYGCALFKFVSLVISIVVLVLLI  469

Query  385   LQSFCSVYTCSRFFNDV  335
             L++FCSV+ C   F ++
Sbjct  470   LRAFCSVFGCRSLFGEI  486



>ref|XP_010041367.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis]
Length=407

 Score =   196 bits (497),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 156/434 (36%), Positives = 224/434 (52%), Gaps = 45/434 (10%)
 Frame = -3

Query  1609  VDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFI  1430
             VDA FL   L  +AV +  L ++  S     L D  GKK + +A+LRD++MLENQIP F 
Sbjct  5     VDAQFLFHLLCQHAVGKKTLESSPFSGV---LADHAGKKLAEDAILRDVMMLENQIPIFF  61

Query  1429  LRKMLQPQCPSPEASDDLLLT-----MLMGLSKELSPFKNEGSAVVQIA-DATHLLGYLF  1268
             L KM+   C   E ++   +      ML+G  K LSP K      V  A    HLL  L+
Sbjct  62    LAKMVTVTCSPLEVAEQKKIEENFPHMLVGFCKFLSPLKETRRYQVDKALKRAHLLDLLY  121

Query  1267  QTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSG-----YVKSAFGQVWGILKKLN  1103
               +V E E E  +I+I  N  + E+          +SG     ++ S   +V G+L+  N
Sbjct  122   SMVV-EREDE-FKIDIPANIILIEEDKTGAVPTSNDSGRTDPQHLVSMTEKVLGLLQSPN  179

Query  1102  KGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKD  923
                                  +P+    K P   +++G +  L     +  G    DS  
Sbjct  180   ---------------------LPFTEKIK-PHAMMVQGIMRIL----SQQIGPSVLDSFS  213

Query  922   NADKPPSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVL  743
               + P   +E+ IP  + LA AGV+F  T   I    FD KT T  LP + L +NSEVV+
Sbjct  214   YEEAPAEEKEL-IPGASSLARAGVKFHKTDY-IEQTSFDEKTHTFQLPAIKLSVNSEVVI  271

Query  742   RNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGM  563
             RNLVAYEA    GPL+  R+ E M+G++D   DV+ L++ GII   LK D EVA L+NGM
Sbjct  272   RNLVAYEAMATSGPLLFTRFVELMDGLLDHPRDVRLLKKHGIITGHLK-DDEVARLFNGM  330

Query  562   NKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvL  383
             + S+ +   + +DKTI  VN+FY+    +KT+  +  Y++  W+ L ++ATI+  LLMVL
Sbjct  331   SHSIDVHGTSQVDKTIKKVNEFYHAAPKIKTQNMIERYVYNFWKVLAMVATILFFLLMVL  390

Query  382   QSFCSVYTCSRFFN  341
             Q+FCS Y+CS   N
Sbjct  391   QTFCSAYSCSTLLN  404



>gb|EMS45711.1| hypothetical protein TRIUR3_14318 [Triticum urartu]
Length=946

 Score =   202 bits (513),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 130/181 (72%), Gaps = 0/181 (0%)
 Frame = -3

Query  898  EEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEA  719
            EEI +PS++ELA  GV F PT  GI +IEF A+T TL+LPV+++D+ +EVVLRNLVAYEA
Sbjct  215  EEIAVPSISELAYVGVTFTPTTGGISTIEFCARTATLHLPVISIDMTTEVVLRNLVAYEA  274

Query  718  CIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTK  539
             +    LV ARY E MNG++DTDED + LRE GIILN LKSD EVA LWNGM +SVRLT+
Sbjct  275  SMGSRALVFARYVELMNGVIDTDEDARLLREHGIILNHLKSDQEVAELWNGMTRSVRLTR  334

Query  538  VAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYT  359
            V  LD+ ID++N+++   W V+ + F+++++ GS   +     +VLLL +  Q+FC    
Sbjct  335  VPALDRVIDELNRYHGACWKVRVRTFVKAHLLGSRDMVACAMMVVLLLFVGFQAFCLSRG  394

Query  358  C  356
            C
Sbjct  395  C  395


 Score =   168 bits (426),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 103/235 (44%), Positives = 138/235 (59%), Gaps = 10/235 (4%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DE++W+I I++ LE E+E  ++  VSIF V K L+   PE YVPQ VA+GPYH+    L 
Sbjct  10    DETQWIIRIRRILEEEIELGDDQPVSIFDVLKPLLCTKPEAYVPQLVALGPYHHCREGLC  69

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             +ME +KL AAK  Q  L + KL  L +     E RIR  Y +QLNL  ETLAWMMA+D S
Sbjct  70    DMEMYKLSAAKRAQSHLPSKKLQQLVDVFATFEHRIRSHYHRQLNLTNETLAWMMAIDVS  129

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLLEFL+ +   + +     + ++MSHLVD   + S H+ LLRDI+MLENQIP F++ K+
Sbjct  130   FLLEFLQTFCETKNRRTTQRMPSRMSHLVDPSHRTSVHSMLLRDIVMLENQIPMFLVVKL  189

Query  1417  LQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQTIVP  1253
             ++  C S              LS  LS F  E  AV  I++    L Y+  T  P
Sbjct  190   VEMWCSSGHGVPR------PNLSSILSGFFQEEIAVPSISE----LAYVGVTFTP  234



>gb|EYU25281.1| hypothetical protein MIMGU_mgv1a004906mg [Erythranthe guttata]
Length=505

 Score =   192 bits (489),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 168/527 (32%), Positives = 258/527 (49%), Gaps = 84/527 (16%)
 Frame = -3

Query  1879  IFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKLHSLA  1700
             +F VP + +   P+ YVP  V +GPYH+  P+L+  +R KL    +  K    I L ++A
Sbjct  42    VFRVPTSFVETKPDAYVPHHVGLGPYHHLRPDLYTAQRRKL---AVVAKLHPRINLRAVA  98

Query  1699  EEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMS  1520
             E + K E  IR  +D+ L+   +TLAW++AVDA +L+ FL  Y+V               
Sbjct  99    EGIAKWEPFIRQCHDEYLDFDPQTLAWILAVDAFYLVNFLNNYSVATSN-----------  147

Query  1519  HLVDLKGKKSSHNALLRDIIMLENQIPFFILRKML-QPQCPSPEASDDLL-LTMLMGLSK  1346
                     K+    L  D++MLENQIP  I+  +      P  +    LL L        
Sbjct  148   -------NKAETEKLAGDVLMLENQIPSLIIAGIFYHLVAPGDDEVRRLLELERFHIFCW  200

Query  1345  ELSPFK----NEGSAVVQIAD-ATHLLGYLFQTIVPEMESEHVEIEIdenggmkekkdge  1181
             ++SP        G  VV  A    HLL  ++  IV              N  +       
Sbjct  201   DVSPLPVPLLGVGPGVVAEAMLEGHLLKLMYYFIV--------------NCTIVRLDSPI  246

Query  1180  edEFLKNSGYVKSAFGQVWGILKKLNKG-PARAL-KRLSSLAPVKTVLLMPWKAITKLPG  1007
                 + N G+V +   ++ G+      G P  A+ ++L SLA       +PW ++     
Sbjct  247   FMAHVDNPGFVLAENLKM-GVDAAAGVGVPGAAIVQQLVSLAE-----KVPWDSVL----  296

Query  1006  LNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPS--IEEITIPSVTELAN-AGVRFIPT  836
                      +LF  G  PDG           K PS  +EEI IP V++L + AG+RF   
Sbjct  297   ---------ALFKKGD-PDG-----------KSPSLLVEEIDIPCVSQLVDLAGIRFSVV  335

Query  835   KKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGP---LVLARYTEFMNG  665
               GI   ++D +    YLP + +  NSEVVLRNL+AYEA    G    L LA + + M G
Sbjct  336   PGGIREFKYDVEEKKFYLPKINIKSNSEVVLRNLLAYEAAAKPGGPDVLELAEFVDLMCG  395

Query  664   IVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSV--RLTKVAFLDKTIDDVNKFYN  491
             I+DT  DV+ LR++ II++ L +D E+A ++NG+ +S   +  K   ++K ++ VN  Y 
Sbjct  396   IIDTPRDVEILRKEEIIVSDL-TDEEIAPIFNGIKRSTGNKEKKTTDIEKAVEKVNVEYG  454

Query  490   CRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
                 VK  R M+ Y++GSW+FLT+ + ++++LL++LQ+FC VY CS+
Sbjct  455   NVPKVKVYRLMKKYVYGSWKFLTVFSMVIVVLLLLLQAFCLVYGCSK  501



>ref|XP_002530455.1| hypothetical protein RCOM_0011030 [Ricinus communis]
 gb|EEF31925.1| hypothetical protein RCOM_0011030 [Ricinus communis]
Length=405

 Score =   186 bits (473),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/242 (43%), Positives = 149/242 (62%), Gaps = 29/242 (12%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             +E +W+  I +T+E E E++ E ++SIF VPK LM   P  Y P R+A+GPYH+  PEL 
Sbjct  13    EELRWLKTIPRTIEEEREDDYENSISIFDVPKILMHTSPLSYTPHRLALGPYHHERPELF  72

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             EMER+KL A K  +KQL+ +K HSL +  +  E++IR  Y+K LN   ETLAWM+ +DAS
Sbjct  73    EMERYKLSATKRVRKQLQILKFHSLVDHFINFETKIRACYNKYLNFNGETLAWMIILDAS  132

Query  1597  FLLEFLKVYAVKE--GKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILR  1424
             FL++FL+VYA KE   K M + I++ M H  +   +  +HN +LRDIIMLENQIP F++R
Sbjct  133   FLIKFLQVYADKECITKPMCSRIASSMCHFFNNAKRNCAHNEILRDIIMLENQIPLFLIR  192

Query  1423  KMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQ---IADATHLLGYLFQTIVP  1253
             K                        K++SPFK +    VQ   +++  HLL +++  IVP
Sbjct  193   K------------------------KDVSPFKTQDLPQVQQVKVSEYAHLLHFMYDIIVP  228

Query  1252  EM  1247
             +M
Sbjct  229   KM  230


 Score =   129 bits (325),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -3

Query  715  IAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKV  536
            IA  P+VL RYTE MNGI+DT EDV+ LR+KGIILN +KSD +VA++WN MNKS+RLTKV
Sbjct  281  IAPSPVVLTRYTEPMNGIIDTKEDVELLRKKGIILNHMKSDQKVADIWNEMNKSIRLTKV  340

Query  535  AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTC  356
             F+DK I+D++K+Y+    V    +M+  ++ SW+ +TLLA+I+LLLL   Q+FCS + C
Sbjct  341  PFMDKVIEDISKYYDSTCKVNAGNYMKHSVYHSWKLITLLASILLLLLTTTQTFCSAWKC  400

Query  355  SRF  347
            S F
Sbjct  401  SNF  403



>ref|XP_010025907.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis]
Length=391

 Score =   184 bits (466),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 145/403 (36%), Positives = 210/403 (52%), Gaps = 42/403 (10%)
 Frame = -3

Query  1516  LVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLT-----MLMGL  1352
             L D  GKK + +A+LRD++MLENQIP F L KM+   C   E ++   +      ML+G 
Sbjct  17    LADHAGKKLAEDAILRDVMMLENQIPIFFLAKMVTVACSPLEVTEQKKIEENFPHMLVGF  76

Query  1351  SKELSPFK-NEGSAVVQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkekkdgeed  1175
              K LSP K      V +     HLL  L+  +V E E E  +I+I  N  + E+      
Sbjct  77    CKFLSPLKETRRYQVDKTLKRAHLLDLLYSMVV-EREDE-FKIDIPANIILIEEDKTGAV  134

Query  1174  EFLKNSG-----YVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLP  1010
                 +SG     ++ S    V G+L+  N      L     + P   ++    + +++  
Sbjct  135   PTSNDSGRTAPQHLVSMTENVLGLLQSPN------LPCTEKIRPHAMMVQGIMRILSQQI  188

Query  1009  GLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEITIPSVTELANAGVRFIPTKK  830
             G +V+        S G               ++ P+ E+  I   + LA AGV+F  T  
Sbjct  189   GPSVLD-------SFGY--------------EEAPAEEKGLISRASSLAKAGVKFRKTDY  227

Query  829   GILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTD  650
              I    FD KT T  LP + L +NSEVV+RNLVAYEA    GPL+  R+ E M+G++DT 
Sbjct  228   -IEETSFDEKTHTFQLPAIKLSVNSEVVIRNLVAYEAMATSGPLLFTRFVELMDGLLDTP  286

Query  649   EDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKT  470
              DV+ L++ GII   LK D EVA L+NGM+ S+     + LDKTI  VN+FY+    +KT
Sbjct  287   HDVRLLKKHGIITGHLK-DGEVARLFNGMSHSIDGHCPSQLDKTIKKVNEFYHAAPKIKT  345

Query  469   KRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFN  341
             +  +  Y++  W+FL ++ATI+  LLMVLQ+FCS Y+CS   N
Sbjct  346   QNMIERYVYNFWKFLAMVATILFFLLMVLQTFCSAYSCSTLLN  388



>gb|EYU25280.1| hypothetical protein MIMGU_mgv1a026350mg [Erythranthe guttata]
Length=474

 Score =   185 bits (469),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 164/524 (31%), Positives = 259/524 (49%), Gaps = 109/524 (21%)
 Frame = -3

Query  1879  IFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAKIFQKQLRTIKLHSLA  1700
             +F VP + +   PE YVP+ V +GPYH+  P+L+  +R KL    +  K    I L ++A
Sbjct  42    VFRVPTSFVETKPEAYVPRLVGLGPYHHLRPDLYTAQRRKL---AVVAKLHPRINLRAIA  98

Query  1699  EEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMS  1520
             E + K E  IR  YD+ L+   +TLAW+ AVDA +L            ++ + +I+    
Sbjct  99    EGIAKWEPFIRQCYDEYLDFDPQTLAWIFAVDAFYL-----------NQIPSLIIAGIFY  147

Query  1519  HLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLLTMLMGLSKEL  1340
             HLV      +S +  +R ++ LE+                              G   + 
Sbjct  148   HLV------ASGDDEVRRLLQLES----------------------------FRGFCYDA  173

Query  1339  SPFKNEGSAVVQIADAT---HLLGYLFQTIVPE---MESEHVEIEIdenggmkekkdgee  1178
             SP       +++ A+A    HLL  ++  IV +   + S+H    I +N  +   ++   
Sbjct  174   SPLPVPLLGILEPAEAMIEGHLLKLMYHLIVKDCTAITSDHCNKLILDNPALILAEN---  230

Query  1177  dEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLSSLAPVKTVLLMPWKAITKLPGLNV  998
                LK    V +A G        +    A  +++L SLA       +PW +I        
Sbjct  231   ---LKRG--VDAAAG--------VGVPGAGIVQQLVSLAEK-----VPWDSIL-------  265

Query  997   MKGPIESLFSCGQKPDGDENSDSKDNADKPPS--IEEITIPSVTELAN-AGVRFIPTKKG  827
                   SLF  G  PDG           K PS  +EEI IP V++L N AG+RF    +G
Sbjct  266   ------SLFKKGD-PDG-----------KSPSLLVEEIDIPCVSQLVNLAGIRFSVVPEG  307

Query  826   ILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGP---LVLARYTEFMNGIVD  656
             I   ++DA+    YLPV+ +  N EVVLRNL+AYEA    G    L LA + + M GI+D
Sbjct  308   IRGFKYDAEEKKFYLPVIKIKSNFEVVLRNLLAYEAAAKPGGPDVLELAEFVDLMCGIID  367

Query  655   TDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSV--RLTKVAFLDKTIDDVNKFYNCRW  482
             T  DV+ LR++ +I++ L +D E+A ++NG+ +S   + TK   ++K ++ VN  Y    
Sbjct  368   TPRDVEILRKEKVIVSDL-TDEEIAPIFNGIKRSTGNKETKTTNIEKAVEKVNVEYGNVP  426

Query  481   NVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
              VK  R M+ Y++GSW+FLT+ + ++++LL++LQ+FC VY CS+
Sbjct  427   KVKAYRLMKKYVYGSWKFLTVFSMVIVVLLLLLQAFCLVYGCSK  470



>ref|XP_010111079.1| hypothetical protein L484_015134 [Morus notabilis]
 gb|EXC29941.1| hypothetical protein L484_015134 [Morus notabilis]
Length=557

 Score =   186 bits (472),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 160/531 (30%), Positives = 261/531 (49%), Gaps = 48/531 (9%)
 Frame = -3

Query  1885  VSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKL-DAAKIFQKQLRTIKLH  1709
             + IF VP +L    PE Y+PQ++  GP H+   EL +M+ +K+ +A +I       +K  
Sbjct  30    IRIFKVPDSLTSAKPEAYIPQQIGFGPIHHFRRELQQMQMYKVVEARRIHNGFQSDLKFG  89

Query  1708  SLAEEMMKVES-RIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMIS  1532
              +AE +  + S  +R SY+  L +  + LA +MA+D  FL   L    + +  L     S
Sbjct  90    EVAEVLKTIVSPSVRASYNIYLQMEDDDLASVMALDGLFLFNLLCCTGINKEALAK---S  146

Query  1531  AKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKMLQPQCPSPEASDDLLL------  1370
             + + HLV+  GK+ +   ++++ +MLENQIP  +++ +L  +C +   S  + +      
Sbjct  147   SSLCHLVNSAGKRLAQKTIIQEAMMLENQIPIDVMKVILLIECWNNSKSQKMKIGSVIFP  206

Query  1369  TMLMGLSKELSPFKN-EGSAVVQIADATHLLGYLFQTIVPEMESEHVEIEIdenggmkek  1193
              +L+G  +  SP K  E   + +     HLL  L+  +  +   E    E ++     E 
Sbjct  207   KILLGFCEFSSPLKTVENYPLYEALKRAHLLDLLYHLVTLKQSPETNPEEEEKEKKSLED  266

Query  1192  kdgeedEFLKNSGYVKSAFGQVWGILKKLNKGP----ARALKRLSSLAPVKTVLLMPWKA  1025
                E       S  + S   ++  ++K+  + P    A A + L +LAP           
Sbjct  267   LSTEIA-----SHEIISRKTRIEEVVKRRIRIPDGVEAAAGEILKTLAP-----------  310

Query  1024  ITKLPGLNVMKGPIESLFSCGQKPDGDENSD--SKDNADKPPSIEEITIPSVTELANAGV  851
                 PG    + PIE +    + P     SD  S    ++PP  +E+ IP  +EL  AGV
Sbjct  311   ----PGF---QKPIELVLGLLELPLSQTKSDIVSSLKEEEPP--KEVFIPRASELDKAGV  361

Query  850   RFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAK--GPLVLARYTE  677
             +F      I  I FD    + YLP++ ++ + EV++RNLV YEA I     PL+L  Y E
Sbjct  362   KF-RVADHITGINFDRNKLSFYLPIIRINADFEVIIRNLVVYEAMIKSETEPLILNWYVE  420

Query  676   FMNGIVDTDEDVKFLREKGIILNRLKS-DSEVANLWNGMNKSVRLTKV-AFLDKTIDDVN  503
              MNG++ T EDV  L ++ II     + D +VA +++GMNKSV LT +   L+  +  V 
Sbjct  421   LMNGLIQTAEDVAVLNKQQIISKSESTLDEQVAKIFSGMNKSVELTNIPQNLNDAVGGVK  480

Query  502   KFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
             ++YN    V T  FM      + ++  +LA ++ L L+ +QSFCSVY C R
Sbjct  481   EYYNNLCWVSTSEFMNKSWRTTKKWFVVLAPLLALFLLAVQSFCSVYGCRR  531



>gb|AEX11069.1| hypothetical protein 0_11495_01 [Pinus taeda]
Length=154

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -3

Query  853  VRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEF  674
            V+F+ T   + +I+F+ KT T+YLP V LD N+EV+LRNLVA+E+  A G LV  RYT+F
Sbjct  1    VKFVATDGDLTTIQFNEKTATIYLPKVRLDANTEVILRNLVAFESSAAPGALVFTRYTDF  60

Query  673  MNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFY  494
            +NG++D++EDV+ L+E GII N L++D EVA+LWN M K V LTKVA+LDK I D+N  Y
Sbjct  61   INGMIDSEEDVRLLKESGIITNHLRNDGEVASLWNSMGKCVPLTKVAYLDKVIKDINNHY  120

Query  493  NCRWNVKTKRFMRSYIFGSWQF  428
            N +WNV    F+   +FGSW+F
Sbjct  121  NRKWNVAVVEFLNERVFGSWKF  142



>gb|EMT19335.1| hypothetical protein F775_42765 [Aegilops tauschii]
Length=228

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 114/147 (78%), Gaps = 1/147 (1%)
 Frame = -3

Query  793  TLYLPVVTLDINSEVVLRNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGII  614
            TLYLP VTLD N+EVVL+NL+A+E+  A GPLVL RYTE M GIVDTD+DV  LR++GI+
Sbjct  81   TLYLPAVTLDGNTEVVLQNLIAFESSAASGPLVLTRYTELMKGIVDTDDDVALLRKRGIV  140

Query  613  LNRLKS-DSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGS  437
            LN +K+ DSE ANL NGM++SV+ +KV  +DK I+DVN++Y+ RW VK KRFM  Y+  S
Sbjct  141  LNHMKNRDSEGANLCNGMSRSVQHSKVPTMDKVIEDVNRYYDGRWRVKMKRFMHKYVLSS  200

Query  436  WQFltllativllllmvLQSFCSVYTC  356
            W+ LT LA I +LLL  LQ F S+YTC
Sbjct  201  WKILTFLAAINILLLTTLQVFSSIYTC  227



>ref|XP_009770903.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana sylvestris]
Length=464

 Score =   174 bits (442),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 164/544 (30%), Positives = 251/544 (46%), Gaps = 102/544 (19%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             +E +WV    +    EL  + E    +F VPKTL    P+ Y PQ +++GPYH+  PEL 
Sbjct  12    NEQRWVNETIRAFTSELRVDIEPTPCVFQVPKTLTETKPQAYTPQIISLGPYHHFWPELL  71

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMM----KVESRIRLSYDKQLNLRVETLAWMMA  1610
               ERHK   AK     L   ++   AEE++     V   IR  YDK  ++   TLAW++A
Sbjct  72    VTERHKQTIAK---NCLNDHQVQHFAEEVIDKLCSVVPVIRGYYDKYSDIEGITLAWILA  128

Query  1609  VDASFLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFI  1430
             +D+ +LL  L  Y   + ++ A                      L +D++MLENQIP F+
Sbjct  129   IDSLYLLHLLSSYVPGDQEVHAV------------------QRKLAQDVMMLENQIPSFV  170

Query  1429  LRKMLQPQCPSPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADATHLLGYLFQTIVPE  1250
             L   ++ Q    ++  +L   +     K  SP K     ++   ++ HLL +L   I+  
Sbjct  171   L---IETQKAINQSYSNLFTELFYNFCKAHSPLKLADPNIIHSFNSPHLLAFLHHLIIES  227

Query  1249  MESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKGPARALKRLS  1070
                                                       G+L  L K     +  L 
Sbjct  228   ------------------------------------------GMLYWLEKQSGSLVPTLG  245

Query  1069  SLAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEI  890
             +   V  +  +PW  I  L                       +N DSK    K P ++EI
Sbjct  246   NPGLVCFITGLPWDLIKVL----------------------SKNMDSK----KKPLVDEI  279

Query  889   TIPSVTELANAGVRFIPTKKGILSIEF--DAKTFTLYLPVVTLDINSEVVLRNLVAYEAC  716
               PSVT+L            GI +I+F  +     LYLP +TL+ +SEV+LRNLVAYEA 
Sbjct  280   KTPSVTQLNETAKINFKLTGGIRNIKFVKEGGEHALYLPEITLNSDSEVILRNLVAYEAV  339

Query  715   IA--KGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLT  542
             +A   G L +A Y + M GIV+T +DV+ L++ GII   L SD E+A+L+NG+ K+    
Sbjct  340   VAGQDGALKVAEYLDLMCGIVNTSKDVEILKKSGIIKGSL-SDEEIADLFNGLPKTTGNH  398

Query  541   KV-AFLDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSV  365
             KV + L + I+ VN+ Y+    +K +R ++ +IF   + LT++ T+VL+LL+ +Q+ C  
Sbjct  399   KVKSRLARIIESVNEKYDNMLRIKAQRLIKKHIFKFRKSLTVITTLVLVLLLSMQTVCQY  458

Query  364   YTCS  353
             Y C 
Sbjct  459   YGCG  462



>ref|XP_010042194.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis]
Length=339

 Score =   169 bits (427),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 104/243 (43%), Positives = 150/243 (62%), Gaps = 2/243 (1%)
 Frame = -3

Query  1066  LAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPSIEEIT  887
             L+ + +++   W  ++K   +  +K  +E +F   Q P       S+  ++ P   E + 
Sbjct  96    LSILASIVTAAWNELSKFSFMKELKERMELIFKIIQLPRQLIPRCSEYLSNDPFQ-EIVM  154

Query  886   IPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAK  707
             IP+ ++L +  ++      GI +I FD KT TL LP + LD  +EV+LRNLVAYE    +
Sbjct  155   IPTASKLRSVRIKLSLATAGIKTIAFDKKTATLKLPHIDLDATTEVLLRNLVAYEMISQR  214

Query  706   GPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAF-  530
             G L L RYTE M GI+DT ED+K LRE  I+LNRL SD++V   +NG+  S+     A  
Sbjct  215   GSLTLTRYTELMYGIIDTSEDLKLLREASIVLNRLNSDNKVVEFFNGVFNSIGSKSTASE  274

Query  529   LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
             LD+TI DVN++YN    VK    MR Y++ SW+FLT++AT+VL+LLMVLQ+FCSV +C R
Sbjct  275   LDQTIRDVNEYYNSTRKVKAYNLMRKYVYSSWKFLTVVATVVLILLMVLQTFCSVLSCPR  334

Query  349   FFN  341
              FN
Sbjct  335   LFN  337



>gb|KCW63599.1| hypothetical protein EUGRSUZ_G01225 [Eucalyptus grandis]
Length=461

 Score =   171 bits (433),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 148/243 (61%), Gaps = 12/243 (5%)
 Frame = -3

Query  1051  TVLLMPWKAITKLPGLNVMKGPIESLFSCGQK-----PDGDENSDSKDNADKPPSIEEIT  887
             +++   WK ++K   +  +K  IE +F   Q      P   E   +       P  E + 
Sbjct  219   SIVTAAWKELSKFSFMKKLKVRIELIFKIIQLAMRLIPRCSEYLSND------PFQEIVM  272

Query  886   IPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYEACIAK  707
             IP+ ++L + G++      GI +  FD KT TL LP + LD  +EV+LRNLVAYE    +
Sbjct  273   IPTASKLRSVGIKLSLATGGIKTTAFDKKTATLKLPHIDLDATTEVLLRNLVAYEMISQR  332

Query  706   GPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAF-  530
             G L+L RYTE M GI+DT ED+K LRE  I+LNRL SD++V  L+NG+ KS+     A  
Sbjct  333   GSLILTRYTELMYGIIDTSEDLKLLREASIVLNRLNSDNKVVELFNGVIKSIGSKSTASE  392

Query  529   LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSR  350
             LD+TI DVN++YN    VK    MR Y++ SW+FLT++AT+VL+LLM LQ+FCSV +C +
Sbjct  393   LDETIRDVNEYYNSTRKVKVYNLMRKYVYSSWKFLTVVATVVLILLMALQTFCSVLSCPQ  452

Query  349   FFN  341
              FN
Sbjct  453   LFN  455


 Score = 86.7 bits (213),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 73/129 (57%), Gaps = 2/129 (2%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
              E +WV HI+  L   ++ E    VS+  VP+++    PE YVP  VA+GPYH+  P+L+
Sbjct  14    SEEQWVKHIRDALHHGIDIETP--VSVHCVPESISSAKPEAYVPHHVALGPYHHLRPQLY  71

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             + E  KL AA+  Q+ L+       A  +   E++IR SY   L +  +TL W+M +D+ 
Sbjct  72    QTEHPKLAAARRAQETLKLPAFDRTAGLLQAEEAKIRASYQLHLEVGTDTLKWIMTIDSL  131

Query  1597  FLLEFLKVY  1571
             FLL+ L  Y
Sbjct  132   FLLDLLYRY  140



>gb|KCW44512.1| hypothetical protein EUGRSUZ_L01981 [Eucalyptus grandis]
Length=341

 Score =   168 bits (425),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 130/190 (68%), Gaps = 1/190 (1%)
 Frame = -3

Query  907  PSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVA  728
            P  E + IP+ ++L + G++      GI +I FD KT TL LP + LD  +EV+LRNLVA
Sbjct  150  PFQEIVMIPTASKLRSVGIKLSLATGGIKTIAFDKKTATLKLPHIDLDATTEVLLRNLVA  209

Query  727  YEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVR  548
            YE    +G L+L RYTE M GI+DT ED+K LRE  I+LNRL SD++V  L+NG+ KS+ 
Sbjct  210  YEMISQRGSLILTRYTELMYGIIDTSEDLKLLREASIVLNRLNSDNKVVELFNGVFKSIG  269

Query  547  LTKVAF-LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFC  371
                A  LD+TI DVN++YN    VK    MR Y++ SW+FLT++AT+VL+LLMVL++ C
Sbjct  270  SKSTASELDETIRDVNEYYNSTRKVKAYNLMRKYVYSSWKFLTVVATVVLILLMVLETSC  329

Query  370  SVYTCSRFFN  341
            S+ +C R FN
Sbjct  330  SILSCPRLFN  339


 Score = 80.9 bits (198),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 2/132 (2%)
 Frame = -3

Query  1954  ESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHE  1775
             E +WV HI+  L   ++ E    VS+  VP+++    PE YVP  VA+GPYH+  P+L++
Sbjct  15    EEQWVKHIRDALHHGIDIETP--VSVHCVPESISSAKPEAYVPHHVALGPYHHLRPQLYQ  72

Query  1774  MERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASF  1595
              E  KL AA+  Q  L+       A  +   E++IR SY   L +  +TL W+M +D+ F
Sbjct  73    TEHPKLAAARRAQAALKLPAFDRTAGLLQAEEAKIRASYQLHLEVGTDTLKWIMTIDSLF  132

Query  1594  LLEFLKVYAVKE  1559
             LL+ L  Y   E
Sbjct  133   LLDLLYRYKCSE  144



>ref|XP_009792464.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana sylvestris]
Length=453

 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 148/498 (30%), Positives = 250/498 (50%), Gaps = 66/498 (13%)
 Frame = -3

Query  1774  MERHKLDAAKIFQKQLRTIKL-HSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             MER+KL A K   +  + +   H L +++   +  +R  +++ +++  ETLAW++A+D  
Sbjct  1     MERYKLAAIKEILEPAQILNFKHLLIDKLRDNDIVVRSCHNRFMDIDEETLAWIVAIDGL  60

Query  1597  FLLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRKM  1418
             FLL  L+                 +   V    +        RD++ML NQIPF +L+++
Sbjct  61    FLLNILR----------------SLYDNVHDDQEIIDDTIFTRDLMMLVNQIPFVVLKQI  104

Query  1417  LQPQC-PSPEASDDL-LLTMLMGLSKELSPFK---NEGSAVVQIADATHLLGYLFQTIVP  1253
              +  C  SPE  +D  L++M     +   P     N+ S  VQ+    HLL  +++ I+ 
Sbjct  105   RKFLCLSSPEDREDSELVSMFRHFCEMHFPLALPINDHSRKVQVTRPLHLLDLMYRLILD  164

Query  1252  E--------MESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAFGQVWGILKKLNKG  1097
             +        M++  + I+ D     +E++D  +D+  +  G +   F  +  +++  N G
Sbjct  165   DRVDFASIPMQTPAIIIKHDNINEDEEEEDNVDDQDRETHGGIIHNFETILEVVE--NIG  222

Query  1096  PARALKRLSSLAPVKTVLL-MPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDN  920
             P    K    + P+  V+  MPW  I+                  G   +G + +  K+N
Sbjct  223   PRNVQK---FVKPINQVVANMPWSMIS------------------GLFREGTQRNRDKEN  261

Query  919   ADKPPSIEEITIPSVTELAN-AGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVL  743
                    E ITIPS + L   AG+R  P  +GI  I+FD    T YLPV+ ++  SEV+L
Sbjct  262   -------EMITIPSASRLWRYAGIRCSPIHEGISKIKFDQAASTFYLPVIAMNAGSEVIL  314

Query  742   RNLVAYEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGM  563
             RNLV YEA ++K  L  ARY   M+GI DT EDV+ L++ G+I   L +D+EVA L++ M
Sbjct  315   RNLVVYEAAMSKSKLEFARYINLMSGIADTTEDVRLLKQNGVIKGDL-TDNEVACLFSTM  373

Query  562   NKS-VRLTKVAFLDKTIDDVNKFYNCRWN--VKTKRFMRSYIFGSWQFltllativllll  392
               S VR ++   ++  ++ VNK+Y+      V+  R ++  I+ SW+FL    +I ++LL
Sbjct  374   QMSFVRSSRSCNVEIAMEKVNKYYDQMLGVIVRAHRGLKKNIYLSWKFLATALSISVVLL  433

Query  391   mvLQSFCSVYTCSRFFND  338
             ++ Q+FCS Y C   + +
Sbjct  434   LIFQTFCSAYGCHNIWGN  451



>gb|KHN14739.1| Putative UPF0481 protein [Glycine soja]
Length=600

 Score =   171 bits (433),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 168/572 (29%), Positives = 266/572 (47%), Gaps = 84/572 (15%)
 Frame = -3

Query  1870  VPKTLMVYDPECYVPQRVAIGPYHYTNPELHEMERHKLDAAK-IFQKQLRTIKLHSLAEE  1694
             VPK+L    PE + PQ V +GPYH  + +L      KL AAK +F+         S+ E 
Sbjct  23    VPKSLCSAKPEAFTPQFVGLGPYHSFDDKLTMTLELKLAAAKRVFKHAFEIPISKSIYEH  82

Query  1693  MMKVESRIRLSYDKQLNLRVETLAWMMAVDASFLLEFLKVYAVKEGKLMAAMISAKMS-H  1517
             +   ++            +    ++ +A D  FLL  L   A  E +   + ++ +    
Sbjct  83    LYHADA-----------FQKPESSYALAQDGLFLLALLHWSADAEPQQHYSFLTGRQGLP  131

Query  1516  LVDLKGKKSSHNALLRDIIMLENQIPFFILRKM--------------LQPQ---------  1406
             LV+  G + + +A++ D+ MLENQIP  +L ++              +QPQ         
Sbjct  132   LVNSFGLELTIDAVISDVYMLENQIPTPVLHQVNQASFCKGKSESDEIQPQEDLGAKMQS  191

Query  1405  -----CP---------SPEASDDLLLTMLMGLSKELSPFKNEGSAVVQIADAT-------  1289
                  CP          P+  D LL  M   +  +  P  + G++ + I+ +        
Sbjct  192   LCEKHCPLVHLQQLSKKPQEYDHLLDLMYHFIVPDEKPKIDSGNSQLTISQSNQDSVLIY  251

Query  1288  HLLGY---LFQTIVPEMESEHVEIEIdenggmkekkdgeedEFLKNSGYVKSAF------  1136
             HLLG+   LF++  P+  ++  E           +       F      +   F      
Sbjct  252   HLLGFISPLFES-NPQSSTDEEEGNNSRRNTCCSRCYSLCLGFFSVCRAILGFFLLFICL  310

Query  1135  --GQVWGILKKLNKGPARALKRLSSLAPVKTVLLMP-----WKAITKLPGLNVMKGPIES  977
                 VW +++ +     RAL+ +  L    + L+ P     + +++     N +   + +
Sbjct  311   IIFFVWELIRHIPALFMRALRSIYDLLKYVSRLIQPTVDSLYGSLSTRQSQNQLLKSV-T  369

Query  976   LFSCGQKPDGDENSDSKDNADKPPSIEEI-TIPSVTELANAGVRFIPTK-KGILSIEFDA  803
             L   G K   +E    K N DK   +  + TIPSVTEL  AG+ F P K  GI  IE+D 
Sbjct  370   LLVGGVKRASEEILRDK-NLDK--DVRSVATIPSVTELHKAGIGFQPAKLGGISGIEYDE  426

Query  802   KTFTLYLPVVTLDINSEVVLRNLVAYEACI-AKGPLVLARYTEFMNGIVDTDEDVKFLRE  626
              T    LP + L++NSEV++RNL+AYE+ I +K PLV +RY E M  I+ T EDVK L +
Sbjct  427   GTCMFSLPSIKLNVNSEVIMRNLMAYESLIDSKRPLVFSRYVEIMRAIIGTREDVKLLVQ  486

Query  625   KGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRWNVKTKRFMRSYI  446
             + II   L SD  VA+L+NG++KS+R T    L+K I  VN  Y+   + K  R M  Y+
Sbjct  487   REIIQTEL-SDQVVADLFNGISKSIRPTNTQDLEKVIKKVNAKYD--DSQKVNRAMVKYV  543

Query  445   FGSWQFltllativllllmvLQSFCSVYTCSR  350
             + + +F T +A  V L+L  +Q++CSVY+C R
Sbjct  544   YSAEKFYTFVAAFVFLVLTAVQAYCSVYSCHR  575



>ref|XP_009591776.1| PREDICTED: putative UPF0481 protein At3g02645 [Nicotiana tomentosiformis]
Length=254

 Score =   162 bits (411),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 105/133 (79%), Gaps = 0/133 (0%)
 Frame = -3

Query  1957  DESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELH  1778
             DES+WVI I++TL+ ELEE+ EI VSIF VPK L++ D + YVPQ VAIGPYHY   ELH
Sbjct  12    DESRWVIQIRRTLDEELEEDTEIPVSIFNVPKALLLSDQDSYVPQVVAIGPYHYWRTELH  71

Query  1777  EMERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDAS  1598
             +MER+KL AAKI QKQL+++K   L E+++  E RIR SY K LN   ETLAWMMAVDAS
Sbjct  72    DMERYKLAAAKITQKQLQSLKFQHLVEQLINFEHRIRCSYHKYLNFNEETLAWMMAVDAS  131

Query  1597  FLLEFLKVYAVKE  1559
             FLLEFL++YA++E
Sbjct  132   FLLEFLQIYAIRE  144


 Score =   141 bits (355),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 88/107 (82%), Gaps = 0/107 (0%)
 Frame = -3

Query  661  VDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVRLTKVAFLDKTIDDVNKFYNCRW  482
            +  +ED   LREKGIILNRLKSD EVANLWNGM++S+RLTKV FLDK I+DVN FYN RW
Sbjct  142  IREEEDALLLREKGIILNRLKSDKEVANLWNGMSRSLRLTKVQFLDKVIEDVNGFYNARW  201

Query  481  NVKTKRFMRSYIFGSWQFltllativllllmvLQSFCSVYTCSRFFN  341
            N+KT + M+ Y+FGSWQ LT LA I+LL+LM LQ+FCSVY C+R F+
Sbjct  202  NIKTGKMMKHYVFGSWQVLTFLACIMLLMLMTLQAFCSVYKCARIFH  248



>gb|KCW63598.1| hypothetical protein EUGRSUZ_G01224 [Eucalyptus grandis]
Length=495

 Score =   166 bits (421),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 94/190 (49%), Positives = 129/190 (68%), Gaps = 1/190 (1%)
 Frame = -3

Query  907  PSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVA  728
            P  E + IP+ ++L N G++      GI +I FD +T TL LP + LD  +EV+LRNLVA
Sbjct  304  PFQEIVMIPTASKLRNVGIKLSLATGGIKTIAFDKRTATLKLPHIDLDATTEVLLRNLVA  363

Query  727  YEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVR  548
            YE    +G L+L RYTE M GI+DT ED+K LRE  I+LNRL SD++V  L+NG+ KS+ 
Sbjct  364  YEMISQRGSLILTRYTELMYGIIDTSEDLKLLREASIVLNRLNSDNKVVELFNGVIKSIG  423

Query  547  LTKVAF-LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFC  371
                A  LD+TI DVN++YN    VK    MR Y++ SW+FLT++AT+VL+LLMVL++ C
Sbjct  424  SKSTASELDETIRDVNEYYNSTRKVKAYNLMRKYVYSSWKFLTVVATVVLILLMVLETSC  483

Query  370  SVYTCSRFFN  341
            S+ +C R  N
Sbjct  484  SILSCPRLIN  493


 Score = 94.7 bits (234),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 73/217 (34%), Positives = 112/217 (52%), Gaps = 23/217 (11%)
 Frame = -3

Query  1954  ESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHE  1775
             E +WV HI+  L   ++ EN   VS+  VP+++    PE YVP  VA+GPYH+  P+L++
Sbjct  15    EEEWVKHIRDALHHGIDIENP--VSVHCVPESISSAKPEAYVPHHVALGPYHHLRPQLYQ  72

Query  1774  MERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASF  1595
              E  KL AA+  Q  L+       A  +   E++IR SY   L +  +TL W+M +D+ F
Sbjct  73    TEHPKLAAARRAQAALKLPAFDRTAGLLQAEEAKIRASYQLHLEVGTDTLKWIMTIDSLF  132

Query  1594  LLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK-M  1418
             LL+ L  Y        +  I  K   + D        ++ ++D++M+ENQIP F+LR+ M
Sbjct  133   LLDLLYRYK-------SPNIGIKEDSIWD-----DDPDSTVKDVMMVENQIPTFVLREIM  180

Query  1417  LQPQCPS--------PEASDDLLLTMLMGLSKELSPF  1331
             LQ +  +         E+ D  L  ML    K +SP 
Sbjct  181   LQIENSANEVRENEEDESIDRKLGEMLTRFCKGMSPL  217



>ref|XP_010041237.1| PREDICTED: putative UPF0481 protein At3g02645 [Eucalyptus grandis]
Length=578

 Score =   167 bits (422),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 130/190 (68%), Gaps = 1/190 (1%)
 Frame = -3

Query  907  PSIEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVA  728
            P  E + IP+ ++L + G++      GI +I FD KT TL LP + LD  +EV+LRNLVA
Sbjct  387  PFQEIVMIPTASKLRSVGIKLSLATGGIKTIAFDKKTATLKLPHIDLDATTEVLLRNLVA  446

Query  727  YEACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRLKSDSEVANLWNGMNKSVR  548
            YE    +G L+L RYTE M GI+DT ED+K LRE  I+LNRL SD++V  L+NG+ KS+ 
Sbjct  447  YEMISQRGSLILTRYTELMYGIIDTSEDLKLLREASIVLNRLNSDNKVVELFNGVFKSIG  506

Query  547  LTKVAF-LDKTIDDVNKFYNCRWNVKTKRFMRSYIFGSWQFltllativllllmvLQSFC  371
                A  LD+TI DVN++YN    VK    MR Y++ SW+FLT++AT+VL+LLMVL++ C
Sbjct  507  SKSTASELDETIRDVNEYYNSTRKVKAYNLMRKYVYSSWKFLTVVATVVLILLMVLETSC  566

Query  370  SVYTCSRFFN  341
            S+ +C R FN
Sbjct  567  SILSCPRLFN  576


 Score = 97.1 bits (240),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/184 (35%), Positives = 100/184 (54%), Gaps = 15/184 (8%)
 Frame = -3

Query  1954  ESKWVIHIQKTlereleeenEINVSIFGVPKTLMVYDPECYVPQRVAIGPYHYTNPELHE  1775
             E +WV HI+  L   ++ E    VS+  VP+++    PE YVP  VA+GPYH+  P+L++
Sbjct  15    EEQWVKHIRDALHHGIDIETP--VSVHCVPESISSAKPEAYVPHHVALGPYHHLRPQLYQ  72

Query  1774  MERHKLDAAKIFQKQLRTIKLHSLAEEMMKVESRIRLSYDKQLNLRVETLAWMMAVDASF  1595
              E  KL AA+  Q  L+       A  +   E++IR SY   L +  +TL W+M +D+ F
Sbjct  73    TEHPKLAAARRAQAALKLPAFDRTAGLLQAEEAKIRASYQLHLEVGTDTLKWIMTIDSLF  132

Query  1594  LLEFLKVYAVKEGKLMAAMISAKMSHLVDLKGKKSSHNALLRDIIMLENQIPFFILRK-M  1418
             LL+ L  Y        +  I  K   + D        ++ ++D++M+ENQIP F+LRK M
Sbjct  133   LLDLLYRYK-------SPTIGIKEDSIWD-----DDPDSTVKDVMMVENQIPTFVLRKIM  180

Query  1417  LQPQ  1406
             LQ +
Sbjct  181   LQTE  184



>gb|EMS57299.1| hypothetical protein TRIUR3_33500 [Triticum urartu]
Length=257

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 109/168 (65%), Gaps = 18/168 (11%)
 Frame = -3

Query  1078  RLSS-LAPVKTVLLMPWKAITKLPGLNVMKGPIESLFSCGQKPDGDENSDSKDNADKPPS  902
             RLS  + P++     PWK +T +PG++ +  P                +D+ + A     
Sbjct  100   RLSHVMKPIEFAAKAPWKMLTGIPGISALSMP----------------ADTGEQASTMSQ  143

Query  901   IEEITIPSVTELANAGVRFIPTKKGILSIEFDAKTFTLYLPVVTLDINSEVVLRNLVAYE  722
              EEI IPSVTELA++GVRF PT   + +I F+ KT TL+LP VTLD N+EVVLRNLVAYE
Sbjct  144   DEEIEIPSVTELASSGVRFAPTNGNLSTIAFNRKTATLHLPAVTLDCNTEVVLRNLVAYE  203

Query  721   ACIAKGPLVLARYTEFMNGIVDTDEDVKFLREKGIILNRL-KSDSEVA  581
             +  A GPLV  RYTE MNGI+DTD+DV  LR++G++LNR+ KSD E A
Sbjct  204   SSAASGPLVFTRYTELMNGIIDTDDDVTLLRKRGVVLNRMKKSDGEAA  251



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6423223341334