BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16431_g1_i1 len=2453 path=[107:0-1351 @106@!:1352-2142
2247:2143-2377 2482:2378-2402 2482:2403-2427 2482:2428-2452]

Length=2453
                                                                      Score     E

ref|XP_006361524.1|  PREDICTED: uncharacterized protein LOC102596611    473   0.0      
ref|XP_004245204.1|  PREDICTED: uncharacterized protein LOC101266356    467   0.0      
ref|XP_009588874.1|  PREDICTED: uncharacterized protein LOC104086333    447   0.0      
ref|XP_011081952.1|  PREDICTED: DNA cross-link repair protein SNM1      433   0.0      
ref|XP_010648404.1|  PREDICTED: uncharacterized protein LOC100256...    415   0.0      
emb|CDP17885.1|  unnamed protein product                                410   0.0      
ref|XP_007012469.1|  Sterile alpha motif domain-containing protei...    409   0.0      
gb|KDP34006.1|  hypothetical protein JCGZ_07577                         400   0.0      
ref|XP_008452797.1|  PREDICTED: DNA cross-link repair protein SNM1      384   0.0      
ref|XP_006474528.1|  PREDICTED: DNA cross-link repair 1A protein-...    403   0.0      
ref|XP_008351944.1|  PREDICTED: DNA cross-link repair protein SNM...    398   0.0      
ref|XP_004157409.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    384   0.0      
ref|XP_007012468.1|  Sterile alpha motif domain-containing protei...    406   0.0      
ref|XP_004141439.1|  PREDICTED: uncharacterized protein LOC101218609    384   0.0      
ref|XP_009363003.1|  PREDICTED: DNA cross-link repair protein SNM1      395   0.0      
ref|XP_011019313.1|  PREDICTED: DNA cross-link repair protein SNM...    391   0.0      
gb|KHG06389.1|  DNA cross-link repair 1A                                394   0.0      
ref|XP_002516164.1|  DNA cross-link repair protein pso2/snm1, put...    385   0.0      Ricinus communis
gb|EYU21966.1|  hypothetical protein MIMGU_mgv1a0253331mg               384   0.0      
ref|XP_008792888.1|  PREDICTED: uncharacterized protein LOC103709368    377   0.0      
ref|XP_002309453.1|  sterile alpha motif domain-containing family...    385   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007012471.1|  Sterile alpha motif domain-containing protei...    408   0.0      
ref|XP_004292890.1|  PREDICTED: DNA cross-link repair protein SNM...    381   0.0      
ref|XP_010917472.1|  PREDICTED: uncharacterized protein LOC105042070    371   0.0      
ref|XP_006452946.1|  hypothetical protein CICLE_v10007634mg             380   0.0      
ref|XP_003603243.1|  DNA cross-link repair 1A protein                   370   0.0      
ref|XP_004501410.1|  PREDICTED: DNA cross-link repair protein SNM...    364   0.0      
ref|XP_007012470.1|  Sterile alpha motif domain-containing protei...    408   0.0      
ref|XP_010098394.1|  DNA cross-link repair 1A protein                   380   0.0      
ref|XP_006843920.1|  hypothetical protein AMTR_s00007p00269400          357   0.0      
ref|XP_003527765.2|  PREDICTED: DNA cross-link repair protein SNM...    356   0.0      
ref|XP_002462447.1|  hypothetical protein SORBIDRAFT_02g025710          352   0.0      Sorghum bicolor [broomcorn]
ref|XP_010273866.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    373   0.0      
ref|XP_008220601.1|  PREDICTED: DNA cross-link repair protein SNM...    364   0.0      
ref|XP_004956893.1|  PREDICTED: uncharacterized protein LOC101778195    352   0.0      
ref|XP_010541701.1|  PREDICTED: uncharacterized protein LOC104815085    364   0.0      
ref|XP_008670221.1|  PREDICTED: uncharacterized protein LOC103647...    350   0.0      
ref|XP_007136912.1|  hypothetical protein PHAVU_009G084300g             360   0.0      
ref|XP_009403292.1|  PREDICTED: uncharacterized protein LOC103986880    352   0.0      
ref|XP_006397751.1|  hypothetical protein EUTSA_v10001326mg             356   0.0      
ref|NP_001063271.1|  Os09g0439000                                       347   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAD36078.1|  putative SNM1                                          347   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAZ44869.1|  hypothetical protein OsJ_29509                          347   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAZ09242.1|  hypothetical protein OsI_31515                          347   0.0      Oryza sativa Indica Group [Indian rice]
gb|EMS66631.1|  DNA cross-link repair 1A protein                        347   0.0      
ref|XP_010508124.1|  PREDICTED: DNA cross-link repair 1A protein-...    348   0.0      
gb|KFK37360.1|  hypothetical protein AALP_AA4G246500                    348   0.0      
ref|XP_007225556.1|  hypothetical protein PRUPE_ppa003302m2g            359   0.0      
ref|XP_002882028.1|  sterile alpha motif domain-containing protein      349   0.0      
ref|NP_182094.1|  sterile alpha motif (SAM) domain-containing pro...    348   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293744.1|  hypothetical protein CARUB_v10022707mg             347   0.0      
ref|XP_009142356.1|  PREDICTED: DNA cross-link repair 1A protein        345   0.0      
ref|XP_006660659.1|  PREDICTED: uncharacterized protein LOC102700457    342   0.0      
ref|XP_010672310.1|  PREDICTED: DNA cross-link repair protein SNM1      352   0.0      
ref|XP_010506532.1|  PREDICTED: DNA cross-link repair 1A protein-...    340   0.0      
emb|CDY27366.1|  BnaC04g50390D                                          342   0.0      
ref|XP_010518204.1|  PREDICTED: DNA cross-link repair 1A protein-...    340   0.0      
ref|XP_003576570.1|  PREDICTED: uncharacterized protein LOC100843196    337   0.0      
emb|CDY37057.1|  BnaA04g26350D                                          345   0.0      
ref|XP_010648405.1|  PREDICTED: uncharacterized protein LOC100256...    414   3e-178   
ref|XP_008670222.1|  PREDICTED: uncharacterized protein LOC103647...    350   5e-178   
ref|XP_007012472.1|  Sterile alpha motif domain-containing protei...    408   2e-176   
ref|XP_007012473.1|  Sterile alpha motif domain-containing protei...    408   2e-176   
gb|EPS68874.1|  hypothetical protein M569_05893                         342   1e-173   
gb|KDO73679.1|  hypothetical protein CISIN_1g0048771mg                  362   5e-173   
ref|XP_006293745.1|  hypothetical protein CARUB_v10022707mg             346   3e-166   
ref|XP_002975301.1|  hypothetical protein SELMODRAFT_415475             317   6e-154   
ref|XP_002993085.1|  hypothetical protein SELMODRAFT_449005             316   8e-154   
ref|XP_001770013.1|  predicted protein                                  294   7e-147   
ref|XP_010648406.1|  PREDICTED: uncharacterized protein LOC100256...    415   1e-145   
ref|XP_009775278.1|  PREDICTED: DNA cross-link repair protein SNM...    389   6e-141   
ref|XP_011019314.1|  PREDICTED: uncharacterized protein LOC105122...    391   3e-138   
tpg|DAA40151.1|  TPA: hypothetical protein ZEAMMB73_008326              350   5e-126   
ref|XP_010506533.1|  PREDICTED: uncharacterized protein LOC104783...    339   3e-118   
gb|KCW81818.1|  hypothetical protein EUGRSUZ_C03174                     383   1e-115   
ref|XP_010049292.1|  PREDICTED: DNA cross-link repair 1A protein        382   1e-115   
ref|XP_009794231.1|  PREDICTED: uncharacterized protein LOC104241024    325   5e-98    
gb|EMT05587.1|  hypothetical protein F775_00976                         309   4e-95    
ref|XP_005649918.1|  DRMBL-domain-containing protein                    220   7e-84    
ref|XP_005847690.1|  hypothetical protein CHLNCDRAFT_134115             221   6e-82    
gb|KFM26805.1|  DNA cross-link repair 1A protein                        205   3e-72    
ref|XP_005704885.1|  DNA ligase                                         182   6e-72    
ref|XP_003061601.1|  predicted protein                                  186   2e-70    
ref|XP_002509150.1|  predicted protein                                  196   1e-69    Micromonas commoda
ref|XP_003081832.1|  putative SNM1 (ISS)                                179   2e-67    
ref|XP_001635152.1|  predicted protein                                  179   2e-67    Nematostella vectensis
emb|CEF99524.1|  DNA repair metallo-beta-lactamase                      178   2e-67    
ref|XP_010239822.1|  PREDICTED: DNA cross-link repair protein SNM...    162   4e-66    
ref|XP_007903848.1|  PREDICTED: DNA cross-link repair 1A protein        172   6e-66    
ref|XP_006778797.1|  PREDICTED: DNA cross-link repair 1A protein ...    169   7e-66    
ref|XP_002447746.1|  hypothetical protein SORBIDRAFT_06g014970          160   1e-65    Sorghum bicolor [broomcorn]
ref|XP_008142549.1|  PREDICTED: DNA cross-link repair 1A protein        167   2e-65    
ref|XP_001420404.1|  predicted protein                                  179   2e-65    Ostreococcus lucimarinus CCE9901
ref|XP_008661391.1|  PREDICTED: uncharacterized protein LOC100192...    162   2e-65    
ref|XP_005874573.1|  PREDICTED: DNA cross-link repair 1A protein ...    166   3e-65    
gb|EPQ12869.1|  DNA cross-link repair 1A protein                        166   3e-65    
ref|XP_005097518.1|  PREDICTED: dentin sialophosphoprotein-like         164   6e-65    
ref|XP_796713.3|  PREDICTED: DNA cross-link repair 1A protein-like      177   6e-65    Strongylocentrotus purpuratus [purple urchin]
ref|XP_006088207.1|  PREDICTED: DNA cross-link repair 1A protein        168   1e-64    
ref|XP_007440705.1|  PREDICTED: DNA cross-link repair 1A protein ...    159   1e-64    
ref|XP_004412852.1|  PREDICTED: DNA cross-link repair 1A protein        167   1e-64    
ref|XP_007440703.1|  PREDICTED: DNA cross-link repair 1A protein ...    159   1e-64    
ref|XP_004763881.1|  PREDICTED: DNA cross-link repair 1A protein ...    165   2e-64    
ref|XP_001783805.1|  predicted protein                                  166   2e-64    
ref|XP_002512800.1|  DNA cross-link repair protein pso2/snm1, put...    158   3e-64    Ricinus communis
ref|XP_535018.3|  PREDICTED: DNA cross-link repair 1A protein iso...    165   3e-64    Canis lupus familiaris [dogs]
ref|XP_006920909.1|  PREDICTED: DNA cross-link repair 1A protein ...    165   4e-64    
ref|XP_002913597.1|  PREDICTED: DNA cross-link repair 1A protein-...    164   6e-64    
ref|XP_001090942.1|  PREDICTED: DNA cross-link repair 1A protein        162   7e-64    Macaca mulatta [rhesus macaque]
gb|EHH19386.1|  hypothetical protein EGK_20079                          162   7e-64    
ref|XP_003512940.1|  PREDICTED: DNA cross-link repair 1A protein        165   8e-64    
ref|XP_005566541.1|  PREDICTED: DNA cross-link repair 1A protein ...    162   8e-64    
ref|XP_003922238.1|  PREDICTED: DNA cross-link repair 1A protein ...    166   9e-64    
gb|ERE79288.1|  DNA cross-link repair 1A protein                        164   9e-64    
ref|XP_007615820.1|  PREDICTED: DNA cross-link repair 1A protein        164   1e-63    
ref|XP_008683015.1|  PREDICTED: LOW QUALITY PROTEIN: DNA cross-li...    165   1e-63    
ref|XP_001926894.1|  PREDICTED: DNA cross-link repair 1A protein        165   1e-63    Sus scrofa [pigs]
ref|XP_005063481.1|  PREDICTED: DNA cross-link repair 1A protein        164   1e-63    
ref|XP_006879983.1|  PREDICTED: DNA cross-link repair 1A protein        166   1e-63    
ref|XP_004701334.1|  PREDICTED: DNA cross-link repair 1A protein        162   2e-63    
gb|ETL82175.1|  hypothetical protein L917_17606                         161   2e-63    
ref|XP_004362808.1|  DNA repair metallo-beta-lactamase domain-con...    156   2e-63    
ref|XP_002756651.1|  PREDICTED: DNA cross-link repair 1A protein ...    165   2e-63    Callithrix jacchus [common marmoset]
ref|XP_008569249.1|  PREDICTED: DNA cross-link repair 1A protein ...    166   2e-63    
gb|EKC33595.1|  DNA cross-link repair 1A protein                        167   2e-63    
gb|ELT87607.1|  hypothetical protein CAPTEDRAFT_226585                  159   2e-63    
gb|ETI35238.1|  hypothetical protein F443_18372                         161   2e-63    
ref|XP_008049340.1|  PREDICTED: DNA cross-link repair 1A protein        159   2e-63    
ref|XP_005320745.1|  PREDICTED: DNA cross-link repair 1A protein        167   2e-63    
gb|ETK75504.1|  hypothetical protein L915_17879                         161   3e-63    
ref|XP_004428151.1|  PREDICTED: DNA cross-link repair 1A protein        167   3e-63    
ref|XP_003961638.1|  PREDICTED: DNA cross-link repair 1A protein-...    167   3e-63    
ref|XP_009593049.1|  PREDICTED: DNA cross-link repair protein SNM1      159   4e-63    
ref|XP_007962318.1|  PREDICTED: DNA cross-link repair 1A protein ...    160   6e-63    
ref|XP_006446878.1|  hypothetical protein CICLE_v10015161mg             160   6e-63    
ref|XP_004316647.1|  PREDICTED: DNA cross-link repair 1A protein        161   6e-63    
ref|XP_003787201.1|  PREDICTED: DNA cross-link repair 1A protein        162   6e-63    
ref|XP_010587275.1|  PREDICTED: DNA cross-link repair 1A protein        162   6e-63    
ref|XP_001495731.2|  PREDICTED: DNA cross-link repair 1A protein ...    162   7e-63    Equus caballus [domestic horse]
ref|XP_005826807.1|  hypothetical protein GUITHDRAFT_76035              170   7e-63    
ref|XP_004493109.1|  PREDICTED: DNA cross-link repair protein SNM...    159   7e-63    
ref|XP_008505037.1|  PREDICTED: DNA cross-link repair 1A protein ...    162   7e-63    
gb|KDP41886.1|  hypothetical protein JCGZ_26904                         162   8e-63    
ref|XP_010085270.1|  PREDICTED: DNA cross-link repair 1A protein        159   9e-63    
ref|XP_007173181.1|  PREDICTED: DNA cross-link repair 1A protein        163   9e-63    
ref|XP_009213650.1|  PREDICTED: DNA cross-link repair 1A protein        160   1e-62    
ref|XP_007962316.1|  PREDICTED: DNA cross-link repair 1A protein ...    160   1e-62    
ref|XP_010239826.1|  PREDICTED: DNA cross-link repair protein SNM...    151   1e-62    
ref|XP_009051023.1|  hypothetical protein LOTGIDRAFT_213948             176   1e-62    
dbj|BAD90139.1|  mKIAA0086 protein                                      166   1e-62    Mus musculus [mouse]
gb|EDL01762.1|  DNA cross-link repair 1A, PSO2 homolog (S. cerevi...    166   1e-62    
ref|XP_006844683.1|  hypothetical protein AMTR_s00016p00244350          161   1e-62    
ref|XP_010361519.1|  PREDICTED: DNA cross-link repair 1A protein        160   1e-62    
sp|Q9JIC3.2|DCR1A_MOUSE  RecName: Full=DNA cross-link repair 1A p...    166   1e-62    Mus musculus [mouse]
ref|XP_006002870.1|  PREDICTED: DNA cross-link repair 1A protein        159   1e-62    
ref|XP_004919436.1|  PREDICTED: DNA cross-link repair 1A protein ...    161   2e-62    
ref|NP_061301.3|  DNA cross-link repair 1A protein                      166   2e-62    Mus musculus [mouse]
ref|XP_006135033.1|  PREDICTED: DNA cross-link repair 1A protein        157   2e-62    
ref|XP_004975484.1|  PREDICTED: LOW QUALITY PROTEIN: DNA cross-li...    152   2e-62    
ref|NP_001093331.1|  uncharacterized protein LOC733261                  159   2e-62    Xenopus laevis [clawed frog]
ref|XP_004680481.1|  PREDICTED: DNA cross-link repair 1A protein        159   2e-62    
ref|XP_009781327.1|  PREDICTED: DNA cross-link repair protein SNM1      158   2e-62    
ref|XP_004459940.1|  PREDICTED: LOW QUALITY PROTEIN: DNA cross-li...    158   2e-62    
ref|XP_006468937.1|  PREDICTED: DNA cross-link repair protein SNM...    160   2e-62    
ref|XP_005387865.1|  PREDICTED: DNA cross-link repair 1A protein ...    159   2e-62    
ref|XP_006162825.1|  PREDICTED: LOW QUALITY PROTEIN: DNA cross-li...    163   3e-62    
ref|XP_006527281.1|  PREDICTED: DNA cross-link repair 1A protein ...    166   3e-62    
ref|XP_010028912.1|  PREDICTED: DNA cross-link repair protein SNM...    153   3e-62    
ref|XP_007107018.1|  PREDICTED: DNA cross-link repair 1A protein ...    160   3e-62    
ref|XP_006831434.1|  PREDICTED: DNA cross-link repair 1A protein        162   3e-62    
ref|XP_007665881.1|  PREDICTED: DNA cross-link repair 1A protein        157   3e-62    
ref|XP_010929555.1|  PREDICTED: LOW QUALITY PROTEIN: DNA cross-li...    163   4e-62    
gb|KDO63501.1|  hypothetical protein CISIN_1g012419mg                   159   4e-62    
ref|XP_007084889.1|  PREDICTED: DNA cross-link repair 1A protein ...    159   4e-62    
ref|XP_003994466.1|  PREDICTED: DNA cross-link repair 1A protein        159   4e-62    
emb|CDY13651.1|  BnaA06g32720D                                          164   4e-62    
ref|XP_004374916.1|  PREDICTED: DNA cross-link repair 1A protein        160   5e-62    
ref|XP_007107015.1|  PREDICTED: DNA cross-link repair 1A protein ...    160   5e-62    
emb|CDX83638.1|  BnaC07g23780D                                          166   5e-62    
ref|XP_006044044.1|  PREDICTED: DNA cross-link repair 1A protein ...    164   6e-62    
ref|XP_004050168.1|  PREDICTED: DNA cross-link repair 1A protein        157   6e-62    
ref|XP_008488343.1|  PREDICTED: DNA cross-link repair 1A protein        157   7e-62    
ref|XP_006183557.1|  PREDICTED: DNA cross-link repair 1A protein        160   7e-62    
ref|XP_006652237.1|  PREDICTED: LOW QUALITY PROTEIN: DNA cross-li...    155   7e-62    
ref|XP_006044045.1|  PREDICTED: DNA cross-link repair 1A protein ...    164   7e-62    
ref|XP_010981522.1|  PREDICTED: DNA cross-link repair 1A protein        160   7e-62    
ref|XP_008828437.1|  PREDICTED: DNA cross-link repair 1A protein        162   8e-62    
ref|XP_004265868.1|  PREDICTED: DNA cross-link repair 1A protein        161   8e-62    
gb|EEE60929.1|  hypothetical protein OsJ_14663                          154   9e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004579866.1|  PREDICTED: DNA cross-link repair 1A protein        162   1e-61    
ref|XP_005293937.1|  PREDICTED: DNA cross-link repair 1A protein ...    160   1e-61    
ref|XP_003223488.1|  PREDICTED: DNA cross-link repair 1A protein        155   1e-61    
ref|XP_003624539.1|  DNA cross-link repair protein SNM1                 159   1e-61    
ref|NP_001099671.1|  DNA cross-link repair 1A protein                   160   1e-61    Rattus norvegicus [brown rat]
ref|NP_001052690.1|  Os04g0401800                                       154   1e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_005048822.1|  PREDICTED: DNA cross-link repair 1A protein        160   1e-61    
gb|AAH97815.1|  LOC733261 protein                                       157   2e-61    Xenopus laevis [clawed frog]
ref|XP_005416424.1|  PREDICTED: DNA cross-link repair 1A protein        159   2e-61    
ref|XP_006978498.1|  PREDICTED: DNA cross-link repair 1A protein        160   2e-61    
dbj|BAK63673.1|  DNA cross-link repair 1A protein                       158   2e-61    
ref|NP_055696.3|  DNA cross-link repair 1A protein                      157   2e-61    Homo sapiens [man]
ref|XP_002321063.2|  hypothetical protein POPTR_0014s13570g             167   2e-61    Populus trichocarpa [western balsam poplar]
ref|XP_010407076.1|  PREDICTED: DNA cross-link repair 1A protein ...    160   2e-61    
ref|XP_010824273.1|  PREDICTED: DNA cross-link repair 1A protein ...    162   2e-61    
ref|NP_001008683.1|  DNA cross-link repair 1A protein                   160   2e-61    Gallus gallus [bantam]
gb|AAT09762.1|  DNA cross-link repair 1A (PSO2 homolog, S. cerevi...    157   2e-61    Homo sapiens [man]
dbj|BAA07646.2|  KIAA0086                                               157   2e-61    Homo sapiens [man]
gb|AAH62582.1|  DNA cross-link repair 1A (PSO2 homolog, S. cerevi...    157   2e-61    Homo sapiens [man]
ref|XP_010857605.1|  PREDICTED: DNA cross-link repair 1A protein ...    162   2e-61    
ref|XP_010824274.1|  PREDICTED: DNA cross-link repair 1A protein ...    162   2e-61    
ref|XP_010407085.1|  PREDICTED: DNA cross-link repair 1A protein ...    159   2e-61    
ref|XP_003825653.1|  PREDICTED: DNA cross-link repair 1A protein        157   2e-61    
ref|XP_008632652.1|  PREDICTED: DNA cross-link repair 1A protein        159   2e-61    
ref|XP_009666936.1|  PREDICTED: DNA cross-link repair 1A protein ...    157   2e-61    
ref|XP_008661392.1|  PREDICTED: uncharacterized protein LOC100192...    148   2e-61    
ref|XP_006598988.1|  PREDICTED: DNA cross-link repair protein SNM...    159   2e-61    
ref|XP_010857607.1|  PREDICTED: DNA cross-link repair 1A protein ...    162   2e-61    
ref|XP_005888713.1|  PREDICTED: DNA cross-link repair 1A protein        162   3e-61    
ref|XP_508045.2|  PREDICTED: DNA cross-link repair 1A protein           157   3e-61    Pan troglodytes
ref|XP_010632899.1|  PREDICTED: DNA cross-link repair 1A protein        155   3e-61    
ref|XP_003548485.1|  PREDICTED: DNA cross-link repair protein SNM...    158   3e-61    
ref|XP_005747454.1|  PREDICTED: DNA cross-link repair 1A protein-...    161   3e-61    
ref|XP_010182241.1|  PREDICTED: DNA cross-link repair 1A protein        159   3e-61    
ref|XP_009078554.1|  PREDICTED: DNA cross-link repair 1A protein        158   3e-61    
ref|XP_007440706.1|  PREDICTED: DNA cross-link repair 1A protein ...    159   3e-61    
ref|XP_009634186.1|  PREDICTED: DNA cross-link repair 1A protein        155   3e-61    
dbj|BAD82911.1|  Snm1                                                   152   4e-61    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009906463.1|  PREDICTED: DNA cross-link repair 1A protein        157   4e-61    
ref|XP_009984180.1|  PREDICTED: DNA cross-link repair 1A protein        155   4e-61    
ref|XP_007939779.1|  PREDICTED: DNA cross-link repair 1A protein        157   4e-61    
ref|XP_004567549.1|  PREDICTED: DNA cross-link repair 1A protein-...    160   4e-61    
ref|XP_007469680.1|  PREDICTED: DNA cross-link repair 1A protein        157   5e-61    
ref|XP_005481144.1|  PREDICTED: DNA cross-link repair 1A protein        157   5e-61    
ref|XP_009704602.1|  PREDICTED: DNA cross-link repair 1A protein        157   5e-61    
ref|XP_006791284.1|  PREDICTED: DNA cross-link repair 1A protein-...    160   5e-61    
ref|XP_006630896.1|  PREDICTED: DNA cross-link repair 1A protein-...    156   6e-61    
ref|XP_009085421.1|  PREDICTED: DNA cross-link repair 1A protein        154   6e-61    
ref|XP_002821207.1|  PREDICTED: DNA cross-link repair 1A protein        157   6e-61    
ref|XP_008798364.1|  PREDICTED: DNA cross-link repair protein SNM...    159   6e-61    
ref|XP_009474331.1|  PREDICTED: DNA cross-link repair 1A protein        156   6e-61    
ref|XP_005520813.1|  PREDICTED: DNA cross-link repair 1A protein        158   6e-61    
ref|XP_002718799.1|  PREDICTED: DNA cross-link repair 1A protein        159   6e-61    Oryctolagus cuniculus [domestic rabbit]
ref|XP_006200255.1|  PREDICTED: LOW QUALITY PROTEIN: DNA cross-li...    156   7e-61    
ref|XP_009948705.1|  PREDICTED: DNA cross-link repair 1A protein        157   7e-61    
emb|CCA20296.1|  DNA crosslink repair protein putative                  159   7e-61    
ref|XP_010713110.1|  PREDICTED: DNA cross-link repair 1A protein ...    158   7e-61    
ref|XP_005958454.1|  PREDICTED: DNA cross-link repair 1A protein        158   7e-61    
ref|XP_007520073.1|  PREDICTED: DNA cross-link repair 1A protein        162   7e-61    
gb|AAF64472.1|AF241240_1  SNM1 protein                                  166   7e-61    Mus musculus [mouse]
ref|XP_008947360.1|  PREDICTED: DNA cross-link repair 1A protein        158   8e-61    
ref|XP_010514323.1|  PREDICTED: DNA cross-link repair protein SNM1      167   8e-61    
ref|XP_005928231.1|  PREDICTED: DNA cross-link repair 1A protein-...    160   9e-61    
ref|XP_010425381.1|  PREDICTED: DNA cross-link repair protein SNM...    163   1e-60    
ref|XP_010006224.1|  PREDICTED: DNA cross-link repair 1A protein        155   1e-60    
ref|XP_009152039.1|  PREDICTED: DNA cross-link repair protein SNM1      163   1e-60    
ref|XP_010151171.1|  PREDICTED: DNA cross-link repair 1A protein        154   1e-60    
ref|XP_009577980.1|  PREDICTED: DNA cross-link repair 1A protein        154   1e-60    
ref|XP_006395534.1|  hypothetical protein EUTSA_v10004102mg             162   1e-60    
emb|CBN81447.1|  DNA cross-link repair 1A protein                       162   1e-60    
ref|XP_009568870.1|  PREDICTED: DNA cross-link repair 1A protein        154   2e-60    
ref|XP_005508238.1|  PREDICTED: DNA cross-link repair 1A protein        153   2e-60    
ref|XP_005698557.1|  PREDICTED: DNA cross-link repair 1A protein        158   2e-60    
ref|XP_010222659.1|  PREDICTED: DNA cross-link repair 1A protein        154   2e-60    
ref|XP_002116720.1|  hypothetical protein TRIADDRAFT_31281              166   2e-60    Trichoplax adhaerens
pdb|4B87|A  Chain A, Crystal Structure Of Human Dna Cross-Link Re...    157   2e-60    
ref|XP_009932920.1|  PREDICTED: DNA cross-link repair 1A protein        155   2e-60    
ref|XP_010309943.1|  PREDICTED: DNA cross-link repair 1A protein        154   2e-60    
ref|XP_009876251.1|  PREDICTED: DNA cross-link repair 1A protein        155   2e-60    
ref|XP_009276159.1|  PREDICTED: DNA cross-link repair 1A protein        155   2e-60    
ref|XP_004659374.1|  PREDICTED: DNA cross-link repair 1A protein        156   2e-60    
ref|XP_010198192.1|  PREDICTED: DNA cross-link repair 1A protein        156   2e-60    
ref|XP_008924600.1|  PREDICTED: DNA cross-link repair 1A protein        156   2e-60    
ref|XP_003441978.1|  PREDICTED: DNA cross-link repair 1A protein-...    159   2e-60    
ref|XP_005443930.1|  PREDICTED: DNA cross-link repair 1A protein        156   2e-60    
ref|XP_008913057.1|  hypothetical protein PPTG_17148                    161   2e-60    
ref|XP_009812063.1|  PREDICTED: DNA cross-link repair 1A protein        155   3e-60    
ref|XP_011033692.1|  PREDICTED: DNA cross-link repair protein SNM...    163   3e-60    
ref|XP_007056394.1|  PREDICTED: DNA cross-link repair 1A protein        156   3e-60    
ref|XP_005239287.1|  PREDICTED: DNA cross-link repair 1A protein        155   3e-60    
ref|XP_006276644.1|  PREDICTED: DNA cross-link repair 1A protein        152   3e-60    
gb|EMP39040.1|  DNA cross-link repair 1A protein                        156   3e-60    
ref|XP_005154574.1|  PREDICTED: DNA cross-link repair 1A protein        154   3e-60    
ref|NP_189302.1|  DNA cross-link repair protein SNM1                    162   4e-60    
ref|XP_003255538.1|  PREDICTED: DNA cross-link repair 1A protein        156   4e-60    
emb|CAA66406.1|  orf12                                                  162   4e-60    
ref|XP_009879872.1|  PREDICTED: DNA cross-link repair 1A protein        153   4e-60    
ref|XP_004020255.1|  PREDICTED: DNA cross-link repair 1A protein        158   4e-60    
ref|XP_010682218.1|  PREDICTED: DNA cross-link repair protein SNM1      155   4e-60    
ref|XP_010160533.1|  PREDICTED: DNA cross-link repair 1A protein        154   5e-60    
ref|XP_004080312.1|  PREDICTED: DNA cross-link repair 1A protein-...    159   5e-60    
ref|XP_006292214.1|  hypothetical protein CARUB_v10018420mg             163   5e-60    
ref|XP_010288681.1|  PREDICTED: DNA cross-link repair 1A protein        154   5e-60    
ref|XP_010021609.1|  PREDICTED: DNA cross-link repair 1A protein        150   5e-60    
ref|XP_007574347.1|  PREDICTED: DNA cross-link repair 1A protein ...    156   5e-60    
ref|XP_003475115.2|  PREDICTED: LOW QUALITY PROTEIN: DNA cross-li...    158   6e-60    
ref|XP_005014500.1|  PREDICTED: DNA cross-link repair 1A protein ...    154   6e-60    
ref|XP_009324214.1|  PREDICTED: DNA cross-link repair 1A protein        155   6e-60    
ref|XP_005014497.1|  PREDICTED: DNA cross-link repair 1A protein ...    153   6e-60    
ref|XP_007574348.1|  PREDICTED: DNA cross-link repair 1A protein ...    156   6e-60    
ref|XP_009971303.1|  PREDICTED: DNA cross-link repair 1A protein        153   7e-60    
ref|XP_005014498.1|  PREDICTED: DNA cross-link repair 1A protein ...    153   8e-60    
ref|XP_004895249.1|  PREDICTED: DNA cross-link repair 1A protein        158   8e-60    
ref|NP_001018385.4|  DNA cross-link repair 1A protein                   160   8e-60    
dbj|GAM28149.1|  hypothetical protein SAMD00019534_113250               147   1e-59    
ref|XP_005804465.1|  PREDICTED: DNA cross-link repair 1A protein-...    156   1e-59    
ref|XP_009505729.1|  PREDICTED: DNA cross-link repair 1A protein        154   1e-59    
ref|XP_008869715.1|  hypothetical protein, variant 2                    167   1e-59    
ref|XP_010895862.1|  PREDICTED: DNA cross-link repair 1A protein ...    157   1e-59    
ref|XP_009836647.1|  hypothetical protein H257_11426                    164   1e-59    
ref|XP_002875331.1|  hypothetical protein ARALYDRAFT_484438             160   2e-59    
ref|XP_010895863.1|  PREDICTED: DNA cross-link repair 1A protein ...    157   2e-59    
ref|XP_010134837.1|  PREDICTED: DNA cross-link repair 1A protein        153   2e-59    
emb|CCI41617.1|  unnamed protein product                                154   2e-59    
ref|XP_004364017.1|  SNM1                                               153   2e-59    
ref|XP_008869713.1|  hypothetical protein H310_06431                    166   3e-59    
gb|EFW45172.2|  hypothetical protein CAOG_03178                         153   3e-59    
ref|XP_010120088.1|  PREDICTED: DNA cross-link repair 1A protein        153   3e-59    
ref|XP_010556329.1|  PREDICTED: DNA cross-link repair protein SNM1      157   3e-59    
gb|AAI29477.1|  Dclre1a protein                                         159   3e-59    
dbj|BAH19739.1|  AT3G26680                                              159   3e-59    
ref|XP_007259318.1|  PREDICTED: DNA cross-link repair 1A protein        158   4e-59    
ref|XP_005644152.1|  DRMBL-domain-containing protein                    154   4e-59    
ref|XP_009487903.1|  PREDICTED: DNA cross-link repair 1A protein        152   5e-59    
ref|XP_008434905.1|  PREDICTED: DNA cross-link repair 1A protein        155   5e-59    
ref|XP_005352579.1|  PREDICTED: DNA cross-link repair 1A protein        156   7e-59    
ref|XP_007032071.1|  DNA repair metallo-beta-lactamase family pro...    151   9e-59    
ref|XP_008312000.1|  PREDICTED: DNA cross-link repair 1A protein        155   9e-59    
ref|XP_010249350.1|  PREDICTED: DNA cross-link repair protein SNM...    157   1e-58    
ref|XP_006338813.1|  PREDICTED: DNA cross-link repair protein SNM...    151   2e-58    
ref|XP_004631601.1|  PREDICTED: LOW QUALITY PROTEIN: DNA cross-li...    154   2e-58    
gb|KHN46827.1|  DNA cross-link repair protein SNM1                      148   3e-58    
emb|CCI41616.1|  unnamed protein product                                149   4e-58    
emb|CCI41613.1|  unnamed protein product                                149   4e-58    
emb|CCI41614.1|  unnamed protein product                                149   4e-58    
gb|KEH23509.1|  DNA cross-link repair protein                           147   4e-58    
ref|XP_006468938.1|  PREDICTED: DNA cross-link repair protein SNM...    144   8e-58    
ref|XP_009666937.1|  PREDICTED: DNA cross-link repair 1A protein ...    161   9e-58    
ref|XP_006598989.1|  PREDICTED: DNA cross-link repair protein SNM...    145   3e-57    
ref|XP_004493110.1|  PREDICTED: DNA cross-link repair protein SNM...    140   3e-57    
ref|XP_002997225.1|  DNA cross-link repair protein, putative            148   4e-57    
ref|XP_009514646.1|  hypothetical protein PHYSODRAFT_472505             155   7e-57    
ref|XP_003290747.1|  hypothetical protein DICPUDRAFT_37896              140   1e-56    
ref|XP_008275793.1|  PREDICTED: DNA cross-link repair 1A protein        147   1e-56    
gb|KDO63502.1|  hypothetical protein CISIN_1g012419mg                   140   1e-56    
gb|KDP33031.1|  hypothetical protein JCGZ_13062                         144   2e-56    
gb|EMT05586.1|  hypothetical protein F775_00975                         214   4e-56    
ref|XP_642494.1|  DNA repair metallo-beta-lactamase domain-contai...    139   4e-56    
emb|CDW54292.1|  DNA cross link repair 1A protein                       154   5e-55    
ref|XP_011099507.1|  PREDICTED: uncharacterized protein LOC105177...    146   8e-55    
ref|XP_011099504.1|  PREDICTED: DNA ligase 1 isoform X1                 146   8e-55    
ref|XP_011099508.1|  PREDICTED: uncharacterized protein LOC105177...    146   8e-55    
ref|XP_011099506.1|  PREDICTED: DNA ligase 1 isoform X2                 146   1e-54    
gb|AAG60081.1|AC013288_15  DNA ligase I, putative                       146   2e-54    
ref|NP_176845.2|  DNA ligase 6                                          146   2e-54    
gb|EPS58033.1|  hypothetical protein M569_16783                         138   3e-54    
ref|XP_007032072.1|  DNA repair metallo-beta-lactamase family pro...    134   6e-54    
ref|XP_002528057.1|  DNA ligase I, putative                             140   6e-54    
ref|XP_010740369.1|  PREDICTED: DNA cross-link repair 1A protein        139   1e-53    
ref|XP_010249351.1|  PREDICTED: DNA cross-link repair protein SNM...    141   1e-53    
ref|XP_010062220.1|  PREDICTED: DNA ligase 1 isoform X2                 136   1e-53    
ref|XP_008569250.1|  PREDICTED: DNA cross-link repair 1A protein ...    133   2e-53    
gb|KCW69312.1|  hypothetical protein EUGRSUZ_F02800                     136   2e-53    
gb|KCW69311.1|  hypothetical protein EUGRSUZ_F02800                     136   2e-53    
ref|XP_010062219.1|  PREDICTED: DNA ligase 1 isoform X1                 136   2e-53    
gb|KCW69310.1|  hypothetical protein EUGRSUZ_F02800                     136   2e-53    
ref|XP_010062221.1|  PREDICTED: uncharacterized protein LOC104449...    136   2e-53    
ref|XP_009605414.1|  PREDICTED: DNA ligase 1 isoform X1                 144   3e-53    
ref|XP_009605415.1|  PREDICTED: DNA ligase 1 isoform X2                 144   3e-53    
ref|XP_009605416.1|  PREDICTED: DNA ligase 1 isoform X3                 144   3e-53    
ref|XP_009605419.1|  PREDICTED: DNA ligase 1 isoform X5                 144   3e-53    
ref|XP_009605420.1|  PREDICTED: uncharacterized protein LOC104099...    143   3e-53    
ref|XP_009605417.1|  PREDICTED: DNA ligase 1 isoform X4                 143   3e-53    
ref|XP_003383318.1|  PREDICTED: DNA cross-link repair 1A protein-...    139   3e-53    
ref|XP_010249352.1|  PREDICTED: DNA cross-link repair protein SNM...    139   4e-53    
gb|EYU44598.1|  hypothetical protein MIMGU_mgv1a021524mg                141   4e-53    
ref|XP_009605421.1|  PREDICTED: uncharacterized protein LOC104099...    143   5e-53    
gb|KFD61523.1|  hypothetical protein M514_26336                         154   5e-53    
gb|KFD61526.1|  hypothetical protein M514_12216                         154   7e-53    
ref|XP_010528511.1|  PREDICTED: DNA ligase 1 isoform X1                 140   8e-53    
ref|XP_010528512.1|  PREDICTED: DNA ligase 1 isoform X2                 140   8e-53    
ref|XP_009105224.1|  PREDICTED: DNA ligase 1 isoform X2                 139   9e-53    
ref|XP_009105223.1|  PREDICTED: DNA ligase 1 isoform X1                 139   9e-53    
ref|XP_009763722.1|  PREDICTED: uncharacterized protein LOC104215...    140   1e-52    
ref|XP_009763723.1|  PREDICTED: uncharacterized protein LOC104215...    140   1e-52    
ref|XP_002295584.1|  predicted protein                                  134   2e-52    
ref|XP_006391424.1|  hypothetical protein EUTSA_v10018010mg             144   2e-52    
ref|XP_010316080.1|  PREDICTED: uncharacterized protein LOC101249...    139   3e-52    
ref|XP_004233623.1|  PREDICTED: DNA ligase 1 isoform X1                 139   4e-52    
gb|KFO98064.1|  DNA cross-link repair 1A protein                        124   6e-52    
ref|XP_006357803.1|  PREDICTED: DNA ligase 1-like                       138   6e-52    
ref|XP_010693570.1|  PREDICTED: DNA ligase 1 isoform X2                 142   6e-52    
ref|XP_008610354.1|  hypothetical protein, variant 1                    141   7e-52    
ref|XP_010693565.1|  PREDICTED: DNA ligase 1 isoform X1                 142   8e-52    
ref|XP_004612021.1|  PREDICTED: DNA cross-link repair 1A protein        124   1e-51    
gb|KFK41070.1|  hypothetical protein AALP_AA2G081800                    141   2e-51    
ref|XP_009666938.1|  PREDICTED: DNA cross-link repair 1A protein ...    124   2e-51    
ref|XP_008610352.1|  hypothetical protein SDRG_06353                    140   2e-51    
gb|KFQ35166.1|  DNA cross-link repair 1A protein                        126   2e-51    
ref|XP_010765642.1|  PREDICTED: DNA cross-link repair 1A protein        128   4e-51    
gb|EFX87923.1|  hypothetical protein DAPPUDRAFT_41973                   133   5e-51    
ref|XP_010713111.1|  PREDICTED: DNA cross-link repair 1A protein ...    124   7e-51    
ref|XP_010232151.1|  PREDICTED: DNA ligase 1 isoform X2                 139   1e-50    
gb|KFW82984.1|  DNA cross-link repair 1A protein                        123   1e-50    
ref|XP_006300589.1|  hypothetical protein CARUB_v10019664mg             139   2e-50    
ref|XP_009836645.1|  hypothetical protein, variant 1                    134   2e-50    
ref|XP_010232149.1|  PREDICTED: DNA ligase 3 isoform X1                 138   2e-50    
emb|CDP02736.1|  unnamed protein product                                132   3e-50    
ref|XP_008444068.1|  PREDICTED: uncharacterized protein LOC103487...    132   4e-50    
ref|XP_008444066.1|  PREDICTED: uncharacterized protein LOC103487...    132   4e-50    
ref|XP_008444067.1|  PREDICTED: uncharacterized protein LOC103487...    132   4e-50    
ref|XP_008444065.1|  PREDICTED: DNA ligase 1 isoform X5                 132   4e-50    
gb|KFO59699.1|  DNA cross-link repair 1A protein                        122   4e-50    
ref|XP_002887071.1|  ATP dependent DNA ligase family protein            135   4e-50    
ref|XP_008444063.1|  PREDICTED: DNA ligase 1 isoform X3                 132   5e-50    
ref|XP_008444064.1|  PREDICTED: DNA ligase 1 isoform X4                 132   5e-50    
gb|KFU85392.1|  DNA cross-link repair 1A protein                        119   5e-50    
ref|XP_006430691.1|  hypothetical protein CICLE_v10010910mg             138   6e-50    
ref|XP_006430690.1|  hypothetical protein CICLE_v10010910mg             138   6e-50    
ref|XP_008444061.1|  PREDICTED: DNA ligase 1 isoform X1                 132   6e-50    
ref|XP_008444062.1|  PREDICTED: DNA ligase 1 isoform X2                 132   6e-50    
gb|KEH23466.1|  ATP-dependent DNA ligase                                134   6e-50    
ref|XP_007033136.1|  DNA ligase                                         138   7e-50    
gb|KEH23465.1|  ATP-dependent DNA ligase                                134   7e-50    
ref|XP_010239827.1|  PREDICTED: DNA cross-link repair protein SNM...    119   7e-50    
gb|KEH23464.1|  ATP-dependent DNA ligase                                134   8e-50    
ref|XP_010239828.1|  PREDICTED: DNA cross-link repair protein SNM...    119   8e-50    
ref|XP_010660381.1|  PREDICTED: uncharacterized protein LOC100266...    143   1e-49    
gb|KFD45284.1|  hypothetical protein M513_13841                         152   1e-49    
ref|XP_010660380.1|  PREDICTED: uncharacterized protein LOC100266...    143   1e-49    
gb|KEH23463.1|  ATP-dependent DNA ligase                                133   1e-49    
ref|XP_003624408.1|  DNA ligase                                         133   1e-49    
ref|XP_010660379.1|  PREDICTED: DNA ligase 1 isoform X3                 143   1e-49    
gb|AES80626.2|  ATP-dependent DNA ligase                                133   1e-49    
ref|XP_010660378.1|  PREDICTED: DNA ligase 3 isoform X2                 143   1e-49    
ref|XP_002266168.2|  PREDICTED: DNA ligase 3 isoform X1                 143   1e-49    
emb|CBI33596.3|  unnamed protein product                                143   1e-49    
emb|CDH56442.1|  dna repair protein pso2                                132   2e-49    
ref|XP_006598990.1|  PREDICTED: DNA cross-link repair protein SNM...    118   3e-49    
gb|KFO89972.1|  DNA cross-link repair 1A protein                        119   3e-49    
ref|XP_006743267.1|  PREDICTED: DNA cross-link repair 1A protein        115   3e-49    
gb|EIE79683.1|  hypothetical protein RO3G_04388                         127   5e-49    
ref|XP_002458331.1|  hypothetical protein SORBIDRAFT_03g031460          130   5e-49    
ref|XP_007217091.1|  hypothetical protein PRUPE_ppa000275mg             131   6e-49    
gb|KFK41071.1|  hypothetical protein AALP_AA2G081800                    132   9e-49    
ref|XP_008229319.1|  PREDICTED: DNA ligase 1                            131   9e-49    
ref|XP_004987660.1|  hypothetical protein PTSG_11300                    122   9e-49    
gb|EFW43945.2|  ATP dependent DNA ligase                                136   1e-48    
ref|XP_008675184.1|  PREDICTED: uncharacterized protein LOC103651...    128   1e-48    
ref|XP_002608959.1|  hypothetical protein BRAFLDRAFT_287105             186   1e-48    
ref|XP_008675185.1|  PREDICTED: uncharacterized protein LOC103651...    128   1e-48    
gb|EEE55195.1|  hypothetical protein OsJ_03041                          130   2e-48    
ref|XP_008675183.1|  PREDICTED: uncharacterized protein LOC103651...    128   2e-48    
tpg|DAA58079.1|  TPA: putative DNA ligase family protein                128   2e-48    
ref|XP_002102232.1|  GD19792                                            120   2e-48    
ref|XP_008675180.1|  PREDICTED: uncharacterized protein LOC103651...    128   2e-48    
ref|XP_008675179.1|  PREDICTED: DNA ligase 1 isoform X1                 128   2e-48    
ref|XP_002681843.1|  predicted protein                                  127   3e-48    
gb|ETN65420.1|  DNA cross-link repair 1A protein                        125   3e-48    
dbj|BAK07470.1|  predicted protein                                      112   6e-48    
gb|KHG17105.1|  hypothetical protein F383_21615                         133   6e-48    
ref|XP_008869717.1|  hypothetical protein, variant 4                    166   6e-48    
ref|XP_005848921.1|  hypothetical protein CHLNCDRAFT_144365             116   9e-48    
ref|XP_006646213.1|  PREDICTED: DNA ligase 1-like                       129   1e-47    
ref|XP_010331158.1|  PREDICTED: DNA cross-link repair 1A protein ...    111   2e-47    
gb|EPB84089.1|  hypothetical protein HMPREF1544_09149                   117   2e-47    
ref|XP_009008557.1|  PREDICTED: DNA cross-link repair 1A protein ...    111   2e-47    
ref|XP_008758745.1|  PREDICTED: DNA cross-link repair 1A protein ...    112   2e-47    
emb|CDQ58821.1|  unnamed protein product                                116   2e-47    
ref|XP_008488018.1|  PREDICTED: DNA cross-link repair 1A protein        133   2e-47    
ref|XP_002492527.1|  Required for a post-incision step in the rep...    121   3e-47    
ref|NP_649548.1|  Snm1                                                  117   3e-47    
ref|XP_311587.4|  AGAP010353-PA                                         119   3e-47    
gb|EDL01761.1|  DNA cross-link repair 1A, PSO2 homolog (S. cerevi...    115   3e-47    
ref|XP_001965917.1|  GF11594                                            124   4e-47    
ref|XP_008343031.1|  PREDICTED: uncharacterized protein LOC103405797    125   4e-47    
emb|CDS11965.1|  hypothetical protein LRAMOSA04161                      129   5e-47    
ref|XP_006482182.1|  PREDICTED: DNA ligase 1-like isoform X2            127   5e-47    
ref|XP_008798365.1|  PREDICTED: DNA cross-link repair protein SNM...    112   6e-47    
ref|XP_006482181.1|  PREDICTED: DNA ligase 1-like isoform X1            127   7e-47    
ref|XP_011033693.1|  PREDICTED: DNA cross-link repair protein SNM...    118   9e-47    
gb|EMT05758.1|  hypothetical protein F775_52464                         129   9e-47    
ref|XP_005839019.1|  hypothetical protein GUITHDRAFT_65538              134   1e-46    
ref|XP_008164555.1|  PREDICTED: DNA cross-link repair 1A protein ...    109   1e-46    
ref|XP_005014499.1|  PREDICTED: DNA cross-link repair 1A protein ...    108   2e-46    
ref|XP_001999401.1|  GI24489                                            117   3e-46    
ref|XP_002174870.1|  DNA 5' exonuclease                                 110   5e-46    
ref|XP_002843675.1|  DNA cross-link repair protein pso2/snm1            111   6e-46    
gb|ELK04944.1|  DNA cross-link repair 1A protein                        165   9e-46    
ref|XP_010248167.1|  PREDICTED: protein artemis-like                    128   1e-45    
ref|XP_001661798.1|  DNA cross-link repair protein pso2/snm1            117   2e-45    
gb|EEC77214.1|  hypothetical protein OsI_15746                          113   2e-45    
ref|XP_003172693.1|  hypothetical protein MGYG_09076                    107   2e-45    
ref|XP_002054620.1|  GJ24554                                            115   3e-45    
ref|XP_003374519.1|  DNA cross-link repair 1A protein                   114   4e-45    
ref|XP_002098027.1|  GE10135                                            114   5e-45    
gb|EPB82023.1|  hypothetical protein HMPREF1544_11227                   106   5e-45    
ref|XP_001996278.1|  GH22402                                            112   5e-45    
ref|XP_007416797.1|  hypothetical protein MELLADRAFT_40002              120   1e-44    
ref|XP_004998418.1|  hypothetical protein PTSG_11661                    127   2e-44    
ref|XP_008889138.1|  DNA repair metallo-beta-lactamase                  128   2e-44    



>ref|XP_006361524.1| PREDICTED: uncharacterized protein LOC102596611 [Solanum tuberosum]
Length=769

 Score =   473 bits (1216),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 258/454 (57%), Positives = 316/454 (70%), Gaps = 44/454 (10%)
 Frame = +3

Query  3     ELELEDMDLNIGLDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNES  182
             E + ED+DL  GLD+I STIDC             C  V                T NE 
Sbjct  131   ESDFEDLDLGHGLDNIESTIDC-------------CSGV--------------QRTTNEE  163

Query  183   FSCASEKSVLEPKKGYFVNSIESRLLkssagleegkgeelgesselDMLLKLCSEGSE--  356
                       E K+GY   SIE+RLL S+   EE K EE  E SELD+LLKLC E  E  
Sbjct  164   ----------ELKRGYLFKSIEARLLNSNGAFEERKEEEPEECSELDLLLKLCGEEDEVY  213

Query  357   GDDDSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAV  536
             GD  + + +++++C    +++  LICCPLCG DI+DL+ E R +HTNEC+DK++ P   V
Sbjct  214   GDALTADLHRQEECLGL-DEEYGLICCPLCGADISDLSGEMRLVHTNECLDKDETPVNVV  272

Query  537   LSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQW  716
              ++ D SFQC GQVL+ SP   P+++V   PVVEWL+ LGLAKYEE+F+++EIDWDTL+ 
Sbjct  273   TANNDVSFQCPGQVLNDSPC--PKEVVHMSPVVEWLQNLGLAKYEEIFVREEIDWDTLKS  330

Query  717   LTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNAKKAVVDDTSKVKLSKLITD  896
             LTEEDL  IGV+ALGPRKKIV+++ ELRKE  +E   +++  K +  D    K SKLITD
Sbjct  331   LTEEDLFSIGVTALGPRKKIVNSILELRKETAEEKVARQDVTKIIPVDAG-TKPSKLITD  389

Query  897   YFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSV-KKNPAKSTKYKDIPVWCSIPGTPFR  1073
             YF C  +  KKV AT   Q EV R+   +S K + KK PAKS K KDIPVWCSIPGTPFR
Sbjct  390   YFICPVSERKKVCATDRAQTEVERTCSSASRKRIQKKTPAKSAKSKDIPVWCSIPGTPFR  449

Query  1074  VDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQIL  1253
             VDAFKYLRRDCSHWFL+HFH DHYQGLT+SFCHGKIYCSS+TAKLVN+KIGIPWD +Q+L
Sbjct  450   VDAFKYLRRDCSHWFLSHFHLDHYQGLTKSFCHGKIYCSSITAKLVNLKIGIPWDMMQVL  509

Query  1254  PLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             P+NQ+INIAGIDVTCFDANHCPG++IILFEP NG
Sbjct  510   PINQKINIAGIDVTCFDANHCPGSLIILFEPPNG  543


 Score =   374 bits (960),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/226 (79%), Positives = 197/226 (87%), Gaps = 1/226 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRFC+EM      Q C +H+LILDTTYC PQYDFPKQ+AVIQFVIE+IQAE F
Sbjct  545   AVLHTGDFRFCEEMTRNAILQIC-VHSLILDTTYCEPQYDFPKQEAVIQFVIESIQAETF  603

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             N +TLFLIGSYTIGKERLFVE+ARAL KK+YVTA+KL IL+CLGF  E+MQFFTLNE ES
Sbjct  604   NSKTLFLIGSYTIGKERLFVEVARALQKKVYVTASKLSILECLGFTREEMQFFTLNEQES  663

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
              IHVVP+WTLA+FKRL  +SNQY GRYSLIVA SPTGWS GKGKKK+ G RWQQGTIIRY
Sbjct  664   QIHVVPMWTLASFKRLKYVSNQYAGRYSLIVAFSPTGWSFGKGKKKSTGSRWQQGTIIRY  723

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD  2031
             EVPYSEHSSFSELK+FVKF+SP NIIPSVNNHGPES+  M+S L D
Sbjct  724   EVPYSEHSSFSELKEFVKFVSPVNIIPSVNNHGPESSSAMVSRLLD  769



>ref|XP_004245204.1| PREDICTED: uncharacterized protein LOC101266356 [Solanum lycopersicum]
Length=770

 Score =   467 bits (1202),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 258/454 (57%), Positives = 319/454 (70%), Gaps = 44/454 (10%)
 Frame = +3

Query  3     ELELEDMDLNIGLDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNES  182
             E + ED+DL  GLD+I STIDC             C  V                  NE 
Sbjct  131   ESDFEDLDLGHGLDNIESTIDC-------------CSGV--------------KRATNEE  163

Query  183   FSCASEKSVLEPKKGYFVNSIESRLLkssagleegkgeelgesselDMLLKLCSEGSEGD  362
                       E K+GY   SIE+RLL S+ GLEE K EE  E SELD+LLKLC E  E  
Sbjct  164   ----------ELKRGYLFKSIEARLLNSNGGLEERKEEESEECSELDLLLKLCGEEDEVY  213

Query  363   DDSMEA--YQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAV  536
              D++ A  +++++C  E +++  LICCPLCG DI+DL+ E R +HTNEC+DK++ PA+ V
Sbjct  214   CDALTADPHRQEECL-ELDEEYGLICCPLCGADISDLSGEMRLVHTNECLDKDETPADVV  272

Query  537   LSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQW  716
              ++ D S QC GQVL+ SP   P+++V   PVVEWLR LGL KYEE+F+++EIDWDTL+ 
Sbjct  273   TANNDVSIQCPGQVLNDSPC--PKEVVHMSPVVEWLRNLGLPKYEEIFVREEIDWDTLKS  330

Query  717   LTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNAKKAVVDDTSKVKLSKLITD  896
             LTEEDL  IGV+ALGPRKKIV+++ ELRKE  +E   +++  K    D    + SKLITD
Sbjct  331   LTEEDLFSIGVTALGPRKKIVNSILELRKETAEEKVARQDVTKITPADAG-TRPSKLITD  389

Query  897   YFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSV-KKNPAKSTKYKDIPVWCSIPGTPFR  1073
             YF C  +  KKV AT   Q EV R+   +S+K + KK PAKS K KDIPVWCSIPGTPFR
Sbjct  390   YFICPVSERKKVCATDKAQMEVQRTCSSASHKRIQKKTPAKSAKSKDIPVWCSIPGTPFR  449

Query  1074  VDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQIL  1253
             VDAFKYLRRDCSHWFL+HFH DHYQGLT+SFCHGKIYCSS+TAKLVN+KIGIPWD +Q+L
Sbjct  450   VDAFKYLRRDCSHWFLSHFHLDHYQGLTKSFCHGKIYCSSITAKLVNLKIGIPWDMMQVL  509

Query  1254  PLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             P+NQ+INIAGIDVTCF+ANHCPG++IILFEP+NG
Sbjct  510   PINQKINIAGIDVTCFEANHCPGSLIILFEPANG  543


 Score =   371 bits (953),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 175/226 (77%), Positives = 196/226 (87%), Gaps = 0/226 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRFC+EM      Q C IH+LILDTTYC+PQYDFPKQ+AVIQFVIE+IQAE F
Sbjct  545   AVLHTGDFRFCEEMTRNAILQTCCIHSLILDTTYCDPQYDFPKQEAVIQFVIESIQAETF  604

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             N +TLFLIGSYTIGKERLFVE+ARAL KK+YVTA+KL IL+CLGF  E+MQFFTLNE ES
Sbjct  605   NSKTLFLIGSYTIGKERLFVEVARALQKKVYVTASKLSILECLGFTREEMQFFTLNEQES  664

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
              IHVVP+WTLA+FKRL  ++NQY  RYSLIVA SPTGWS GKGKKK+ G RWQQGTIIRY
Sbjct  665   QIHVVPMWTLASFKRLKYVANQYARRYSLIVAFSPTGWSFGKGKKKSTGSRWQQGTIIRY  724

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD  2031
             EVPYSEHSSF+ELK+FVKF+SP NIIPSVNN GPES+  M+S L D
Sbjct  725   EVPYSEHSSFTELKEFVKFVSPVNIIPSVNNRGPESSSAMVSRLLD  770



>ref|XP_009588874.1| PREDICTED: uncharacterized protein LOC104086333 [Nicotiana tomentosiformis]
Length=744

 Score =   447 bits (1151),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/449 (55%), Positives = 302/449 (67%), Gaps = 55/449 (12%)
 Frame = +3

Query  12    LEDMDLNIGLDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSC  191
              ED+DL  GLDSI STIDC                                 T+NE    
Sbjct  123   FEDLDLCHGLDSIESTIDC---------------------------CSRTQRTENEE---  152

Query  192   ASEKSVLEPKKGYFVNSIESRLLkssagleegkgeelgesselDMLLKLCSEGSEGDDDS  371
                    E KKGY   SIE+RLL S+ GLEE K E    S   D+LLKLC E        
Sbjct  153   -------ELKKGYLFKSIEARLLNSNDGLEERKEELEECSEL-DLLLKLCGE-------E  197

Query  372   MEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRD  551
              +     +C   G D+  LICCPLCG DI+DL+ + R++HTNEC+D E+ PA  V ++ D
Sbjct  198   EDEGDGVECFGLG-DEYGLICCPLCGADISDLSGDMREVHTNECLDNEETPAHVVTANND  256

Query  552   TSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEED  731
              S QC GQVL+ SP ++P+++V   PVVEWL+ LGLAKYEE+F+++EIDWD L+ LTEED
Sbjct  257   VSVQCPGQVLNDSPRQSPKEVVRVLPVVEWLQNLGLAKYEEIFVREEIDWDALKSLTEED  316

Query  732   LCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCS  911
             L  IGV+ALGPRKKI++++ +LRKE  +E    ++  K V DD    K SKLITDYF  S
Sbjct  317   LFSIGVTALGPRKKIINSILKLRKETAEEKVAWRDVTKVVPDDAG-TKPSKLITDYFISS  375

Query  912   AAGTKKVHATSCGQNEVGRSLMYSSNKSV-KKNPAKSTKYKDIPVWCSIPGTPFRVDAFK  1088
              +  K+V    CG    GR+   +S K + KKNPAKS K KDIPVWCS+PGTPFRVDAFK
Sbjct  376   VSERKRV----CG---TGRACSDASRKRIQKKNPAKSAKSKDIPVWCSVPGTPFRVDAFK  428

Query  1089  YLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQR  1268
             YLRRDCSHWFL+HFH DHYQGLT+SFCHGKIYCSS+TAKLVN+KIGIPWD IQ+LP+NQ+
Sbjct  429   YLRRDCSHWFLSHFHLDHYQGLTKSFCHGKIYCSSITAKLVNLKIGIPWDKIQVLPINQK  488

Query  1269  INIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             INIAG+DV CFDANHCPG++IILFEP NG
Sbjct  489   INIAGVDVICFDANHCPGSLIILFEPPNG  517


 Score =   385 bits (988),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/226 (79%), Positives = 199/226 (88%), Gaps = 0/226 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRFC+EM      Q C +HT+ILDTTYC+PQYDFPKQ+AVIQFVIE+IQAE F
Sbjct  519   AVLHTGDFRFCEEMTRNSILQTCGVHTVILDTTYCDPQYDFPKQEAVIQFVIESIQAETF  578

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             N +TLFLIGSYTIGKERLFVE+ARAL KK+Y+TA+KLRIL+CLGFP EDMQFFTLNE ES
Sbjct  579   NSKTLFLIGSYTIGKERLFVEVARALQKKVYITASKLRILECLGFPREDMQFFTLNEQES  638

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
              IHVVP+WTLA+ KRL  +SNQY GRYSLIVA SPTGWS GKGKKK+ G RWQQGTIIRY
Sbjct  639   QIHVVPMWTLASIKRLKYVSNQYAGRYSLIVAFSPTGWSFGKGKKKSTGSRWQQGTIIRY  698

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD  2031
             EVPYSEHSSFSELK+FVKF+SP NIIPSVNNHGPES+  M+S L D
Sbjct  699   EVPYSEHSSFSELKEFVKFVSPVNIIPSVNNHGPESSNAMVSRLLD  744



>ref|XP_011081952.1| PREDICTED: DNA cross-link repair protein SNM1 [Sesamum indicum]
Length=712

 Score =   433 bits (1114),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 214/347 (62%), Positives = 263/347 (76%), Gaps = 10/347 (3%)
 Frame = +3

Query  321   DMLLKLCSEGSEGDDDSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNE  500
             D+LLKLC+E  E  + S   Y++D   SEG  D S ICCPLCG DI+ L ++ RQIHTNE
Sbjct  148   DVLLKLCAEVDEPGNAS---YRDD---SEGKCDVS-ICCPLCGADISGLRDDLRQIHTNE  200

Query  501   CIDKEDAPAE-AVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEEL  677
             C+DK +   + AV      ++QC GQVLD SP ++ ++ V   PVVEWLR LGLAKYEE+
Sbjct  201   CLDKLEGSTDVAVRDDELGTYQCPGQVLDGSPHKSVKEAVDASPVVEWLRNLGLAKYEEI  260

Query  678   FIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNAKKAVVD  857
             FI+QEIDW  LQWLTEEDLC IG++ALGPRKKI+HAL ELR  +T+ +E   +  K + D
Sbjct  261   FIRQEIDWKALQWLTEEDLCSIGITALGPRKKILHALRELRNNSTRALEPNTDVSKGIAD  320

Query  858   DTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKN-PAKSTKYKD  1034
             + SK+  +KLITDYF    +  K+   T+  QN V RS   S+++S++++   +  K KD
Sbjct  321   E-SKLGTNKLITDYFSGPLSERKRGGDTTNVQNNVRRSQAISTHRSIQRDDRVRKGKQKD  379

Query  1035  IPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             +P+WC IPGTPFRVDAFKYLRRDCSHWFLTHFH DHYQGLTRSFCHG IYCSS+TAKL+N
Sbjct  380   VPLWCCIPGTPFRVDAFKYLRRDCSHWFLTHFHLDHYQGLTRSFCHGIIYCSSITAKLIN  439

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             +KIGI WD IQ+LPLNQ+IN+AGIDVTCFDANHCPGAIIILFEP NG
Sbjct  440   LKIGISWDKIQVLPLNQKINVAGIDVTCFDANHCPGAIIILFEPPNG  486


 Score =   377 bits (967),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 202/224 (90%), Gaps = 1/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             +VLHTGDFRFC+EM ++   Q C IHTLILDTTYCNPQYDFPKQDAVIQFVI+AIQAEAF
Sbjct  488   SVLHTGDFRFCEEMRDLSILQACPIHTLILDTTYCNPQYDFPKQDAVIQFVIDAIQAEAF  547

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKE+LFVE+ARAL KK+YVTAAKLR+L+CL    E+MQ+FTLNE ES
Sbjct  548   NPKTLFLIGSYTIGKEKLFVEVARALRKKVYVTAAKLRLLECLDLQHEEMQWFTLNEQES  607

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WT+A+FKRL Q+SNQYMGR+SLIVA+SPTGWS GKGKK T G+RWQQGTIIRY
Sbjct  608   HIHVVPMWTIASFKRLKQMSNQYMGRFSLIVAVSPTGWSFGKGKKST-GRRWQQGTIIRY  666

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+ELK+FVKFISP +IIPSVNN GP++   M+S L
Sbjct  667   EVPYSEHSSFTELKEFVKFISPVDIIPSVNNDGPDAHNSMVSQL  710



>ref|XP_010648404.1| PREDICTED: uncharacterized protein LOC100256089 isoform X1 [Vitis 
vinifera]
 emb|CBI20745.3| unnamed protein product [Vitis vinifera]
Length=723

 Score =   415 bits (1066),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 222/409 (54%), Positives = 276/409 (67%), Gaps = 34/409 (8%)
 Frame = +3

Query  213   EPKKGYFVNSIESRLLkssagleegk-----geelgesselDMLLKLCSEGSE-GDDDSM  374
             E +  Y  NS+ESRLLKS +G +         E   +  +LD+L++LCSEG E  D D  
Sbjct  94    ESEGSYSCNSVESRLLKSRSGGDGDGNGGFCEESDEDFEQLDVLIRLCSEGEEEPDSDGF  153

Query  375   EAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDT  554
                ++    SEG     L+ CPLC  DI+DLN+E RQ+HTN C+D+ +A  + VL + D 
Sbjct  154   RFREQRGSGSEGR---GLVRCPLCEIDISDLNDELRQVHTNGCLDRLEA--DNVLRNGDR  208

Query  555   SFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDL  734
               Q      D SP +T QK+V   PV+ W+  LGL +YEE FI++EIDWDTLQ LTEEDL
Sbjct  209   ECQFPQPFNDGSPVQTHQKVVDVSPVIGWIHSLGLGRYEEAFIREEIDWDTLQRLTEEDL  268

Query  735   CKIGVSALGPRKKIVHALSELRK--------------------ENTKEVEFQKNAKKAVV  854
               IGV+ALGPRK+IVHALSELRK                    ++T  VE + +A KA V
Sbjct  269   LNIGVTALGPRKRIVHALSELRKGSTHTVDIHTHVPALSELRKQSTHGVEIEADASKATV  328

Query  855   DDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKS--VKKNPAKSTKY  1028
             D+TSK+  +KLITDYF  S     +    S G+ +    +   S++   V KN A+S K 
Sbjct  329   DETSKLAANKLITDYFPGSVTDRSR-GCISSGERKAAEKIQLGSSRKQVVVKNHARSGKL  387

Query  1029  KDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKL  1208
             +D+P+WC IPGTPFRVDAF+YLRRDCSHWFLTHFH DHYQGLTRSFCHGKIYCS++TA+L
Sbjct  388   RDLPLWCCIPGTPFRVDAFRYLRRDCSHWFLTHFHLDHYQGLTRSFCHGKIYCSAITARL  447

Query  1209  VNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             VNMKIGIPWD +QILPLNQ+INI G+DVTC DANHCPG+IIILFEPSNG
Sbjct  448   VNMKIGIPWDRLQILPLNQKINIDGVDVTCLDANHCPGSIIILFEPSNG  496


 Score =   382 bits (980),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/225 (80%), Positives = 198/225 (88%), Gaps = 0/225 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF +EM  +   Q C IHTLILDTTYCNPQYDFPKQ+AVIQFVI+AIQAEAF
Sbjct  498   AVLHTGDFRFSEEMTSMSVLQMCPIHTLILDTTYCNPQYDFPKQEAVIQFVIDAIQAEAF  557

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTLFLIGSYTIGKERLF+E+AR L KK+YV AAKL IL+CL F  EDMQ+FTLNE ES
Sbjct  558   NPRTLFLIGSYTIGKERLFLEVARVLRKKVYVNAAKLHILECLEFQKEDMQWFTLNEQES  617

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKRL  ISNQY GR+SLIVA SPTGW+ GKGKKKTPG+RWQQGTIIRY
Sbjct  618   HIHVVPMWTLASFKRLKHISNQYAGRFSLIVAFSPTGWTFGKGKKKTPGRRWQQGTIIRY  677

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
             EVPYSEHSSF+EL++FVKF+SP NIIPSVNNHG ES   M+ LLS
Sbjct  678   EVPYSEHSSFTELREFVKFVSPVNIIPSVNNHGSESVDTMVRLLS  722



>emb|CDP17885.1| unnamed protein product [Coffea canephora]
Length=749

 Score =   410 bits (1053),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 206/357 (58%), Positives = 259/357 (73%), Gaps = 17/357 (5%)
 Frame = +3

Query  321   DMLLKLCSEGSEGDDDSMEAYQEDDCASEGND------------DSSLICCPLCGRDITD  464
             D+LLKLC   S+ D +  E      C+ +G D            D  LICCPLCG DI+ 
Sbjct  169   DLLLKLCDADSDQDVECSEKVS--TCSDDGLDFREACGFEEEEVDERLICCPLCGNDISG  226

Query  465   LNEEQRQIHTNECIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWL  644
             L++E RQ+HTNEC+DK +   E  L +++ +   +  VLD SP ++ +K+VA  PV+EWL
Sbjct  227   LSDELRQVHTNECLDKGETANEN-LRNQEKATHIVPFVLDGSPRQSSRKVVAAFPVLEWL  285

Query  645   RKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVE  824
               LGLAKYEE+F+++EIDWDTL+ LTEEDLC IGV+ALGPRKK+VHAL+EL++     VE
Sbjct  286   HNLGLAKYEEIFVREEIDWDTLKRLTEEDLCSIGVTALGPRKKLVHALAELKRHEGNPVE  345

Query  825   FQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSV-K  1001
                + +  VVD+ +K+  +KLITDYF  S A  K+   ++  Q E  +S   S+++S  K
Sbjct  346   -TPDIQNVVVDERNKLATNKLITDYFPGSVARRKRDCISAKEQKETLKSHPSSASRSQQK  404

Query  1002  KNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKI  1181
             KN   + K+K +P WC IPGTPFRVDAFKYLRR+CSHWFLTHFH DHYQGLTRSFCHGKI
Sbjct  405   KNRINNVKHKTVPTWCCIPGTPFRVDAFKYLRRECSHWFLTHFHMDHYQGLTRSFCHGKI  464

Query  1182  YCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSN  1352
             YCSS+TAKLVNMK+GI WD +Q+LPLNQ+INIAGI VTCFDANHCPGAIIILFEP N
Sbjct  465   YCSSITAKLVNMKLGISWDKLQVLPLNQKINIAGIAVTCFDANHCPGAIIILFEPPN  521


 Score =   386 bits (991),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 181/224 (81%), Positives = 202/224 (90%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF +EM +IP  Q C IHTLILDTTYC+PQYDFPKQ+AVIQFVIEAIQAEAF
Sbjct  524   AVLHTGDFRFGEEMAKIPILQTCPIHTLILDTTYCDPQYDFPKQEAVIQFVIEAIQAEAF  583

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+EIAR L KK+YV+AAKLR+L+CL FP ED Q+FTLNE ES
Sbjct  584   NPKTLFLIGSYTIGKERLFLEIARVLRKKVYVSAAKLRLLECLEFPKEDAQWFTLNEHES  643

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKRL  I+NQY GR++LIVA SPTGW+  KGKKK+PG+RWQQGTIIRY
Sbjct  644   HIHVVPMWTLASFKRLKYIANQYAGRFNLIVAFSPTGWTFSKGKKKSPGRRWQQGTIIRY  703

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEH SFSEL+ FVKFISPANIIPSVNNHGPESTR M+S L
Sbjct  704   EVPYSEHCSFSELRDFVKFISPANIIPSVNNHGPESTRTMVSHL  747



>ref|XP_007012469.1| Sterile alpha motif domain-containing protein isoform 2 [Theobroma 
cacao]
 gb|EOY30088.1| Sterile alpha motif domain-containing protein isoform 2 [Theobroma 
cacao]
Length=745

 Score =   409 bits (1050),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 225/470 (48%), Positives = 297/470 (63%), Gaps = 56/470 (12%)
 Frame = +3

Query  18    DMDLNIGLDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCAS  197
             D+D    LD IPS+I+CS             FN+    ++   +++ D            
Sbjct  81    DLDETCSLDLIPSSINCS-------------FNLTSAQDRDSDYVKCDE----------K  117

Query  198   EKSVLEPKKGYFVNSIESRLLkssagleegkgeelgesselDMLLKLCSEGSEGDDDSME  377
             +K +LE  KGY  NSIESRL++  + L E  GE+  E +ELD LLKLC++        +E
Sbjct  118   KKELLELNKGYLCNSIESRLIRPRSELSEEFGEDFDEDNELDALLKLCND--------VE  169

Query  378   AYQEDDCASEGND---DSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVL--S  542
               +E+D   E      D+SL+ CPLCG +I+ LNEE R +H N+C+DK + P + V+   
Sbjct  170   EEKEEDSGDEKESNVLDNSLVQCPLCGVNISGLNEEHRLVHINDCLDKVENPGQNVVFPP  229

Query  543   HRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLT  722
               D  FQC+ +V+D  P  +P+++V   PVV+WL  LGLA+Y + F+++E+DWDTL+WLT
Sbjct  230   SVDREFQCVPEVVDGPPL-SPRQVVDVSPVVKWLSNLGLARYADAFVREEVDWDTLKWLT  288

Query  723   EEDLCKIGVSALGPRKKIVHALSELRKE-------------------NTKEVEFQKNAKK  845
             EEDL  IGV+ALGPRKKIVHALSELRK                     +   + Q     
Sbjct  289   EEDLFSIGVTALGPRKKIVHALSELRKSYSCAAERHMGHPSHGNGSAKSSRAKTQTEISN  348

Query  846   AVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTK  1025
              + D+T+K   +KLITD+F    +  KKV     GQ+   +S      + V+ N  K+ K
Sbjct  349   FIDDETTKPAANKLITDFFPGLVSDRKKVCTPPRGQHISSKSHSDPGRRRVQTNHVKNGK  408

Query  1026  YKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
              KDIP WC IPGTPFRVDAFKYLR DCSHWFLTHFH DHYQGLTRSF HGKIYCSS+TA+
Sbjct  409   LKDIPAWCCIPGTPFRVDAFKYLRGDCSHWFLTHFHMDHYQGLTRSFRHGKIYCSSITAQ  468

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             LVN+K+GIPW+ +Q+LPLNQ+INIAGI++TC DANHCPG+I+ILF P NG
Sbjct  469   LVNVKLGIPWEKLQVLPLNQKINIAGIEITCLDANHCPGSIMILFVPPNG  518


 Score =   379 bits (974),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 175/224 (78%), Positives = 200/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRFC+EM  +  +  C IHTLILDTTYCNPQYDFPKQ+AVIQFVIEAIQAEAF
Sbjct  520   AVLHTGDFRFCEEMASMSLWHACPIHTLILDTTYCNPQYDFPKQEAVIQFVIEAIQAEAF  579

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +K+Y+TAAK R+L CLGF +EDM++FTLNE ES
Sbjct  580   NPKTLFLIGSYTIGKERLFLEVARVLRRKVYITAAKFRLLDCLGFSEEDMRWFTLNEQES  639

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
              IHVVP+WTLA+FKRL  ISNQY GR+SLIVA SPTGW+LGKGKKK PG+RWQQGTIIRY
Sbjct  640   QIHVVPMWTLASFKRLKHISNQYAGRFSLIVAFSPTGWALGKGKKKAPGRRWQQGTIIRY  699

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEH SF+ELK+FVK +SP NIIPSVNN GP+ST+ M+SLL
Sbjct  700   EVPYSEHCSFTELKEFVKILSPENIIPSVNNDGPDSTKAMISLL  743



>gb|KDP34006.1| hypothetical protein JCGZ_07577 [Jatropha curcas]
Length=760

 Score =   400 bits (1027),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 230/483 (48%), Positives = 292/483 (60%), Gaps = 85/483 (18%)
 Frame = +3

Query  30    NIGLDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCAS--EK  203
             N  LD I S+IDCS                          I  D++ + +SF   S   K
Sbjct  95    NCSLDLIESSIDCSNKN-----------------------INEDANFQEKSFETGSNKRK  131

Query  204   SVLEPKKGYFVNSIESRLLkssagleegkgeelgesse-----------lDMLLKLCSEG  350
               LE   GY  NSIE+RL++S +          G +             LD+L+KLC+  
Sbjct  132   EGLEMNTGYLCNSIEARLMRSVSDTGLNPVGHSGLNEADGLEDLDEDGQLDLLIKLCT--  189

Query  351   SEGDDDSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAE  530
                 DD+ E  +  +   EG     L  CPLCG DI+DL+EE R +HTN+C+DKE+   E
Sbjct  190   ----DDANEGNKVANGVDEG---GCLAQCPLCGIDISDLSEESRLVHTNDCLDKEEKNVE  242

Query  531   AVL---SHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDW  701
              ++   ++R+T F  + Q +D     +P+++V   PV++WL+ LGL +YEE FIQ+EIDW
Sbjct  243   EIVPARNNRETHF--VPQAVD-DLIHSPRQVVDVSPVLKWLQNLGLERYEEAFIQEEIDW  299

Query  702   DTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKE--------------------NTKEV  821
             D+L+WLTEEDL  IGV+ALGPRKKIVHAL ELR+                     + +E 
Sbjct  300   DSLKWLTEEDLVSIGVTALGPRKKIVHALGELRRGCNLMTETYRETRASTEVGSWSIREG  359

Query  822   EFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVK  1001
             E Q  A K V +DTSK   +KLITDYF+ S    KK+   S  +   G         SV+
Sbjct  360   EMQVEASKVVEEDTSKSTTNKLITDYFRGSVTARKKICTISAEKRNPG---------SVR  410

Query  1002  KNPAK-----STKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSF  1166
             K+ AK     + K KDIP+WC+IPGT FRVDAFKYLR DCSHWFLTHFH DHYQGLTRSF
Sbjct  411   KHKAKNCSVRNRKLKDIPLWCTIPGTSFRVDAFKYLRGDCSHWFLTHFHMDHYQGLTRSF  470

Query  1167  CHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEP  1346
             CHGKIYCS +TA+LVNMK+GIPWD +Q+LPLNQRI+IAG+DVTC DANHCPG+IIILFEP
Sbjct  471   CHGKIYCSLITARLVNMKLGIPWDKLQVLPLNQRISIAGVDVTCLDANHCPGSIIILFEP  530

Query  1347  SNG  1355
              NG
Sbjct  531   PNG  533


 Score =   379 bits (974),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/224 (78%), Positives = 199/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRFC+ M  + + Q C+IHTLILDTTYCNPQYDFPKQ+AVIQFVIEAIQAE+F
Sbjct  535   AVLHTGDFRFCENMASVTALQICRIHTLILDTTYCNPQYDFPKQEAVIQFVIEAIQAESF  594

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTLFLIGSYTIGKERLF+E+AR L +K+YVTAAK R+L+CLG+  EDMQ+FTLNE ES
Sbjct  595   NPRTLFLIGSYTIGKERLFLEVARLLHRKVYVTAAKFRLLECLGYSKEDMQWFTLNEQES  654

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
              IHVVP+WTLA+FKRL  ISNQY+ R+SLIVA SPTGW+ GKGKKK+PG+RWQQGTIIRY
Sbjct  655   QIHVVPMWTLASFKRLKHISNQYVDRFSLIVAFSPTGWTFGKGKKKSPGRRWQQGTIIRY  714

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEH SFSEL++FVKF+SP  IIPSVNN GPES   M+SLL
Sbjct  715   EVPYSEHCSFSELREFVKFVSPEKIIPSVNNDGPESADTMVSLL  758



>ref|XP_008452797.1| PREDICTED: DNA cross-link repair protein SNM1 [Cucumis melo]
Length=774

 Score =   384 bits (986),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/225 (78%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRFC++M  +  FQ C+IHTLILDTTYC+PQYDFPKQ+ VIQFVI+AIQAEAF
Sbjct  549   AVLHTGDFRFCEQMGSLSVFQTCRIHTLILDTTYCDPQYDFPKQETVIQFVIDAIQAEAF  608

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIG YTIGKERLF+E+AR L KK+YVTA+KLRIL+CLGF  EDM++FT+NE ES
Sbjct  609   NPKTLFLIGCYTIGKERLFLEVARVLRKKVYVTASKLRILKCLGFSAEDMKWFTVNERES  668

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVPLWTLA+FKRL  +S QY  R+SLIVA SPTGW+L KGKKK+PG+RWQQGTIIRY
Sbjct  669   HIHVVPLWTLASFKRLKHVSTQYADRFSLIVAFSPTGWALSKGKKKSPGRRWQQGTIIRY  728

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
             EVPYSEHSSFSELK FVK +SP NIIPSVNNHGP+S R M SLLS
Sbjct  729   EVPYSEHSSFSELKDFVKLVSPVNIIPSVNNHGPDSARAMTSLLS  773


 Score =   380 bits (975),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 223/474 (47%), Positives = 286/474 (60%), Gaps = 57/474 (12%)
 Frame = +3

Query  18    DMDLNIGLDSI-PSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCA  194
             D+DL   LD I PS + CSY        E    N  E+       ++ D D    +  C 
Sbjct  103   DIDLGCSLDLIQPSIVGCSY--------ETHDVNSGEE------IVDGDDDFSGATDECK  148

Query  195   SEKSVLEPKKGYFVNSIESRLLkss---------agleegkgeelgesselDMLLKLCSE  347
               K     K GY VNSIESRL+ S          +G ++  G+     +ELD+LL L SE
Sbjct  149   GSKE----KGGYLVNSIESRLVNSRVDCDVGVSGSGDDKVSGDGFESDTELDLLLNLHSE  204

Query  348   GSEGDDDSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPA  527
               E D  + E +   +      D+  LI CPLCG DI+DL++EQR +HTN+CIDK DA A
Sbjct  205   LDEEDGINGEGFGI-EATDFLVDEEGLIQCPLCGVDISDLSDEQRLVHTNDCIDKVDAQA  263

Query  528   E-AVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWD  704
             + A L+H              S +R          V++WL  L L+KYE+LF+++EIDWD
Sbjct  264   QNAALTHDKKQ---------TSGSRQSDNNSKFSTVLKWLHDLDLSKYEDLFVREEIDWD  314

Query  705   TLQWLTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNA---------------  839
             TLQWLT+EDL  +G++ALGPR+KI HALSELRKE++  VE   N+               
Sbjct  315   TLQWLTDEDLNNMGITALGPRRKITHALSELRKESST-VETSTNSLASSSTGQQSNNGSD  373

Query  840   -KKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKS-VKKNPA  1013
              ++   + T+K   +KLITDYF   A         S GQ +VG+ +  S NK    K   
Sbjct  374   GREGSTNGTNKTPPNKLITDYFPGFATNKNNPCGISSGQKDVGKKIPGSLNKGKTAKRNV  433

Query  1014  KSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSS  1193
             ++ K  ++PVW  IPGTPFRVDAF++LR DC HWFLTHFH DHYQGLT+SFCHG IYCS 
Sbjct  434   RNGKLGNVPVWSCIPGTPFRVDAFRHLRGDCFHWFLTHFHMDHYQGLTKSFCHGMIYCSP  493

Query  1194  VTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             +TAKLVNMKIGIPW+ +Q+LPL+Q+INIAG+DVTCFDANHCPG+IIILFEP NG
Sbjct  494   ITAKLVNMKIGIPWERLQVLPLDQKINIAGVDVTCFDANHCPGSIIILFEPPNG  547



>ref|XP_006474528.1| PREDICTED: DNA cross-link repair 1A protein-like [Citrus sinensis]
Length=728

 Score =   403 bits (1035),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 230/466 (49%), Positives = 286/466 (61%), Gaps = 64/466 (14%)
 Frame = +3

Query  24    DLNIGLDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEK  203
             D    L++IPS+IDC+ P +        C +V                  + S  C   K
Sbjct  78    DETCSLEAIPSSIDCTRPTA--------CVDV------------------DHSPECEEIK  111

Query  204   SVLEPKKGYFVNSIESRLLkssag--leegkgeelgesselDMLLKLCSEGSEGDDDSME  377
              +L+  +GY  NS+ESRLL+  A       + EE  E +ELD+LLKLC            
Sbjct  112   EILKVNEGYLRNSVESRLLRPRAADCSLSEESEEEEEDAELDVLLKLC------------  159

Query  378   AYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDTS  557
                ++D      D+S  + CPLCG DI+DLNEE RQ HTN C+DK +  A+ V+  R   
Sbjct  160   --DKNDVNCNKIDES--VRCPLCGIDISDLNEELRQAHTNNCLDKCENQAQDVVFPRHER  215

Query  558   FQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLC  737
                L   +D    R+PQK V   PVVE+L  LGLA+YEE F+++EIDWDTLQWLTEEDL 
Sbjct  216   GPRLEPEIDLGLGRSPQKAVDVSPVVEFLHSLGLARYEEAFVREEIDWDTLQWLTEEDLI  275

Query  738   KIGVSALGPRKKIVHALSELRKENTKEVEFQKNA-------------------KKAVVDD  860
              IGV+ALGPRKKI+H L E++KE ++ VE  K+A                    K +VD 
Sbjct  276   GIGVTALGPRKKILHTLCEIKKEYSRAVESNKDAHVSNDGSSSYHGSERHKEASKVIVDG  335

Query  861   TSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKS-VKKNPAKSTKYKDI  1037
             +SK   +KLITD+F  S    KKV   + GQ+   +S   S  K    K+ +K  K+KDI
Sbjct  336   SSKPAANKLITDFFLGSITNVKKVSTPTNGQSGSRKSFSGSDRKKHAAKDQSKGRKHKDI  395

Query  1038  PVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNM  1217
             P WC +PGTPFRVDAFKYLR DCSHWFLTHFH DHYQGLTRSF HGKIYCS +TA+LVNM
Sbjct  396   PTWCCVPGTPFRVDAFKYLRGDCSHWFLTHFHMDHYQGLTRSFHHGKIYCSLITARLVNM  455

Query  1218  KIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             KIGIPWD +Q+LPLNQ+  IAGIDVTC +ANHCPG+IIILFEP NG
Sbjct  456   KIGIPWDRLQVLPLNQKTTIAGIDVTCLEANHCPGSIIILFEPQNG  501


 Score =   360 bits (925),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 193/224 (86%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF +EM  +   Q C IHTLILDTTYCNP YDFPKQ+AVIQFVIEAIQAE+F
Sbjct  503   AVLHTGDFRFSEEMASMSVLQTCPIHTLILDTTYCNPLYDFPKQEAVIQFVIEAIQAESF  562

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L KKIYV AAK R+L+CL F  ED+Q+FT NE ES
Sbjct  563   NPKTLFLIGSYTIGKERLFLEVARVLRKKIYVNAAKFRVLKCLDFSKEDIQWFTTNEHES  622

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHV+P+WTLA+FKRL  +SNQY GR+SLIVA SPTGW+  KGKKK+PG+RWQQGTIIRY
Sbjct  623   HIHVMPMWTLASFKRLKHMSNQYAGRFSLIVAFSPTGWTFSKGKKKSPGRRWQQGTIIRY  682

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEH SF+ELK+FVKF+SP +IIPSVNN G +S   M+SLL
Sbjct  683   EVPYSEHCSFTELKEFVKFVSPEHIIPSVNNDGRDSANAMVSLL  726



>ref|XP_008351944.1| PREDICTED: DNA cross-link repair protein SNM1-like [Malus domestica]
Length=722

 Score =   398 bits (1022),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 221/455 (49%), Positives = 282/455 (62%), Gaps = 65/455 (14%)
 Frame = +3

Query  39    LDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKSVLEP  218
             LDSIP++ DC   G+LD                 G  + + S       +C  E+  L+ 
Sbjct  85    LDSIPASFDC---GTLD-----------------GGGLASSS-------ACVDEEKGLKS  117

Query  219   KKGYFVNSIESRLLkssag-leegkgeelgesselDMLLKLCSEGSEGDDDSMEAYQEDD  395
             K GY  NSIESRL+K            E  +  ELD+LLKLC     G+   +   +E  
Sbjct  118   KGGYLCNSIESRLIKPRPDWDFGSGDGESQDFEELDVLLKLCDRAEGGESVGVNGMEEGF  177

Query  396   CASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAE-AVLSHRDTSFQCLG  572
                E ++++ L+ CPLCG DI+DL++E+RQ+H+NEC+DKE+   + A     +   Q  G
Sbjct  178   GIVE-DENAGLVLCPLCGADISDLSDEERQVHSNECLDKEEVQTQDAPRPDEEREHQNSG  236

Query  573   QVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVS  752
             QVL                  EWL  LGL KY+++F+++EIDWDTLQWLTEEDL  IG++
Sbjct  237   QVL------------------EWLGSLGLEKYKDVFVREEIDWDTLQWLTEEDLFSIGIT  278

Query  753   ALGPRKKIVHALSELR----------------KENTKEVEFQKNAKKAVVDDTSKVKLSK  884
             ALGP+KKIVHAL++LR                K+    V+   +A +A V+D SK   +K
Sbjct  279   ALGPQKKIVHALAQLREGATTTTTSSTEAQPRKKRANGVDMPNDASEAPVNDVSKTAANK  338

Query  885   LITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNK-SVKKNPAKSTKYKDIPVWCSIPG  1061
             LITDYF       K+V  TS  Q  V + +  S  K  V  N A + K +DIP WC IPG
Sbjct  339   LITDYFPGFGTARKQVCTTSREQQRVEKRVSGSGQKRGVANNNATNRKLRDIPSWCCIPG  398

Query  1062  TPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDN  1241
             TPFRVDAFKYLRRDCSHWFLTHFH DHYQGLT+SFCHGKIYCSS+TAKLVNMKIGIPWD+
Sbjct  399   TPFRVDAFKYLRRDCSHWFLTHFHMDHYQGLTKSFCHGKIYCSSITAKLVNMKIGIPWDS  458

Query  1242  IQILPLNQRINIAGIDVTCFDANHCPGAIIILFEP  1346
             IQ++P+NQ++NIAGI+VTC DANHCPG+IIILFEP
Sbjct  459   IQVVPVNQKMNIAGINVTCLDANHCPGSIIILFEP  493


 Score =   365 bits (938),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/225 (76%), Positives = 194/225 (86%), Gaps = 1/225 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFR+ D    +   Q C IHTLILDTTYCNPQYDFPKQ+AVIQFVI+AIQAE F
Sbjct  498   AVLHTGDFRYSDSAASMSFLQACSIHTLILDTTYCNPQYDFPKQEAVIQFVIDAIQAETF  557

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L KKIYV A KL  L+CL FP+EDMQ+FTLNE ES
Sbjct  558   NPKTLFLIGSYTIGKERLFLEVARVLRKKIYVNAGKLHTLKCLDFPEEDMQWFTLNEQES  617

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKRL  ISNQY GR+SLIVA SPTGW+ GKG KK+PG+R QQGT+IRY
Sbjct  618   HIHVVPMWTLASFKRLKHISNQYSGRFSLIVAFSPTGWTFGKG-KKSPGRRSQQGTVIRY  676

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
             EVPYSEHSSF+ELK+FVK +SP  IIPSVNNHGP+S + M+SLLS
Sbjct  677   EVPYSEHSSFTELKEFVKLVSPVEIIPSVNNHGPDSAKAMVSLLS  721



>ref|XP_004157409.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101218609 
[Cucumis sativus]
Length=774

 Score =   384 bits (987),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 200/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRFC++M  +  FQ C+IHTL+LDTTYC+PQYDFPKQ+ VIQFVI+AIQAEAF
Sbjct  548   AVLHTGDFRFCEQMGGLSVFQTCRIHTLVLDTTYCDPQYDFPKQETVIQFVIDAIQAEAF  607

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIG YTIGKERLF+E+AR L KK+YVTAAKLRIL+CLGF  EDM++FT+NE ES
Sbjct  608   NPKTLFLIGCYTIGKERLFLEVARVLRKKVYVTAAKLRILKCLGFSAEDMKWFTVNERES  667

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVPLWTLA+FKRL  +S QY  R+SLIVA SPTGW+L KGKKK+PG+RWQQGTIIRY
Sbjct  668   HIHVVPLWTLASFKRLKHVSTQYANRFSLIVAFSPTGWALSKGKKKSPGRRWQQGTIIRY  727

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSFSELK FVK +SPANIIPSVNNHGP+S R M SLL
Sbjct  728   EVPYSEHSSFSELKDFVKLVSPANIIPSVNNHGPDSARAMTSLL  771


 Score =   377 bits (967),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 216/472 (46%), Positives = 285/472 (60%), Gaps = 54/472 (11%)
 Frame = +3

Query  18    DMDLNIGLDSI-PSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCA  194
             D+DL   LD I PS + CSY    +  + +    +++ ++K    I+           C 
Sbjct  103   DIDLGCSLDLIQPSIVGCSY----ETHDVNSGEEIVDGDDKFSGAID----------ECK  148

Query  195   SEKSVLEPKKGYFVNSIESRLLkssagleegkgeel---------gesselDMLLKLCSE  347
               K     K GY VNSIESRL+ S    + G                 +ELD+LL L SE
Sbjct  149   GSKG----KGGYLVNSIESRLVNSRVDYDIGVSGSGDDKVSGDDFESDTELDLLLNLHSE  204

Query  348   GSEGDDDSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPA  527
               E D  + E +   +      D+  LI CPLCG DI+DL++EQR +HTN+CIDK DA A
Sbjct  205   LDEEDGINREGFGI-EATDFMLDEEGLIQCPLCGVDISDLSDEQRLVHTNDCIDKVDAEA  263

Query  528   EAVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDT  707
             + V    D       +  D S   T         V++WL  LGL+KYE LF+++E+DWDT
Sbjct  264   QNVALTPDKKQTSGPRQSDNSKFST---------VLKWLHDLGLSKYEGLFVREEVDWDT  314

Query  708   LQWLTEEDLCKIGVSALGPRKKIVHALSELRKENT---------------KEVEFQKNAK  842
             LQWLT+EDL  +G++ALGPR+KI HALSELRKE++               ++     + +
Sbjct  315   LQWLTDEDLNNMGITALGPRRKITHALSELRKESSLVETSTNSRAYSSTGQQSNNGSDGR  374

Query  843   KAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKS-VKKNPAKS  1019
             +   + T+K   +KLITDYF   A   K   ++S  Q +VG+ +  S NK    K   ++
Sbjct  375   EGSTNGTNKTPPNKLITDYFPGFATNXKNPCSSSSVQKDVGKKIPDSLNKGKTAKRNVRN  434

Query  1020  TKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVT  1199
              K  ++PVW  IPGTPFRVDAF++LR DC HWFLTHFH DHYQGLT+SFCHG IYCS++T
Sbjct  435   RKLGNVPVWSCIPGTPFRVDAFRHLRGDCFHWFLTHFHMDHYQGLTKSFCHGMIYCSTIT  494

Query  1200  AKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             AKLVNMKIGIPW+ +Q+LPL+Q+INIAG+DVTCFDANHCPG+IIILFEP NG
Sbjct  495   AKLVNMKIGIPWERLQVLPLDQKINIAGVDVTCFDANHCPGSIIILFEPPNG  546



>ref|XP_007012468.1| Sterile alpha motif domain-containing protein isoform 1 [Theobroma 
cacao]
 gb|EOY30087.1| Sterile alpha motif domain-containing protein isoform 1 [Theobroma 
cacao]
Length=838

 Score =   406 bits (1044),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 225/470 (48%), Positives = 297/470 (63%), Gaps = 56/470 (12%)
 Frame = +3

Query  18    DMDLNIGLDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCAS  197
             D+D    LD IPS+I+CS             FN+    ++   +++ D            
Sbjct  81    DLDETCSLDLIPSSINCS-------------FNLTSAQDRDSDYVKCDE----------K  117

Query  198   EKSVLEPKKGYFVNSIESRLLkssagleegkgeelgesselDMLLKLCSEGSEGDDDSME  377
             +K +LE  KGY  NSIESRL++  + L E  GE+  E +ELD LLKLC++        +E
Sbjct  118   KKELLELNKGYLCNSIESRLIRPRSELSEEFGEDFDEDNELDALLKLCND--------VE  169

Query  378   AYQEDDCASEGND---DSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVL--S  542
               +E+D   E      D+SL+ CPLCG +I+ LNEE R +H N+C+DK + P + V+   
Sbjct  170   EEKEEDSGDEKESNVLDNSLVQCPLCGVNISGLNEEHRLVHINDCLDKVENPGQNVVFPP  229

Query  543   HRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLT  722
               D  FQC+ +V+D  P  +P+++V   PVV+WL  LGLA+Y + F+++E+DWDTL+WLT
Sbjct  230   SVDREFQCVPEVVDGPPL-SPRQVVDVSPVVKWLSNLGLARYADAFVREEVDWDTLKWLT  288

Query  723   EEDLCKIGVSALGPRKKIVHALSELRKE-------------------NTKEVEFQKNAKK  845
             EEDL  IGV+ALGPRKKIVHALSELRK                     +   + Q     
Sbjct  289   EEDLFSIGVTALGPRKKIVHALSELRKSYSCAAERHMGHPSHGNGSAKSSRAKTQTEISN  348

Query  846   AVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTK  1025
              + D+T+K   +KLITD+F    +  KKV     GQ+   +S      + V+ N  K+ K
Sbjct  349   FIDDETTKPAANKLITDFFPGLVSDRKKVCTPPRGQHISSKSHSDPGRRRVQTNHVKNGK  408

Query  1026  YKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
              KDIP WC IPGTPFRVDAFKYLR DCSHWFLTHFH DHYQGLTRSF HGKIYCSS+TA+
Sbjct  409   LKDIPAWCCIPGTPFRVDAFKYLRGDCSHWFLTHFHMDHYQGLTRSFRHGKIYCSSITAQ  468

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             LVN+K+GIPW+ +Q+LPLNQ+INIAGI++TC DANHCPG+I+ILF P NG
Sbjct  469   LVNVKLGIPWEKLQVLPLNQKINIAGIEITCLDANHCPGSIMILFVPPNG  518


 Score =   354 bits (909),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRFC+EM  +  +  C IHTLILDTTYCNPQYDFPKQ+AVIQFVIEAIQAEAF
Sbjct  520   AVLHTGDFRFCEEMASMSLWHACPIHTLILDTTYCNPQYDFPKQEAVIQFVIEAIQAEAF  579

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +K+Y+TAAK R+L CLGF +EDM++FTLNE ES
Sbjct  580   NPKTLFLIGSYTIGKERLFLEVARVLRRKVYITAAKFRLLDCLGFSEEDMRWFTLNEQES  639

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
              IHVVP+WTLA+FKRL  ISNQY GR+SLIVA SPTGW+LGKGKKK PG+RWQQGTIIRY
Sbjct  640   QIHVVPMWTLASFKRLKHISNQYAGRFSLIVAFSPTGWALGKGKKKAPGRRWQQGTIIRY  699

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPS  1977
             EVPYSEH SF+ELK+FVK +SP NIIPS
Sbjct  700   EVPYSEHCSFTELKEFVKILSPENIIPS  727



>ref|XP_004141439.1| PREDICTED: uncharacterized protein LOC101218609 [Cucumis sativus]
 gb|KGN55391.1| hypothetical protein Csa_4G649610 [Cucumis sativus]
Length=774

 Score =   384 bits (987),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 200/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRFC++M  +  FQ C+IHTL+LDTTYC+PQYDFPKQ+ VIQFVI+AIQAEAF
Sbjct  548   AVLHTGDFRFCEQMGGLSVFQTCRIHTLVLDTTYCDPQYDFPKQETVIQFVIDAIQAEAF  607

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIG YTIGKERLF+E+AR L KK+YVTAAKLRIL+CLGF  EDM++FT+NE ES
Sbjct  608   NPKTLFLIGCYTIGKERLFLEVARVLRKKVYVTAAKLRILKCLGFSAEDMKWFTVNERES  667

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVPLWTLA+FKRL  +S QY  R+SLIVA SPTGW+L KGKKK+PG+RWQQGTIIRY
Sbjct  668   HIHVVPLWTLASFKRLKHVSTQYANRFSLIVAFSPTGWALSKGKKKSPGRRWQQGTIIRY  727

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSFSELK FVK +SPANIIPSVNNHGP+S R M SLL
Sbjct  728   EVPYSEHSSFSELKDFVKLVSPANIIPSVNNHGPDSARAMTSLL  771


 Score =   377 bits (967),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 216/472 (46%), Positives = 285/472 (60%), Gaps = 54/472 (11%)
 Frame = +3

Query  18    DMDLNIGLDSI-PSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCA  194
             D+DL   LD I PS + CSY    +  + +    +++ ++K    I+           C 
Sbjct  103   DIDLGCSLDLIQPSIVGCSY----ETHDVNSGEEIVDGDDKFSGAID----------ECK  148

Query  195   SEKSVLEPKKGYFVNSIESRLLkssagleegkgeel---------gesselDMLLKLCSE  347
               K     K GY VNSIESRL+ S    + G                 +ELD+LL L SE
Sbjct  149   GSKG----KGGYLVNSIESRLVNSRVDYDIGVSGSGDDKVSGDDFESDTELDLLLNLHSE  204

Query  348   GSEGDDDSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPA  527
               E D  + E +   +      D+  LI CPLCG DI+DL++EQR +HTN+CIDK DA A
Sbjct  205   LDEEDGINREGFGI-EATDFMLDEEGLIQCPLCGVDISDLSDEQRLVHTNDCIDKVDAEA  263

Query  528   EAVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDT  707
             + V    D       +  D S   T         V++WL  LGL+KYE LF+++E+DWDT
Sbjct  264   QNVALTPDKKQTSGPRQSDNSKFST---------VLKWLHDLGLSKYEGLFVREEVDWDT  314

Query  708   LQWLTEEDLCKIGVSALGPRKKIVHALSELRKENT---------------KEVEFQKNAK  842
             LQWLT+EDL  +G++ALGPR+KI HALSELRKE++               ++     + +
Sbjct  315   LQWLTDEDLNNMGITALGPRRKITHALSELRKESSLVETSTNSRAYSSTGQQSNNGSDGR  374

Query  843   KAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKS-VKKNPAKS  1019
             +   + T+K   +KLITDYF   A   K   ++S  Q +VG+ +  S NK    K   ++
Sbjct  375   EGSTNGTNKTPPNKLITDYFPGFATNKKNPCSSSSVQKDVGKKIPDSLNKGKTAKRNVRN  434

Query  1020  TKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVT  1199
              K  ++PVW  IPGTPFRVDAF++LR DC HWFLTHFH DHYQGLT+SFCHG IYCS++T
Sbjct  435   RKLGNVPVWSCIPGTPFRVDAFRHLRGDCFHWFLTHFHMDHYQGLTKSFCHGMIYCSTIT  494

Query  1200  AKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             AKLVNMKIGIPW+ +Q+LPL+Q+INIAG+DVTCFDANHCPG+IIILFEP NG
Sbjct  495   AKLVNMKIGIPWERLQVLPLDQKINIAGVDVTCFDANHCPGSIIILFEPPNG  546



>ref|XP_009363003.1| PREDICTED: DNA cross-link repair protein SNM1 [Pyrus x bretschneideri]
Length=727

 Score =   395 bits (1014),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 220/462 (48%), Positives = 281/462 (61%), Gaps = 68/462 (15%)
 Frame = +3

Query  39    LDSIPSTIDCSYPGSLD----PKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKS  206
             LDSIP+  DC   G+LD          C +  ++NEK                       
Sbjct  84    LDSIPTNFDC---GTLDGGGLASSSSACVDEEKENEKG----------------------  118

Query  207   VLEPKKGYFVNSIESRLLkssag-leegkgeelgesselDMLLKLCSEGSEGDDDSMEAY  383
              L+ K GY  NSIESRL+K            E  +  ELD+LLKLC+    G+   +   
Sbjct  119   -LKSKGGYLCNSIESRLIKPRPDWDFGSGDGESQDFEELDVLLKLCNRAGGGESVGVNGM  177

Query  384   QEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAE-AVLSHRDTSF  560
             ++     E +++  L+ CPLCG DI+DL+ E+RQ+H+NEC+D+E+  A+ A     +   
Sbjct  178   EKGFGIVE-DENGGLVLCPLCGADISDLSNEERQVHSNECLDEEEVQAQDAPCPDEERGH  236

Query  561   QCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCK  740
             Q  G VL                  EWLR LGL KY+++F+++EIDWDTLQWLTEEDL  
Sbjct  237   QNSGHVL------------------EWLRSLGLEKYKDVFVREEIDWDTLQWLTEEDLFS  278

Query  741   IGVSALGPRKKIVHALSELR----------------KENTKEVEFQKNAKKAVVDDTSKV  872
             IG++ALGPRKKIVHAL++LR                K     V+   +A +A V+D SK 
Sbjct  279   IGITALGPRKKIVHALAQLREGATTTTSSSTEAQPRKRRANGVDMPNDASEAPVNDVSKT  338

Query  873   KLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNK-SVKKNPAKSTKYKDIPVWC  1049
               +KLITDYF       K+V  TS  Q  V + +  S  K  V+ N A + K +DIP WC
Sbjct  339   AANKLITDYFPGFGTARKQVCTTSREQRRVEKRVPRSGQKRGVENNNATNRKLRDIPSWC  398

Query  1050  SIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGI  1229
              IPGTPFRVDAFKYLRRDCSHWFLTHFH DHYQGLT+SFCHGKIYCSS+TAKLVNMKIGI
Sbjct  399   CIPGTPFRVDAFKYLRRDCSHWFLTHFHMDHYQGLTKSFCHGKIYCSSITAKLVNMKIGI  458

Query  1230  PWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             PWD+IQ++P+N ++NI+GI+VTC DANHCPG+IIILFEP +G
Sbjct  459   PWDSIQVVPVNHKMNISGINVTCLDANHCPGSIIILFEPPDG  500


 Score =   365 bits (937),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 194/225 (86%), Gaps = 0/225 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFR+ +    +   Q C IHTLILDTTYCNPQYDFPKQ+AVIQFVI+AIQAE F
Sbjct  502   AVLHTGDFRYSNSAASMSFLQTCSIHTLILDTTYCNPQYDFPKQEAVIQFVIDAIQAETF  561

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L KKIYV A KL  L+CL FP+EDMQ+FTLNE ES
Sbjct  562   NPKTLFLIGSYTIGKERLFLEVARVLRKKIYVNAGKLHTLKCLDFPEEDMQWFTLNEQES  621

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKRL  ISNQY  R+SLIVA SPTGW+ GKGKKK+PG+R QQGT+IRY
Sbjct  622   HIHVVPMWTLASFKRLKHISNQYSSRFSLIVAFSPTGWTFGKGKKKSPGRRSQQGTVIRY  681

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
             EVPYSEHSSF+EL++FVK +SP  IIPSVNNHGP+S + M+SLLS
Sbjct  682   EVPYSEHSSFTELREFVKLVSPVEIIPSVNNHGPDSAKAMVSLLS  726



>ref|XP_011019313.1| PREDICTED: DNA cross-link repair protein SNM1 isoform X1 [Populus 
euphratica]
Length=739

 Score =   391 bits (1005),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 231/471 (49%), Positives = 285/471 (61%), Gaps = 61/471 (13%)
 Frame = +3

Query  18    DMDLNIGLDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESF-SCA  194
             ++D N  LD I S+IDC+                   + KVG          NE F S +
Sbjct  78    NLDENCSLDFIESSIDCTV------------------SSKVG----------NEKFDSGS  109

Query  195   SEKSVLEPKKGYFVNSIESRLLkssagleegkgeelg---esselDMLLKLCSEGSEGDD  365
              +K  LE   GY  NSIE+RL+KS                E+  LD L++LC+E  E   
Sbjct  110   GKKEKLEVSGGYLCNSIEARLMKSRVDYSGVSVGNEEDCEENRGLDALIQLCTEEEE---  166

Query  366   DSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKE-DAPAEAVLS  542
                    + +C     D+   + CPLCG DI+DL+EE R +HTNEC+DKE ++  + VL 
Sbjct  167   SEAREKIKVNC---NGDECCFVLCPLCGTDISDLSEEFRLVHTNECLDKEENSVPDVVLG  223

Query  543   HRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLT  722
               D   + + + ++  P   P+K V   PV +WLR LGL +YEE F+++EIDW+TLQWLT
Sbjct  224   GDDGRPEVVPRGVEG-PVCGPKK-VDVSPVAKWLRNLGLERYEEDFVREEIDWETLQWLT  281

Query  723   EEDLCKIGVSALGPRKKIVHALSELRKENTKEV--------------------EFQKNAK  842
             EEDL  IGV+ALGPRKKIVHAL ELRK + + +                    E Q  A 
Sbjct  282   EEDLFGIGVTALGPRKKIVHALGELRKGSNRAIKAHGDAHASGEVGSSRSHGAEMQVEAS  341

Query  843   KAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKST  1022
             K + DDTSK   +KLITDYF  S    KK   +S  Q    +S     +K   KN  K  
Sbjct  342   KIIGDDTSKPTANKLITDYFPGSVPIKKKTCVSSKEQRGAEKSQPGYVHKQRVKNNTKKG  401

Query  1023  KYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTA  1202
             K KDIP+WCS+PGTPFRVDAFKYLR DCSHWFLTHFH DHYQGLTRSFCHGKIYCS +TA
Sbjct  402   KLKDIPLWCSVPGTPFRVDAFKYLRGDCSHWFLTHFHMDHYQGLTRSFCHGKIYCSLITA  461

Query  1203  KLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             KLVN+KIGIPWD+I +LPLNQ+I IAG+DVTC DANHCPG+IIILFEP NG
Sbjct  462   KLVNLKIGIPWDSIHVLPLNQKICIAGVDVTCLDANHCPGSIIILFEPPNG  512


 Score =   364 bits (935),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 195/224 (87%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF + M+ +P  Q   IHTLILDTTYCN QYDFPKQ+AVIQFVIEAIQAEAF
Sbjct  514   AVLHTGDFRFSENMVTMPVLQMSSIHTLILDTTYCNAQYDFPKQEAVIQFVIEAIQAEAF  573

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTLFLIGSYTIGKERLF+E+AR L KK+YV  AK R+L+CLGFP+EDM + TLNE ES
Sbjct  574   NPRTLFLIGSYTIGKERLFLEVARVLHKKVYVNMAKFRLLECLGFPEEDMTWITLNEQES  633

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKRL  +S+QY GR++LIVA SPTGW+ GKGKKK+PG+R QQGTIIRY
Sbjct  634   HIHVVPMWTLASFKRLKHLSSQYAGRFTLIVAFSPTGWTFGKGKKKSPGRRCQQGTIIRY  693

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEH SF+EL++FVKF+SP NIIPSVNN GP+S   M+SLL
Sbjct  694   EVPYSEHCSFTELREFVKFVSPENIIPSVNNDGPDSANDMVSLL  737



>gb|KHG06389.1| DNA cross-link repair 1A [Gossypium arboreum]
Length=753

 Score =   394 bits (1013),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/474 (49%), Positives = 294/474 (62%), Gaps = 52/474 (11%)
 Frame = +3

Query  9     ELEDMDLNIGLDSIPSTIDCSYPG-SLDPKEED--KCFNVIEQNEKVGVFIEADSDTKNE  179
             +L D+    GLD IPS+ID S+   S   KE D  KC                  + K E
Sbjct  80    DLPDLHDICGLDLIPSSIDSSFDSTSAQNKESDTGKC-----------------DEKKME  122

Query  180   SFSCASEKSVLEPKKGYFVNSIESRLLkssagleegkgeelgesselDMLLKLCSEGSEG  359
             S         LE  KGY  NS+E RL++  + L EG  E   E  ELD LLKLC E  E 
Sbjct  123   S---------LELTKGYMCNSVEWRLIRPISELSEGFREVCEEDEELDELLKLCDEVEEK  173

Query  360   DDDSMEAYQEDDCASEGN-DDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAV  536
             ++ S E  +++   +E N +D+  + CPLCG DIT+LNEEQR +HTN C+DK + P   V
Sbjct  174   EEVSREEEEDNGVENERNGEDNGSVPCPLCGVDITNLNEEQRLVHTNGCLDKVENPPPRV  233

Query  537   LSHR--DTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTL  710
             + H   D+      +V+D  P  +P+++V   PVV WL  LGLAKY   F+++E+DWDTL
Sbjct  234   VVHSSVDSELHSFPEVVDG-PLSSPRQVVDVSPVVNWLSGLGLAKYAAAFVREEVDWDTL  292

Query  711   QWLTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVE-------------------FQK  833
             +WLTEEDL  IGV+ALGPRKKIVHALSELRKE  +  E                    Q 
Sbjct  293   KWLTEEDLFSIGVTALGPRKKIVHALSELRKEGLRAAEPHMDHPRHEKGSAKSNKRKMQT  352

Query  834   NAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPA  1013
                    D+T+K   +KLITDYF    +  KKV   + GQ+   +    S  + V+KN  
Sbjct  353   ELSNVADDETTKPAANKLITDYFPGYVSDRKKVCTPTRGQDRSDKGQSSSGRRPVQKNNV  412

Query  1014  KSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSS  1193
             K+ K KDIP WC IPGTPFRVDAFKYLR DCSHWFLTHFH DHYQGLT+SF HGKIYCSS
Sbjct  413   KNGKPKDIPSWCCIPGTPFRVDAFKYLRGDCSHWFLTHFHMDHYQGLTKSFRHGKIYCSS  472

Query  1194  VTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             +TA+LVN+K+GIPW  +Q+LPLN++INI+GI +TC DANHCPG+I+ILFEP NG
Sbjct  473   ITARLVNLKLGIPWAMLQVLPLNEKINISGIYITCLDANHCPGSIMILFEPPNG  526


 Score =   357 bits (917),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 194/224 (87%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             A+LHTGDFR+ +EM  +     C IHTLILDTTYCNPQYDFPKQ AVIQFVIEAIQAEAF
Sbjct  528   AILHTGDFRYSEEMGGLSLLHACPIHTLILDTTYCNPQYDFPKQVAVIQFVIEAIQAEAF  587

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +K+Y+TAAKLR+L+CLGF +EDMQ+FT N+ ES
Sbjct  588   NPKTLFLIGSYTIGKERLFLEVARVLRRKVYITAAKLRLLECLGFSEEDMQWFTSNDQES  647

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
              IHVVP+WTLA+FKRL  ISN Y  R++L+VA SPTGW+  KGKKK+PG+RWQQGTIIRY
Sbjct  648   QIHVVPMWTLASFKRLKHISNHYARRFNLVVAFSPTGWTFVKGKKKSPGRRWQQGTIIRY  707

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+EL++FVK +SP NIIPSVNN GP+S + M+S L
Sbjct  708   EVPYSEHSSFTELREFVKLVSPENIIPSVNNEGPDSAKAMISHL  751



>ref|XP_002516164.1| DNA cross-link repair protein pso2/snm1, putative [Ricinus communis]
 gb|EEF46166.1| DNA cross-link repair protein pso2/snm1, putative [Ricinus communis]
Length=737

 Score =   385 bits (988),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 222/464 (48%), Positives = 280/464 (60%), Gaps = 67/464 (14%)
 Frame = +3

Query  39    LDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKSVLEP  218
             LD I S+IDCSY                       V  + D+D          E+ +   
Sbjct  89    LDLIESSIDCSY---------------------RSVHGDGDNDV-----DFVKEEGLEVK  122

Query  219   KKGYFVNSIESRLLkssagleegkgeelgesse-lDMLLKLCSEGSEGDDDSMEAYQEDD  395
             KKGY  NSIES+L++S      G      E    LD+L+KLC++            + + 
Sbjct  123   KKGYLCNSIESKLIRSGVSDSVGDEFGDFEEDSDLDLLIKLCTD------------EMNQ  170

Query  396   CASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVL-SHRDTSFQCLG  572
               S   D   L+ CPLCG DI++L+EE R +HTN+C+DK+D   + V     D       
Sbjct  171   VPSGVADGDCLVQCPLCGIDISNLSEESRLVHTNDCLDKQDNHLQEVTCGSNDEGTHFAP  230

Query  573   QVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVS  752
             QV+  S      K+V   PV++WLR LGL +Y + FI++EIDWD+L+WLTEEDL  IGV+
Sbjct  231   QVVGDSG----HKVVDVSPVLQWLRNLGLERYGDAFIREEIDWDSLKWLTEEDLFSIGVT  286

Query  753   ALGPRKKIVHALSELRKE--------------------NTKEVEFQKNAKKAVVDDTSKV  872
             ALGPRKKIVHAL+ELRK                     +T   E Q  A K   D+TSK 
Sbjct  287   ALGPRKKIVHALAELRKGCNLVDETHRDPNASADVGSLSTHAAEMQMEASKVSGDETSKQ  346

Query  873   KLSKLITDYFQCSAAGTKKVHATSCGQNEVG--RSLMYSSNKSVKKN-PAKSTKYKDIPV  1043
               +KLITDYF  S + T +    S  + + G  ++   S +K + KN P K+ K KDIP+
Sbjct  347   TANKLITDYFPGSVSVTVREKGCSIAKEKRGPAKNRPDSVHKRMAKNHPVKNGKLKDIPL  406

Query  1044  WCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKI  1223
             WCSIPGTPFRVDAFKYLR DCSHWFLTHFH DHYQGLTRSFCHGKIYCS +TA+LVNMKI
Sbjct  407   WCSIPGTPFRVDAFKYLRGDCSHWFLTHFHMDHYQGLTRSFCHGKIYCSLITARLVNMKI  466

Query  1224  GIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             GIPWD +Q+LPLN++I+IAG+DVTC DANHCPG+II+LFEP NG
Sbjct  467   GIPWDRLQVLPLNKKISIAGVDVTCLDANHCPGSIIVLFEPPNG  510


 Score =   365 bits (938),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/224 (75%), Positives = 195/224 (87%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRFC+ M  + + Q C+IHTLILDTTYCNPQYDFPKQ+AVIQFVIEAIQAE+F
Sbjct  512   AVLHTGDFRFCENMASMTALQMCRIHTLILDTTYCNPQYDFPKQEAVIQFVIEAIQAESF  571

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +K+YVTAAK R+L+ LGF  E MQ+FTLNE ES
Sbjct  572   NPKTLFLIGSYTIGKERLFLEVARVLRRKVYVTAAKFRLLESLGFSKEAMQWFTLNEHES  631

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
              IHVVP+WTLA+FKRL  ISNQY  R+S IV+ SPTGW+ GKGKKK+PG+RWQQGTIIRY
Sbjct  632   QIHVVPMWTLASFKRLKHISNQYASRFSPIVSFSPTGWTFGKGKKKSPGRRWQQGTIIRY  691

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEH SF+EL++FVKF+SP  IIPSVNN GPES   M+SLL
Sbjct  692   EVPYSEHCSFTELREFVKFVSPEKIIPSVNNDGPESVDTMVSLL  735



>gb|EYU21966.1| hypothetical protein MIMGU_mgv1a0253331mg, partial [Erythranthe 
guttata]
Length=529

 Score =   384 bits (986),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 184/304 (61%), Positives = 231/304 (76%), Gaps = 5/304 (2%)
 Frame = +3

Query  456   ITDLNEEQRQIHTNECIDKEDAPAEAVL--SHRDT-SFQCLGQVLDASPARTPQKLVARP  626
             I+ L+++QRQIHTNEC+D  +  A   +  S+ DT + Q  G V+D SP ++  K     
Sbjct  1     ISGLSDDQRQIHTNECLDSVEGSANVAVAVSNDDTRTHQGPGHVVDGSPLKSATKAGNLS  60

Query  627   PVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKE  806
              VVEWLR LGLAKYEE+F+ QEIDW+ LQWLTEEDLC IG++ LGPRKKI+HA+ EL  +
Sbjct  61    SVVEWLRNLGLAKYEEIFVSQEIDWEALQWLTEEDLCSIGITTLGPRKKILHAIKELSND  120

Query  807   NTKEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSS  986
             +T  VE + +  K V D+T K +  KLITDYF    +  K+    + GQ+ V ++   S+
Sbjct  121   STTTVEPKADVSKVVADET-KFETKKLITDYFSGPPSERKRGGVATNGQSSVRKNQANST  179

Query  987   NKSVKKN-PAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRS  1163
             +KSV++N   ++ K K++PVWC +PGTPFRVDAFKYLRRDCSHWFL+HFH DHYQGLT+S
Sbjct  180   HKSVQRNDRLRNGKQKNVPVWCCVPGTPFRVDAFKYLRRDCSHWFLSHFHLDHYQGLTKS  239

Query  1164  FCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFE  1343
             FCHG IYCSS+TAKLVN+KIGIP+D IQ+LPLNQ+INIAG DVTCFDANHCPGAIIILFE
Sbjct  240   FCHGTIYCSSITAKLVNLKIGIPFDKIQVLPLNQKINIAGTDVTCFDANHCPGAIIILFE  299

Query  1344  PSNG  1355
             P NG
Sbjct  300   PPNG  303


 Score =   365 bits (938),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/223 (76%), Positives = 193/223 (87%), Gaps = 1/223 (0%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAFN  1536
             VLHTGDFRFC+EM ++   Q C IHTLILDTTYC  QYDFPKQ+ VIQFVI+AIQAEAFN
Sbjct  306   VLHTGDFRFCEEMAQLSVLQACSIHTLILDTTYCESQYDFPKQETVIQFVIDAIQAEAFN  365

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             PRTLFLIGSYTIGKERLF+E+AR L KK+YVTA KLRIL+CLG P EDMQ+FT NE +SH
Sbjct  366   PRTLFLIGSYTIGKERLFLEVARTLRKKVYVTAPKLRILECLGLPREDMQWFTTNEQDSH  425

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRYE  1896
             IHVVP+WT+ANFKRL  +S+QY  R++LIVA SPTGWS GKGKK T GKRWQ+GT+IRYE
Sbjct  426   IHVVPMWTIANFKRLKHVSDQYTRRFNLIVAFSPTGWSFGKGKKST-GKRWQKGTVIRYE  484

Query  1897  VPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             VPYSEHSSF+ELK+FVK ISP NIIPSVNNHGP+S   M+S L
Sbjct  485   VPYSEHSSFTELKEFVKLISPVNIIPSVNNHGPDSHSAMVSQL  527



>ref|XP_008792888.1| PREDICTED: uncharacterized protein LOC103709368 [Phoenix dactylifera]
Length=777

 Score =   377 bits (969),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 190/350 (54%), Positives = 237/350 (68%), Gaps = 22/350 (6%)
 Frame = +3

Query  327   LLKLCSE-GSEGDDDSMEAYQEDDCASEGNDD---SSLICCPLCGRDITDLNEEQRQIHT  494
             L+ LC E G EG+ +      E++    G      S ++ CPLCG DITD+++E RQ HT
Sbjct  214   LMNLCCEMGEEGNSNGGVTLSEENDVGVGTPKLQWSGIMECPLCGLDITDMSKEMRQAHT  273

Query  495   NECIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEE  674
              +C+DK++    AV  H   S               PQK+V   PV+EWLR LGL++YEE
Sbjct  274   YKCLDKDENLEVAVPIHEINS-------------NLPQKVVDVSPVLEWLRNLGLSRYEE  320

Query  675   LFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNAKKAVV  854
              F++QEIDW+TLQWLTEEDL  IG+ ALGPRKKIVHALSELRK        +K+   A  
Sbjct  321   FFVRQEIDWETLQWLTEEDLLSIGIVALGPRKKIVHALSELRKRTDHAHVIEKDISSAAA  380

Query  855   DDTSKVKLS--KLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKST-K  1025
                S++ +S  KLIT+YF  S A   +V +     N  G+    S++KSV+     S  K
Sbjct  381   YKNSRLSISGNKLITEYFHGSVAHRNRVCSLKKPLN--GKGNKDSASKSVRAGSCVSKGK  438

Query  1026  YKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
              +DIP WC IPGTPFRVDAF+YLR DCSHWFLTHFH DHYQGLTR+FCHGKIYCSS+TA 
Sbjct  439   VRDIPPWCCIPGTPFRVDAFRYLRGDCSHWFLTHFHMDHYQGLTRNFCHGKIYCSSITAH  498

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             LVNMK+G+PWD + ILPLNQ+I +AG+++TCFDANHCPG+IIILFEP NG
Sbjct  499   LVNMKLGVPWDRLHILPLNQKITVAGVNLTCFDANHCPGSIIILFEPPNG  548


 Score =   372 bits (954),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 197/224 (88%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF  EM      Q C++HTLILDTTYCNPQYDFPKQ+AVIQFVIEAIQAEAF
Sbjct  550   AVLHTGDFRFSTEMASNSVLQSCRVHTLILDTTYCNPQYDFPKQEAVIQFVIEAIQAEAF  609

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L KK+YV  AKLR+L+CLGF +EDMQ+FT NE+ES
Sbjct  610   NPKTLFLIGSYTIGKERLFLEVARLLRKKVYVGVAKLRLLRCLGFAEEDMQWFTANEMES  669

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKR+  ISNQY GR+ LIVA SP+GW+ GKG+KKTPG+RWQQGT+IRY
Sbjct  670   HIHVVPMWTLASFKRMKYISNQYSGRFDLIVAFSPSGWAFGKGRKKTPGRRWQQGTVIRY  729

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEH SF+EL++FV+F+SP +IIPSVNN GPES   M++LL
Sbjct  730   EVPYSEHCSFTELREFVQFVSPEHIIPSVNNDGPESADAMIALL  773



>ref|XP_002309453.1| sterile alpha motif domain-containing family protein [Populus 
trichocarpa]
 gb|EEE92976.1| sterile alpha motif domain-containing family protein [Populus 
trichocarpa]
Length=740

 Score =   385 bits (988),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/481 (49%), Positives = 280/481 (58%), Gaps = 81/481 (17%)
 Frame = +3

Query  18    DMDLNIGLDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESF-SCA  194
             ++D N  LD I S+IDC+                   + KVG          NE F S +
Sbjct  79    NLDENCSLDFIESSIDCTV------------------SSKVG----------NEKFDSGS  110

Query  195   SEKSVLEPKKGYFVNSIESRLLkssagleegkgeelg---esselDMLLKLCSEGSEGDD  365
              +K  LE   GY  NSIE+RL+KS                E+SELD L+KLC+E  E   
Sbjct  111   GKKEKLEVSGGYLCNSIEARLMKSRVDYSGVNVGNEEDFEENSELDALIKLCTEEEE---  167

Query  366   DSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSH  545
                    + +C     D+   + CPLCG DI+DL+EE R +HTNEC+DKE+     V+  
Sbjct  168   SEAREKIKVNC---NGDECCFVLCPLCGTDISDLSEEFRLVHTNECLDKEENSVTYVVLG  224

Query  546   RDTSFQCLGQVLDASPARTPQKLVARPPV-----------VEWLRKLGLAKYEELFIQQE  692
              D          D  P   P+ +    PV           V+WLR LGL +YEE F+++E
Sbjct  225   GD----------DGRPEVVPRGVEG--PVCGPKKVVVSPVVKWLRNLGLERYEEDFVREE  272

Query  693   IDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVE----------------  824
             IDW+TLQWLTEEDL  IGV+ALGPRKKIVHALSELRK +   +E                
Sbjct  273   IDWETLQWLTEEDLFGIGVTALGPRKKIVHALSELRKGSNHAIEAHGDAHAFGEVGSRRS  332

Query  825   ----FQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNK  992
                  Q  A K + DDTSK   +KLITDYF  S    KK    S  Q    +S      K
Sbjct  333   HGAEMQVEASKIIGDDTSKPTANKLITDYFPGSVPIKKKTSVISKEQRGAEKSQPGYVRK  392

Query  993   SVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCH  1172
                KN  K  K+KDIP+WCSIPGTPFRVDAFKYLR DCSHWFLTHFH DHYQGLTRSFCH
Sbjct  393   QGVKNYTKKGKFKDIPLWCSIPGTPFRVDAFKYLRGDCSHWFLTHFHMDHYQGLTRSFCH  452

Query  1173  GKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSN  1352
             GKIYCS +TAKLVN+KIGIPWD++ +LPLNQ+I IAG+DVTC DANHCPG+IIILFEP N
Sbjct  453   GKIYCSLITAKLVNLKIGIPWDSLHVLPLNQKICIAGVDVTCLDANHCPGSIIILFEPPN  512

Query  1353  G  1355
             G
Sbjct  513   G  513


 Score =   364 bits (934),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 197/224 (88%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF ++M+ +P  Q   IHTLILDTTYCN QYDFPKQ+AVIQFVIEAIQAEAF
Sbjct  515   AVLHTGDFRFSEKMVTMPVLQMSSIHTLILDTTYCNAQYDFPKQEAVIQFVIEAIQAEAF  574

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L KK+YV  AK R+L+CLGFP+EDM++ TLNE ES
Sbjct  575   NPKTLFLIGSYTIGKERLFLEVARVLHKKVYVNMAKFRLLECLGFPEEDMRWITLNEQES  634

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKRL  +S+QY GR++LIVA SPTGW+ GKGKKK+PG+R QQGTIIRY
Sbjct  635   HIHVVPMWTLASFKRLKHLSSQYAGRFTLIVAFSPTGWTFGKGKKKSPGRRCQQGTIIRY  694

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEH SF+EL++FVKF+SP NIIPSVNN GP+S   M+SLL
Sbjct  695   EVPYSEHCSFTELREFVKFVSPENIIPSVNNDGPDSANDMVSLL  738



>ref|XP_007012471.1| Sterile alpha motif domain-containing protein isoform 4 [Theobroma 
cacao]
 gb|EOY30090.1| Sterile alpha motif domain-containing protein isoform 4 [Theobroma 
cacao]
Length=727

 Score =   408 bits (1049),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 225/470 (48%), Positives = 297/470 (63%), Gaps = 56/470 (12%)
 Frame = +3

Query  18    DMDLNIGLDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCAS  197
             D+D    LD IPS+I+CS             FN+    ++   +++ D            
Sbjct  81    DLDETCSLDLIPSSINCS-------------FNLTSAQDRDSDYVKCDE----------K  117

Query  198   EKSVLEPKKGYFVNSIESRLLkssagleegkgeelgesselDMLLKLCSEGSEGDDDSME  377
             +K +LE  KGY  NSIESRL++  + L E  GE+  E +ELD LLKLC++        +E
Sbjct  118   KKELLELNKGYLCNSIESRLIRPRSELSEEFGEDFDEDNELDALLKLCND--------VE  169

Query  378   AYQEDDCASEGND---DSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVL--S  542
               +E+D   E      D+SL+ CPLCG +I+ LNEE R +H N+C+DK + P + V+   
Sbjct  170   EEKEEDSGDEKESNVLDNSLVQCPLCGVNISGLNEEHRLVHINDCLDKVENPGQNVVFPP  229

Query  543   HRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLT  722
               D  FQC+ +V+D  P  +P+++V   PVV+WL  LGLA+Y + F+++E+DWDTL+WLT
Sbjct  230   SVDREFQCVPEVVDGPPL-SPRQVVDVSPVVKWLSNLGLARYADAFVREEVDWDTLKWLT  288

Query  723   EEDLCKIGVSALGPRKKIVHALSELRKE-------------------NTKEVEFQKNAKK  845
             EEDL  IGV+ALGPRKKIVHALSELRK                     +   + Q     
Sbjct  289   EEDLFSIGVTALGPRKKIVHALSELRKSYSCAAERHMGHPSHGNGSAKSSRAKTQTEISN  348

Query  846   AVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTK  1025
              + D+T+K   +KLITD+F    +  KKV     GQ+   +S      + V+ N  K+ K
Sbjct  349   FIDDETTKPAANKLITDFFPGLVSDRKKVCTPPRGQHISSKSHSDPGRRRVQTNHVKNGK  408

Query  1026  YKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
              KDIP WC IPGTPFRVDAFKYLR DCSHWFLTHFH DHYQGLTRSF HGKIYCSS+TA+
Sbjct  409   LKDIPAWCCIPGTPFRVDAFKYLRGDCSHWFLTHFHMDHYQGLTRSFRHGKIYCSSITAQ  468

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             LVN+K+GIPW+ +Q+LPLNQ+INIAGI++TC DANHCPG+I+ILF P NG
Sbjct  469   LVNVKLGIPWEKLQVLPLNQKINIAGIEITCLDANHCPGSIMILFVPPNG  518


 Score =   335 bits (860),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 183/224 (82%), Gaps = 18/224 (8%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRFC+EM  +  +  C IHTLILDTTYCNPQYDFPKQ+AVIQFVIEAIQAEAF
Sbjct  520   AVLHTGDFRFCEEMASMSLWHACPIHTLILDTTYCNPQYDFPKQEAVIQFVIEAIQAEAF  579

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +K+Y+TAAK R+L CLGF +EDM++FTLNE ES
Sbjct  580   NPKTLFLIGSYTIGKERLFLEVARVLRRKVYITAAKFRLLDCLGFSEEDMRWFTLNEQES  639

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
              IHVVP+WTLA+FKRL  ISNQY                   GKKK PG+RWQQGTIIRY
Sbjct  640   QIHVVPMWTLASFKRLKHISNQYA------------------GKKKAPGRRWQQGTIIRY  681

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEH SF+ELK+FVK +SP NIIPSVNN GP+ST+ M+SLL
Sbjct  682   EVPYSEHCSFTELKEFVKILSPENIIPSVNNDGPDSTKAMISLL  725



>ref|XP_004292890.1| PREDICTED: DNA cross-link repair protein SNM1-like [Fragaria 
vesca subsp. vesca]
Length=683

 Score =   381 bits (979),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 207/419 (49%), Positives = 264/419 (63%), Gaps = 54/419 (13%)
 Frame = +3

Query  165   DTKNESFSCAS-------EKSVLEPKKGYFVNSIESRLLkssagleegkgeelgesselD  323
             D+  ESF  A+       EK   +P+ GY  NSIESRL+K  A        E  +  E+D
Sbjct  66    DSLPESFDLAAADVTEENEKGFSKPEGGYLRNSIESRLIKPRASDWGFDSGEGEDFEEID  125

Query  324   MLLKLCSEGSEGDDDSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNEC  503
             +LL+L     EGD        ED+       +  L+ CPLCG DI++L  E+R++H+N+C
Sbjct  126   VLLRLNGVEEEGD-----GIVEDE-------NGGLVLCPLCGVDISELGNEERELHSNDC  173

Query  504   IDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFI  683
             +D+ +A             + +  V  A  AR   +      VVEWLR LGL KYEE+F+
Sbjct  174   LDRLEA-------------RPVDGVGIADEARASGR------VVEWLRGLGLGKYEEVFV  214

Query  684   QQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELR---------------KENTKE  818
             ++EIDWD LQWLTEEDL  IG++ LGPRKKIVHA+++LR               K +   
Sbjct  215   REEIDWDALQWLTEEDLLSIGITTLGPRKKIVHAIAQLREGISSGIEAQTAQQRKRSANG  274

Query  819   VEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNK-S  995
             V  + +A +  V D+SK   +KLITDYF       K V +TS  Q  V +    S  K +
Sbjct  275   VAVRSDALEGAVGDSSKSASNKLITDYFPGFGGARKPVSSTSREQPRVEKRQTGSGQKRA  334

Query  996   VKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHG  1175
             V KN   + K +D+P+WC +PGTPFRVDAFKYLRRDCSHWFLTHFH DHYQGLT+SF HG
Sbjct  335   VVKNHVTNRKLRDVPLWCCVPGTPFRVDAFKYLRRDCSHWFLTHFHMDHYQGLTKSFSHG  394

Query  1176  KIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSN  1352
             KI CSS+TAKLVNMK+GIPW++IQ++PLNQ+INIAGIDVTC DANHCPG+IIILFEP N
Sbjct  395   KIICSSITAKLVNMKLGIPWNSIQVVPLNQKINIAGIDVTCLDANHCPGSIIILFEPPN  453


 Score =   362 bits (928),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/227 (74%), Positives = 195/227 (86%), Gaps = 2/227 (1%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF ++   +   +   IHTLILDTTYCNPQYDFPKQ+AVIQFVI+AIQAE F
Sbjct  456   AVLHTGDFRFSEDAASMSVLRTSFIHTLILDTTYCNPQYDFPKQEAVIQFVIDAIQAETF  515

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERL++E+AR L KKIYVTA KL IL+CL FP+EDMQ+FTLNE ES
Sbjct  516   NPKTLFLIGSYTIGKERLYLEVARVLRKKIYVTAGKLHILKCLDFPEEDMQWFTLNEHES  575

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKK--TPGKRWQQGTII  1887
              IHVVP+WTLA+FKRL  +SNQY  RYSLIVA SPTGW+ GKGKKK  +PG+RWQQGTII
Sbjct  576   QIHVVPMWTLASFKRLKHVSNQYASRYSLIVAFSPTGWTFGKGKKKSQSPGRRWQQGTII  635

Query  1888  RYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
             RYEVPYSEHSSF+EL++FVK +SP  IIPSVNNHGP+S + M+ LLS
Sbjct  636   RYEVPYSEHSSFTELRQFVKLVSPEQIIPSVNNHGPDSAKSMICLLS  682



>ref|XP_010917472.1| PREDICTED: uncharacterized protein LOC105042070 [Elaeis guineensis]
Length=777

 Score =   371 bits (952),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 196/224 (88%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF  EM      Q C +HTLILDTTYCNPQYDFPKQ+AV QFVIEAIQAEAF
Sbjct  550   AVLHTGDFRFSAEMASNSVLQSCHVHTLILDTTYCNPQYDFPKQEAVTQFVIEAIQAEAF  609

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTLFLIGSYTIGKERLF+E+AR L KK+YV AAKLR+L+CLGFP+EDMQ+FT NE+ES
Sbjct  610   NPRTLFLIGSYTIGKERLFLEVARLLRKKVYVGAAKLRLLRCLGFPEEDMQWFTANEMES  669

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKR+  ISNQY  R+ LIVA SP+GW+ GKG+KKTPG+RWQQGTIIRY
Sbjct  670   HIHVVPMWTLASFKRMKYISNQYSDRFDLIVAFSPSGWAFGKGRKKTPGRRWQQGTIIRY  729

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEH SF+EL++FV+FI P +IIPSVNN+GPES   M++LL
Sbjct  730   EVPYSEHCSFTELREFVQFICPEHIIPSVNNNGPESVDAMIALL  773


 Score =   368 bits (945),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 187/350 (53%), Positives = 236/350 (67%), Gaps = 22/350 (6%)
 Frame = +3

Query  327   LLKLCSE-GSEGD-DDSMEAYQEDDCA--SEGNDDSSLICCPLCGRDITDLNEEQRQIHT  494
             L+ LC E G EG+ +D +   +E+D    +     + ++ CPLCG DITD++EE RQ HT
Sbjct  214   LMNLCCEMGEEGNSNDGVTLSEENDFGVRTPKLQWNGIMECPLCGSDITDMSEEMRQAHT  273

Query  495   NECIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEE  674
             N+C+DK++     V  H   S               PQK V   PV+EWLR LGL++YEE
Sbjct  274   NKCLDKDENLEVPVSIHEINS-------------NLPQKAVDVNPVLEWLRNLGLSRYEE  320

Query  675   LFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNAKKAVV  854
              F++QE+DW+TLQWLTEEDL  IG+ ALGPRKKIVHALSELRK        +K+   A  
Sbjct  321   FFMRQEVDWETLQWLTEEDLLGIGIVALGPRKKIVHALSELRKRTNHAHVIEKDISGAAA  380

Query  855   DDTSKVKL--SKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKST-K  1025
             +  S++ +  +KLIT+YFQ       +V   S  +   G+    S++KSV      S  K
Sbjct  381   NKNSRLSIPGNKLITEYFQGPVVDRNRV--CSLKKTLNGKGNKDSASKSVHTRSCMSKGK  438

Query  1026  YKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
              +DIP WC IPGTPFRVDAF+YLR DCSHWFLTHFH DHY GLTR+FCHGKIYCSS+TA 
Sbjct  439   ARDIPPWCCIPGTPFRVDAFRYLRGDCSHWFLTHFHIDHYGGLTRNFCHGKIYCSSITAH  498

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             LVNMKIG+PWD + ILPLNQ+I +A +++TCFDANHCPG+IIILFEP NG
Sbjct  499   LVNMKIGVPWDRLHILPLNQKITVASVNLTCFDANHCPGSIIILFEPPNG  548



>ref|XP_006452946.1| hypothetical protein CICLE_v10007634mg [Citrus clementina]
 gb|ESR66186.1| hypothetical protein CICLE_v10007634mg [Citrus clementina]
Length=700

 Score =   380 bits (977),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 221/466 (47%), Positives = 274/466 (59%), Gaps = 89/466 (19%)
 Frame = +3

Query  24    DLNIGLDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEK  203
             D    L++IPS+IDC+ P +        C ++                  + S  C   K
Sbjct  75    DETCSLEAIPSSIDCTRPTA--------CVDI------------------DHSPECEEIK  108

Query  204   SVLEPKKGYFVNSIESRLLkssag--leegkgeelgesselDMLLKLCSEGSEGDDDSME  377
              +L+  +GY  NS+ESRLL+  A       + EE  E + LD+LLKLC            
Sbjct  109   EILKVNEGYLRNSVESRLLRPRAADCRLSEESEEEEEDAVLDVLLKLC------------  156

Query  378   AYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDTS  557
                ++D      D+S  + CPLCG DI+DLNEE RQ HTN C+DK               
Sbjct  157   --DKNDVNCNKIDES--VRCPLCGIDISDLNEELRQAHTNNCLDK---------------  197

Query  558   FQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLC  737
               C  Q  D        K V   PVVE+L  LGLA+YEE F+++EIDWDTLQWLTEEDL 
Sbjct  198   --CENQAQD--------KAVDVSPVVEFLHSLGLARYEEAFVREEIDWDTLQWLTEEDLI  247

Query  738   KIGVSALGPRKKIVHALSELRKENTKEVEFQKNA-------------------KKAVVDD  860
              IGV+ALGPRKKI+H L E++KE ++ VE  K+A                    K ++D 
Sbjct  248   GIGVTALGPRKKILHTLCEIKKEYSRAVESNKDAHVSDGGSSSYHGSERHKEASKVIIDG  307

Query  861   TSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKS-VKKNPAKSTKYKDI  1037
             +SK   +KLITD+F  S    KKV   + GQ+   +S   S  K    K+ +K  K+KDI
Sbjct  308   SSKPAANKLITDFFLGSITNVKKVSTPTNGQSGSRKSFSGSGRKKHAAKDQSKGRKHKDI  367

Query  1038  PVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNM  1217
             P W  +PGTPFRVDAFKYLR DCSHWFLTHFH DHYQGLTRSF HGKIYCS +TA+LVNM
Sbjct  368   PTWYCVPGTPFRVDAFKYLRGDCSHWFLTHFHMDHYQGLTRSFHHGKIYCSLITARLVNM  427

Query  1218  KIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             KIGIPWD +Q+LPLNQ+  IAGIDVTC +ANHCPG+IIILFEP NG
Sbjct  428   KIGIPWDRLQVLPLNQKTTIAGIDVTCLEANHCPGSIIILFEPQNG  473


 Score =   356 bits (914),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 192/224 (86%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF +EM  +   Q C IHTLILDTTYCNP YDFPKQ+AVIQFVIEAIQAE+F
Sbjct  475   AVLHTGDFRFSEEMASMSVLQTCLIHTLILDTTYCNPLYDFPKQEAVIQFVIEAIQAESF  534

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L KKIYV AAK R+L+CL F  ED+Q+FT NE ES
Sbjct  535   NPKTLFLIGSYTIGKERLFLEVARVLRKKIYVNAAKFRVLKCLDFSKEDIQWFTTNEHES  594

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             +IHVVP+WTLA+FKRL  +SNQY GR+SLIVA SPTGW+  KGKKK+PG+RWQQGTIIRY
Sbjct  595   NIHVVPMWTLASFKRLKHMSNQYAGRFSLIVAFSPTGWTFSKGKKKSPGRRWQQGTIIRY  654

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEH SF+ELK+FVK +SP +IIPSVNN G +S   M+SLL
Sbjct  655   EVPYSEHCSFTELKEFVKSVSPEHIIPSVNNDGRDSANAMVSLL  698



>ref|XP_003603243.1| DNA cross-link repair 1A protein [Medicago truncatula]
 gb|AES73494.1| DNA cross-link repair protein pso2/SNM1, putative [Medicago truncatula]
Length=671

 Score =   370 bits (951),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 198/227 (87%), Gaps = 0/227 (0%)
 Frame = +1

Query  1348  PMAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAE  1527
             P  VLHTGDFR+ +EM   P  Q C IHTLILDTTYCNPQYDFPKQ+AVIQFVI+AIQAE
Sbjct  444   PPNVLHTGDFRYSEEMANNPLLQTCPIHTLILDTTYCNPQYDFPKQEAVIQFVIDAIQAE  503

Query  1528  AFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNEL  1707
             AFNPRTLFLIGSYTIGKERLF+E+AR+L +K+YVTAAKLR+L+CL F +EDMQ+FT NE 
Sbjct  504   AFNPRTLFLIGSYTIGKERLFLEVARSLHQKVYVTAAKLRLLKCLEFTEEDMQWFTSNEH  563

Query  1708  ESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTII  1887
             ES+IHV P+WTLA+FKRL  IS+QY  R+SLIVA SPTGW+ GKGKKK+PG+RWQQGTII
Sbjct  564   ESNIHVAPMWTLASFKRLKHISSQYASRFSLIVAFSPTGWTFGKGKKKSPGRRWQQGTII  623

Query  1888  RYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
             RYEVPYSEH SF+ELK+FV F+SP NIIPSVNN GPES   M+SL+S
Sbjct  624   RYEVPYSEHCSFTELKEFVNFVSPDNIIPSVNNDGPESADAMVSLMS  670


 Score =   361 bits (926),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 207/427 (48%), Positives = 247/427 (58%), Gaps = 80/427 (19%)
 Frame = +3

Query  147   FIEADSDTKNESFSCASEKSVLEPKKGYFVNSIESRLLkssagleegkgeelgesselDM  326
             F+ +  D+ +  FS    +     K+ YF NS+ESRL+ S                  D+
Sbjct  75    FVPSTLDSDSTVFSSPVSELKKSNKRDYFSNSLESRLVASRKNAF-------------DL  121

Query  327   LLKLCSE-GSEGDDDSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNEC  503
              + LC E GS  D                        CPLCG DI++L EEQR +HTN+C
Sbjct  122   EVNLCDEFGSSVD------------------------CPLCGVDISNLTEEQRNLHTNDC  157

Query  504   IDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFI  683
             +DK     E V    D          D      P+      PVVEW+R LGLAKYEE+F+
Sbjct  158   LDKS---GEDVAPPND----------DVGAQFGPKN----SPVVEWIRGLGLAKYEEVFV  200

Query  684   QQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELR--------------KENTKEV  821
             ++E+DWDTLQWLTEEDL  +G++ALGPRKKIVHALSELR              K    EV
Sbjct  201   REEVDWDTLQWLTEEDLLNMGITALGPRKKIVHALSELRRGITLGTTSSSSSEKHEDAEV  260

Query  822   E----------FQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRS  971
             E           Q +  +  VD T K   +KLIT+YF   A   KKV A    +NE   S
Sbjct  261   EPRRTRNQKSKMQHDKSERKVDGTVKPVANKLITEYFPGFATSGKKVSAPPVERNETNTS  320

Query  972   LMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQG  1151
                S  K   KN + STK +DIP WC+I GTPFRVDAFKYLR DCSHWFLTHFH DHYQG
Sbjct  321   -GSSDRKRKAKNISTSTKIRDIPKWCAIQGTPFRVDAFKYLRGDCSHWFLTHFHMDHYQG  379

Query  1152  LTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAII  1331
             LT+SF HGKIYCSSVTA+LVNM IGIP+D + ILPLNQ++ IAGI VTC DANHCPG+II
Sbjct  380   LTKSFNHGKIYCSSVTARLVNMNIGIPYDKLHILPLNQKVEIAGIGVTCLDANHCPGSII  439

Query  1332  ILFEPSN  1352
             ILFEP N
Sbjct  440   ILFEPPN  446



>ref|XP_004501410.1| PREDICTED: DNA cross-link repair protein SNM1-like [Cicer arietinum]
Length=676

 Score =   364 bits (934),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 170/225 (76%), Positives = 196/225 (87%), Gaps = 0/225 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFR+ +EM   P  + C IHTLILDTTYCNPQYDFPKQ+AVIQFVI+AIQAEAF
Sbjct  451   AVLHTGDFRYSEEMSNNPFLRICPIHTLILDTTYCNPQYDFPKQEAVIQFVIDAIQAEAF  510

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTLFLIGSYTIGKERLF+E+AR+L KK+YVTAAK RIL+CL F +EDMQ+FTLNE ES
Sbjct  511   NPRTLFLIGSYTIGKERLFLEVARSLRKKVYVTAAKYRILKCLEFTEEDMQWFTLNEHES  570

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             +IHV P+WTLA+FKRL  +S+QY  RYSL+VA SPTGW+ GKGKKK+PG+RWQQGTIIRY
Sbjct  571   NIHVAPMWTLASFKRLKYLSSQYASRYSLMVAFSPTGWTFGKGKKKSPGRRWQQGTIIRY  630

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
             EVPYSEH SF+ELK+ V  +SP NIIPSVNN GPES   M+SL+S
Sbjct  631   EVPYSEHCSFTELKELVNILSPNNIIPSVNNDGPESAAAMVSLMS  675


 Score =   356 bits (914),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 194/417 (47%), Positives = 249/417 (60%), Gaps = 66/417 (16%)
 Frame = +3

Query  159   DSDTKNESFSCASEKSVLEPKKGYFVNSIESRLLkssagleegkgeelgesselDMLLKL  338
             DSDT  ++   +  +   +  + YF NSIES+L+ S     +            D  + L
Sbjct  81    DSDTTVQTVCSSVSELKKKNTRTYFHNSIESKLVVSRTNAFDYAES--------DYEVNL  132

Query  339   CSEGSEGDDDSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKED  518
             C E                       DSS + CPLCG DI++L EE R +HTN C+DK +
Sbjct  133   CDEL----------------------DSS-VYCPLCGVDISNLTEEHRYLHTNHCLDKNE  169

Query  519   APAEAVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEID  698
                  VL + D + + + +                 PVV+WLR +GL KYEE+F+++E+D
Sbjct  170   E--NVVLPNDDVNAKFVSKA---------------SPVVDWLRDIGLDKYEEVFVREEVD  212

Query  699   WDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKE------------------NTKEVE  824
             W+TLQWLTEEDL  +G++ALGPRKKIVHALSELR+                     ++V+
Sbjct  213   WETLQWLTEEDLLNMGITALGPRKKIVHALSELRRGIDPSNEKPEDDVVEPRRIRNQKVK  272

Query  825   FQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKK  1004
              Q       +D T K   +KLIT+YF   A   KKV A    Q+E+  +   S  K   K
Sbjct  273   SQHGKSDRKIDGTVKPAANKLITEYFPGFATNGKKVSAPPGEQHEMKNNGSVSDRKRKAK  332

Query  1005  NPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIY  1184
             N + STK +D+P+WC+I GTPFRVDAFKYLR DCSHWFLTHFH DHYQGLT+SF HGKIY
Sbjct  333   NMSTSTKIRDVPIWCTIQGTPFRVDAFKYLRGDCSHWFLTHFHMDHYQGLTKSFNHGKIY  392

Query  1185  CSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             CSSVTA+LVNM IGIP++ + ILPLNQ++ IAGI VTC DANHCPGAII+LFEP NG
Sbjct  393   CSSVTARLVNMNIGIPYEKLHILPLNQKVEIAGIGVTCLDANHCPGAIIVLFEPPNG  449



>ref|XP_007012470.1| Sterile alpha motif domain-containing protein isoform 3 [Theobroma 
cacao]
 gb|EOY30089.1| Sterile alpha motif domain-containing protein isoform 3 [Theobroma 
cacao]
Length=703

 Score =   408 bits (1049),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 225/470 (48%), Positives = 297/470 (63%), Gaps = 56/470 (12%)
 Frame = +3

Query  18    DMDLNIGLDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCAS  197
             D+D    LD IPS+I+CS             FN+    ++   +++ D            
Sbjct  81    DLDETCSLDLIPSSINCS-------------FNLTSAQDRDSDYVKCDE----------K  117

Query  198   EKSVLEPKKGYFVNSIESRLLkssagleegkgeelgesselDMLLKLCSEGSEGDDDSME  377
             +K +LE  KGY  NSIESRL++  + L E  GE+  E +ELD LLKLC++        +E
Sbjct  118   KKELLELNKGYLCNSIESRLIRPRSELSEEFGEDFDEDNELDALLKLCND--------VE  169

Query  378   AYQEDDCASEGND---DSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVL--S  542
               +E+D   E      D+SL+ CPLCG +I+ LNEE R +H N+C+DK + P + V+   
Sbjct  170   EEKEEDSGDEKESNVLDNSLVQCPLCGVNISGLNEEHRLVHINDCLDKVENPGQNVVFPP  229

Query  543   HRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLT  722
               D  FQC+ +V+D  P  +P+++V   PVV+WL  LGLA+Y + F+++E+DWDTL+WLT
Sbjct  230   SVDREFQCVPEVVDGPPL-SPRQVVDVSPVVKWLSNLGLARYADAFVREEVDWDTLKWLT  288

Query  723   EEDLCKIGVSALGPRKKIVHALSELRKE-------------------NTKEVEFQKNAKK  845
             EEDL  IGV+ALGPRKKIVHALSELRK                     +   + Q     
Sbjct  289   EEDLFSIGVTALGPRKKIVHALSELRKSYSCAAERHMGHPSHGNGSAKSSRAKTQTEISN  348

Query  846   AVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTK  1025
              + D+T+K   +KLITD+F    +  KKV     GQ+   +S      + V+ N  K+ K
Sbjct  349   FIDDETTKPAANKLITDFFPGLVSDRKKVCTPPRGQHISSKSHSDPGRRRVQTNHVKNGK  408

Query  1026  YKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
              KDIP WC IPGTPFRVDAFKYLR DCSHWFLTHFH DHYQGLTRSF HGKIYCSS+TA+
Sbjct  409   LKDIPAWCCIPGTPFRVDAFKYLRGDCSHWFLTHFHMDHYQGLTRSFRHGKIYCSSITAQ  468

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             LVN+K+GIPW+ +Q+LPLNQ+INIAGI++TC DANHCPG+I+ILF P NG
Sbjct  469   LVNVKLGIPWEKLQVLPLNQKINIAGIEITCLDANHCPGSIMILFVPPNG  518


 Score =   308 bits (788),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRFC+EM  +  +  C IHTLILDTTYCNPQYDFPKQ+AVIQFVIEAIQAEAF
Sbjct  520   AVLHTGDFRFCEEMASMSLWHACPIHTLILDTTYCNPQYDFPKQEAVIQFVIEAIQAEAF  579

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +K+Y+TAAK R+L CLGF +EDM++FTLNE ES
Sbjct  580   NPKTLFLIGSYTIGKERLFLEVARVLRRKVYITAAKFRLLDCLGFSEEDMRWFTLNEQES  639

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIR  1890
              IHVVP+WTLA+FKRL  ISNQY GR+SLIVA SPTGW+LGKGKKK PG+RWQQGTIIR
Sbjct  640   QIHVVPMWTLASFKRLKHISNQYAGRFSLIVAFSPTGWALGKGKKKAPGRRWQQGTIIR  698



>ref|XP_010098394.1| DNA cross-link repair 1A protein [Morus notabilis]
 gb|EXB74918.1| DNA cross-link repair 1A protein [Morus notabilis]
Length=825

 Score =   380 bits (977),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/472 (50%), Positives = 281/472 (60%), Gaps = 84/472 (18%)
 Frame = +3

Query  39    LDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKSVLEP  218
             L+SIPS+ DC+              N     E V      D+  K++  S   EK  L  
Sbjct  168   LESIPSSFDCT--------------NATAPEEAV------DNVGKDDCCSSPPEKKELLN  207

Query  219   KK-GYFVNSIESRLLks------sagleegkgeelgesselDMLLKLCSEGSEGDDDSME  377
             K  GY  NSIESRL+KS       +G      E+  +  ELD LLKLCS           
Sbjct  208   KNWGYSRNSIESRLMKSWGDRGFGSGDGGSAVEDDEDEGELDELLKLCS-----------  256

Query  378   AYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDTS  557
             A +E+D      D+   + CPLCG DI+D++EEQR  HTN+C+DK D+PA+ V+  R+  
Sbjct  257   ALEEEDSL---GDNGGSVECPLCGVDISDVSEEQRHRHTNDCLDKGDSPAQDVIVPREEG  313

Query  558   FQCLGQVLDASPARTPQKLVARP-----PVVEWLRKLGLAKYEELFIQQEIDWDTLQWLT  722
                             +  V+RP      VVEWLR LGL KYE++F+++EI WDTLQWLT
Sbjct  314   ----------------EYRVSRPCGEVSGVVEWLRGLGLTKYEDIFVREEIVWDTLQWLT  357

Query  723   EEDLCKIGVSALGPRKKIVHALSELRK-------------------ENTKEVEFQKNAKK  845
             EEDL  IG++ALGPRKKIVHALS+LRK                     T  VE   +  +
Sbjct  358   EEDLFNIGITALGPRKKIVHALSQLRKGSIQAIEVPPPSNASSEHRRGTNGVEMPSDVSE  417

Query  846   AVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSV--KKNPAKS  1019
              V ++ SKV  +KLITDYF    +  KKV  T   Q  + +    S  K V  KK+  K 
Sbjct  418   RVTENASKVAANKLITDYFPGYFSDRKKVCDTGRQQRAIVQGSSSSGRKRVTGKKHITKG  477

Query  1020  TKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVT  1199
              K KD P WCSIPGTPFRVDAF+YLR DCSHWFLTHFH DHYQGLTRSFCHG IYCSS+T
Sbjct  478   -KLKDPPSWCSIPGTPFRVDAFRYLRGDCSHWFLTHFHMDHYQGLTRSFCHGLIYCSSIT  536

Query  1200  AKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             AKLVNMKIGIPWD + +LPLNQ+INI GIDVTC DANHCPGAIIILFEP NG
Sbjct  537   AKLVNMKIGIPWDRLHVLPLNQKINIGGIDVTCLDANHCPGAIIILFEPPNG  588


 Score =   331 bits (849),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/232 (72%), Positives = 194/232 (84%), Gaps = 8/232 (3%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQ--------YDFPKQDAVIQFVI  1509
             AVLHTGDFRF ++   +P  +   IHTL+LDTTYCNPQ        YDFPKQ+AVIQFV+
Sbjct  590   AVLHTGDFRFSEDKDMMPFLRARFIHTLVLDTTYCNPQASLNVNYGYDFPKQEAVIQFVL  649

Query  1510  EAIQAEAFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQF  1689
             +AIQAE FNP+TLFLIGSYTIGKERLF+E+AR L KK+YV AAKLRIL CLGFP EDMQ+
Sbjct  650   DAIQAETFNPKTLFLIGSYTIGKERLFLEVARVLRKKVYVNAAKLRILNCLGFPQEDMQW  709

Query  1690  FTLNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRW  1869
             FT+NE ES IHVVP+WTLA+FKRL  ++NQY  R+SLIVA SPTGW+  KGKKK+PGK+W
Sbjct  710   FTVNEQESQIHVVPMWTLASFKRLKHVANQYKDRFSLIVAFSPTGWTFSKGKKKSPGKKW  769

Query  1870  QQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             QQGTIIRYEVPYSEHSSF+ELK+FVK ISP NIIPSVNN GP+S   M+SLL
Sbjct  770   QQGTIIRYEVPYSEHSSFTELKEFVKIISPVNIIPSVNNDGPDSANAMVSLL  821



>ref|XP_006843920.1| hypothetical protein AMTR_s00007p00269400 [Amborella trichopoda]
 gb|ERN05595.1| hypothetical protein AMTR_s00007p00269400 [Amborella trichopoda]
Length=858

 Score =   357 bits (917),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 164/225 (73%), Positives = 191/225 (85%), Gaps = 0/225 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRFC EM      + C IHTLILDTTYC+ QYDFPKQ+AV+QFVIEAIQAEAF
Sbjct  629   AVLHTGDFRFCTEMGTNSILRSCSIHTLILDTTYCDAQYDFPKQEAVVQFVIEAIQAEAF  688

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKE+LF+E+AR L KK+YV  AKLR+LQCLG   EDMQ+FT NE ES
Sbjct  689   NPKTLFLIGSYTIGKEKLFLEVARFLRKKVYVGVAKLRLLQCLGLAKEDMQWFTSNEHES  748

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WT+A+FKR+  +SNQY GRY+LIVA SPTGW+ GKGKKK+ G+RWQQGTIIRY
Sbjct  749   HIHVVPMWTIASFKRMKYLSNQYSGRYNLIVAFSPTGWTFGKGKKKSNGRRWQQGTIIRY  808

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
             EVPYSEH SF+EL++FV  +SP NIIPSVNN  P++   M+SLLS
Sbjct  809   EVPYSEHCSFTELREFVSLVSPVNIIPSVNNSDPQAADVMVSLLS  853


 Score =   351 bits (900),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/314 (53%), Positives = 217/314 (69%), Gaps = 16/314 (5%)
 Frame = +3

Query  420   SSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDTSFQCLGQVLDASPAR  599
             + ++ CPLCG DIT L+EE R +H+N C+DK++ P    L   +     L  V D +P  
Sbjct  328   AQVVECPLCGIDITYLSEEDRLVHSNGCLDKDEIPKANHLKD-EMRVDRLHGVADVTP--  384

Query  600   TPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIV  779
                       V+ WLR L L++YEE FI++EIDWDTLQWL EEDL  +G++ALGPR+KI+
Sbjct  385   ----------VLNWLRTLNLSRYEEAFIKEEIDWDTLQWLKEEDLINLGINALGPRRKIL  434

Query  780   HALSELRKENTKEVEFQKNAKKAVVDDTSKVKL--SKLITDYFQCSAAGTKKVHATSCGQ  953
             HAL+ELRK+N +  E Q +     ++D  K+ +  +KLIT++FQ S+       + + G 
Sbjct  435   HALNELRKQNMQPSEVQTDHSSIAINDNGKLVVPGNKLITEFFQGSSTAAGFQGSRASGS  494

Query  954   NEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFH  1133
                  + + S    ++ NP  +T  +DIP W  IPGTPFRVDAF+YLR DCSHWFLTHFH
Sbjct  495   RPRQETALGSKGSRIR-NPVSATNVRDIPPWSCIPGTPFRVDAFRYLRGDCSHWFLTHFH  553

Query  1134  ADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANH  1313
              DHYQGLTR F HGKIYCS VTA+L+NMKIGI  D IQ+LPLN +INIAG++VTCFDANH
Sbjct  554   LDHYQGLTRGFRHGKIYCSEVTARLINMKIGITLDKIQVLPLNCKINIAGVNVTCFDANH  613

Query  1314  CPGAIIILFEPSNG  1355
             CPG+I+ILFEPSNG
Sbjct  614   CPGSIMILFEPSNG  627



>ref|XP_003527765.2| PREDICTED: DNA cross-link repair protein SNM1-like [Glycine max]
 gb|KHN37225.1| DNA cross-link repair protein SNM1 [Glycine soja]
Length=682

 Score =   356 bits (913),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 196/224 (88%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF +EM   P  + C I+TLILDTTYCNPQYDFPKQ++VIQFVI+A+QAE F
Sbjct  457   AVLHTGDFRFSEEMAVNPLMRICPINTLILDTTYCNPQYDFPKQESVIQFVIDAVQAETF  516

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR+L KK++VTAAKLRIL+CL   +EDMQ+FT NE ES
Sbjct  517   NPKTLFLIGSYTIGKERLFLEVARSLRKKVHVTAAKLRILKCLELKEEDMQWFTSNEHES  576

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             +IHV P+WTLA+FKRL  IS+QY  +Y+LIVA SPTGW+ GKGKKK+ G+RWQQGTIIRY
Sbjct  577   NIHVAPMWTLASFKRLKHISSQYKSQYNLIVAFSPTGWTFGKGKKKSTGRRWQQGTIIRY  636

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+ELK+FV+ +SP NIIPSVNN GPES+  M+SLL
Sbjct  637   EVPYSEHSSFTELKEFVRVVSPDNIIPSVNNDGPESSDAMISLL  680


 Score =   351 bits (901),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/457 (45%), Positives = 263/457 (58%), Gaps = 80/457 (18%)
 Frame = +3

Query  39    LDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKSVLEP  218
             LD IPSTI C    S+ P  E+                  DS + + S +  SE   L+ 
Sbjct  61    LDFIPSTIGCVSACSVQPLGEE------------------DSVSPSSSTASLSE---LKT  99

Query  219   KKGYFVNSIESRLLkssagleegkgeelgesselDMLLKLCSEGSEGDDDSMEAYQEDDC  398
             K  Y  NSIES+L+ S A        +       D+L+ LC E  E D            
Sbjct  100   KGNYLRNSIESKLVVSRANALNRADADSDSEL--DLLMNLCDELEEVD------------  145

Query  399   ASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDTSFQCLGQV  578
                     S + CPLC  DI++L EEQR +HTN C+D             D +      V
Sbjct  146   --------SSVRCPLCEVDISNLTEEQRHLHTNNCLD-------------DVA------V  178

Query  579   LDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVSAL  758
             +     +  Q++     VV+WLR LGL KYE++F+++E+DWDTLQWLTEEDL  +G++AL
Sbjct  179   VPDDNEKGAQQVPKVASVVDWLRGLGLNKYEDVFVREEVDWDTLQWLTEEDLLSMGIAAL  238

Query  759   GPRKKIVHALSELRKENT------------------KEVEFQKNAKKAVVDDTSKVKLSK  884
             GPR+KIVHALSELRK +                   ++V+ + +  +  VD T K   +K
Sbjct  239   GPRRKIVHALSELRKGDAAANEKHEDSSAEPRRIRNQKVKLKHDKSERKVDGTGKPVANK  298

Query  885   LITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGT  1064
             LIT+YF   A+  KKV A+     E   S + S  K   KN   + K +D+P WC++ GT
Sbjct  299   LITEYFPGFASKEKKVSASPGEPQEKKNSGLDSGRKHKSKNTPTNRKLRDVPKWCAVQGT  358

Query  1065  PFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNI  1244
             PFRVDAFKYLR DCSHWFLTHFH DHYQGLT+SF HGKIYCSSVTA+LVNM IGIP+D +
Sbjct  359   PFRVDAFKYLRGDCSHWFLTHFHLDHYQGLTKSFNHGKIYCSSVTARLVNMNIGIPYDKL  418

Query  1245  QILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              +LPLNQ++ IAG+DVTC DANHCPG+IIILF+P NG
Sbjct  419   HVLPLNQKVEIAGVDVTCLDANHCPGSIIILFQPPNG  455



>ref|XP_002462447.1| hypothetical protein SORBIDRAFT_02g025710 [Sorghum bicolor]
 gb|EER98968.1| hypothetical protein SORBIDRAFT_02g025710 [Sorghum bicolor]
Length=963

 Score =   352 bits (903),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 171/315 (54%), Positives = 221/315 (70%), Gaps = 15/315 (5%)
 Frame = +3

Query  435   CPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQ--  608
             CPLCG DI+DL+EE RQ+HTN C+D+   PA+ +      +F  +  ++++SP    +  
Sbjct  428   CPLCGSDISDLSEELRQLHTNNCLDE---PAKKL--KNIAAFVLILYLMESSPNHKKEPC  482

Query  609   --KLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVH  782
               + V    VVEWLR LGL+KYEE+FI++E+DW+TLQWLTEEDL  IG+++LGPRKKI+H
Sbjct  483   AGQNVETGRVVEWLRNLGLSKYEEVFIREEVDWETLQWLTEEDLLGIGITSLGPRKKIIH  542

Query  783   ALSELRKENTKEVEFQKNAKKAVVDDTSKVKL----SKLITDYFQCSAAGTKKVHATSCG  950
             AL ELRK++    E +     +  ++T K KL    +KLIT+YFQCS+   ++       
Sbjct  543   ALGELRKKHDDPCEVEDVVLNS--ENTKKTKLPMNGNKLITEYFQCSSFDQRQRRVCKVN  600

Query  951   QNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHF  1130
             +         SS K   +  A   K KD P+WC IPGTPFRVDAF+YLR DCSHWFLTHF
Sbjct  601   KPSNLNEKKISSAKIPTRRSAGKGKVKDTPLWCCIPGTPFRVDAFRYLRGDCSHWFLTHF  660

Query  1131  HADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDAN  1310
             H DHYQGLTRSFCHGKIYCSS+TA LV+ KIGIPWD + +L LN+++ I G+ +TCFDAN
Sbjct  661   HVDHYQGLTRSFCHGKIYCSSITASLVHHKIGIPWDRLHVLTLNEKLTIGGVSLTCFDAN  720

Query  1311  HCPGAIIILFEPSNG  1355
             HCPG+IIILFEP NG
Sbjct  721   HCPGSIIILFEPPNG  735


 Score =   350 bits (897),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 166/224 (74%), Positives = 188/224 (84%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF  EM   P  Q   IHTLILDTTYCNP+YDFP Q+ VIQFVIEAIQAEAF
Sbjct  737   AVLHTGDFRFSSEMANNPVLQSSHIHTLILDTTYCNPRYDFPSQEIVIQFVIEAIQAEAF  796

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L KKIYV AAKL+IL+ L  P E M +FT NE ES
Sbjct  797   NPKTLFLIGSYTIGKERLFMEVARLLQKKIYVGAAKLQILKHLELPQEIMHWFTANEAES  856

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKR+  +SNQY G++ LIVA  PTGW+ GKG+KKTPGKRWQQG+IIRY
Sbjct  857   HIHVVPMWTLASFKRMKYLSNQYAGQFDLIVAFCPTGWAFGKGRKKTPGKRWQQGSIIRY  916

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+EL++FVKFISP +IIPSVNN GPES   ML+ L
Sbjct  917   EVPYSEHSSFTELQEFVKFISPEHIIPSVNNDGPESADAMLAQL  960



>ref|XP_010273866.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104609288 
[Nelumbo nucifera]
Length=1054

 Score =   373 bits (958),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/225 (75%), Positives = 200/225 (89%), Gaps = 0/225 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
              VLHTGDFRF  EM  +  FQ C IHTLILDTTYCNPQYDFPKQ+AV+QFVI+AIQAEAF
Sbjct  829   TVLHTGDFRFSKEMESMCVFQGCPIHTLILDTTYCNPQYDFPKQEAVVQFVIDAIQAEAF  888

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             +P+TLFLIGSYTIGKERLF+E+AR L KK+YV +AKLR+L+CLG P+EDMQ+FT+NE ES
Sbjct  889   HPKTLFLIGSYTIGKERLFLEVARVLRKKVYVGSAKLRLLECLGLPEEDMQWFTVNEQES  948

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WT+A+FKR+  I NQY+GR++LIVA SPTGW+ GKGKKKTPG+RWQQGTIIRY
Sbjct  949   HIHVVPMWTIASFKRMKHICNQYLGRFNLIVAFSPTGWTYGKGKKKTPGRRWQQGTIIRY  1008

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
             EVPYSEHSSF+EL++FV+ +SP NIIPSVNN GPES   M++LL+
Sbjct  1009  EVPYSEHSSFTELREFVRLVSPDNIIPSVNNDGPESAHSMVALLN  1053


 Score =   328 bits (842),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 185/380 (49%), Positives = 237/380 (62%), Gaps = 25/380 (7%)
 Frame = +3

Query  228   YFVNSIESRLLkssagleegkgeelgesselDMLLKLCSEGSEGD-DDSMEAYQEDDCAS  404
             Y  NSIESRLL S                   ++ K C +  EG+  D +  Y ++D +S
Sbjct  469   YLSNSIESRLLASRTDNRS-------------VVDKCCLD--EGNWVDFVPGYDQEDHSS  513

Query  405   EGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLS-HRDTSFQCLGQVL  581
             +      L  CPLC  DI+DL EEQRQ+H N C+DK +         H     Q +    
Sbjct  514   D-----VLFECPLCQMDISDLTEEQRQLHINNCLDKVEQQQFCTDDCHDRYVTQKVVPPS  568

Query  582   DASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVSALG  761
             D   +R P K V   PV+EWL++LGL++YEE F+++EIDWDTLQWLTEEDL  IGV+ALG
Sbjct  569   DGMESRPPGKPVDVSPVLEWLQRLGLSRYEEAFVKEEIDWDTLQWLTEEDLLSIGVTALG  628

Query  762   PRKKIVHALSELRKENTKEVEFQK-NAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHA  938
             PRKK+ +AL+ELR  +T   +    ++ +    DTSK+  +KLIT+YF  S+    +  A
Sbjct  629   PRKKM-NALNELRNGSTSGEDIHAGDSSRITPKDTSKLAGNKLITEYFPGSSINRPRQCA  687

Query  939   TSCGQNEVGRSLMYSS-NKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHW  1115
                G  ++ RS   S   K   +N  K+ K +D+P WC IPGTPF VDAF+YLRR+CSHW
Sbjct  688   LIKGNRKLERSNKDSGLGKISVRNHNKNGKLRDLPSWCCIPGTPFLVDAFRYLRRECSHW  747

Query  1116  FLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVT  1295
             FLTHFH DHYQGLTR FC+GKIY SSV       K+G   D +QILPLNQ+I+IAG+ VT
Sbjct  748   FLTHFHIDHYQGLTRGFCYGKIYHSSVKTTFXKRKLGFIGDRLQILPLNQKISIAGVGVT  807

Query  1296  CFDANHCPGAIIILFEPSNG  1355
             C DANHCPG+IIILFEP NG
Sbjct  808   CLDANHCPGSIIILFEPPNG  827



>ref|XP_008220601.1| PREDICTED: DNA cross-link repair protein SNM1-like, partial [Prunus 
mume]
Length=512

 Score =   364 bits (934),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 195/225 (87%), Gaps = 0/225 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF +    +   Q C IHTLILDTTYCNPQYDFPKQ+AVIQFVI+AIQAE F
Sbjct  283   AVLHTGDFRFSENAASMSFLQTCSIHTLILDTTYCNPQYDFPKQEAVIQFVIDAIQAETF  342

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERL++E+AR L KKIY+   KL IL+CL FP+EDM++FTLNE ES
Sbjct  343   NPKTLFLIGSYTIGKERLYLEVARVLRKKIYINPGKLHILKCLDFPEEDMRWFTLNEQES  402

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
              IHVVP+WTLA+FKRL  +SNQY  R+SLIVA SPTGW+ GKGKKK+PG+R QQGTIIRY
Sbjct  403   QIHVVPMWTLASFKRLKHMSNQYASRFSLIVAFSPTGWTFGKGKKKSPGRRSQQGTIIRY  462

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
             EVPYSEHSSF+ELK+FVK ISPA+IIPSVNNHGP+S + M+SLLS
Sbjct  463   EVPYSEHSSFTELKEFVKLISPADIIPSVNNHGPDSAKAMISLLS  507


 Score =   336 bits (861),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 163/254 (64%), Positives = 189/254 (74%), Gaps = 13/254 (5%)
 Frame = +3

Query  630   VVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKEN  809
             V++WLR LGL KYE+ F+++EIDWDTLQWLTEEDL  IG++ALGPRKKIVHAL++LR+  
Sbjct  27    VLQWLRSLGLEKYEDAFVREEIDWDTLQWLTEEDLFSIGIAALGPRKKIVHALTQLREGT  86

Query  810   TKE-VEFQKNAKKA-----VVD------DTSKVKLSKLITDYFQCSAAGTKKVHATSCGQ  953
             T   +E Q   + A     V D      D SK   +KLITDYF       K+V  TS   
Sbjct  87    TSPGIEAQPRKRSASGVETVNDASEEPVDNSKTAANKLITDYFPGFTTARKQVCTTSGEH  146

Query  954   NEVGRSLMYSSNKS-VKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHF  1130
               V +    S +K    KN   + K +DIP WC IPGTPFRVDAFKYLRRDCSHWFLTHF
Sbjct  147   QRVEKRGSGSGHKGGAAKNHVTTRKLRDIPSWCCIPGTPFRVDAFKYLRRDCSHWFLTHF  206

Query  1131  HADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDAN  1310
             H DHYQGLT+SFCHGKIYCSS+TAKLVNMKIGIPWDNI++LPLNQ+INIAGIDVTC DAN
Sbjct  207   HMDHYQGLTKSFCHGKIYCSSITAKLVNMKIGIPWDNIKVLPLNQKINIAGIDVTCLDAN  266

Query  1311  HCPGAIIILFEPSN  1352
             HCPG++IILFEP N
Sbjct  267   HCPGSVIILFEPPN  280



>ref|XP_004956893.1| PREDICTED: uncharacterized protein LOC101778195 [Setaria italica]
Length=949

 Score =   352 bits (904),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 189/224 (84%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF  EM+  P  Q   IHTLILDTTYCNP+YDFP Q+ VIQFVIEAIQAEAF
Sbjct  723   AVLHTGDFRFSSEMVNNPVLQSSHIHTLILDTTYCNPRYDFPSQEIVIQFVIEAIQAEAF  782

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L KKIYV AAKL+IL+ L  P E M +FT NE ES
Sbjct  783   NPKTLFLIGSYTIGKERLFMEVARLLQKKIYVGAAKLQILKHLELPQEIMHWFTANEAES  842

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKR+  +SNQY GR+ LIVA  PTGW+ GKGKK+TPGKRWQQG+IIRY
Sbjct  843   HIHVVPMWTLASFKRMKHLSNQYAGRFDLIVAFCPTGWAFGKGKKRTPGKRWQQGSIIRY  902

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+EL++FVKFISP +IIPSVNN GPES   ML+ L
Sbjct  903   EVPYSEHSSFTELQEFVKFISPEHIIPSVNNDGPESADAMLAQL  946


 Score =   347 bits (890),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 183/358 (51%), Positives = 234/358 (65%), Gaps = 41/358 (11%)
 Frame = +3

Query  327   LLKLCSEGS-EGDDDSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNEC  503
             L+ LC E S EG  +     +++   S+       + CPLCG DI+DL+EE RQ+HTN C
Sbjct  390   LINLCMEDSIEGHSNCTSPIEKNTFDSKRFKSDYQVKCPLCGLDISDLSEELRQLHTNNC  449

Query  504   ID---KEDAP-AEAVLSHRDT-SFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKY  668
             +D   KE +P  E   S  +T   +C                     V+EWLR LGL+KY
Sbjct  450   LDEPAKESSPNHEKEPSAGETVEIRC---------------------VIEWLRNLGLSKY  488

Query  669   EELFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNAKKA  848
             EE+FI++E+DW+TLQW TEEDL  +G++ALGPRKKI HAL+ELRK++  +      A   
Sbjct  489   EEIFIKEEVDWETLQWFTEEDLLGMGITALGPRKKITHALAELRKKHDDDAN-DMEAGVL  547

Query  849   VVDDTSKVKL----SKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAK  1016
               +DT K KL    +KLIT+YF+CS+   ++  +  C  N+   S +    KS  K P +
Sbjct  548   SSEDTKKTKLPMNGNKLITEYFKCSSVDQRQ--SRVCKVNK--SSNLNEQKKSSAKVPTR  603

Query  1017  ST-----KYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKI  1181
                    K KD P+WC IPGTPFRVDAF+YLR DC HWFLTHFH DHYQGLTRSFCHGKI
Sbjct  604   RISTGKGKVKDTPLWCCIPGTPFRVDAFRYLRGDCCHWFLTHFHVDHYQGLTRSFCHGKI  663

Query  1182  YCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             YCSS+TA LV+ KIGIPWD + +LPLN+RI I+G+++TCFDANHCPG+IIILFEP NG
Sbjct  664   YCSSITASLVHHKIGIPWDKLHVLPLNKRITISGVNLTCFDANHCPGSIIILFEPPNG  721



>ref|XP_010541701.1| PREDICTED: uncharacterized protein LOC104815085 [Tarenaya hassleriana]
Length=768

 Score =   364 bits (935),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 223/474 (47%), Positives = 285/474 (60%), Gaps = 75/474 (16%)
 Frame = +3

Query  39    LDSIPSTIDCS---YPGSLDP----KEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCAS  197
             LD IPS+IDCS   Y G+        +  +C   +E+N+                  C  
Sbjct  110   LDCIPSSIDCSVEDYGGAFRSYGVETDYGQCSTEVEEND-----------------GCFK  152

Query  198   EKSVLEPKKGYFVNSIESRLLkssagleegkgeel-----gesselDMLLKLCSEGSEGD  362
             ++     ++GY  NSIE+RLL        G G E       + +ELD+L+KLCSE + G+
Sbjct  153   DR-----REGYRCNSIEARLLGPKIDPGSGGGMEEDDGFLEDGTELDVLMKLCSEENGGE  207

Query  363   DDSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKED-APAEAVL  539
              +S            G+ DS L+ CPLC  DI+ L EEQRQ+H+NEC+DK D  P +   
Sbjct  208   GNS------------GDGDSGLVQCPLCTMDISALTEEQRQVHSNECLDKVDNGPHD---  252

Query  540   SHRDTS--FQCLGQVLDAS---PARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWD  704
              H D++  ++     ++ S   P R P+++     V+ WLR LGLAKYE++FI++EI WD
Sbjct  253   -HDDSAKKYEQTSSFMEESVDDPLRLPRQVDDLSEVLIWLRSLGLAKYEDIFIREEIYWD  311

Query  705   TLQWLTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVEFQ-------KNAKKAVVDD-  860
             TLQ LTEEDL  IG++ALGPRKKI++AL ELRK N   VE Q        +A +   DD 
Sbjct  312   TLQSLTEEDLLSIGIAALGPRKKILNALRELRKSNASSVEAQAQPFSMNNHAIEVQPDDG  371

Query  861   --------TSKVKLSKLITDYFQCSAAGTKKVHATSCGQ-NEVGRSLMYSSNKSVKKNPA  1013
                     T  V  +KLIT++F   A   KKV  T     +E G S   S  +   K   
Sbjct  372   SSTREAIQTKTVAANKLITEFFPGLAIEGKKVRRTPKEPLSEKGPS--NSRGRRADKRHV  429

Query  1014  KSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSS  1193
              + K K +P WC IPGTPFRVDAFKYLR DC HWFLTHFH DHYQGLT+SFCHGKIYCSS
Sbjct  430   SNGKSKIVPQWCCIPGTPFRVDAFKYLRGDCCHWFLTHFHLDHYQGLTKSFCHGKIYCSS  489

Query  1194  VTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             VTAKLVNMKIGIPW+ +Q+L + Q++NIAGI VTCFDANHCPG+I+ILFEP NG
Sbjct  490   VTAKLVNMKIGIPWERLQVLQIGQKVNIAGIYVTCFDANHCPGSIMILFEPPNG  543


 Score =   334 bits (857),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 188/224 (84%), Gaps = 2/224 (1%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             A LHTGDFR+ ++M    S     I +LILDTTYCNPQYDFPKQ+AVIQFVIE+IQAEAF
Sbjct  545   ATLHTGDFRYTEDMGNWLSRY--HIDSLILDTTYCNPQYDFPKQEAVIQFVIESIQAEAF  602

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L KK+Y+   KL+IL+CLGF  EDMQ+FT+NELES
Sbjct  603   NPKTLFLIGSYTIGKERLFLEVARVLRKKVYINVTKLKILECLGFSKEDMQWFTVNELES  662

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKRL  ++ +Y  R+SLIVA SPTGW+  K +KK+PG+R +QGTIIRY
Sbjct  663   HIHVVPMWTLASFKRLEHVARRYKNRFSLIVAFSPTGWTSSKARKKSPGRRLKQGTIIRY  722

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+ELK+FVK +SP  IIPSVNN GP+S   M+SLL
Sbjct  723   EVPYSEHSSFTELKEFVKLVSPERIIPSVNNDGPDSASSMVSLL  766



>ref|XP_008670221.1| PREDICTED: uncharacterized protein LOC103647460 isoform X1 [Zea 
mays]
Length=938

 Score =   350 bits (897),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 188/224 (84%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF  +M   P  Q   +HTLILDTTYCNP+YDFP Q+ VIQFVIEAIQAEAF
Sbjct  712   AVLHTGDFRFSSKMANNPVLQSSCVHTLILDTTYCNPRYDFPSQEIVIQFVIEAIQAEAF  771

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L KK+YV AAKL+IL+ L  P E M +FT NE ES
Sbjct  772   NPKTLFLIGSYTIGKERLFMEVARLLQKKVYVGAAKLQILKHLELPQEIMHWFTANEAES  831

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKR+  +SNQY GRY LIVA  PTGW+ GKG+KKTPGKRWQQG+IIRY
Sbjct  832   HIHVVPMWTLASFKRMKYLSNQYAGRYDLIVAFCPTGWAFGKGRKKTPGKRWQQGSIIRY  891

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+EL++FVKFISP +IIPSVNN GPES   ML+ L
Sbjct  892   EVPYSEHSSFTELQQFVKFISPEHIIPSVNNDGPESANAMLAQL  935


 Score =   348 bits (894),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/316 (55%), Positives = 219/316 (69%), Gaps = 33/316 (10%)
 Frame = +3

Query  435   CPLCGRDITDLNEEQRQIHTNECID---KEDAPAEAVLSHRDTSFQCLGQVLDASPARTP  605
             CPLCG DI+DL+EE RQ+HTN C+D   KE +P     +H+      +GQ ++       
Sbjct  419   CPLCGSDISDLSEELRQLHTNNCLDEPAKESSP-----NHKKEP--SVGQNVETGR----  467

Query  606   QKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHA  785
                     VVEWLR LGL+KYEE+FI++E+DW+TLQWLTEEDL  IG+S+LGPRKKI+HA
Sbjct  468   --------VVEWLRNLGLSKYEEVFIREEVDWETLQWLTEEDLLGIGISSLGPRKKIIHA  519

Query  786   LSELRKENTKEVEFQKNAKKAVVD--DTSKVKL----SKLITDYFQCSAAGTKKVHATSC  947
             L EL K++    E +     AV++  +T K KL    +KLIT+YFQCS+   ++      
Sbjct  520   LGELLKKHDDPSEME-----AVLNSGNTKKTKLPMNGNKLITEYFQCSSFDQRQRRVCKA  574

Query  948   GQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTH  1127
              +         SS K   +  A   K KD P+WC IPGTPFRVDAF+YLR DCSHWFLTH
Sbjct  575   NKPSNLNEKKISSAKVPTRRTAGKGKIKDTPLWCCIPGTPFRVDAFRYLRGDCSHWFLTH  634

Query  1128  FHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDA  1307
             FH DHYQGLTRSFCHGKIYCSS+TA LV+ KIGIPWD + +L LN+++NIAG+++ CFDA
Sbjct  635   FHVDHYQGLTRSFCHGKIYCSSITASLVHHKIGIPWDRLHVLTLNEKLNIAGVNLICFDA  694

Query  1308  NHCPGAIIILFEPSNG  1355
             NHCPG+IIILFEP NG
Sbjct  695   NHCPGSIIILFEPPNG  710



>ref|XP_007136912.1| hypothetical protein PHAVU_009G084300g [Phaseolus vulgaris]
 gb|ESW08906.1| hypothetical protein PHAVU_009G084300g [Phaseolus vulgaris]
Length=687

 Score =   360 bits (924),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 198/224 (88%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF +EM   P  + C I+TLILDTTYCNPQYDFPKQ+AVIQFVI+AIQAE F
Sbjct  462   AVLHTGDFRFSEEMTINPLLKTCPINTLILDTTYCNPQYDFPKQEAVIQFVIDAIQAETF  521

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKER+F+E+ARAL KK++VTAAKLR+L+CL F +EDM++FT NE ES
Sbjct  522   NPKTLFLIGSYTIGKERIFLEVARALSKKVHVTAAKLRLLKCLEFKEEDMKWFTSNEHES  581

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             +IHV P+WTLA+FKRL Q+S+QY GRY+LIVA SP+GW+ GKGKKK+ G+R QQGTIIRY
Sbjct  582   NIHVAPMWTLASFKRLKQMSSQYTGRYNLIVAFSPSGWTFGKGKKKSSGRRCQQGTIIRY  641

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+ELK+FVK +SP NIIPSVNN GPES+  M+SLL
Sbjct  642   EVPYSEHSSFTELKEFVKLVSPGNIIPSVNNDGPESSDAMISLL  685


 Score =   337 bits (863),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 185/397 (47%), Positives = 239/397 (60%), Gaps = 58/397 (15%)
 Frame = +3

Query  219   KKGYFVNSIESRLLkssagleegkgeelgesselDMLLKLCSEGSEGDDDSMEAYQEDDC  398
             K  Y  NSIES+L+ S+ G       +        +L+ LC E  E D            
Sbjct  104   KGNYLRNSIESKLVVSTTGALNAADADSDSEL--GLLMNLCDELEEVD------------  149

Query  399   ASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDTSFQCLGQV  578
                     S + CPLC  DI++L EEQR +HTN C+D+ D  A  VL             
Sbjct  150   --------SSVRCPLCDVDISNLTEEQRHLHTNNCLDEGDNVA--VLE------------  187

Query  579   LDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVSAL  758
              D   A+   K+ +   VV+WL  LGL KYE +FI++E+DW+TLQ LTEEDL  +G++AL
Sbjct  188   -DEKGAQHVPKVAS---VVDWLHGLGLGKYEVVFIREEVDWNTLQCLTEEDLLSMGITAL  243

Query  759   GPRKKIVHALSELR------------------KENTKEVEFQKNAKKAVVDDTSKVKLSK  884
             GPRKKIVHAL ELR                  +   ++V+ + +  +   D + K   +K
Sbjct  244   GPRKKIVHALRELRNGDAAINEKQEDALEEPRRIRNQKVKLKHDKSERKADGSIKPVANK  303

Query  885   LITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGT  1064
             LIT+YF   A+  KKV A+   Q E+  S + S  K   KN   + K +D+P WCS+ GT
Sbjct  304   LITEYFPGFASKEKKVFASPGEQKEMKNSGLDSGRKRKSKNVTANRKLRDVPKWCSVQGT  363

Query  1065  PFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNI  1244
             PFRVDAFKYLR DCSHWFLTHFH DHYQGLT+SF HGKIYCSS+TA+LVN  IGIP+D +
Sbjct  364   PFRVDAFKYLRGDCSHWFLTHFHLDHYQGLTKSFNHGKIYCSSITARLVNTNIGIPYDKL  423

Query  1245  QILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              +LPLNQ+I +AG+DVTCFDANHCPG+I+ILF+P NG
Sbjct  424   HVLPLNQKIEVAGVDVTCFDANHCPGSILILFQPPNG  460



>ref|XP_009403292.1| PREDICTED: uncharacterized protein LOC103986880 [Musa acuminata 
subsp. malaccensis]
Length=777

 Score =   352 bits (903),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 191/224 (85%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF  EM      Q C IHTLILDTTYCNPQYDFPKQ+AV QFVIEAIQAEAF
Sbjct  550   AVLHTGDFRFSREMANNAVLQSCHIHTLILDTTYCNPQYDFPKQEAVAQFVIEAIQAEAF  609

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERL++E+A+ L +KIYV AAKL++L+ L   +E+MQ+FT NE+ES
Sbjct  610   NPKTLFLIGSYTIGKERLYLEVAQILRQKIYVGAAKLQLLRHLELAEEEMQWFTANEMES  669

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVPLWTLA+FKR+  ISNQY  RY LIVA SPTGW+ GKGKK+TPGKRWQQGT+IRY
Sbjct  670   HIHVVPLWTLASFKRMRYISNQYSARYDLIVAFSPTGWACGKGKKRTPGKRWQQGTMIRY  729

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEH SF+ELK+FV+ ++P +IIPSVNN GPES   M++LL
Sbjct  730   EVPYSEHCSFTELKEFVRLVTPEHIIPSVNNDGPESADAMIALL  773


 Score =   341 bits (875),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/353 (51%), Positives = 230/353 (65%), Gaps = 30/353 (8%)
 Frame = +3

Query  327   LLKLCSE----GSEGDDDSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHT  494
             L+ LC E    GS     S+EA + D   +E      L+ CPLCG DITD+++E RQIHT
Sbjct  216   LMNLCCEMDDGGSSHGGASLEANEVDGETAELKQ-GGLVECPLCGIDITDISDELRQIHT  274

Query  495   NECIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEE  674
             N C+DK +    A               +    +   + +V   PV +WL+ LGL+KY++
Sbjct  275   NNCLDKVETLEVA-------------DPISEMKSNASEGVVDISPVTQWLQSLGLSKYKD  321

Query  675   LFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNAKKAVV  854
             +F+++EI+W+TLQ LTEEDL  IG+ ALGPRKKIVHAL+ELR+ N    +  KN   A +
Sbjct  322   IFVKEEINWETLQCLTEEDLLGIGIDALGPRKKIVHALNELRRRNHLP-DTDKNISSAAI  380

Query  855   DDTSKVKLS--KLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKST--  1022
              +  K   S  KLIT+YFQ S      V   +   N  GR    + +   K+ P ++T  
Sbjct  381   VENIKPHFSGNKLITEYFQGSVVDRHSVRNHNKPLN--GR---ITKDSIPKRKPTRNTVS  435

Query  1023  --KYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSV  1196
               K ++IP WC IPGTPFRVDAF+YLR DCSHWFLTHFH DHYQGL ++F HGKIYCSS+
Sbjct  436   KGKVREIPPWCCIPGTPFRVDAFRYLRGDCSHWFLTHFHMDHYQGLNKNFYHGKIYCSSI  495

Query  1197  TAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             TA LVNMKIG+PWD +QILPLNQ+I +AG+ +TCFDANHCPG+IIILFEP NG
Sbjct  496   TAHLVNMKIGVPWDRLQILPLNQKITVAGVGLTCFDANHCPGSIIILFEPPNG  548



>ref|XP_006397751.1| hypothetical protein EUTSA_v10001326mg [Eutrema salsugineum]
 gb|ESQ39204.1| hypothetical protein EUTSA_v10001326mg [Eutrema salsugineum]
Length=740

 Score =   356 bits (913),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 212/463 (46%), Positives = 280/463 (60%), Gaps = 60/463 (13%)
 Frame = +3

Query  39    LDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKSVLEP  218
             LD IPS++DCS     +P        +  + E   +   AD   +++ F    E      
Sbjct  89    LDCIPSSVDCSGGDVSEP--------IFVETEDEHLL--ADEKVRDDCFKANRE------  132

Query  219   KKGYFVNSIESRL------LkssagleegkgeelgesselDMLLKLCSEGSEGDDDSMEA  380
               GY  NS+E+RL      L+   G+ E     +   +ELD+L+KLCSEG+ G+      
Sbjct  133   --GYLCNSMEARLSKSRIRLRFDGGIHEEDEVFVEPDTELDVLIKLCSEGNSGE------  184

Query  381   YQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHR--DT  554
                  C+   ND   LI CPLC  DI+DL+EEQRQ H++EC+DK    A    S R  + 
Sbjct  185   -----CSLGKND---LIQCPLCSMDISDLSEEQRQFHSSECLDKSHNHALQQGSPRKCEN  236

Query  555   SFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDL  734
             S  C+ + +D  P R PQ +    PV++WLR LGLAKYE++F+++EIDWDTLQ LTEEDL
Sbjct  237   SSSCIEESVD-DPVRHPQLVNDLSPVLKWLRSLGLAKYEDVFLREEIDWDTLQSLTEEDL  295

Query  735   CKIGVSALGPRKKIVHALSELRKEN----------------TKEVEFQKNAKKAVVDDTS  866
               IG+S+LGPRKKIV+ALS LR+E                 T+ +  +   +KA   +  
Sbjct  296   LSIGISSLGPRKKIVNALSALREEACASSAQGQAHSLISHVTERLREKSTNRKA--SEPK  353

Query  867   KVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVW  1046
             K   +KLIT++F   A  + K+       +           ++V++N + S K K IP W
Sbjct  354   KPTANKLITEFFPGQATDSTKIRKPPKEPSTEKSPSDSGGRRAVRRN-SNSGKSKVIPHW  412

Query  1047  CSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIG  1226
               IPGTPFRVDAFKYL R+C HWFLTHFH DHYQGLT+SF HGKIYCS VTAKLVNMKIG
Sbjct  413   NCIPGTPFRVDAFKYLTRNCCHWFLTHFHLDHYQGLTKSFTHGKIYCSLVTAKLVNMKIG  472

Query  1227  IPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             IPW+ + +L L Q+++IAGIDVTCFDANHCPG+I+ILFEP+NG
Sbjct  473   IPWERLHVLHLGQKVSIAGIDVTCFDANHCPGSIMILFEPANG  515


 Score =   334 bits (856),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 188/224 (84%), Gaps = 2/224 (1%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFR+ +EM          IH+LILDTTYCNPQYDFPKQ+ VIQFV+EAIQAEAF
Sbjct  517   AVLHTGDFRYGEEMSNW--LMGSHIHSLILDTTYCNPQYDFPKQETVIQFVVEAIQAEAF  574

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +KIY+  +KL++L+CLGF  EDMQ+FT+ E ES
Sbjct  575   NPKTLFLIGSYTIGKERLFLEVARVLREKIYINPSKLKLLECLGFSKEDMQWFTVKEEES  634

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVPLWTLA+FKRL  I+N+Y  RYSLIVA SPTGW+ GK KKK+PG+R QQGTIIRY
Sbjct  635   HIHVVPLWTLASFKRLKHIANRYTNRYSLIVAFSPTGWTSGKTKKKSPGRRLQQGTIIRY  694

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+ELK+FV+ +SP  IIPSVNN  P+S   M+S+L
Sbjct  695   EVPYSEHSSFTELKEFVQQVSPEVIIPSVNNDVPDSAAAMVSML  738



>ref|NP_001063271.1| Os09g0439000 [Oryza sativa Japonica Group]
 dbj|BAF25185.1| Os09g0439000 [Oryza sativa Japonica Group]
Length=966

 Score =   347 bits (891),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 180/349 (52%), Positives = 234/349 (67%), Gaps = 22/349 (6%)
 Frame = +3

Query  327   LLKLCSEG-SEGDDDSMEAYQEDDCASEGNDDSSL-ICCPLCGRDITDLNEEQRQIHTNE  500
             L+ LC E  +EG   +  A  E +    G+ +SS  + CPLCG +I+DL+EE R +HTN 
Sbjct  406   LINLCMEDYTEGPLSNKVACLEGNGMDCGSFNSSCEVQCPLCGSNISDLSEELRLVHTNS  465

Query  501   CIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELF  680
             C+D  D PA+   S  D   +  G+             V +  V+EWLR LGL+KYEE+F
Sbjct  466   CLDG-DKPAKEPNS--DNQNEPCGE-----------SNVEKRRVMEWLRNLGLSKYEEIF  511

Query  681   IQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNAKKAVVDD  860
             I++E+DW+TLQWLTEEDL  +G+++LGPRKKI HAL ELRK+N    +    A    +++
Sbjct  512   IKEEVDWETLQWLTEEDLLGMGITSLGPRKKIAHALCELRKKNNDANDLA--ADMLNLEN  569

Query  861   TSKVKL----SKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKY  1028
             T K K+    +KLIT+YF+C ++  ++  A          S   S+ K+         K 
Sbjct  570   TKKAKIPMNGNKLITEYFRCPSSDQRQKKACKVNTPSNLNSQKKSNAKATGGRRTVKGKV  629

Query  1029  KDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKL  1208
             KD P+WC IPGTPFRVDAF+YLR DC HWFLTHFH DHYQGLT+SFCHGKIYCSSVTA L
Sbjct  630   KDTPIWCCIPGTPFRVDAFRYLRGDCCHWFLTHFHVDHYQGLTKSFCHGKIYCSSVTANL  689

Query  1209  VNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             V+ KIGIPWD + +LPLN++I IAG+++TCFDANHCPGA+IILFEPSNG
Sbjct  690   VHYKIGIPWDRLHVLPLNEKITIAGVNLTCFDANHCPGAVIILFEPSNG  738


 Score =   342 bits (876),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 163/227 (72%), Positives = 188/227 (83%), Gaps = 1/227 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF  EM      Q   IHTLILDTTYCNP+YDFP Q+ VIQFVIEAIQAEAF
Sbjct  740   AVLHTGDFRFSSEMANNRVLQSSPIHTLILDTTYCNPRYDFPTQEIVIQFVIEAIQAEAF  799

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERL++E+AR L KKIYV AAKL+IL+ LG P E M +FT NE ES
Sbjct  800   NPKTLFLIGSYTIGKERLYMEVARLLQKKIYVGAAKLQILKHLGLPQEIMHWFTANEAES  859

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKR+  +S QY  R+ LIVA  PTGWS GKGKK+TPG++WQQG IIRY
Sbjct  860   HIHVVPMWTLASFKRMKYLSTQYADRFDLIVAFCPTGWSFGKGKKRTPGRKWQQGAIIRY  919

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLS-LLSD  2031
             EVPYSEHSSF+EL++FV+FISP +IIPSVNN GP+S   ML+ LL+D
Sbjct  920   EVPYSEHSSFTELREFVRFISPEHIIPSVNNDGPDSANAMLAQLLND  966



>dbj|BAD36078.1| putative SNM1 [Oryza sativa Japonica Group]
 dbj|BAD36136.1| putative SNM1 [Oryza sativa Japonica Group]
Length=1024

 Score =   347 bits (891),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 180/349 (52%), Positives = 234/349 (67%), Gaps = 22/349 (6%)
 Frame = +3

Query  327   LLKLCSEG-SEGDDDSMEAYQEDDCASEGNDDSSL-ICCPLCGRDITDLNEEQRQIHTNE  500
             L+ LC E  +EG   +  A  E +    G+ +SS  + CPLCG +I+DL+EE R +HTN 
Sbjct  464   LINLCMEDYTEGPLSNKVACLEGNGMDCGSFNSSCEVQCPLCGSNISDLSEELRLVHTNS  523

Query  501   CIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELF  680
             C+D  D PA+   S  D   +  G+             V +  V+EWLR LGL+KYEE+F
Sbjct  524   CLDG-DKPAKEPNS--DNQNEPCGE-----------SNVEKRRVMEWLRNLGLSKYEEIF  569

Query  681   IQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNAKKAVVDD  860
             I++E+DW+TLQWLTEEDL  +G+++LGPRKKI HAL ELRK+N    +    A    +++
Sbjct  570   IKEEVDWETLQWLTEEDLLGMGITSLGPRKKIAHALCELRKKNNDANDLA--ADMLNLEN  627

Query  861   TSKVKL----SKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKY  1028
             T K K+    +KLIT+YF+C ++  ++  A          S   S+ K+         K 
Sbjct  628   TKKAKIPMNGNKLITEYFRCPSSDQRQKKACKVNTPSNLNSQKKSNAKATGGRRTVKGKV  687

Query  1029  KDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKL  1208
             KD P+WC IPGTPFRVDAF+YLR DC HWFLTHFH DHYQGLT+SFCHGKIYCSSVTA L
Sbjct  688   KDTPIWCCIPGTPFRVDAFRYLRGDCCHWFLTHFHVDHYQGLTKSFCHGKIYCSSVTANL  747

Query  1209  VNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             V+ KIGIPWD + +LPLN++I IAG+++TCFDANHCPGA+IILFEPSNG
Sbjct  748   VHYKIGIPWDRLHVLPLNEKITIAGVNLTCFDANHCPGAVIILFEPSNG  796


 Score =   342 bits (876),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 163/227 (72%), Positives = 188/227 (83%), Gaps = 1/227 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF  EM      Q   IHTLILDTTYCNP+YDFP Q+ VIQFVIEAIQAEAF
Sbjct  798   AVLHTGDFRFSSEMANNRVLQSSPIHTLILDTTYCNPRYDFPTQEIVIQFVIEAIQAEAF  857

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERL++E+AR L KKIYV AAKL+IL+ LG P E M +FT NE ES
Sbjct  858   NPKTLFLIGSYTIGKERLYMEVARLLQKKIYVGAAKLQILKHLGLPQEIMHWFTANEAES  917

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKR+  +S QY  R+ LIVA  PTGWS GKGKK+TPG++WQQG IIRY
Sbjct  918   HIHVVPMWTLASFKRMKYLSTQYADRFDLIVAFCPTGWSFGKGKKRTPGRKWQQGAIIRY  977

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLS-LLSD  2031
             EVPYSEHSSF+EL++FV+FISP +IIPSVNN GP+S   ML+ LL+D
Sbjct  978   EVPYSEHSSFTELREFVRFISPEHIIPSVNNDGPDSANAMLAQLLND  1024



>gb|EAZ44869.1| hypothetical protein OsJ_29509 [Oryza sativa Japonica Group]
Length=967

 Score =   347 bits (891),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 180/349 (52%), Positives = 234/349 (67%), Gaps = 22/349 (6%)
 Frame = +3

Query  327   LLKLCSEG-SEGDDDSMEAYQEDDCASEGNDDSSL-ICCPLCGRDITDLNEEQRQIHTNE  500
             L+ LC E  +EG   +  A  E +    G+ +SS  + CPLCG +I+DL+EE R +HTN 
Sbjct  407   LINLCMEDYTEGPLSNKVACLEGNGMDCGSFNSSCEVQCPLCGSNISDLSEELRLVHTNS  466

Query  501   CIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELF  680
             C+D  D PA+   S  D   +  G+             V +  V+EWLR LGL+KYEE+F
Sbjct  467   CLDG-DKPAKEPNS--DNQNEPCGE-----------SNVEKRRVMEWLRNLGLSKYEEIF  512

Query  681   IQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNAKKAVVDD  860
             I++E+DW+TLQWLTEEDL  +G+++LGPRKKI HAL ELRK+N    +    A    +++
Sbjct  513   IKEEVDWETLQWLTEEDLLGMGITSLGPRKKIAHALCELRKKNNDANDLA--ADMLNLEN  570

Query  861   TSKVKL----SKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKY  1028
             T K K+    +KLIT+YF+C ++  ++  A          S   S+ K+         K 
Sbjct  571   TKKAKIPMNGNKLITEYFRCPSSDQRQKKACKVNTPSNLNSQKKSNAKATGGRRTVKGKV  630

Query  1029  KDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKL  1208
             KD P+WC IPGTPFRVDAF+YLR DC HWFLTHFH DHYQGLT+SFCHGKIYCSSVTA L
Sbjct  631   KDTPIWCCIPGTPFRVDAFRYLRGDCCHWFLTHFHVDHYQGLTKSFCHGKIYCSSVTANL  690

Query  1209  VNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             V+ KIGIPWD + +LPLN++I IAG+++TCFDANHCPGA+IILFEPSNG
Sbjct  691   VHYKIGIPWDRLHVLPLNEKITIAGVNLTCFDANHCPGAVIILFEPSNG  739


 Score =   341 bits (874),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 163/227 (72%), Positives = 188/227 (83%), Gaps = 1/227 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF  EM      Q   IHTLILDTTYCNP+YDFP Q+ VIQFVIEAIQAEAF
Sbjct  741   AVLHTGDFRFSSEMANNRVLQSSPIHTLILDTTYCNPRYDFPTQEIVIQFVIEAIQAEAF  800

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERL++E+AR L KKIYV AAKL+IL+ LG P E M +FT NE ES
Sbjct  801   NPKTLFLIGSYTIGKERLYMEVARLLQKKIYVGAAKLQILKHLGLPQEIMHWFTANEAES  860

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKR+  +S QY  R+ LIVA  PTGWS GKGKK+TPG++WQQG IIRY
Sbjct  861   HIHVVPMWTLASFKRMKYLSTQYADRFDLIVAFCPTGWSFGKGKKRTPGRKWQQGAIIRY  920

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLS-LLSD  2031
             EVPYSEHSSF+EL++FV+FISP +IIPSVNN GP+S   ML+ LL+D
Sbjct  921   EVPYSEHSSFTELREFVRFISPEHIIPSVNNDGPDSANAMLAQLLND  967



>gb|EAZ09242.1| hypothetical protein OsI_31515 [Oryza sativa Indica Group]
Length=966

 Score =   347 bits (890),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 180/349 (52%), Positives = 234/349 (67%), Gaps = 22/349 (6%)
 Frame = +3

Query  327   LLKLCSEG-SEGDDDSMEAYQEDDCASEGNDDSSL-ICCPLCGRDITDLNEEQRQIHTNE  500
             L+ LC E  +EG   +  A  E +    G+ +SS  + CPLCG +I+DL+EE R +HTN 
Sbjct  406   LINLCMEDYTEGPLSNKVACLEGNGMDCGSFNSSCEVQCPLCGSNISDLSEELRLVHTNS  465

Query  501   CIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELF  680
             C+D  D PA+   S  D   +  G+             V +  V+EWLR LGL+KYEE+F
Sbjct  466   CLDG-DKPAKEPNS--DNQNEPCGE-----------SNVEKRRVMEWLRNLGLSKYEEIF  511

Query  681   IQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNAKKAVVDD  860
             I++E+DW+TLQWLTEEDL  +G+++LGPRKKI HAL ELRK+N    +    A    +++
Sbjct  512   IKEEVDWETLQWLTEEDLLGMGITSLGPRKKIAHALCELRKKNDDANDLA--ADMLNLEN  569

Query  861   TSKVKL----SKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKY  1028
             T K K+    +KLIT+YF+C ++  ++  A          S   S+ K+         K 
Sbjct  570   TKKAKIPMNGNKLITEYFRCPSSDQRQKKACKVNTPSNLNSQKNSNAKATGGRRTVKGKV  629

Query  1029  KDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKL  1208
             KD P+WC IPGTPFRVDAF+YLR DC HWFLTHFH DHYQGLT+SFCHGKIYCSSVTA L
Sbjct  630   KDTPIWCCIPGTPFRVDAFRYLRGDCCHWFLTHFHVDHYQGLTKSFCHGKIYCSSVTANL  689

Query  1209  VNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             V+ KIGIPWD + +LPLN++I IAG+++TCFDANHCPGA+IILFEPSNG
Sbjct  690   VHYKIGIPWDRLHVLPLNEKITIAGVNLTCFDANHCPGAVIILFEPSNG  738


 Score =   341 bits (875),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 163/227 (72%), Positives = 188/227 (83%), Gaps = 1/227 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF  EM      Q   IHTLILDTTYCNP+YDFP Q+ VIQFVIEAIQAEAF
Sbjct  740   AVLHTGDFRFSSEMANNRVLQSSPIHTLILDTTYCNPRYDFPTQEIVIQFVIEAIQAEAF  799

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERL++E+AR L KKIYV AAKL+IL+ LG P E M +FT NE ES
Sbjct  800   NPKTLFLIGSYTIGKERLYMEVARLLQKKIYVGAAKLQILKHLGLPQEIMHWFTANEAES  859

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKR+  +S QY  R+ LIVA  PTGWS GKGKK+TPG++WQQG IIRY
Sbjct  860   HIHVVPMWTLASFKRMKYLSTQYADRFDLIVAFCPTGWSFGKGKKRTPGRKWQQGAIIRY  919

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLS-LLSD  2031
             EVPYSEHSSF+EL++FV+FISP +IIPSVNN GP+S   ML+ LL+D
Sbjct  920   EVPYSEHSSFTELREFVRFISPEHIIPSVNNDGPDSANAMLAQLLND  966



>gb|EMS66631.1| DNA cross-link repair 1A protein [Triticum urartu]
Length=736

 Score =   347 bits (890),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/227 (74%), Positives = 188/227 (83%), Gaps = 1/227 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF  EM   P  Q   IHTLILDTTYCNP+YDFP Q+ VIQFVIEAIQAEAF
Sbjct  510   AVLHTGDFRFSSEMANNPVLQSSHIHTLILDTTYCNPRYDFPSQEIVIQFVIEAIQAEAF  569

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF E+AR L KKIYV AAKL+IL+ L  P E M + T NE ES
Sbjct  570   NPKTLFLIGSYTIGKERLFTEVARLLQKKIYVGAAKLQILKHLELPKEIMPWLTANEAES  629

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKRL  +S+QY  RY LIVA  PTGWS GKG+KKTPG+RWQQGTIIRY
Sbjct  630   HIHVVPMWTLASFKRLKHLSSQYADRYDLIVAFCPTGWSFGKGRKKTPGRRWQQGTIIRY  689

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLS-LLSD  2031
             EVPYSEHSSF+EL++FV+FISP +I+PSVNN GPES   ML+ LL+D
Sbjct  690   EVPYSEHSSFTELREFVRFISPEHIVPSVNNDGPESADAMLAQLLND  736


 Score =   340 bits (871),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 162/313 (52%), Positives = 218/313 (70%), Gaps = 20/313 (6%)
 Frame = +3

Query  429   ICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQ  608
             + CPLCG DI+DL+EE +  HTN C+DK D PA+    +R+    C G+ ++        
Sbjct  212   VQCPLCGLDISDLSEELQLAHTNNCLDK-DEPAKESNPNRERG-PCYGENIE--------  261

Query  609   KLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHAL  788
                    VVEWLR LGL+KYEE+F ++E+DW+TLQWLTEEDL  +G+++LGPRKKI+HAL
Sbjct  262   ----NKCVVEWLRNLGLSKYEEIFTKEEVDWETLQWLTEEDLLGMGITSLGPRKKIIHAL  317

Query  789   SELRKENTKEVEFQKNAKKAVVDDTSKVKL----SKLITDYFQCSAAGTKKVHATSCGQN  956
              ELRK+N    + +  A   + ++T + K     +KLIT++F+CS++  K+        +
Sbjct  318   GELRKKNDNANDTE--ADVLISENTKRTKGPMDGNKLITEFFRCSSSDQKQREHKVKKPS  375

Query  957   EVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHA  1136
              +      S+  +  +   +  K KD P+WC IPGTPFRVDAF+YLR DC HWFLTHFH 
Sbjct  376   NLNNQKNSSAKVATSRGRTRKAKVKDTPLWCCIPGTPFRVDAFRYLRGDCCHWFLTHFHL  435

Query  1137  DHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHC  1316
             DHYQGLT+SFCHGKIYC+S+TA LV+ KIG+ WD + +LPLN+RI +AG+D+TCFDANHC
Sbjct  436   DHYQGLTKSFCHGKIYCTSITANLVHHKIGVAWDRMHVLPLNKRITVAGVDLTCFDANHC  495

Query  1317  PGAIIILFEPSNG  1355
             PG+IIILFEP NG
Sbjct  496   PGSIIILFEPPNG  508



>ref|XP_010508124.1| PREDICTED: DNA cross-link repair 1A protein-like [Camelina sativa]
Length=738

 Score =   348 bits (892),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 218/459 (47%), Positives = 277/459 (60%), Gaps = 56/459 (12%)
 Frame = +3

Query  39    LDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKSVLEP  218
             LD IPS++DCS  G +    ED+   V    +K+G          ++ F    E      
Sbjct  89    LDCIPSSVDCSI-GPICSLGEDEHVLV----DKLG---------NDDCFKANRE------  128

Query  219   KKGYFVNSIESRLLkssagleegkgeel--gesselDMLLKLCSEGSEGDDDSMEAYQED  392
               GY  NS+E+RL KS   L    G        SE D+LLKLCSE SEG+     +  +D
Sbjct  129   --GYLCNSMEARLSKSRIRLGIDSGIHEDDESDSEFDVLLKLCSE-SEGNIGGECSLVKD  185

Query  393   DCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPA----EAVLSHRDTSF  560
             D           I CPLC  DI+ L+EEQRQ+HTN+C+D  D+ A    +  L   + S 
Sbjct  186   DS----------IQCPLCSIDISALSEEQRQVHTNKCLDNSDSQAPEQLQGSLRKCENSS  235

Query  561   QCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCK  740
               + + +D  P + PQ +    PV++WLR LGLAKYE++FI++EIDWDTLQ LTEEDL  
Sbjct  236   SLIEESID-DPVQLPQLVTDVSPVLKWLRSLGLAKYEDVFIREEIDWDTLQSLTEEDLLS  294

Query  741   IGVSALGPRKKIVHALSELRKE--NTKEVEFQKNAKKAVV-----DDTSKVKLS------  881
             IG+++LGPRKKIV+ALS LR+   ++ E + Q     A V     D T+  K S      
Sbjct  295   IGITSLGPRKKIVNALSGLREAFASSSEAQAQSPCTSAHVTERQRDKTTSRKASEPKKPT  354

Query  882   --KLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSI  1055
               KLIT++F   A    K+                SS ++V++N   S K K +P W  I
Sbjct  355   ANKLITEFFPGQATEGTKIRKAPKDPVAEKSPPDSSSRRAVRRN-GNSGKSKVVPHWNCI  413

Query  1056  PGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPW  1235
             PGTPFRVDAFKYL RDC HWFLTHFH DHYQGLT+SF HGKIYCS VTAKLVNMKIGIPW
Sbjct  414   PGTPFRVDAFKYLTRDCGHWFLTHFHLDHYQGLTKSFNHGKIYCSLVTAKLVNMKIGIPW  473

Query  1236  DNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSN  1352
             + +Q+L L Q++NIAG+DVTCFDANHCPG+IIILFEP+N
Sbjct  474   ERMQVLDLGQKVNIAGVDVTCFDANHCPGSIIILFEPAN  512


 Score =   338 bits (867),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 161/224 (72%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFR+ +EM          I +LILDTTYCNPQYDFPKQ+AVIQFV+EAIQAEAF
Sbjct  515   AVLHTGDFRYSEEMANW--LIGSHISSLILDTTYCNPQYDFPKQEAVIQFVVEAIQAEAF  572

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +KIY+  +KL++L+CLGF  EDMQ+FT+ E ES
Sbjct  573   NPKTLFLIGSYTIGKERLFLEVARVLREKIYINPSKLKLLECLGFSKEDMQWFTVKEEES  632

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVPLWTLA+FKRL  +SN+Y  RYSLIVA SPTGW+ GK KKK+PG+R QQGTIIRY
Sbjct  633   HIHVVPLWTLASFKRLKHVSNRYTNRYSLIVAFSPTGWTSGKTKKKSPGRRLQQGTIIRY  692

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+ELK+FV+ +SP  IIPSVNN GP+S   M+SLL
Sbjct  693   EVPYSEHSSFTELKEFVQKVSPEVIIPSVNNDGPDSAAAMVSLL  736



>gb|KFK37360.1| hypothetical protein AALP_AA4G246500 [Arabis alpina]
Length=734

 Score =   348 bits (892),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 196/401 (49%), Positives = 256/401 (64%), Gaps = 39/401 (10%)
 Frame = +3

Query  219   KKGYFVNSIESRLLkssagl-----eegkgeelgesselDMLLKLCSEGSEGDDDSMEAY  383
             ++GY  NS+E+RL KS   L      +   E +   SELD+L+KLCSE + G+     + 
Sbjct  126   REGYMCNSMEARLSKSRVYLGFDCGIKEDEEFVESDSELDVLIKLCSESNSGE----RSL  181

Query  384   QEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKED--APAEAVLSHRDTS  557
             ++DD          LI CPLC  DI+DL+EE+RQ+H+NEC+DK +  AP +  L   + S
Sbjct  182   RKDD----------LIQCPLCSMDISDLSEERRQVHSNECLDKSNNQAPKQDSLRKCENS  231

Query  558   FQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLC  737
                + + +D  P R P+ +    PV+ WLR LGLAKYE++FI++EIDWD+LQ LTEEDL 
Sbjct  232   SLFIEESVDDDPVRVPELVNDLSPVLNWLRNLGLAKYEDVFIREEIDWDSLQSLTEEDLL  291

Query  738   KIGVSALGPRKKIVHALSELRKENTKEVEFQKNA---------------KKAVVDDTSKV  872
              IG++ LGPRKKIV+ALS LR+      E Q  +                   V +  K 
Sbjct  292   SIGITTLGPRKKIVNALSALREAGVSSAEAQGQSLCTSTHVTVGQRDISSNRRVSELKKP  351

Query  873   KLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCS  1052
               +KLIT++F     GTK + +      E   S      +SV++N   + K K IP W  
Sbjct  352   AANKLITEFF-LGQDGTKILKSPKEPVTEKSPS-DSGCRRSVRRN-GNNGKSKAIPQWNC  408

Query  1053  IPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIP  1232
             IPGTPFRVDAFKYL RDC HWFLTHFH DHYQGLT+SF HGKIYCS +TAKLVNMKIGIP
Sbjct  409   IPGTPFRVDAFKYLTRDCCHWFLTHFHLDHYQGLTKSFSHGKIYCSLITAKLVNMKIGIP  468

Query  1233  WDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             W+ +++L L Q++NI+G DVTCFDANHCPG+I+ILFEP+NG
Sbjct  469   WERLEVLHLGQKVNISGTDVTCFDANHCPGSIMILFEPANG  509


 Score =   338 bits (866),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFR+ +EM          I +LILDTTYCNPQYDFPKQ+AVIQFV+E+IQAEAF
Sbjct  511   AVLHTGDFRYSEEMSNW--LMGSHISSLILDTTYCNPQYDFPKQEAVIQFVVESIQAEAF  568

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +KIY+  AKL++L+CLGF  EDMQ+FT+ E ES
Sbjct  569   NPKTLFLIGSYTIGKERLFLEVARVLHQKIYINPAKLKLLECLGFSKEDMQWFTVKEEES  628

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVPLWTLA+FKR+  I+N+Y  RYSLIVA SPTGW+ GK KKK+PG+R QQGTIIRY
Sbjct  629   HIHVVPLWTLASFKRMKHIANRYTNRYSLIVAFSPTGWTSGKAKKKSPGRRLQQGTIIRY  688

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+ELK+FV+ +SP  IIPSVNN GP+S   M+SLL
Sbjct  689   EVPYSEHSSFTELKEFVQQVSPEVIIPSVNNDGPDSAAAMVSLL  732



>ref|XP_007225556.1| hypothetical protein PRUPE_ppa003302m2g, partial [Prunus persica]
 gb|EMJ26755.1| hypothetical protein PRUPE_ppa003302m2g, partial [Prunus persica]
Length=479

 Score =   359 bits (922),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/225 (74%), Positives = 193/225 (86%), Gaps = 0/225 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF +    +   Q C IHTLILDTTYCNPQYDFPKQ+AVIQFVI+AIQAE F
Sbjct  250   AVLHTGDFRFSENAASMSFLQTCSIHTLILDTTYCNPQYDFPKQEAVIQFVIDAIQAETF  309

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERL++E+AR L K IY+   KL IL+CL FP+EDM++FT NE ES
Sbjct  310   NPKTLFLIGSYTIGKERLYLEVARVLRKNIYINPGKLHILKCLDFPEEDMRWFTSNEQES  369

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
              IHVVP+WTLA+FKRL  +SNQY  R+SLIVA SPTGW+ GKGKKK+PG+R QQGTIIRY
Sbjct  370   QIHVVPMWTLASFKRLKHMSNQYASRFSLIVAFSPTGWTFGKGKKKSPGRRSQQGTIIRY  429

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
             EVPYSEHSSF+ELK+FVK ISPA+IIPSVNNHGP+S + M+SLLS
Sbjct  430   EVPYSEHSSFTELKEFVKLISPADIIPSVNNHGPDSAKAMISLLS  474


 Score =   324 bits (831),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 158/248 (64%), Positives = 184/248 (74%), Gaps = 15/248 (6%)
 Frame = +3

Query  651   LGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELR----------  800
             LGL KYE+ F+++EIDWDTLQWLTEEDL  IG++ALGPRKKIVHAL++LR          
Sbjct  1     LGLEKYEDAFVREEIDWDTLQWLTEEDLFSIGIAALGPRKKIVHALTQLREGTTSPGIEA  60

Query  801   ---KENTKEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRS  971
                K +   VE   +A +  VD+ SK   +KLITDYF       K+V  TS  Q  V + 
Sbjct  61    QPRKRSASGVETVNDASEEPVDN-SKTAANKLITDYFPGFTTARKQVCTTSGEQQRVEKR  119

Query  972   LMYSSNKS-VKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQ  1148
                S +K    KN   + K +DIP WC IPGTPFRVDAFKYLRRDCSHWFLTHFH DHYQ
Sbjct  120   GSGSGHKGGAAKNHVTTRKLRDIPSWCCIPGTPFRVDAFKYLRRDCSHWFLTHFHMDHYQ  179

Query  1149  GLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAI  1328
             GLT+SFCHGKIYCSS+TAKLVNMKIGIPW+NI++LPLNQ+INIAGIDVTC DANHCPG++
Sbjct  180   GLTKSFCHGKIYCSSITAKLVNMKIGIPWNNIKVLPLNQKINIAGIDVTCLDANHCPGSV  239

Query  1329  IILFEPSN  1352
             IILFEP N
Sbjct  240   IILFEPPN  247



>ref|XP_002882028.1| sterile alpha motif domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH58287.1| sterile alpha motif domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=721

 Score =   349 bits (896),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 219/463 (47%), Positives = 280/463 (60%), Gaps = 66/463 (14%)
 Frame = +3

Query  39    LDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKSVLEP  218
             LD IPS++DCS                      +G       D K +   C         
Sbjct  76    LDCIPSSVDCS----------------------IGPISSLGEDDKVDKDDCIKVN-----  108

Query  219   KKGYFVNSIESRLLkssagl------eegkgeelgesselDMLLKLCSEGSEGDDDSMEA  380
             ++GY  NS+E+RLLKS   L       E   E +  +SELD+L+KLCSE SEG       
Sbjct  109   REGYLCNSMEARLLKSRIRLGFDRGIHEDDEEFVESNSELDVLIKLCSE-SEG-------  160

Query  381   YQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDK--EDAPAEAVLSHRDT  554
              +  +C S GNDDS  I CPLC  DI+ L+EEQRQ+H+N C+DK  +  P +  L   D 
Sbjct  161   -RSGEC-SLGNDDS--IQCPLCSMDISALSEEQRQVHSNTCLDKSYDQPPEQDSLRKCDN  216

Query  555   SFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDL  734
             S   + +  D  P + PQ +    PV++WLR LGLAKYE++FI++EIDWDTLQ LTEEDL
Sbjct  217   SSSLIEESTD-DPVQLPQLVTDLSPVLKWLRSLGLAKYEDVFIREEIDWDTLQSLTEEDL  275

Query  735   CKIGVSALGPRKKIVHALSELRK--ENTKEVEFQKNAKKAVVDDTSKVK-----------  875
               IG+++LGPRKKIV+AL  LR+   ++ E   Q +     V +  + K           
Sbjct  276   LSIGITSLGPRKKIVNALCGLREPFASSAEAHAQSHCTSGHVTERRRDKSTNRWASEPKK  335

Query  876   --LSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLM-YSSNKSVKKNPAKSTKYKDIPVW  1046
                +KLIT++F   A    K+      +  V RS    +S ++V++N   + K K IP W
Sbjct  336   PTANKLITEFFPGQATEGMKIRKAP-KEPVVERSPSDLNSRRAVRRN-GNNGKSKVIPHW  393

Query  1047  CSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIG  1226
               IPGTPFRVDAFKYL RDC HWFLTHFH DHYQGLT+SF HGKIYCS VTAKLVNMKIG
Sbjct  394   NCIPGTPFRVDAFKYLTRDCCHWFLTHFHLDHYQGLTKSFSHGKIYCSLVTAKLVNMKIG  453

Query  1227  IPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             IPW+ +Q+L L Q++NIAGIDVTCFDANHCPG+I+ILFEP+NG
Sbjct  454   IPWERLQVLDLGQKVNIAGIDVTCFDANHCPGSIMILFEPTNG  496


 Score =   333 bits (853),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFR+ +EM +       +I++LILDTTYCNPQYDFPKQ+AVIQFV+EAIQAEAF
Sbjct  498   AVLHTGDFRYSEEMSDW--LIGSQINSLILDTTYCNPQYDFPKQEAVIQFVVEAIQAEAF  555

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +KIY+  +KL++L+CLGF  EDMQ+FT+ E ES
Sbjct  556   NPKTLFLIGSYTIGKERLFLEVARVLREKIYINPSKLKLLECLGFSKEDMQWFTVKEEES  615

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVPLWTLA+FKRL  I+N+Y  RYSLIV  SPTGW+  K KKK+PG+R QQGTIIRY
Sbjct  616   HIHVVPLWTLASFKRLKHIANRYTNRYSLIVTFSPTGWTSSKTKKKSPGRRLQQGTIIRY  675

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+ELK+FV+  SP  IIPSVNN GP+S   M+SLL
Sbjct  676   EVPYSEHSSFTELKEFVQKASPEVIIPSVNNDGPDSAAAMVSLL  719



>ref|NP_182094.1| sterile alpha motif (SAM) domain-containing protein [Arabidopsis 
thaliana]
 gb|AAC28555.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAM14896.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAO64178.1| unknown protein [Arabidopsis thaliana]
 gb|AAP04089.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00373.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC10589.1| sterile alpha motif (SAM) domain-containing protein [Arabidopsis 
thaliana]
Length=723

 Score =   348 bits (892),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 217/466 (47%), Positives = 283/466 (61%), Gaps = 69/466 (15%)
 Frame = +3

Query  39    LDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKSVLEP  218
             LD IPS++DCS               + + N  +    E D + K++      E      
Sbjct  75    LDCIPSSVDCS---------------LGDFNGPISSLGEEDKEDKDDCIKVNRE------  113

Query  219   KKGYFVNSIESRLLkss------agleegkgeelgesselDMLLKLCSEGSEGDDDSMEA  380
               GY  NS+E+RLLKS       +G+ E     +  +SELD+L+ LCSE SEG       
Sbjct  114   --GYLCNSMEARLLKSRICLGFDSGIHEDDEGFVESNSELDVLINLCSE-SEGRSGEF--  168

Query  381   YQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKE-DAPAEAVLSHRDTS  557
                    S G DDS  I CPLC  DI+ L+EEQRQ+H+N C+DK  + P+E     +D+ 
Sbjct  169   -------SLGKDDS--IQCPLCSMDISSLSEEQRQVHSNTCLDKSYNQPSE-----QDSL  214

Query  558   FQC--LGQVLDAS---PARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLT  722
              +C  L  ++  S   P + PQ +    PV++WLR LGLAKYE++FI++EIDWDTLQ LT
Sbjct  215   RKCENLSSLIKESIDDPVQLPQLVTDLSPVLKWLRSLGLAKYEDVFIREEIDWDTLQSLT  274

Query  723   EEDLCKIGVSALGPRKKIVHALSELRK--ENTKEVEFQKNAKKAVVDDTSKVK-------  875
             EEDL  IG+++LGPRKKIV+ALS +R    ++ EV+ Q +     V +  + K       
Sbjct  275   EEDLLSIGITSLGPRKKIVNALSGVRDPFASSAEVQAQSHCTSGHVTERQRDKSTTRKAS  334

Query  876   ------LSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDI  1037
                    +KLIT++F   A    K+        E   S   SS ++V++N   + K K I
Sbjct  335   EPKKPTANKLITEFFPGQATEGTKIRTAPKPVAEKSPS-DSSSRRAVRRN-GNNGKSKVI  392

Query  1038  PVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNM  1217
             P W  IPGTPFRVDAFKYL RDC HWFLTHFH DHYQGLT+SF HGKIYCS VTAKLVNM
Sbjct  393   PHWNCIPGTPFRVDAFKYLTRDCCHWFLTHFHLDHYQGLTKSFSHGKIYCSLVTAKLVNM  452

Query  1218  KIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             KIGIPW+ +Q+L L Q++NI+GIDVTCFDANHCPG+I+ILFEP+NG
Sbjct  453   KIGIPWERLQVLDLGQKVNISGIDVTCFDANHCPGSIMILFEPANG  498


 Score =   333 bits (855),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFR+ +EM          I +LILDTTYCNPQYDFPKQ+AVIQFV+EAIQAEAF
Sbjct  500   AVLHTGDFRYSEEMSNW--LIGSHISSLILDTTYCNPQYDFPKQEAVIQFVVEAIQAEAF  557

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +KIY+  AKL++L+CLGF  +D+Q+FT+ E ES
Sbjct  558   NPKTLFLIGSYTIGKERLFLEVARVLREKIYINPAKLKLLECLGFSKDDIQWFTVKEEES  617

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVPLWTLA+FKRL  ++N+Y  RYSLIVA SPTGW+ GK KKK+PG+R QQGTIIRY
Sbjct  618   HIHVVPLWTLASFKRLKHVANRYTNRYSLIVAFSPTGWTSGKTKKKSPGRRLQQGTIIRY  677

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+ELK+FV+ +SP  IIPSVNN GP+S   M+SLL
Sbjct  678   EVPYSEHSSFTELKEFVQKVSPEVIIPSVNNDGPDSAAAMVSLL  721



>ref|XP_006293744.1| hypothetical protein CARUB_v10022707mg [Capsella rubella]
 gb|EOA26642.1| hypothetical protein CARUB_v10022707mg [Capsella rubella]
Length=744

 Score =   347 bits (889),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 214/464 (46%), Positives = 278/464 (60%), Gaps = 57/464 (12%)
 Frame = +3

Query  39    LDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKSVLEP  218
             LD IPS++DCS      P       +++E  + +   +E D   K               
Sbjct  88    LDCIPSSVDCSIGDFSAP-----ICSLVEDGQVLVDKLENDDCFKAN-------------  129

Query  219   KKGYFVNSIESRLLkssagleegk-----geelgesselDMLLKLCSEGSEGDDDSMEAY  383
             ++GY  NS+E+RL KS   L            +   SELD+LLKLCSE SEG+       
Sbjct  130   REGYLCNSMEARLSKSRIRLGIDSGIHEDESFVESDSELDVLLKLCSE-SEGNSG-----  183

Query  384   QEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHR----D  551
                +C+   +D   LI CPLC  DI+ L EEQRQ+HTN+C+D  D  A   L       D
Sbjct  184   ---ECSLSKDD---LIQCPLCSMDISALGEEQRQVHTNKCLDNSDNHAPEQLQDSLKKCD  237

Query  552   TSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEED  731
              S   + + +D  P + PQ +    PV++WLR LGLAKYE++FI++EIDWDTL  LTEED
Sbjct  238   KSSSLIEESID-DPVQLPQLVTDLSPVLKWLRSLGLAKYEDVFIREEIDWDTLHSLTEED  296

Query  732   LCKIGVSALGPRKKIVHALSELRK---ENTKEVEFQKNAKKAVV-----DDTSKVKLS--  881
             L  IG+++LGPRKKIV+ALS LR+    + +E + Q++   + +     D T+  K S  
Sbjct  297   LLSIGITSLGPRKKIVNALSGLREVDASSAEEAQAQRHCTSSHITGRHEDKTTNRKASVP  356

Query  882   ------KLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPV  1043
                   KLIT++F   A    K+                SS ++V++N   + K K IP 
Sbjct  357   KKPTANKLITEFFPGQATEGTKIRKAPKDPVAEKSPPDSSSRRAVRRN-GNNGKSKVIPR  415

Query  1044  WCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKI  1223
             W  IPGTPFRVDAFKYL R+CSHWFLTHFH DHYQGLT+SF HGKIYCS VTAKLVNMKI
Sbjct  416   WNCIPGTPFRVDAFKYLTRECSHWFLTHFHLDHYQGLTKSFNHGKIYCSLVTAKLVNMKI  475

Query  1224  GIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             GIPW+ + +L L Q++NIAGIDVTCFDANHCPG+II+LFEP+NG
Sbjct  476   GIPWERLHVLDLGQKVNIAGIDVTCFDANHCPGSIIMLFEPANG  519


 Score =   334 bits (857),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 188/224 (84%), Gaps = 2/224 (1%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFR+ +EM          I +LILDTTYCNPQYDFPKQ+AVIQFV+EAIQAEAF
Sbjct  521   AVLHTGDFRYSEEMSNW--LIGSHISSLILDTTYCNPQYDFPKQEAVIQFVVEAIQAEAF  578

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+ LFLIGSYTIGKERLF+E+AR L +KIY+  +KL++L+CLGF  EDMQ+FT+ E ES
Sbjct  579   NPKALFLIGSYTIGKERLFLEVARVLREKIYINPSKLKLLECLGFSKEDMQWFTVKEEES  638

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVPLWTLA+FKR+  I+N+Y  RYSLIVA SPTGW+ GK KKK+PG+R QQGTIIRY
Sbjct  639   HIHVVPLWTLASFKRMKHIANRYTNRYSLIVAFSPTGWTSGKTKKKSPGRRLQQGTIIRY  698

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+ELK+FV+ +SP  IIPSVNN GP+S   M+SLL
Sbjct  699   EVPYSEHSSFTELKEFVQKVSPEVIIPSVNNEGPDSAAAMVSLL  742



>ref|XP_009142356.1| PREDICTED: DNA cross-link repair 1A protein [Brassica rapa]
Length=703

 Score =   345 bits (885),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 162/224 (72%), Positives = 193/224 (86%), Gaps = 2/224 (1%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFR+ +EM+ + +  P  I +L+LDTTYCNPQYDFPKQ+AVIQFV+EAIQAEAF
Sbjct  480   AVLHTGDFRYSEEMLNLLTGSP--ISSLVLDTTYCNPQYDFPKQEAVIQFVVEAIQAEAF  537

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +KIY+  AKL++L+CLGF  EDMQ+FT+ E ES
Sbjct  538   NPKTLFLIGSYTIGKERLFLEVARVLREKIYINPAKLKLLECLGFSKEDMQWFTVKEEES  597

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVPLWTLA+FKRL  I+N+Y  RYSLIVA SPTGW+ GK KKKTPG+R QQGTIIRY
Sbjct  598   HIHVVPLWTLASFKRLKHIANRYTNRYSLIVAFSPTGWTSGKSKKKTPGRRLQQGTIIRY  657

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+ELK+FV+ +SP  IIPSVNN GP+S   M+S+L
Sbjct  658   EVPYSEHSSFTELKEFVEQVSPEVIIPSVNNDGPDSAAAMVSML  701


 Score =   333 bits (854),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/460 (44%), Positives = 273/460 (59%), Gaps = 73/460 (16%)
 Frame = +3

Query  39    LDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKSVLEP  218
             LD IPS++DCS         E  C ++  + E  GV ++   + K E F    E      
Sbjct  71    LDCIPSSVDCSS------ASEPFC-SLAAKVENDGVLVDGK-EKKGECFKANRE------  116

Query  219   KKGYFVNSIESRLLkssagleegkgee------lgesselDMLLKLCSEGSEGDDDSMEA  380
               GY  NS+E+RLL  S      + EE      +   SELD+L+KLCS      DDS++ 
Sbjct  117   --GYSCNSMEARLLLKSRVSLRLEDEEEDECCFVESDSELDVLIKLCS------DDSIQ-  167

Query  381   YQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDTSF  560
                               CPLC  DI+ L+EE+RQ+HTN C+DK  AP +  L   + S 
Sbjct  168   ------------------CPLCETDISSLSEEERQVHTNNCLDK--APEQDSLRRCEKSS  207

Query  561   QCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCK  740
               + + +D      P+ +    PV++W+R LGLAKYE++F+++EIDWDTLQ LTEEDL  
Sbjct  208   SLIEESVD-----NPELVNDLSPVLKWVRSLGLAKYEDVFLREEIDWDTLQSLTEEDLLS  262

Query  741   IGVSALGPRKKIVHALSELRKE--------------NTKEVEFQKNAKKAVVDDTSKVKL  878
             IG+++LGPRKKIV+ALS LR+E              N  E + +++  +    +  K   
Sbjct  263   IGITSLGPRKKIVNALSALREEASASSAEPQGQSLSNVTERQRERSTTRKA-SEPRKPTA  321

Query  879   SKLITDYFQCSAA-GTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSI  1055
             +KLIT++F   A  G +K+      +     S       +V++N   + K K +P W  +
Sbjct  322   NKLITEFFPGQATDGIRKLPKEPVTEKSAADS--GCRRAAVRRN-GNNGKSKAVPQWNCV  378

Query  1056  PGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPW  1235
             PGTPFRVDAFKYL RDC HWFLTHFH DHYQGLT+SF HGKIYCS +TAKLVNMKIGIPW
Sbjct  379   PGTPFRVDAFKYLTRDCCHWFLTHFHLDHYQGLTKSFSHGKIYCSLITAKLVNMKIGIPW  438

Query  1236  DNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             + +Q+L L Q+++IAG+DVTCFDANHCPG+I+I FEP+NG
Sbjct  439   ERLQVLHLGQKVSIAGVDVTCFDANHCPGSIMIRFEPANG  478



>ref|XP_006660659.1| PREDICTED: uncharacterized protein LOC102700457, partial [Oryza 
brachyantha]
Length=932

 Score =   342 bits (877),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/347 (48%), Positives = 228/347 (66%), Gaps = 22/347 (6%)
 Frame = +3

Query  327   LLKLCSEG-SEGDDDSMEAYQEDDCASEGNDDS-SLICCPLCGRDITDLNEEQRQIHTNE  500
             L+ LC E  +EG   +  +  E +    G+  S + + CP+CG D+++L+EE + +HTN 
Sbjct  376   LINLCMEDYAEGPFSNRASCLEGNGMDSGSFSSVNQVQCPVCGSDLSELSEELQLVHTNS  435

Query  501   CIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELF  680
             C+D+++   E   +H++                  +      PVVEWLR LGL+KYEE+F
Sbjct  436   CLDRDEPAKEPDSNHQN------------------EPCAENMPVVEWLRNLGLSKYEEIF  477

Query  681   IQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNAKKAVVDD  860
             I++E+DW+TLQWLTEEDL  +G+ +LGPRK+I HALSEL+K+N    +   +      + 
Sbjct  478   IKEEVDWETLQWLTEEDLLGMGIISLGPRKRIAHALSELQKKNDDANDLANDVLNMENNK  537

Query  861   TSKVKLS--KLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKD  1034
              +K+ ++  KLIT+YF+CS+   +   A          S   S+ K+         K KD
Sbjct  538   KAKLPMNGNKLITEYFRCSSFDQRPRKACKISTPSNLNSQKNSNAKASSGRHTVKGKVKD  597

Query  1035  IPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
              P+WC IPGTPFRVDAF+YLR DC HWFLTHFH DHYQGLT+SFCHGKIYCSSVTA LV+
Sbjct  598   TPLWCCIPGTPFRVDAFRYLRGDCCHWFLTHFHVDHYQGLTKSFCHGKIYCSSVTASLVH  657

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              KIGIPWD + +LPLN++I +AG+++TCFDANHCPGAIIILFEP NG
Sbjct  658   HKIGIPWDRLHVLPLNEKITVAGVNLTCFDANHCPGAIIILFEPPNG  704


 Score =   335 bits (859),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 161/227 (71%), Positives = 186/227 (82%), Gaps = 1/227 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF  EM      Q   IHTLILDTTYCNP+YDFP Q+ VIQFVIEAIQAEAF
Sbjct  706   AVLHTGDFRFSSEMANNHILQSSPIHTLILDTTYCNPRYDFPSQEIVIQFVIEAIQAEAF  765

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L KKIYV AAKL+IL+ L  P +   +FT NE ES
Sbjct  766   NPKTLFLIGSYTIGKERLFMEVARLLQKKIYVGAAKLQILKHLELPQDIFHWFTANEAES  825

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKR+  +S QY  R+ LIVA  PTGWS GKGKK+TPG++WQQG IIRY
Sbjct  826   HIHVVPMWTLASFKRMKYLSTQYADRFDLIVAFCPTGWSFGKGKKRTPGRKWQQGAIIRY  885

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLS-LLSD  2031
             EVPYSEHSSF+EL++FV+FISP +IIPSVNN GP+S   ML+ LL+D
Sbjct  886   EVPYSEHSSFTELREFVRFISPEHIIPSVNNDGPDSANAMLAQLLND  932



>ref|XP_010672310.1| PREDICTED: DNA cross-link repair protein SNM1 [Beta vulgaris 
subsp. vulgaris]
Length=703

 Score =   352 bits (903),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 175/330 (53%), Positives = 233/330 (71%), Gaps = 19/330 (6%)
 Frame = +3

Query  381   YQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAP-AEAVLSHRDTS  557
             Y+EDD +S  ++    + CP+CG DI+  +EE RQ H N C+D   AP  ++    ++ +
Sbjct  159   YEEDDNSS--HEPGPALVCPMCGIDISLWDEESRQSHANACLDNLVAPKGDSPGGAKNET  216

Query  558   FQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLC  737
              Q      D    ++ +   A   V++WL  LGLAKYE  F++QEIDW++LQWLTEEDL 
Sbjct  217   LQSS----DKPSVQSSEPASAEAAVIKWLHSLGLAKYEAAFVEQEIDWESLQWLTEEDLI  272

Query  738   KIGVSALGPRKKIVHALSELR-KENTKEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSA  914
              IG++ALGPRKKI+ +L +LR K+N  E +  +++  A  ++  K  ++KLIT+YF  S 
Sbjct  273   AIGINALGPRKKILESLRQLRNKDNISEEQGNRDSVYAG-NEAKKPAMNKLITEYFS-SP  330

Query  915   AGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKS---TKYKDIPVWCSIPGTPFRVDAF  1085
             +G KK  A+S  Q    +S       S ++ PAKS    K KD+P+WCSIPGTPFRVDAF
Sbjct  331   SGVKKNLASSRQQTTTAKS------NSCQRIPAKSFSNGKNKDVPLWCSIPGTPFRVDAF  384

Query  1086  KYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQ  1265
             +YLRRDCSHWFLTHFH DHYQGLTRSF +GK+YCS +TAKLVN KIGIPW+ +Q++PLNQ
Sbjct  385   RYLRRDCSHWFLTHFHIDHYQGLTRSFAYGKVYCSMITAKLVNAKIGIPWEKLQVMPLNQ  444

Query  1266  RINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             +IN+AGIDVTC+DANHCPG++IILFEP NG
Sbjct  445   KINVAGIDVTCYDANHCPGSVIILFEPPNG  474


 Score =   324 bits (830),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 184/226 (81%), Gaps = 2/226 (1%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF +EM    S     I+ LILDTTYC+PQY+FPKQ+ V+QFVIEAIQAE+F
Sbjct  476   AVLHTGDFRFNEEMANTLSQLGGHINALILDTTYCSPQYNFPKQEVVVQFVIEAIQAESF  535

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             N +TLFLIGSYT+GKER+F+E+AR L KKI+V AAKLR+L+CL  P EDMQ+FTLNE ES
Sbjct  536   NSKTLFLIGSYTVGKERIFIEVARVLRKKIHVPAAKLRLLECLELPSEDMQWFTLNEHES  595

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKT--PGKRWQQGTII  1887
             +IH+VP+WT+A+FKRL Q+S+QY  R+SLIVA SPTGW+ GKGKK     G+RWQQGTII
Sbjct  596   NIHIVPMWTIASFKRLKQLSSQYAERFSLIVAFSPTGWAFGKGKKNAGRAGRRWQQGTII  655

Query  1888  RYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             RYEVPYSEH SF EL++FVK ISP  IIPSVNN    S+  M+ LL
Sbjct  656   RYEVPYSEHCSFEELREFVKLISPTKIIPSVNNDSEASSNAMIELL  701



>ref|XP_010506532.1| PREDICTED: DNA cross-link repair 1A protein-like isoform X1 [Camelina 
sativa]
Length=735

 Score =   340 bits (873),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 213/460 (46%), Positives = 271/460 (59%), Gaps = 56/460 (12%)
 Frame = +3

Query  39    LDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKSVLEP  218
             LD IPS++DCS        EED+                 D    ++ F    E      
Sbjct  86    LDCIPSSVDCSIGPICSLGEEDQVL--------------VDKLGNDDCFKANRE------  125

Query  219   KKGYFVNSIESRLLkssagleegkgeel--gesselDMLLKLCSEGSEGDDDSMEAYQED  392
               GY  NS+E+RL KS   L    G        SE D+LLKLCSE SEG+     +  +D
Sbjct  126   --GYLCNSMEARLSKSRIRLGIDSGIHEDDESDSEFDVLLKLCSE-SEGNIGGECSIVKD  182

Query  393   DCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDK--EDAPAEAVLSHR--DTSF  560
             D           I CPLC  DI+ L+EE RQ+HTN+C+D      P +   S R  + S 
Sbjct  183   DS----------IQCPLCSIDISALSEELRQVHTNKCLDNPVNQVPEQLQDSLRKCEKSS  232

Query  561   QCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCK  740
               + + +D  P + PQ +    PV++WLR LGLAKYE++FI++EIDWDTLQ L EEDL  
Sbjct  233   SLIEESID-DPVQLPQLVTDVSPVLKWLRSLGLAKYEDVFIREEIDWDTLQSLAEEDLLS  291

Query  741   IGVSALGPRKKIVHALSELRKE--NTKEVEFQKNAKKAVV-----DDTSKVKLS------  881
             IG+++LGPRKKIV+ALS LR+   ++ E + Q +   A V     D T+  K S      
Sbjct  292   IGITSLGPRKKIVNALSGLREAFASSSEAQAQSHCPSAHVTERQRDKTTNRKASEPKKPT  351

Query  882   --KLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSI  1055
               KLIT++F   A    K+                SS ++V++N   + K K +P W  I
Sbjct  352   ANKLITEFFPGQATEGTKIRKAPKDPVAEKSPPDSSSRRAVRRN-CNNGKSKVVPHWNCI  410

Query  1056  PGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPW  1235
             PGTPFRVDAFKYL RDC HWFLTHFH DHYQGLT+SF HGKIYCS VTAKLVNMKIGIPW
Sbjct  411   PGTPFRVDAFKYLTRDCGHWFLTHFHLDHYQGLTKSFNHGKIYCSLVTAKLVNMKIGIPW  470

Query  1236  DNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             + +Q+L L Q++NIAG+DVTCFDANHCPG+I+ILFEP+NG
Sbjct  471   ERLQVLDLGQKVNIAGVDVTCFDANHCPGSIMILFEPANG  510


 Score =   335 bits (859),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 189/224 (84%), Gaps = 2/224 (1%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFR+ +EM          I +LILDTTYCNPQYDFPKQ+AVIQFV+EAIQAEAF
Sbjct  512   AVLHTGDFRYSEEMANW--LIGSHISSLILDTTYCNPQYDFPKQEAVIQFVVEAIQAEAF  569

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +KIY+  +KL++L+CLGF  EDMQ+FT+ E ES
Sbjct  570   NPKTLFLIGSYTIGKERLFLEVARVLREKIYINPSKLKLLECLGFSKEDMQWFTVKEEES  629

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVPLWTLA+FKRL  ++N+Y  RYSLIVA SPTGW+ GK KKK+PG++ QQGTIIRY
Sbjct  630   HIHVVPLWTLASFKRLKHVANRYTNRYSLIVAFSPTGWTSGKSKKKSPGRKLQQGTIIRY  689

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+ELK+FV+ +SP  IIPSVNN GP+S   M+SLL
Sbjct  690   EVPYSEHSSFTELKEFVQKVSPEVIIPSVNNDGPDSAAAMVSLL  733



>emb|CDY27366.1| BnaC04g50390D [Brassica napus]
Length=717

 Score =   342 bits (876),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 193/224 (86%), Gaps = 2/224 (1%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFR+ +EM+ + +  P  I +L+LDTTYCNPQYDFPKQ+AVIQFV+EAIQAEAF
Sbjct  494   AVLHTGDFRYSEEMLNLLTGSP--ISSLVLDTTYCNPQYDFPKQEAVIQFVVEAIQAEAF  551

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +KIY+  AKL++L+CLGF  EDM++FT+ E ES
Sbjct  552   NPKTLFLIGSYTIGKERLFLEVARVLREKIYINPAKLKLLECLGFSKEDMRWFTVKEEES  611

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVPLWTLA+FKRL  I+N+Y  RYSLIVA SPTGW+ GK KKK+PG+R QQGTIIRY
Sbjct  612   HIHVVPLWTLASFKRLKHIANRYTNRYSLIVAFSPTGWTSGKSKKKSPGRRLQQGTIIRY  671

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+ELK+FV+ +SP  IIPSVNN GP+S   M+S+L
Sbjct  672   EVPYSEHSSFTELKEFVQQVSPEVIIPSVNNDGPDSAAAMVSML  715


 Score =   333 bits (855),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/457 (45%), Positives = 275/457 (60%), Gaps = 63/457 (14%)
 Frame = +3

Query  42    DSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKSVLEPK  221
             D IPS++DCS         E  C ++  + E  GV +      K E F    E       
Sbjct  80    DCIPSSVDCS--------GEPFC-SLAAEVENDGVLV--GGKEKGECFKANRE-------  121

Query  222   KGYFVNSIESRLLkssagleegkgee---lgesselDMLLKLCSEGSEGDDDSMEAYQED  392
              GY  NS+E+RLL  S      + +E   +   SELD+L+KLCSE  EG +         
Sbjct  122   -GYSCNSMEARLLLKSRVSLRLEEDECCFVESDSELDVLIKLCSE-PEGSN---------  170

Query  393   DCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDTSFQCLG  572
               +  G DDS  I CPLC  DI+ L+EE+R +HTN C+D + AP +  L   + SF  + 
Sbjct  171   --SGGGKDDS--IQCPLCETDISGLSEEERHVHTNNCLDTQ-APEQDSLRRCEKSFSLIE  225

Query  573   Q-VLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGV  749
             + V+D      PQ +    PV++W+R LGLAKYE++F+++EIDWDTL  LTEEDL  IG+
Sbjct  226   ESVVD------PQLVNDLSPVLKWIRSLGLAKYEDVFLREEIDWDTLHSLTEEDLLSIGI  279

Query  750   SALGPRKKIVHALSELRKE--------------NTKEVEFQKNAKKAVVDDTSKVKLSKL  887
             ++LGPRKKIV+ALS LR+E              N  E + +++  +    +  K   +KL
Sbjct  280   TSLGPRKKIVNALSALREEACASSAEPQAQSLSNVTERQRERSTTRKA-SEPRKPTANKL  338

Query  888   ITDYFQCSAA-GTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGT  1064
             IT++F   A  G +K+      +     S       +V++N   + K K +P W  +PGT
Sbjct  339   ITEFFPGQATDGIRKLPKEHVAEKSAADS--GCRRAAVRRN-GNNGKSKVVPQWNCVPGT  395

Query  1065  PFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNI  1244
             PFRVDAFKYL RDC HWFLTHFH DHYQGLT+SF HGKIYCS +TAKLVNMKI IPW+ +
Sbjct  396   PFRVDAFKYLTRDCCHWFLTHFHLDHYQGLTKSFSHGKIYCSLITAKLVNMKIAIPWERL  455

Query  1245  QILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             ++L LNQ+++IAG+DVTCFDANHCPG+I+I FEP+NG
Sbjct  456   EVLQLNQKVSIAGVDVTCFDANHCPGSIMIRFEPANG  492



>ref|XP_010518204.1| PREDICTED: DNA cross-link repair 1A protein-like [Camelina sativa]
Length=737

 Score =   340 bits (872),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 214/461 (46%), Positives = 274/461 (59%), Gaps = 60/461 (13%)
 Frame = +3

Query  39    LDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKSVLEP  218
             LD IPS++DCS      P        +    +KV           N+ F    E      
Sbjct  90    LDCIPSSVDCSIGDFTGP--------ICSLGDKVD---------NNDCFKANRE------  126

Query  219   KKGYFVNSIESRLLkssagl---eegkgeelgesselDMLLKLCSEGSEGDDDSMEAYQE  389
               GY  NS+E+RL KS   L        ++    SE D+LLKLCSE SEG+     +  +
Sbjct  127   --GYLCNSMEARLSKSRIRLGIDSGIHEDDDESDSEFDVLLKLCSE-SEGNIGGECSLVK  183

Query  390   DDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKED--APAEAVLSHR--DTS  557
             DD           I CPLC  DI+ L+EEQRQ+HTN+C+D  D  AP +   S R  + S
Sbjct  184   DDS----------IQCPLCSMDISALSEEQRQVHTNKCLDNSDNQAPEQLQDSLRKCEKS  233

Query  558   FQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLC  737
             +  + + +D  P + PQ +    PV++WLR LGLAKYE++FI++EIDWDTL  LTEEDL 
Sbjct  234   YSLIEESID-DPVQLPQLVTDLSPVLKWLRSLGLAKYEDVFIREEIDWDTLHSLTEEDLL  292

Query  738   KIGVSALGPRKKIVHALSELRKE--NTKEVEFQKNAKKAVV-----DDTSKVKLS-----  881
              IG+++LGPRKKIV+ALS LR+   ++ E + Q N   A V     D T+  K S     
Sbjct  293   SIGITSLGPRKKIVNALSGLREAFVSSSEAQAQSNCTSAHVTARQRDKTTSRKASEPKKT  352

Query  882   ---KLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCS  1052
                KLIT++F   A    K+                SS ++V++N   + K K IP W  
Sbjct  353   TANKLITEFFPGQATDGTKIRKAPKDPVAEKSPPDSSSRRAVRRN-GNNGKSKVIPHWNC  411

Query  1053  IPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIP  1232
             I GTPF VDAFKYL R+C HWFLTHFH DHYQGLT+SF HGKIYCS VTAKLVNMKIGIP
Sbjct  412   ILGTPFLVDAFKYLTRNCGHWFLTHFHLDHYQGLTKSFNHGKIYCSLVTAKLVNMKIGIP  471

Query  1233  WDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             W+ +Q+L L Q++NIAG+DVTCFDANHCPG+I+ILFEP+NG
Sbjct  472   WERLQVLELGQKVNIAGVDVTCFDANHCPGSIMILFEPANG  512


 Score =   333 bits (853),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 158/224 (71%), Positives = 188/224 (84%), Gaps = 2/224 (1%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFR+ +EM          I +LILDTTYCNPQYDFPKQ+AVIQFV+EAIQAEAF
Sbjct  514   AVLHTGDFRYSEEMANW--LIGSHISSLILDTTYCNPQYDFPKQEAVIQFVVEAIQAEAF  571

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +KIY+  +KL++ +CLGF  EDMQ+FT+ E ES
Sbjct  572   NPKTLFLIGSYTIGKERLFLEVARVLREKIYINPSKLKLFECLGFSKEDMQWFTVKEEES  631

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVPLWTLA+FKRL  ++N+Y  RYSLIVA SPTGW+ GK KKK+PG+R+Q GTIIRY
Sbjct  632   HIHVVPLWTLASFKRLKHVANRYTNRYSLIVAFSPTGWTSGKTKKKSPGRRFQLGTIIRY  691

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+ELK+FV+ +SP  IIPSVNN GP+S   M+SLL
Sbjct  692   EVPYSEHSSFTELKEFVQKVSPEVIIPSVNNDGPDSAAAMVSLL  735



>ref|XP_003576570.1| PREDICTED: uncharacterized protein LOC100843196 [Brachypodium 
distachyon]
Length=910

 Score =   337 bits (863),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 163/227 (72%), Positives = 185/227 (81%), Gaps = 1/227 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             A+LHTGDFRF  EM   P  Q   IHTLILDTTYC+P+YDFP Q+ VIQFVIEAIQAEAF
Sbjct  684   AILHTGDFRFSSEMANNPVLQSSHIHTLILDTTYCSPRYDFPSQETVIQFVIEAIQAEAF  743

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             N +TLFLIGSYTIGKERLF E+ R L KKIYV AAKL+IL+ L  P E M + T NE ES
Sbjct  744   NKKTLFLIGSYTIGKERLFTEVGRLLQKKIYVGAAKLQILKHLELPQEIMPWLTANEAES  803

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
              IHVVP+WTLA+FKRL  +S+QY  R+ LIVA  PTGWS GKGKKKTPG+RWQQGTIIRY
Sbjct  804   QIHVVPMWTLASFKRLKHLSSQYADRFDLIVAFCPTGWSFGKGKKKTPGRRWQQGTIIRY  863

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLS-LLSD  2031
             EVPYSEHSSF+EL++FV+FISP +IIPSVNN GPES   ML+ LL+D
Sbjct  864   EVPYSEHSSFTELREFVRFISPEHIIPSVNNDGPESADAMLAQLLND  910


 Score =   336 bits (861),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 161/313 (51%), Positives = 215/313 (69%), Gaps = 24/313 (8%)
 Frame = +3

Query  435   CPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKL  614
             CPLC  DI+DL+ E +  HTN C+D+ +   E+  +H      C G+ ++          
Sbjct  388   CPLCRSDISDLSVELQLAHTNNCLDEGEPAKESKSNHERGP--CAGENIE----------  435

Query  615   VARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSE  794
                  V+EWLR LGL+KYEE FI++E+DW+TLQWLTEEDL  +G+++LGPRKKIVHAL E
Sbjct  436   --NKCVLEWLRNLGLSKYEECFIKEEVDWETLQWLTEEDLLGMGINSLGPRKKIVHALGE  493

Query  795   LRKENTK------EVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQN  956
             LRK+N +      EV F +N  +  +     +  +KLIT+YFQC ++  K+        +
Sbjct  494   LRKKNDRANDTEPEVLFSENNNRTKL----PMNGNKLITEYFQCFSSDQKQRDRKVQKPS  549

Query  957   EVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHA  1136
              +      S+  +  ++  +  K KD P+WC IPGTPFRVD+F+YLR DCSHWFLTHFH 
Sbjct  550   NLNSQKKSSAKVATSRSLIRKGKVKDTPIWCCIPGTPFRVDSFRYLRGDCSHWFLTHFHL  609

Query  1137  DHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHC  1316
             DHYQGLTRSFCHGKI+CSS+TAKLV+ KIG+PWD   +LPLN+RI ++G+++TCFDANHC
Sbjct  610   DHYQGLTRSFCHGKIFCSSITAKLVHHKIGVPWDRFHVLPLNKRITVSGVNLTCFDANHC  669

Query  1317  PGAIIILFEPSNG  1355
             PGAIIILFEP +G
Sbjct  670   PGAIIILFEPPSG  682



>emb|CDY37057.1| BnaA04g26350D [Brassica napus]
Length=691

 Score =   345 bits (886),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 162/224 (72%), Positives = 193/224 (86%), Gaps = 2/224 (1%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFR+ +EM+ + +  P  I +L+LDTTYCNPQYDFPKQ+AVIQFV+EAIQAEAF
Sbjct  468   AVLHTGDFRYSEEMLNLLTGSP--ISSLVLDTTYCNPQYDFPKQEAVIQFVVEAIQAEAF  525

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +KIY+  AKL++L+CLGF  EDMQ+FT+ E ES
Sbjct  526   NPKTLFLIGSYTIGKERLFMEVARVLREKIYINPAKLKLLECLGFSKEDMQWFTVKEEES  585

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVPLWTLA+FKRL  I+N+Y  RYSLIVA SPTGW+ GK KKKTPG+R QQGTIIRY
Sbjct  586   HIHVVPLWTLASFKRLKHIANRYTNRYSLIVAFSPTGWTSGKSKKKTPGRRLQQGTIIRY  645

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+ELK+FV+ +SP  IIPSVNN GP+S   M+S+L
Sbjct  646   EVPYSEHSSFTELKEFVEQVSPEVIIPSVNNDGPDSAAAMVSML  689


 Score =   325 bits (833),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/459 (43%), Positives = 267/459 (58%), Gaps = 83/459 (18%)
 Frame = +3

Query  39    LDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKSVLEP  218
             LD IPS++DCS   + +P                  F    +  +N+   C         
Sbjct  71    LDCIPSSVDCS--SASEP------------------FCSLAAKVENDGVLCFKAN-----  105

Query  219   KKGYFVNSIESRLLkssagleegkgeelges------selDMLLKLCSEGSEGDDDSMEA  380
             ++GY  NS+E+RLL  S      + EE  E       SELD+L+KLCS      DDS++ 
Sbjct  106   REGYSCNSMEARLLLKSRVSLRLEDEEEDECCFVESDSELDVLIKLCS------DDSIQ-  158

Query  381   YQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDTSF  560
                               CPLC  DI+ L+EE+RQ+HTN C+DK  AP +  L   + S 
Sbjct  159   ------------------CPLCETDISGLSEEERQVHTNNCLDK--APEQDSLRRCEKSS  198

Query  561   QCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCK  740
               + + +D      P+ +    PV++W+R LGLAKYE +F+++EIDWDTLQ LTEEDL  
Sbjct  199   SLIEESVD-----NPELVNDLSPVLKWVRSLGLAKYEHVFLREEIDWDTLQSLTEEDLLS  253

Query  741   IGVSALGPRKKIVHALSELRKE--------------NTKEVEFQKNAKKAVVDDTSKVKL  878
             IG+++LGPRKKIV+ALS LR+E              N  E + +K+  +    +  K   
Sbjct  254   IGITSLGPRKKIVNALSALREEASASSAEPQGQSLSNVTERQREKSTTRKA-SEPRKPTA  312

Query  879   SKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIP  1058
             +KLIT++F     G +K+      +     S       +V++N   + K K +P W  + 
Sbjct  313   NKLITEFF--PGDGIRKLPKEPVTEKSAADS--GCRRAAVRRN-GNNGKSKAVPQWNCVA  367

Query  1059  GTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWD  1238
             GTPFRVDAFKYL RDC HWFLTHFH DHYQGLT+SF HGKIYCS +TAKLVNMKIGIPW+
Sbjct  368   GTPFRVDAFKYLTRDCCHWFLTHFHLDHYQGLTKSFSHGKIYCSLITAKLVNMKIGIPWE  427

Query  1239  NIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              +Q+L LNQ+++IAG+DVTCFDANHCPG+I+I FEP+NG
Sbjct  428   RLQVLNLNQKVSIAGVDVTCFDANHCPGSIMIRFEPANG  466



>ref|XP_010648405.1| PREDICTED: uncharacterized protein LOC100256089 isoform X2 [Vitis 
vinifera]
Length=644

 Score =   414 bits (1065),  Expect(2) = 3e-178, Method: Compositional matrix adjust.
 Identities = 222/409 (54%), Positives = 276/409 (67%), Gaps = 34/409 (8%)
 Frame = +3

Query  213   EPKKGYFVNSIESRLLkssagleegk-----geelgesselDMLLKLCSEGSE-GDDDSM  374
             E +  Y  NS+ESRLLKS +G +         E   +  +LD+L++LCSEG E  D D  
Sbjct  94    ESEGSYSCNSVESRLLKSRSGGDGDGNGGFCEESDEDFEQLDVLIRLCSEGEEEPDSDGF  153

Query  375   EAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDT  554
                ++    SEG     L+ CPLC  DI+DLN+E RQ+HTN C+D+ +A  + VL + D 
Sbjct  154   RFREQRGSGSEGR---GLVRCPLCEIDISDLNDELRQVHTNGCLDRLEA--DNVLRNGDR  208

Query  555   SFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDL  734
               Q      D SP +T QK+V   PV+ W+  LGL +YEE FI++EIDWDTLQ LTEEDL
Sbjct  209   ECQFPQPFNDGSPVQTHQKVVDVSPVIGWIHSLGLGRYEEAFIREEIDWDTLQRLTEEDL  268

Query  735   CKIGVSALGPRKKIVHALSELRK--------------------ENTKEVEFQKNAKKAVV  854
               IGV+ALGPRK+IVHALSELRK                    ++T  VE + +A KA V
Sbjct  269   LNIGVTALGPRKRIVHALSELRKGSTHTVDIHTHVPALSELRKQSTHGVEIEADASKATV  328

Query  855   DDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKS--VKKNPAKSTKY  1028
             D+TSK+  +KLITDYF  S     +    S G+ +    +   S++   V KN A+S K 
Sbjct  329   DETSKLAANKLITDYFPGSVTDRSR-GCISSGERKAAEKIQLGSSRKQVVVKNHARSGKL  387

Query  1029  KDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKL  1208
             +D+P+WC IPGTPFRVDAF+YLRRDCSHWFLTHFH DHYQGLTRSFCHGKIYCS++TA+L
Sbjct  388   RDLPLWCCIPGTPFRVDAFRYLRRDCSHWFLTHFHLDHYQGLTRSFCHGKIYCSAITARL  447

Query  1209  VNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             VNMKIGIPWD +QILPLNQ+INI G+DVTC DANHCPG+IIILFEPSNG
Sbjct  448   VNMKIGIPWDRLQILPLNQKINIDGVDVTCLDANHCPGSIIILFEPSNG  496


 Score =   241 bits (614),  Expect(2) = 3e-178, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF +EM  +   Q C IHTLILDTTYCNPQYDFPKQ+AVIQFVI+AIQAEAF
Sbjct  498   AVLHTGDFRFSEEMTSMSVLQMCPIHTLILDTTYCNPQYDFPKQEAVIQFVIDAIQAEAF  557

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTLFLIGSYTIGKERLF+E+AR L KK+YV AAKL IL+CL F  EDMQ+FTLNE ES
Sbjct  558   NPRTLFLIGSYTIGKERLFLEVARVLRKKVYVNAAKLHILECLEFQKEDMQWFTLNEQES  617

Query  1714  HIHVVPLWTLANFKRLNQISNQY  1782
             HIHVVP+WTLA+FKRL  ISNQY
Sbjct  618   HIHVVPMWTLASFKRLKHISNQY  640



>ref|XP_008670222.1| PREDICTED: uncharacterized protein LOC103647460 isoform X2 [Zea 
mays]
Length=924

 Score =   350 bits (897),  Expect(2) = 5e-178, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 188/224 (84%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF  +M   P  Q   +HTLILDTTYCNP+YDFP Q+ VIQFVIEAIQAEAF
Sbjct  698   AVLHTGDFRFSSKMANNPVLQSSCVHTLILDTTYCNPRYDFPSQEIVIQFVIEAIQAEAF  757

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L KK+YV AAKL+IL+ L  P E M +FT NE ES
Sbjct  758   NPKTLFLIGSYTIGKERLFMEVARLLQKKVYVGAAKLQILKHLELPQEIMHWFTANEAES  817

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKR+  +SNQY GRY LIVA  PTGW+ GKG+KKTPGKRWQQG+IIRY
Sbjct  818   HIHVVPMWTLASFKRMKYLSNQYAGRYDLIVAFCPTGWAFGKGRKKTPGKRWQQGSIIRY  877

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+EL++FVKFISP +IIPSVNN GPES   ML+ L
Sbjct  878   EVPYSEHSSFTELQQFVKFISPEHIIPSVNNDGPESANAMLAQL  921


 Score =   305 bits (780),  Expect(2) = 5e-178, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 206/316 (65%), Gaps = 47/316 (15%)
 Frame = +3

Query  435   CPLCGRDITDLNEEQRQIHTNECID---KEDAPAEAVLSHRDTSFQCLGQVLDASPARTP  605
             CPLCG DI+DL+EE RQ+HTN C+D   KE +P     +H+      +GQ ++       
Sbjct  419   CPLCGSDISDLSEELRQLHTNNCLDEPAKESSP-----NHKKEP--SVGQNVETGR----  467

Query  606   QKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHA  785
                     VVEWLR LGL+KYEE+FI++E+DW+TLQWLTEEDL  IG+S+LGPRKKI+HA
Sbjct  468   --------VVEWLRNLGLSKYEEVFIREEVDWETLQWLTEEDLLGIGISSLGPRKKIIHA  519

Query  786   LSELRKENTKEVEFQKNAKKAVVD--DTSKVKL----SKLITDYFQCSAAGTKKVHATSC  947
             L EL K++    E +     AV++  +T K KL    +KLIT+YFQCS+   ++      
Sbjct  520   LGELLKKHDDPSEME-----AVLNSGNTKKTKLPMNGNKLITEYFQCSSFDQRQRRVCKA  574

Query  948   GQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTH  1127
              +         SS K   +  A   K KD P+WC IPGTPFRVDAF+YLR          
Sbjct  575   NKPSNLNEKKISSAKVPTRRTAGKGKIKDTPLWCCIPGTPFRVDAFRYLR----------  624

Query  1128  FHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDA  1307
                  YQGLTRSFCHGKIYCSS+TA LV+ KIGIPWD + +L LN+++NIAG+++ CFDA
Sbjct  625   ----DYQGLTRSFCHGKIYCSSITASLVHHKIGIPWDRLHVLTLNEKLNIAGVNLICFDA  680

Query  1308  NHCPGAIIILFEPSNG  1355
             NHCPG+IIILFEP NG
Sbjct  681   NHCPGSIIILFEPPNG  696



>ref|XP_007012472.1| Sterile alpha motif domain-containing protein isoform 5, partial 
[Theobroma cacao]
 gb|EOY30091.1| Sterile alpha motif domain-containing protein isoform 5, partial 
[Theobroma cacao]
Length=680

 Score =   408 bits (1049),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 225/470 (48%), Positives = 297/470 (63%), Gaps = 56/470 (12%)
 Frame = +3

Query  18    DMDLNIGLDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCAS  197
             D+D    LD IPS+I+CS             FN+    ++   +++ D            
Sbjct  86    DLDETCSLDLIPSSINCS-------------FNLTSAQDRDSDYVKCDE----------K  122

Query  198   EKSVLEPKKGYFVNSIESRLLkssagleegkgeelgesselDMLLKLCSEGSEGDDDSME  377
             +K +LE  KGY  NSIESRL++  + L E  GE+  E +ELD LLKLC++        +E
Sbjct  123   KKELLELNKGYLCNSIESRLIRPRSELSEEFGEDFDEDNELDALLKLCND--------VE  174

Query  378   AYQEDDCASEGND---DSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVL--S  542
               +E+D   E      D+SL+ CPLCG +I+ LNEE R +H N+C+DK + P + V+   
Sbjct  175   EEKEEDSGDEKESNVLDNSLVQCPLCGVNISGLNEEHRLVHINDCLDKVENPGQNVVFPP  234

Query  543   HRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLT  722
               D  FQC+ +V+D  P  +P+++V   PVV+WL  LGLA+Y + F+++E+DWDTL+WLT
Sbjct  235   SVDREFQCVPEVVDGPPL-SPRQVVDVSPVVKWLSNLGLARYADAFVREEVDWDTLKWLT  293

Query  723   EEDLCKIGVSALGPRKKIVHALSELRKE-------------------NTKEVEFQKNAKK  845
             EEDL  IGV+ALGPRKKIVHALSELRK                     +   + Q     
Sbjct  294   EEDLFSIGVTALGPRKKIVHALSELRKSYSCAAERHMGHPSHGNGSAKSSRAKTQTEISN  353

Query  846   AVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTK  1025
              + D+T+K   +KLITD+F    +  KKV     GQ+   +S      + V+ N  K+ K
Sbjct  354   FIDDETTKPAANKLITDFFPGLVSDRKKVCTPPRGQHISSKSHSDPGRRRVQTNHVKNGK  413

Query  1026  YKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
              KDIP WC IPGTPFRVDAFKYLR DCSHWFLTHFH DHYQGLTRSF HGKIYCSS+TA+
Sbjct  414   LKDIPAWCCIPGTPFRVDAFKYLRGDCSHWFLTHFHMDHYQGLTRSFRHGKIYCSSITAQ  473

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             LVN+K+GIPW+ +Q+LPLNQ+INIAGI++TC DANHCPG+I+ILF P NG
Sbjct  474   LVNVKLGIPWEKLQVLPLNQKINIAGIEITCLDANHCPGSIMILFVPPNG  523


 Score =   241 bits (614),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRFC+EM  +  +  C IHTLILDTTYCNPQYDFPKQ+AVIQFVIEAIQAEAF
Sbjct  525   AVLHTGDFRFCEEMASMSLWHACPIHTLILDTTYCNPQYDFPKQEAVIQFVIEAIQAEAF  584

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +K+Y+TAAK R+L CLGF +EDM++FTLNE ES
Sbjct  585   NPKTLFLIGSYTIGKERLFLEVARVLRRKVYITAAKFRLLDCLGFSEEDMRWFTLNEQES  644

Query  1714  HIHVVPLWTLANFKRLNQISNQY  1782
              IHVVP+WTLA+FKRL  ISNQY
Sbjct  645   QIHVVPMWTLASFKRLKHISNQY  667



>ref|XP_007012473.1| Sterile alpha motif domain-containing protein isoform 6, partial 
[Theobroma cacao]
 gb|EOY30092.1| Sterile alpha motif domain-containing protein isoform 6, partial 
[Theobroma cacao]
Length=686

 Score =   408 bits (1049),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 225/470 (48%), Positives = 297/470 (63%), Gaps = 56/470 (12%)
 Frame = +3

Query  18    DMDLNIGLDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCAS  197
             D+D    LD IPS+I+CS             FN+    ++   +++ D            
Sbjct  93    DLDETCSLDLIPSSINCS-------------FNLTSAQDRDSDYVKCDE----------K  129

Query  198   EKSVLEPKKGYFVNSIESRLLkssagleegkgeelgesselDMLLKLCSEGSEGDDDSME  377
             +K +LE  KGY  NSIESRL++  + L E  GE+  E +ELD LLKLC++        +E
Sbjct  130   KKELLELNKGYLCNSIESRLIRPRSELSEEFGEDFDEDNELDALLKLCND--------VE  181

Query  378   AYQEDDCASEGND---DSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVL--S  542
               +E+D   E      D+SL+ CPLCG +I+ LNEE R +H N+C+DK + P + V+   
Sbjct  182   EEKEEDSGDEKESNVLDNSLVQCPLCGVNISGLNEEHRLVHINDCLDKVENPGQNVVFPP  241

Query  543   HRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLT  722
               D  FQC+ +V+D  P  +P+++V   PVV+WL  LGLA+Y + F+++E+DWDTL+WLT
Sbjct  242   SVDREFQCVPEVVDGPPL-SPRQVVDVSPVVKWLSNLGLARYADAFVREEVDWDTLKWLT  300

Query  723   EEDLCKIGVSALGPRKKIVHALSELRKE-------------------NTKEVEFQKNAKK  845
             EEDL  IGV+ALGPRKKIVHALSELRK                     +   + Q     
Sbjct  301   EEDLFSIGVTALGPRKKIVHALSELRKSYSCAAERHMGHPSHGNGSAKSSRAKTQTEISN  360

Query  846   AVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTK  1025
              + D+T+K   +KLITD+F    +  KKV     GQ+   +S      + V+ N  K+ K
Sbjct  361   FIDDETTKPAANKLITDFFPGLVSDRKKVCTPPRGQHISSKSHSDPGRRRVQTNHVKNGK  420

Query  1026  YKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
              KDIP WC IPGTPFRVDAFKYLR DCSHWFLTHFH DHYQGLTRSF HGKIYCSS+TA+
Sbjct  421   LKDIPAWCCIPGTPFRVDAFKYLRGDCSHWFLTHFHMDHYQGLTRSFRHGKIYCSSITAQ  480

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             LVN+K+GIPW+ +Q+LPLNQ+INIAGI++TC DANHCPG+I+ILF P NG
Sbjct  481   LVNVKLGIPWEKLQVLPLNQKINIAGIEITCLDANHCPGSIMILFVPPNG  530


 Score =   241 bits (614),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRFC+EM  +  +  C IHTLILDTTYCNPQYDFPKQ+AVIQFVIEAIQAEAF
Sbjct  532   AVLHTGDFRFCEEMASMSLWHACPIHTLILDTTYCNPQYDFPKQEAVIQFVIEAIQAEAF  591

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L +K+Y+TAAK R+L CLGF +EDM++FTLNE ES
Sbjct  592   NPKTLFLIGSYTIGKERLFLEVARVLRRKVYITAAKFRLLDCLGFSEEDMRWFTLNEQES  651

Query  1714  HIHVVPLWTLANFKRLNQISNQY  1782
              IHVVP+WTLA+FKRL  ISNQY
Sbjct  652   QIHVVPMWTLASFKRLKHISNQY  674



>gb|EPS68874.1| hypothetical protein M569_05893, partial [Genlisea aurea]
Length=559

 Score =   342 bits (878),  Expect(2) = 1e-173, Method: Compositional matrix adjust.
 Identities = 170/346 (49%), Positives = 230/346 (66%), Gaps = 30/346 (9%)
 Frame = +3

Query  321   DMLLKLCSEGSEGDDDSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNE  500
             D LLKLC       D   E    +    E + +  LICCPLCG DI+ L+++++QIHTN 
Sbjct  13    DELLKLC-------DALDEPGNRNPGVDEESGNGFLICCPLCGCDISALSDDRKQIHTNG  65

Query  501   CIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELF  680
             C+DK +         R +         D S A+         P+ EWL  LGLAKYEE+F
Sbjct  66    CLDKLE---------RSSDVSSYSTATDVSHAKLGTNAPGLSPIGEWLSLLGLAKYEEVF  116

Query  681   IQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNAKKAVVDD  860
             ++ E+D + LQW+TEEDLC +G++ LGPRKKI+HA++ LR +  +  E +       VD+
Sbjct  117   LKHEVDLEALQWITEEDLCSLGITLLGPRKKILHAINSLRNDAIEVAEAEP------VDE  170

Query  861   TSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVK-KNPAKSTKYKDI  1037
             T  V  +KLITDYF    +   +    +  +        +S  K+ K K   +++K KD+
Sbjct  171   TKSVA-NKLITDYFAHPLSVRNRGRVVTIEKKP------HSVRKAAKGKENFRNSKQKDV  223

Query  1038  PVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNM  1217
             P WC IPGTPFRVDAFKYLRRDCSHWFLTHFH DHYQGLT+SFCHGKIYCSS+TAKLV++
Sbjct  224   PSWCRIPGTPFRVDAFKYLRRDCSHWFLTHFHLDHYQGLTKSFCHGKIYCSSITAKLVHL  283

Query  1218  KIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             KIGIP ++I++LP+N++IN+AG+D+TCF+ANHCPGA++ILFEP++G
Sbjct  284   KIGIPMESIEVLPINRKINVAGVDITCFNANHCPGAVMILFEPTDG  329


 Score =   298 bits (762),  Expect(2) = 1e-173, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 187/227 (82%), Gaps = 5/227 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAFN  1536
             VLHTGDFRFC+ M +I + +   IHTLILDTTYCN QYDFPKQ++VIQFVI+AIQAE FN
Sbjct  332   VLHTGDFRFCENMKDISALKTRSIHTLILDTTYCNAQYDFPKQESVIQFVIDAIQAETFN  391

Query  1537  PRTLFLIGSYTIG-KERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
              +TLFLIGSYTIG KERLF+E+AR L KKI+V+A+KLRIL+CL   +EDM+ FTL+E ES
Sbjct  392   SKTLFLIGSYTIGRKERLFLEVARVLQKKIHVSASKLRILECLELGEEDMKRFTLDEGES  451

Query  1714  HIHVVPLWTLANFKRLNQI-SNQYMG-RYSLIVAISPTGWSLGKGKKKTPGKRWQQGTII  1887
              IHVVP+W +A+FKRL Q+ S++Y G R++ IV+ SPTGWS G+G +++ GK+ QQGTII
Sbjct  452   CIHVVPMWVVASFKRLKQMASSRYTGSRFNSIVSFSPTGWSFGQG-RRSMGKKLQQGTII  510

Query  1888  RYEVPYSEHSSFSELKKFVKFISPANIIPSVN-NHGPESTRKMLSLL  2025
             RYEVPYSEHSSF+ELK+FVK I+P  IIPSVN +HG +S    +S L
Sbjct  511   RYEVPYSEHSSFTELKEFVKMITPERIIPSVNDDHGLDSLNPTVSEL  557



>gb|KDO73679.1| hypothetical protein CISIN_1g0048771mg, partial [Citrus sinensis]
Length=456

 Score =   362 bits (928),  Expect(2) = 5e-173, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 193/224 (86%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF +EM  +   Q C IHTLILDTTYCNP YDFPKQ+AVIQFVIEAIQAE+F
Sbjct  231   AVLHTGDFRFSEEMASMSVLQTCPIHTLILDTTYCNPLYDFPKQEAVIQFVIEAIQAESF  290

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L KKIYV AAK R+L+CL F  ED+Q+FT NE ES
Sbjct  291   NPKTLFLIGSYTIGKERLFLEVARVLRKKIYVNAAKFRVLKCLDFSKEDIQWFTTNEHES  350

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHV+P+WTLA+FKRL  +SNQY GR+SLIVA SPTGW+  KGKKK+PG+RWQQGTIIRY
Sbjct  351   HIHVMPMWTLASFKRLKHMSNQYAGRFSLIVAFSPTGWTFSKGKKKSPGRRWQQGTIIRY  410

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEH SF+ELK+FVKF+SP +IIPSVNN G +S   M+SLL
Sbjct  411   EVPYSEHCSFTELKEFVKFVSPEHIIPSVNNDGRDSANAMVSLL  454


 Score =   276 bits (706),  Expect(2) = 5e-173, Method: Compositional matrix adjust.
 Identities = 135/229 (59%), Positives = 160/229 (70%), Gaps = 20/229 (9%)
 Frame = +3

Query  729   DLCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNA-------------------KKAV  851
             DL  IGV+ALGPRKKI+H L E++KE ++ VE  K+A                    K +
Sbjct  1     DLIGIGVTALGPRKKILHTLCEIKKEYSRAVESNKDAHVSNDGSSSYHGSERHKEASKVI  60

Query  852   VDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKS-VKKNPAKSTKY  1028
             VD +SK   +KLITD+F  S    KKV   + GQ+   +S   S  K    K+ +K  K+
Sbjct  61    VDGSSKPAANKLITDFFLGSITNVKKVSTPTNGQSGSRKSFSGSDRKKHAAKDQSKGRKH  120

Query  1029  KDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKL  1208
             KDIP WC +PGTPFRVDAFKYLR DCSHWFLTHFH DHYQGLTRSF HGKIYCS +TA+L
Sbjct  121   KDIPTWCCVPGTPFRVDAFKYLRGDCSHWFLTHFHMDHYQGLTRSFHHGKIYCSLITARL  180

Query  1209  VNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             VNMKIGIPWD +Q+LPLNQ+  IAGIDVTC +ANHCPG+IIILFEP NG
Sbjct  181   VNMKIGIPWDRLQVLPLNQKTTIAGIDVTCLEANHCPGSIIILFEPQNG  229



>ref|XP_006293745.1| hypothetical protein CARUB_v10022707mg [Capsella rubella]
 gb|EOA26643.1| hypothetical protein CARUB_v10022707mg [Capsella rubella]
Length=697

 Score =   346 bits (887),  Expect(2) = 3e-166, Method: Compositional matrix adjust.
 Identities = 214/464 (46%), Positives = 278/464 (60%), Gaps = 57/464 (12%)
 Frame = +3

Query  39    LDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKSVLEP  218
             LD IPS++DCS      P       +++E  + +   +E D   K               
Sbjct  88    LDCIPSSVDCSIGDFSAP-----ICSLVEDGQVLVDKLENDDCFKAN-------------  129

Query  219   KKGYFVNSIESRLLkssagleegk-----geelgesselDMLLKLCSEGSEGDDDSMEAY  383
             ++GY  NS+E+RL KS   L            +   SELD+LLKLCSE SEG+       
Sbjct  130   REGYLCNSMEARLSKSRIRLGIDSGIHEDESFVESDSELDVLLKLCSE-SEGN-------  181

Query  384   QEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHR----D  551
                +C+   +D   LI CPLC  DI+ L EEQRQ+HTN+C+D  D  A   L       D
Sbjct  182   -SGECSLSKDD---LIQCPLCSMDISALGEEQRQVHTNKCLDNSDNHAPEQLQDSLKKCD  237

Query  552   TSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEED  731
              S   + + +D  P + PQ +    PV++WLR LGLAKYE++FI++EIDWDTL  LTEED
Sbjct  238   KSSSLIEESID-DPVQLPQLVTDLSPVLKWLRSLGLAKYEDVFIREEIDWDTLHSLTEED  296

Query  732   LCKIGVSALGPRKKIVHALSELRK---ENTKEVEFQKNAKKAVV-----DDTSKVKLS--  881
             L  IG+++LGPRKKIV+ALS LR+    + +E + Q++   + +     D T+  K S  
Sbjct  297   LLSIGITSLGPRKKIVNALSGLREVDASSAEEAQAQRHCTSSHITGRHEDKTTNRKASVP  356

Query  882   ------KLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPV  1043
                   KLIT++F   A    K+                SS ++V++N   + K K IP 
Sbjct  357   KKPTANKLITEFFPGQATEGTKIRKAPKDPVAEKSPPDSSSRRAVRRN-GNNGKSKVIPR  415

Query  1044  WCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKI  1223
             W  IPGTPFRVDAFKYL R+CSHWFLTHFH DHYQGLT+SF HGKIYCS VTAKLVNMKI
Sbjct  416   WNCIPGTPFRVDAFKYLTRECSHWFLTHFHLDHYQGLTKSFNHGKIYCSLVTAKLVNMKI  475

Query  1224  GIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             GIPW+ + +L L Q++NIAGIDVTCFDANHCPG+II+LFEP+NG
Sbjct  476   GIPWERLHVLDLGQKVNIAGIDVTCFDANHCPGSIIMLFEPANG  519


 Score =   269 bits (688),  Expect(2) = 3e-166, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 150/179 (84%), Gaps = 2/179 (1%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFR+ +EM          I +LILDTTYCNPQYDFPKQ+AVIQFV+EAIQAEAF
Sbjct  521   AVLHTGDFRYSEEMSNW--LIGSHISSLILDTTYCNPQYDFPKQEAVIQFVVEAIQAEAF  578

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+ LFLIGSYTIGKERLF+E+AR L +KIY+  +KL++L+CLGF  EDMQ+FT+ E ES
Sbjct  579   NPKALFLIGSYTIGKERLFLEVARVLREKIYINPSKLKLLECLGFSKEDMQWFTVKEEES  638

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIR  1890
             HIHVVPLWTLA+FKR+  I+N+Y  RYSLIVA SPTGW+ GK KKK+PG+R QQGTIIR
Sbjct  639   HIHVVPLWTLASFKRMKHIANRYTNRYSLIVAFSPTGWTSGKTKKKSPGRRLQQGTIIR  697



>ref|XP_002975301.1| hypothetical protein SELMODRAFT_415475 [Selaginella moellendorffii]
 gb|EFJ23502.1| hypothetical protein SELMODRAFT_415475 [Selaginella moellendorffii]
Length=769

 Score =   317 bits (813),  Expect(2) = 6e-154, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 177/221 (80%), Gaps = 1/221 (0%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAFN  1536
             VLHTGDFRFCD+M  I    PC++ TL+LDTTYC+PQYDFPKQ+ VIQFVI+AIQAE+FN
Sbjct  434   VLHTGDFRFCDDMARIMDILPCRLSTLVLDTTYCDPQYDFPKQETVIQFVIDAIQAESFN  493

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             P TLFLIG+Y++GKERLF+E+AR L KKIYV A K R+L CL   DEDM + T +E ES 
Sbjct  494   PSTLFLIGTYSLGKERLFLEVARVLRKKIYVGAVKRRMLGCLDLSDEDMDWITTSECESS  553

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTP-GKRWQQGTIIRY  1893
             IHVVPLW++A+FKR+  IS  Y G+Y+ IV+ SPTGWS  KGK+ T  GKRWQQGTIIRY
Sbjct  554   IHVVPLWSIASFKRMASISRHYHGKYTTIVSFSPTGWSFSKGKRGTGNGKRWQQGTIIRY  613

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKML  2016
             EVPYSEHSSF+ELK FVK +SP  IIPSVNN   ++ + M+
Sbjct  614   EVPYSEHSSFTELKTFVKLLSPVEIIPSVNNSSIQAAKSMV  654


 Score =   256 bits (655),  Expect(2) = 6e-154, Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 191/327 (58%), Gaps = 21/327 (6%)
 Frame = +3

Query  411   NDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKE------DAPAEAVLSHRDTSFQCLG  572
             N  ++ + CP+C  +IT ++ +QR+ H+N C+D++      D P+ AV      S  C  
Sbjct  114   NGLNAAVFCPICSSEITSMSIQQREDHSNLCLDQKSQHCQNDVPS-AVECLDKKSQHCQN  172

Query  573   QVLDASPARTPQKL-VARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGV  749
              V   S     Q L V   PVV +L KL L+KY  LFI++EIDWDTL WLTEEDL  +G+
Sbjct  173   DV--PSAVEEDQNLPVDVAPVVRFLEKLNLSKYASLFIKEEIDWDTLHWLTEEDLRSLGI  230

Query  750   SALGPRKKIVHALSELRKENTKEVEFQKNAKKAVVDDTSKVKL-----SKLITDYFQCSA  914
              A GPRKKIV AL E++   + EV   +N      D+     L      K ITD+F  + 
Sbjct  231   DAFGPRKKIVSALREMKTPFSTEVPVPENDTHKTNDNEEDEALLPQSGKKYITDFFGATG  290

Query  915   AGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYL  1094
                    A+  G+   G +    S    +K P+   K  +   W  IPGT FRVDAFK+ 
Sbjct  291   GTGGTKPAS--GRKRNGDA----SLSKTRKKPSNLFKAAEARQWMKIPGTTFRVDAFKHT  344

Query  1095  RRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRIN  1274
               +CSHWFLTHFH+DHYQGLT+SF  GKIYCS +TA+LVN++IGI WD +  L  N+R  
Sbjct  345   TTECSHWFLTHFHSDHYQGLTKSFRFGKIYCSMITARLVNLRIGITWDRLHPLNFNERTK  404

Query  1275  IAGIDVTCFDANHCPGAIIILFEPSNG  1355
             I G+ VT  DANHCPGA +ILFE  +G
Sbjct  405   IDGVWVTLLDANHCPGAAMILFETHDG  431



>ref|XP_002993085.1| hypothetical protein SELMODRAFT_449005 [Selaginella moellendorffii]
 gb|EFJ05833.1| hypothetical protein SELMODRAFT_449005 [Selaginella moellendorffii]
Length=795

 Score =   316 bits (810),  Expect(2) = 8e-154, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 178/225 (79%), Gaps = 1/225 (0%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAFN  1536
             VLHTGDFRFCD+M  I    PC++  L+LDTTYC+PQYDFPKQ+ VIQFVI+AIQAE+FN
Sbjct  460   VLHTGDFRFCDDMARIMDILPCRLSALVLDTTYCDPQYDFPKQETVIQFVIDAIQAESFN  519

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             P TLFLIG+Y++GKERLF+E+AR L KKIYV A K R+L CL   DEDM + T +E ES 
Sbjct  520   PSTLFLIGTYSLGKERLFLEVARVLRKKIYVGAVKRRMLGCLDLSDEDMDWITTSECESS  579

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTP-GKRWQQGTIIRY  1893
             IHVVPLW++A+FKR+  IS  Y G+Y+ IV+ SPTGWS  KGK+ T  GKRWQQGTIIRY
Sbjct  580   IHVVPLWSIASFKRMASISRHYHGKYTTIVSFSPTGWSFSKGKRGTGNGKRWQQGTIIRY  639

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
             EVPYSEHSSF+ELK FVK +SP  IIPSVNN   ++ + M+  ++
Sbjct  640   EVPYSEHSSFTELKTFVKLLSPVEIIPSVNNSSIQAAKSMVGAMA  684


 Score =   258 bits (658),  Expect(2) = 8e-154, Method: Compositional matrix adjust.
 Identities = 146/327 (45%), Positives = 192/327 (59%), Gaps = 21/327 (6%)
 Frame = +3

Query  411   NDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKE------DAPAEAVLSHRDTSFQCLG  572
             N  ++ + CP+C  +IT ++ +QR+ H+N C+D++      D P+ AV      S  C  
Sbjct  140   NGLNAAVFCPICSSEITSMSIQQRENHSNLCLDQKSQHCQNDVPS-AVECLEQKSQHCQN  198

Query  573   QVLDASPARTPQKL-VARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGV  749
              V   S     Q L V   PVV +L KL L+KY  LFI++EIDWDTL WLTEEDL  +G+
Sbjct  199   DV--PSAVEEDQNLPVDVAPVVRFLEKLNLSKYVSLFIKEEIDWDTLHWLTEEDLRSLGI  256

Query  750   SALGPRKKIVHALSELRKENTKEVEFQKNAKKAVVDDTSKVKL-----SKLITDYFQCSA  914
              A GPRKKIV AL E++   + EV   +N      D+     L      K ITD+F  + 
Sbjct  257   DAFGPRKKIVSALREMKTPFSTEVPVPENDTHKKNDNEEDEALLPQSGKKYITDFFGATG  316

Query  915   AGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYL  1094
                    A+  G+   G +    S    +K P+   K  +   W  IPGT FRVDAFK+ 
Sbjct  317   GTGGTKPAS--GRKRNGDA----SLSKTRKKPSNLFKAAEARQWMKIPGTTFRVDAFKHT  370

Query  1095  RRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRIN  1274
               +CSHWFLTHFH+DHYQGLT+SF  GKIYCS +TA+LVN++IGI WD +  L LN+R  
Sbjct  371   TTECSHWFLTHFHSDHYQGLTKSFRFGKIYCSMITARLVNLRIGITWDRLHPLNLNERTK  430

Query  1275  IAGIDVTCFDANHCPGAIIILFEPSNG  1355
             I G+ VT  DANHCPGA +ILFE  +G
Sbjct  431   IDGVWVTLLDANHCPGAAMILFETHDG  457



>ref|XP_001770013.1| predicted protein [Physcomitrella patens]
 gb|EDQ65189.1| predicted protein [Physcomitrella patens]
Length=530

 Score =   294 bits (753),  Expect(2) = 7e-147, Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 180/229 (79%), Gaps = 4/229 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAFN  1536
             VLHTGDFR+  +M      + C+I TLILDTTYC+PQ+DFPKQD+VIQFVI+AIQAEAFN
Sbjct  300   VLHTGDFRYYSDMASNDVLRKCRITTLILDTTYCDPQHDFPKQDSVIQFVIDAIQAEAFN  359

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             P+TLFLIG+YTIGKE+LF+E+ +AL K +YV +AK R+L C+   +ED ++ T  + ESH
Sbjct  360   PKTLFLIGTYTIGKEKLFLEVGKALQKYVYVGSAKQRLLDCMDLTEEDKRWLTTKDQESH  419

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKT---PGKRWQQGTII  1887
             IHVVPLW++A+FKR+  IS  Y GRY  IVA SPTG S GK KK+    PG+R+QQG+II
Sbjct  420   IHVVPLWSVASFKRMGSISRHYHGRYDSIVAFSPTGCSFGKDKKRVQGRPGRRYQQGSII  479

Query  1888  RYEVPYSEHSSFSELKKFVKFISPANIIPSV-NNHGPESTRKMLSLLSD  2031
             RYEVPYSEHSSF+ELK+FV+FI   NIIPSV ++ GP +   + +LL++
Sbjct  480   RYEVPYSEHSSFTELKEFVRFIGSENIIPSVISSTGPTADAMVATLLNE  528


 Score =   256 bits (655),  Expect(2) = 7e-147, Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 188/310 (61%), Gaps = 22/310 (7%)
 Frame = +3

Query  435   CPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKL  614
             CP+C   I  L+  QR+ HTN C+DK                + LG+V + + A   Q  
Sbjct  7     CPVCQICIGGLSTAQREEHTNACLDK-------------CKEEELGEVSEFAEAAMGQA-  52

Query  615   VARP---PVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHA  785
               RP   PVV WL  L LAKY ++F+++EIDWDTL+WLTEEDL  +G+SALGPR+KI+ A
Sbjct  53    AGRPDMAPVVTWLTNLNLAKYVDIFVKEEIDWDTLKWLTEEDLNSLGISALGPRRKILSA  112

Query  786   LSELRKENTKEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVG  965
             ++ELR   +         +   + D++   L + +      + AG K     S  +    
Sbjct  113   INELRNVPSTSQHMTAIKEGQKLSDSA---LPRRVPAPDNHTLAGPKASGNASTTEMPWR  169

Query  966   RSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHY  1145
              +    +  +V+ + A  T    IP W  IPGT FRVDAFK+   +CS+WFLTHFH DHY
Sbjct  170   NTNPRRAISAVRNSRAIGTS--GIPTWMCIPGTSFRVDAFKHTTGNCSNWFLTHFHTDHY  227

Query  1146  QGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGA  1325
             QGLTR F HGKI+CSS+TA+L++++IG+P D IQ LPLN+ + I G+ VT  DANHCPG+
Sbjct  228   QGLTRGFRHGKIFCSSITARLISLRIGVPLDRIQALPLNETVLIDGVRVTFIDANHCPGS  287

Query  1326  IIILFEPSNG  1355
             ++ILFEP NG
Sbjct  288   VMILFEPPNG  297



>ref|XP_010648406.1| PREDICTED: uncharacterized protein LOC100256089 isoform X3 [Vitis 
vinifera]
Length=590

 Score =   415 bits (1066),  Expect(2) = 1e-145, Method: Compositional matrix adjust.
 Identities = 222/409 (54%), Positives = 276/409 (67%), Gaps = 34/409 (8%)
 Frame = +3

Query  213   EPKKGYFVNSIESRLLkssagleegk-----geelgesselDMLLKLCSEGSE-GDDDSM  374
             E +  Y  NS+ESRLLKS +G +         E   +  +LD+L++LCSEG E  D D  
Sbjct  94    ESEGSYSCNSVESRLLKSRSGGDGDGNGGFCEESDEDFEQLDVLIRLCSEGEEEPDSDGF  153

Query  375   EAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDT  554
                ++    SEG     L+ CPLC  DI+DLN+E RQ+HTN C+D+ +A  + VL + D 
Sbjct  154   RFREQRGSGSEGR---GLVRCPLCEIDISDLNDELRQVHTNGCLDRLEA--DNVLRNGDR  208

Query  555   SFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDL  734
               Q      D SP +T QK+V   PV+ W+  LGL +YEE FI++EIDWDTLQ LTEEDL
Sbjct  209   ECQFPQPFNDGSPVQTHQKVVDVSPVIGWIHSLGLGRYEEAFIREEIDWDTLQRLTEEDL  268

Query  735   CKIGVSALGPRKKIVHALSELRK--------------------ENTKEVEFQKNAKKAVV  854
               IGV+ALGPRK+IVHALSELRK                    ++T  VE + +A KA V
Sbjct  269   LNIGVTALGPRKRIVHALSELRKGSTHTVDIHTHVPALSELRKQSTHGVEIEADASKATV  328

Query  855   DDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKS--VKKNPAKSTKY  1028
             D+TSK+  +KLITDYF  S     +    S G+ +    +   S++   V KN A+S K 
Sbjct  329   DETSKLAANKLITDYFPGSVTDRSR-GCISSGERKAAEKIQLGSSRKQVVVKNHARSGKL  387

Query  1029  KDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKL  1208
             +D+P+WC IPGTPFRVDAF+YLRRDCSHWFLTHFH DHYQGLTRSFCHGKIYCS++TA+L
Sbjct  388   RDLPLWCCIPGTPFRVDAFRYLRRDCSHWFLTHFHLDHYQGLTRSFCHGKIYCSAITARL  447

Query  1209  VNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             VNMKIGIPWD +QILPLNQ+INI G+DVTC DANHCPG+IIILFEPSNG
Sbjct  448   VNMKIGIPWDRLQILPLNQKINIDGVDVTCLDANHCPGSIIILFEPSNG  496


 Score =   132 bits (331),  Expect(2) = 1e-145, Method: Compositional matrix adjust.
 Identities = 62/77 (81%), Positives = 67/77 (87%), Gaps = 0/77 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF +EM  +   Q C IHTLILDTTYCNPQYDFPKQ+AVIQFVI+AIQAEAF
Sbjct  498   AVLHTGDFRFSEEMTSMSVLQMCPIHTLILDTTYCNPQYDFPKQEAVIQFVIDAIQAEAF  557

Query  1534  NPRTLFLIGSYTIGKER  1584
             NPRTLFLIGSYTI + R
Sbjct  558   NPRTLFLIGSYTIEQVR  574



>ref|XP_009775278.1| PREDICTED: DNA cross-link repair protein SNM1-like, partial [Nicotiana 
sylvestris]
Length=307

 Score =   389 bits (998),  Expect(2) = 6e-141, Method: Compositional matrix adjust.
 Identities = 181/226 (80%), Positives = 200/226 (88%), Gaps = 0/226 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRFC+EM      Q C +HTLILDTTYC+PQYDFPKQ+AVIQFVIE+IQAE F
Sbjct  82    AVLHTGDFRFCEEMTRNSILQTCGVHTLILDTTYCDPQYDFPKQEAVIQFVIESIQAETF  141

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             N +TLFLIGSYTIGKERLFVE+ARAL KK+Y+TA+KLRIL+CLGFP EDMQFFTLNE ES
Sbjct  142   NSKTLFLIGSYTIGKERLFVEVARALQKKVYITASKLRILECLGFPQEDMQFFTLNEQES  201

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
              IHVVP+WTLA+FKRL  +SNQY GRYSLIVA SPTGWS GKGKKK+ G RWQQGTIIRY
Sbjct  202   QIHVVPMWTLASFKRLKYVSNQYAGRYSLIVAFSPTGWSFGKGKKKSTGSRWQQGTIIRY  261

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD  2031
             EVPYSEHSSFSELK+FVKF+SP NIIPSVNNHGPES+  M+S L D
Sbjct  262   EVPYSEHSSFSELKEFVKFVSPVNIIPSVNNHGPESSNAMVSCLLD  307


 Score =   142 bits (358),  Expect(2) = 6e-141, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  1119  LTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTC  1298
             L  + +  YQGLT+SFCHGKIYCSS+TAKLVN+KIGIPWD IQ+LP+NQ+INIAGIDV C
Sbjct  2     LLSYTSVDYQGLTKSFCHGKIYCSSITAKLVNLKIGIPWDKIQVLPINQKINIAGIDVIC  61

Query  1299  FDANHCPGAIIILFEPSNG  1355
             FDANHCPG++IILFEP NG
Sbjct  62    FDANHCPGSLIILFEPPNG  80



>ref|XP_011019314.1| PREDICTED: uncharacterized protein LOC105122097 isoform X2 [Populus 
euphratica]
Length=598

 Score =   391 bits (1005),  Expect(2) = 3e-138, Method: Compositional matrix adjust.
 Identities = 231/471 (49%), Positives = 285/471 (61%), Gaps = 61/471 (13%)
 Frame = +3

Query  18    DMDLNIGLDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESF-SCA  194
             ++D N  LD I S+IDC+                   + KVG          NE F S +
Sbjct  78    NLDENCSLDFIESSIDCTV------------------SSKVG----------NEKFDSGS  109

Query  195   SEKSVLEPKKGYFVNSIESRLLkssagleegkgeelg---esselDMLLKLCSEGSEGDD  365
              +K  LE   GY  NSIE+RL+KS                E+  LD L++LC+E  E   
Sbjct  110   GKKEKLEVSGGYLCNSIEARLMKSRVDYSGVSVGNEEDCEENRGLDALIQLCTEEEE---  166

Query  366   DSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKE-DAPAEAVLS  542
                    + +C     D+   + CPLCG DI+DL+EE R +HTNEC+DKE ++  + VL 
Sbjct  167   SEAREKIKVNC---NGDECCFVLCPLCGTDISDLSEEFRLVHTNECLDKEENSVPDVVLG  223

Query  543   HRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLT  722
               D   + + + ++  P   P+K V   PV +WLR LGL +YEE F+++EIDW+TLQWLT
Sbjct  224   GDDGRPEVVPRGVEG-PVCGPKK-VDVSPVAKWLRNLGLERYEEDFVREEIDWETLQWLT  281

Query  723   EEDLCKIGVSALGPRKKIVHALSELRKENTKEV--------------------EFQKNAK  842
             EEDL  IGV+ALGPRKKIVHAL ELRK + + +                    E Q  A 
Sbjct  282   EEDLFGIGVTALGPRKKIVHALGELRKGSNRAIKAHGDAHASGEVGSSRSHGAEMQVEAS  341

Query  843   KAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKST  1022
             K + DDTSK   +KLITDYF  S    KK   +S  Q    +S     +K   KN  K  
Sbjct  342   KIIGDDTSKPTANKLITDYFPGSVPIKKKTCVSSKEQRGAEKSQPGYVHKQRVKNNTKKG  401

Query  1023  KYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTA  1202
             K KDIP+WCS+PGTPFRVDAFKYLR DCSHWFLTHFH DHYQGLTRSFCHGKIYCS +TA
Sbjct  402   KLKDIPLWCSVPGTPFRVDAFKYLRGDCSHWFLTHFHMDHYQGLTRSFCHGKIYCSLITA  461

Query  1203  KLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             KLVN+KIGIPWD+I +LPLNQ+I IAG+DVTC DANHCPG+IIILFEP NG
Sbjct  462   KLVNLKIGIPWDSIHVLPLNQKICIAGVDVTCLDANHCPGSIIILFEPPNG  512


 Score =   131 bits (329),  Expect(2) = 3e-138, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF + M+ +P  Q   IHTLILDTTYCN QYDFPKQ+AVIQFVIEAIQAEAF
Sbjct  514   AVLHTGDFRFSENMVTMPVLQMSSIHTLILDTTYCNAQYDFPKQEAVIQFVIEAIQAEAF  573

Query  1534  NPRTLFLIGSYTIGK  1578
             NPRTLFLIGSYTIGK
Sbjct  574   NPRTLFLIGSYTIGK  588



>tpg|DAA40151.1| TPA: hypothetical protein ZEAMMB73_008326 [Zea mays]
Length=1174

 Score =   350 bits (899),  Expect(2) = 5e-126, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 188/224 (84%), Gaps = 0/224 (0%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             AVLHTGDFRF  +M   P  Q   +HTLILDTTYCNP+YDFP Q+ VIQFVIEAIQAEAF
Sbjct  948   AVLHTGDFRFSSKMANNPVLQSSCVHTLILDTTYCNPRYDFPSQEIVIQFVIEAIQAEAF  1007

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFLIGSYTIGKERLF+E+AR L KK+YV AAKL+IL+ L  P E M +FT NE ES
Sbjct  1008  NPKTLFLIGSYTIGKERLFMEVARLLQKKVYVGAAKLQILKHLELPQEIMHWFTANEAES  1067

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRY  1893
             HIHVVP+WTLA+FKR+  +SNQY GRY LIVA  PTGW+ GKG+KKTPGKRWQQG+IIRY
Sbjct  1068  HIHVVPMWTLASFKRMKYLSNQYAGRYDLIVAFCPTGWAFGKGRKKTPGKRWQQGSIIRY  1127

Query  1894  EVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             EVPYSEHSSF+EL++FVKFISP +IIPSVNN GPES   ML+ L
Sbjct  1128  EVPYSEHSSFTELQQFVKFISPEHIIPSVNNDGPESANAMLAQL  1171


 Score =   130 bits (328),  Expect(2) = 5e-126, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 74/102 (73%), Gaps = 5/102 (5%)
 Frame = +3

Query  1065  PFRVDAFKY-LRRDCSHWFLTHFH----ADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGI  1229
             P R    KY L +  S W L   H       YQGLTRSFCHGKIYCSS+TA LV+ KIGI
Sbjct  845   PERNYLAKYALYKGPSLWDLATTHNSILGHDYQGLTRSFCHGKIYCSSITASLVHHKIGI  904

Query  1230  PWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             PWD + +L LN+++NIAG+++ CFDANHCPG+IIILFEP NG
Sbjct  905   PWDRLHVLTLNEKLNIAGVNLICFDANHCPGSIIILFEPPNG  946


 Score =   220 bits (560),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 122/254 (48%), Positives = 157/254 (62%), Gaps = 24/254 (9%)
 Frame = +3

Query  435   CPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDT---SFQCLGQVL------DA  587
             CPLCG DI+DL+EE RQ+HTN C+D+       V+    +   S   L Q L      ++
Sbjct  419   CPLCGSDISDLSEELRQLHTNNCLDEPAKGKHGVVVRAVSLVPSVVGLKQSLRICGRKES  478

Query  588   SPARTPQKLVAR----PPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVSA  755
             SP    +  V +      VVEWLR LGL+KYEE+FI++E+DW+TLQWLTEEDL  IG+S+
Sbjct  479   SPNHKKEPSVGQNVETGRVVEWLRNLGLSKYEEVFIREEVDWETLQWLTEEDLLGIGISS  538

Query  756   LGPRKKIVHALSELRKENTKEVEFQKNAKKAVVD--DTSKVKL----SKLITDYFQCSAA  917
             LGPRKKI+HAL EL K++    E +     AV++  +T K KL    +KLIT+YFQCS+ 
Sbjct  539   LGPRKKIIHALGELLKKHDDPSEME-----AVLNSGNTKKTKLPMNGNKLITEYFQCSSF  593

Query  918   GTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLR  1097
               ++       +         SS K   +  A   K KD P+WC IPGTPFRVDAF+YLR
Sbjct  594   DQRQRRVCKANKPSNLNEKKISSAKVPTRRTAGKGKIKDTPLWCCIPGTPFRVDAFRYLR  653

Query  1098  RDCSHWFLTHFHAD  1139
              DCSHWFLTHFH D
Sbjct  654   GDCSHWFLTHFHVD  667



>ref|XP_010506533.1| PREDICTED: uncharacterized protein LOC104783131 isoform X2 [Camelina 
sativa]
Length=647

 Score =   339 bits (870),  Expect(2) = 3e-118, Method: Compositional matrix adjust.
 Identities = 213/460 (46%), Positives = 272/460 (59%), Gaps = 56/460 (12%)
 Frame = +3

Query  39    LDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNESFSCASEKSVLEP  218
             LD IPS++DCS        EED+              +  D    ++ F    E      
Sbjct  86    LDCIPSSVDCSIGPICSLGEEDQ--------------VLVDKLGNDDCFKANRE------  125

Query  219   KKGYFVNSIESRLLkssagleegkgeel--gesselDMLLKLCSEGSEGDDDSMEAYQED  392
               GY  NS+E+RL KS   L    G        SE D+LLKLCSE SEG+     +  +D
Sbjct  126   --GYLCNSMEARLSKSRIRLGIDSGIHEDDESDSEFDVLLKLCSE-SEGNIGGECSIVKD  182

Query  393   DCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDK--EDAPAEAVLSHR--DTSF  560
             D           I CPLC  DI+ L+EE RQ+HTN+C+D      P +   S R  + S 
Sbjct  183   DS----------IQCPLCSIDISALSEELRQVHTNKCLDNPVNQVPEQLQDSLRKCEKSS  232

Query  561   QCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCK  740
               + + +D  P + PQ +    PV++WLR LGLAKYE++FI++EIDWDTLQ L EEDL  
Sbjct  233   SLIEESID-DPVQLPQLVTDVSPVLKWLRSLGLAKYEDVFIREEIDWDTLQSLAEEDLLS  291

Query  741   IGVSALGPRKKIVHALSELRKE--NTKEVEFQKNAKKAVV-----DDTSKVKLS------  881
             IG+++LGPRKKIV+ALS LR+   ++ E + Q +   A V     D T+  K S      
Sbjct  292   IGITSLGPRKKIVNALSGLREAFASSSEAQAQSHCPSAHVTERQRDKTTNRKASEPKKPT  351

Query  882   --KLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSI  1055
               KLIT++F   A    K+                SS ++V++N   + K K +P W  I
Sbjct  352   ANKLITEFFPGQATEGTKIRKAPKDPVAEKSPPDSSSRRAVRRN-CNNGKSKVVPHWNCI  410

Query  1056  PGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPW  1235
             PGTPFRVDAFKYL RDC HWFLTHFH DHYQGLT+SF HGKIYCS VTAKLVNMKIGIPW
Sbjct  411   PGTPFRVDAFKYLTRDCGHWFLTHFHLDHYQGLTKSFNHGKIYCSLVTAKLVNMKIGIPW  470

Query  1236  DNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             + +Q+L L Q++NIAG+DVTCFDANHCPG+I+ILFEP+NG
Sbjct  471   ERLQVLDLGQKVNIAGVDVTCFDANHCPGSIMILFEPANG  510


 Score =   116 bits (290),  Expect(2) = 3e-118, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 66/80 (83%), Gaps = 6/80 (8%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMME--IPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAE  1527
             AVLHTGDFR+ +EM    I S     I +LILDTTYCNPQYDFPKQ+AVIQFV+EAIQAE
Sbjct  512   AVLHTGDFRYSEEMANWLIGSH----ISSLILDTTYCNPQYDFPKQEAVIQFVVEAIQAE  567

Query  1528  AFNPRTLFLIGSYTIGKERL  1587
             AFNP+TLFLIGSYTIG+  L
Sbjct  568   AFNPKTLFLIGSYTIGEAVL  587



>gb|KCW81818.1| hypothetical protein EUGRSUZ_C03174 [Eucalyptus grandis]
Length=841

 Score =   383 bits (983),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/271 (68%), Positives = 216/271 (80%), Gaps = 7/271 (3%)
 Frame = +1

Query  1219  KLEFLGITYKFYLSTRG-SILQELMSPVLMQIIAQVPS*SSLNHPMAVLHTGDFRFCDEM  1395
             +LE L I  K  + + G + L+    P  + I+ + P+         VLHTGDFRF +EM
Sbjct  576   RLEVLPINQKVVIESVGVTCLEANHCPGAVVILFEPPT------GEVVLHTGDFRFSEEM  629

Query  1396  MEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAFNPRTLFLIGSYTIG  1575
               +   Q  +IHTLILDTTYCNPQYDFPKQ+AV QFV+E+IQAE+FNP TLFLIGSYTIG
Sbjct  630   AGLSILQATRIHTLILDTTYCNPQYDFPKQEAVAQFVVESIQAESFNPNTLFLIGSYTIG  689

Query  1576  KERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESHIHVVPLWTLANFK  1755
             KERLF+E+AR L KKIYV+AAKLRI+QC G+ +EDMQ+FTLNE ESHIHVVP+WTLANFK
Sbjct  690   KERLFLEVARVLHKKIYVSAAKLRIIQCFGYSEEDMQWFTLNEKESHIHVVPMWTLANFK  749

Query  1756  RLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRYEVPYSEHSSFSELK  1935
             RL QISNQY+GRYSL+VA SPTGW+ GKGKKK  G+RWQQGTIIRYEVPYSEH SFSELK
Sbjct  750   RLKQISNQYLGRYSLVVAFSPTGWTFGKGKKKCTGRRWQQGTIIRYEVPYSEHCSFSELK  809

Query  1936  KFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
             +FVKFISP  IIPSVNN GPES   M+SLL+
Sbjct  810   EFVKFISPDRIIPSVNNDGPESANSMISLLT  840


 Score =   376 bits (965),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 196/374 (52%), Positives = 245/374 (66%), Gaps = 41/374 (11%)
 Frame = +3

Query  321   DMLLKLCSEGSEGDDDSMEAYQEDDCASEGND----DSSLICCPLCGRDITDLNEEQRQI  488
             D+L+KLC      DD+    Y +D    E  D    DS L+CCPLCG DI+DL++E RQI
Sbjct  253   DLLIKLC------DDEGPVHYSDDKDGEEAEDGWDCDSGLVCCPLCGVDISDLSDESRQI  306

Query  489   HTNECIDKEDAPA-EAVLSHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAK  665
             HTN+C+DK +A   EA L        C       SP  +PQ  V   PV+ WLR LGL +
Sbjct  307   HTNDCLDKGEARLDEASL------LICSRAEAVGSPVSSPQLAVDISPVLGWLRSLGLDR  360

Query  666   YEELFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRK----ENTKEVEF--  827
             YEE F+++EIDWD+LQ LTEEDL K+G+SALGPRKKIVHAL+ELRK    E  + V+   
Sbjct  361   YEEAFVREEIDWDSLQCLTEEDLLKMGISALGPRKKIVHALNELRKGVQGETAEHVDING  420

Query  828   ---------QKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMY  980
                      +  A KA+V   SKV  SKLITDYF  S+   KK    S  Q  V   L  
Sbjct  421   KCGDHMTKTEPGASKAMVSGDSKVAASKLITDYFLGSSTNQKKTCNISTLQRRVTEQLSS  480

Query  981   SSN--------KSVK-KNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFH  1133
             S          K+VK +   K++  +++P+WC IPGTPFRVDAF+YL RDCSHWFLTHFH
Sbjct  481   SRGCAKVNDHVKNVKPRGRVKNSTRREVPLWCRIPGTPFRVDAFRYLTRDCSHWFLTHFH  540

Query  1134  ADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANH  1313
              DHYQGLTRSFCHGK+YCS+VTAKLVN+KIGIPW+ +++LP+NQ++ I  + VTC +ANH
Sbjct  541   MDHYQGLTRSFCHGKVYCSAVTAKLVNLKIGIPWERLEVLPINQKVVIESVGVTCLEANH  600

Query  1314  CPGAIIILFEPSNG  1355
             CPGA++ILFEP  G
Sbjct  601   CPGAVVILFEPPTG  614



>ref|XP_010049292.1| PREDICTED: DNA cross-link repair 1A protein [Eucalyptus grandis]
Length=823

 Score =   382 bits (981),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 185/271 (68%), Positives = 216/271 (80%), Gaps = 7/271 (3%)
 Frame = +1

Query  1219  KLEFLGITYKFYLSTRG-SILQELMSPVLMQIIAQVPS*SSLNHPMAVLHTGDFRFCDEM  1395
             +LE L I  K  + + G + L+    P  + I+ + P+         VLHTGDFRF +EM
Sbjct  558   RLEVLPINQKVVIESVGVTCLEANHCPGAVVILFEPPT------GEVVLHTGDFRFSEEM  611

Query  1396  MEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAFNPRTLFLIGSYTIG  1575
               +   Q  +IHTLILDTTYCNPQYDFPKQ+AV QFV+E+IQAE+FNP TLFLIGSYTIG
Sbjct  612   AGLSILQATRIHTLILDTTYCNPQYDFPKQEAVAQFVVESIQAESFNPNTLFLIGSYTIG  671

Query  1576  KERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESHIHVVPLWTLANFK  1755
             KERLF+E+AR L KKIYV+AAKLRI+QC G+ +EDMQ+FTLNE ESHIHVVP+WTLANFK
Sbjct  672   KERLFLEVARVLHKKIYVSAAKLRIIQCFGYSEEDMQWFTLNEKESHIHVVPMWTLANFK  731

Query  1756  RLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRYEVPYSEHSSFSELK  1935
             RL QISNQY+GRYSL+VA SPTGW+ GKGKKK  G+RWQQGTIIRYEVPYSEH SFSELK
Sbjct  732   RLKQISNQYLGRYSLVVAFSPTGWTFGKGKKKCTGRRWQQGTIIRYEVPYSEHCSFSELK  791

Query  1936  KFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
             +FVKFISP  IIPSVNN GPES   M+SLL+
Sbjct  792   EFVKFISPDRIIPSVNNDGPESANSMISLLT  822


 Score =   379 bits (973),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 196/374 (52%), Positives = 247/374 (66%), Gaps = 35/374 (9%)
 Frame = +3

Query  321   DMLLKLCSEGSEGDDDSMEAYQEDDCASEGND----DSSLICCPLCGRDITDLNEEQRQI  488
             D+L+KLC      DD+    Y +D    E  D    DS L+CCPLCG DI+DL++E RQI
Sbjct  229   DLLIKLC------DDEGPVHYSDDKDGEEAEDGWDCDSGLVCCPLCGVDISDLSDESRQI  282

Query  489   HTNECIDKEDAPAEAVL-SHRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAK  665
             HTN+C+DK +A  + VL    D +     Q    SP  +PQ  V   PV+ WLR LGL +
Sbjct  283   HTNDCLDKGEARLDEVLFPDADGAPSPRPQEAVGSPVSSPQLAVDISPVLGWLRSLGLDR  342

Query  666   YEELFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVHALSELRK----ENTKEVEF--  827
             YEE F+++EIDWD+LQ LTEEDL K+G+SALGPRKKIVHAL+ELRK    E  + V+   
Sbjct  343   YEEAFVREEIDWDSLQCLTEEDLLKMGISALGPRKKIVHALNELRKGVQGETAEHVDING  402

Query  828   ---------QKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMY  980
                      +  A KA+V   SKV  SKLITDYF  S+   KK    S  Q  V   L  
Sbjct  403   KCGDHMTKTEPGASKAMVSGDSKVAASKLITDYFLGSSTNQKKTCNISTLQRRVTEQLSS  462

Query  981   SSN--------KSVK-KNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRDCSHWFLTHFH  1133
             S          K+VK +   K++  +++P+WC IPGTPFRVDAF+YL RDCSHWFLTHFH
Sbjct  463   SRGCAKVNDHVKNVKPRGRVKNSTRREVPLWCRIPGTPFRVDAFRYLTRDCSHWFLTHFH  522

Query  1134  ADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANH  1313
              DHYQGLTRSFCHGK+YCS+VTAKLVN+KIGIPW+ +++LP+NQ++ I  + VTC +ANH
Sbjct  523   MDHYQGLTRSFCHGKVYCSAVTAKLVNLKIGIPWERLEVLPINQKVVIESVGVTCLEANH  582

Query  1314  CPGAIIILFEPSNG  1355
             CPGA++ILFEP  G
Sbjct  583   CPGAVVILFEPPTG  596



>ref|XP_009794231.1| PREDICTED: uncharacterized protein LOC104241024 [Nicotiana sylvestris]
Length=467

 Score =   325 bits (832),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 195/389 (50%), Positives = 239/389 (61%), Gaps = 48/389 (12%)
 Frame = +3

Query  3     ELELEDMDLNIGLDSIPSTIDCSYPGSLDPKEEDKCFNVIEQNEKVGVFIEADSDTKNES  182
             E E ED+DL  GLDSI STIDC                   +NEK               
Sbjct  122   ESEFEDLDLCHGLDSIESTIDCCSRAQR------------TENEK---------------  154

Query  183   FSCASEKSVLEPKKGYFVNSIESRLLkssagleegkgeelgesselDMLLKLCSEGSEGD  362
                       E KKGY   SIE+RLL S  G EE K E    S   D+LLKLC E  +  
Sbjct  155   ----------ELKKGYLFKSIEARLLNSDGGFEERKEESEECSEL-DLLLKLCGEEEDEG  203

Query  363   DDSMEAYQEDDCASEGNDDSSLICCPLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLS  542
             D       ED+          L+CCPLCG DI+DL+ + R++HTNEC+D E+ PA  V +
Sbjct  204   DGVESFGLEDEYG--------LLCCPLCGADISDLSGDMREVHTNECLDNEETPAHVVTA  255

Query  543   HRDTSFQCLGQVLDASPARTPQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLT  722
             + D SFQC GQVL+ SP ++P++++   PVVEWLR LGLAKYEE+F+++EIDWD L+ LT
Sbjct  256   NNDVSFQCPGQVLNDSPCQSPKEVIRVSPVVEWLRNLGLAKYEEIFVREEIDWDALKSLT  315

Query  723   EEDLCKIGVSALGPRKKIVHALSELRKENTKEVEFQKNAKKAVVDDTSKVKLSKLITDYF  902
             EEDL  IGV+ALGPRKKI++++ ELRKE   E   +++A K V DD    K SKLITDYF
Sbjct  316   EEDLFGIGVTALGPRKKIINSILELRKETAVEKVARRDATKVVHDDAC-TKPSKLITDYF  374

Query  903   QCSAAGTKKVHATSCGQNEVGRSLMYSSNKSV-KKNPAKSTKYKDIPVWCSIPGTPFRVD  1079
               S +  K+V AT   Q EVGR+   +S+K + KKNPAKS K KDIPVWCS+PGTPFRVD
Sbjct  375   IGSVSERKRVCATGRAQMEVGRTCSDASHKRIQKKNPAKSAKSKDIPVWCSVPGTPFRVD  434

Query  1080  AFKYLRRDCSHWFLTHFHADHYQGLTRSF  1166
             AFKYLRRDCSHWFL+HFH D        F
Sbjct  435   AFKYLRRDCSHWFLSHFHLDRKTSSVNHF  463



>gb|EMT05587.1| hypothetical protein F775_00976 [Aegilops tauschii]
Length=239

 Score =   309 bits (791),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 155/239 (65%), Positives = 176/239 (74%), Gaps = 26/239 (11%)
 Frame = +1

Query  1393  MMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAFNPRTLFLIGSYTI  1572
             M   P  Q   IHTLILDTTYCNP+YDFP Q+ VIQFVIEAIQAEAFNP+TLFLIGSYTI
Sbjct  1     MANNPVLQSSHIHTLILDTTYCNPRYDFPSQEIVIQFVIEAIQAEAFNPKTLFLIGSYTI  60

Query  1573  G-------------------------KERLFVEIARALCKKIYVTAAKLRILQCLGFPDE  1677
             G                         KERLF E+AR L KKIYV AAKL+IL+ L  P E
Sbjct  61    GTVSSSRSLIFKCSCISCLILSPVAGKERLFTEVARLLQKKIYVGAAKLQILKHLELPQE  120

Query  1678  DMQFFTLNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTP  1857
              M + T NE ESHIHVVP+WTLA+FKRL  +S+QY  RY LIVA  PTGWS GKG+KKTP
Sbjct  121   IMPWLTANEAESHIHVVPMWTLASFKRLKHLSSQYADRYDLIVAFCPTGWSFGKGRKKTP  180

Query  1858  GKRWQQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLS-LLSD  2031
             G+RWQQGTIIRYEVPYSEHSSF+EL++FV+FISP +I+PSVNN GPE    ML+ LL+D
Sbjct  181   GRRWQQGTIIRYEVPYSEHSSFTELREFVRFISPEHIVPSVNNDGPEGADAMLAQLLND  239



>ref|XP_005649918.1| DRMBL-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25374.1| DRMBL-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=363

 Score =   220 bits (560),  Expect(2) = 7e-84, Method: Compositional matrix adjust.
 Identities = 111/225 (49%), Positives = 148/225 (66%), Gaps = 4/225 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIH-TLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             ++HTGD R+   M +  +    +   TLILDTTYC  QY+FP Q  V+QFV+EA++AEAF
Sbjct  137   IVHTGDCRYHVGMQQERALVAVRGRATLILDTTYCAAQYNFPPQLQVLQFVLEAVRAEAF  196

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP TLFL GSYTIGKERLF+E+AR L +K+YV+ +K  +L  LG P E     T ++  +
Sbjct  197   NPATLFLFGSYTIGKERLFLEVARILQRKVYVSVSKRAVLDTLGLPPEYETLLTTDD-RA  255

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTP-GKRWQQGTIIR  1890
              +H VPLW + + K + +    Y GRY+ IV   PTGWS+  GK + P G+R Q+GT+I 
Sbjct  256   RLHAVPLWRV-SLKHMARTLKHYRGRYTTIVGFQPTGWSMHSGKGRAPRGRRRQKGTLIV  314

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             Y VPYSEHSS  EL++ V F+ P  IIPSVNN G      M++ L
Sbjct  315   YSVPYSEHSSHQELRQMVDFLRPTKIIPSVNNDGGSKASHMVASL  359


 Score =   120 bits (302),  Expect(2) = 7e-84, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 72/106 (68%), Gaps = 2/106 (2%)
 Frame = +3

Query  1035  IPVWCSIPGTPFRVDAFK--YLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKL  1208
             +P W  +PG PF VD F     +  C  WFLTHFH+DHY+GLT  F  G IYC+ +TAKL
Sbjct  26    LPPWQKMPGLPFLVDRFGKGTEKAACKSWFLTHFHSDHYKGLTSKFKAGVIYCTLITAKL  85

Query  1209  VNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEP  1346
             V+ ++ +PW+ ++++ LN    + G+ VT  DANHCPGA +I+FEP
Sbjct  86    VHQRLKVPWERLRVVQLNAAQLVEGVRVTFVDANHCPGAAMIVFEP  131



>ref|XP_005847690.1| hypothetical protein CHLNCDRAFT_134115 [Chlorella variabilis]
 gb|EFN55588.1| hypothetical protein CHLNCDRAFT_134115 [Chlorella variabilis]
Length=886

 Score =   221 bits (562),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 109/222 (49%), Positives = 150/222 (68%), Gaps = 6/222 (3%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHT-LILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF  1533
             VLHTGD R   EM    +    +    +ILDTTYC+P+Y FP Q  V++F I+A++AEAF
Sbjct  656   VLHTGDCRLIPEMQHEAALAAVRGQADIILDTTYCSPEYAFPSQQEVLRFAIDAVKAEAF  715

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TLFL GSYTIGKERLF+E AR L ++IYV+AAK ++L CL  P E     T ++  +
Sbjct  716   NPKTLFLFGSYTIGKERLFLEAARVLQRRIYVSAAKRKVLDCLELPQEYASLLTTDDHTT  775

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTP--GKRWQQGTII  1887
             ++H VPLW ++  K + ++   Y GR+S  V   PTGW+  +   +    G+R Q+GTII
Sbjct  776   NLHAVPLWMVSQ-KHMAKLLKHYRGRFSTAVGFQPTGWTHQRDASQAGARGRRRQKGTII  834

Query  1888  RYEVPYSEHSSFSELKKFVKFISPANIIPSVNNH--GPESTR  2007
              Y+VPYSEHSSFSEL++FV +  P +IIPSVN+   GP++ R
Sbjct  835   TYQVPYSEHSSFSELRQFVDWFRPVSIIPSVNSDGGGPKAMR  876


 Score =   114 bits (284),  Expect(2) = 6e-82, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 69/107 (64%), Gaps = 3/107 (3%)
 Frame = +3

Query  1044  WCSIPGTPFRVDAFKYLRRDCSH--WFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNM  1217
             W  +PGT F VD F  L +   H  WFLTHFHADHY+GLT  F  G +YCS  TA LV  
Sbjct  548   WQLVPGTSFVVDRFSNLPQQSPHRHWFLTHFHADHYKGLTGRFDRGTLYCSPPTALLVQQ  607

Query  1218  KIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGC  1358
             ++ +    I+ +PLN  I + G+ VT  DANHCPGA++ILFEP  GC
Sbjct  608   QLRVKPACIRCVPLNSPILVEGVRVTFLDANHCPGAVMILFEPP-GC  653



>gb|KFM26805.1| DNA cross-link repair 1A protein [Auxenochlorella protothecoides]
Length=335

 Score =   205 bits (521),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 100/218 (46%), Positives = 151/218 (69%), Gaps = 8/218 (4%)
 Frame = +1

Query  1393  MMEIPSFQPCKIHT-LILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAFNPRTLFLIGSYT  1569
             M+ +P+    +    LILDTTYC+PQY FP QD V+ FVI+A++AEAFNP+TLFL GSYT
Sbjct  121   MLRLPALARLRGRADLILDTTYCDPQYQFPSQDEVLSFVIDAVKAEAFNPKTLFLFGSYT  180

Query  1570  IGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESHIHVVPLWTLAN  1749
             IGKER+F+E AR L +K+YV+A KL+IL CL    E     T ++ E+ +H VPLW + +
Sbjct  181   IGKERVFLEAARVLRQKVYVSATKLKILNCLELEPEVRAQLTTSDRETSLHAVPLWMITH  240

Query  1750  FKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTIIRYEVPYSEHSSF  1923
                + ++   Y GR++ +V   PTGW+  K  G+ +  G++ Q+G++I Y+  + EHSSF
Sbjct  241   -DHMTKLLKHYRGRFTTVVGFKPTGWTHDKEAGRTRARGRKQQRGSLITYQASF-EHSSF  298

Query  1924  SELKKFVKFISPANIIPSVNN--HGPESTRKMLSLLSD  2031
             SEL++FV + +P  I+PSVN+  HGP++ + ++ LL++
Sbjct  299   SELREFVTWFAPLRIVPSVNSDCHGPKA-KALVDLLTN  335


 Score = 97.4 bits (241),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 60/100 (60%), Gaps = 3/100 (3%)
 Frame = +3

Query  1044  WCSIPGTPFRVDAFKYLRRDCS---HWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             W  +PGT F VD F  L        HWFLTHFHADHY+GLT  F  G I+C+  T  LV 
Sbjct  23    WQLVPGTQFVVDRFDSLPPSLPQHRHWFLTHFHADHYKGLTGKFDRGIIHCTPTTGALVA  82

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIII  1334
              ++ +P   ++  PL++  ++ G  VT  DANHCPGA ++
Sbjct  83    QQLRLPPARLRTQPLDEPFDLEGTRVTFLDANHCPGAAML  122



>ref|XP_005704885.1| DNA ligase [Galdieria sulphuraria]
 gb|EME28365.1| DNA ligase [Galdieria sulphuraria]
Length=574

 Score =   182 bits (461),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 101/236 (43%), Positives = 138/236 (58%), Gaps = 13/236 (6%)
 Frame = +1

Query  1357  VLHTGDFRFCDEM-MEIPS-FQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEA  1530
             +LHTGDFR+  E+  +IP  F    +  L LDTTYCNP+YDFP Q   ++ V+EA++AE+
Sbjct  340   ILHTGDFRYSIELHSQIPQMFGKSCLDYLFLDTTYCNPRYDFPSQQEAVEAVLEAVKAES  399

Query  1531  FNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE  1710
             F+ R LFL G+Y IGKE++F+ +A  L +K+YV   K RIL  L  P+      T     
Sbjct  400   FHSRVLFLFGTYQIGKEKVFLHVAERLNEKVYVDKRKYRILNHLSLPENVQNLLTTEPSA  459

Query  1711  SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKK-------TPG--K  1863
             S +HVV + T++ F  + +I+  Y  RY+  VA  PTGWS   GKK         PG   
Sbjct  460   SRLHVVDMRTVS-FGGMREIAKNYATRYNTFVAFRPTGWSY-TGKKMLRSYGNLKPGILT  517

Query  1864  RWQQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD  2031
             R  +   + Y VPYSEHSSFSEL++FV    P N+IP+V  +  E   +   LL D
Sbjct  518   RQLKQNCVLYGVPYSEHSSFSELREFVSICRPKNLIPTVCKNSKEEADRQRKLLLD  573


 Score =   119 bits (299),  Expect(2) = 6e-72, Method: Compositional matrix adjust.
 Identities = 86/270 (32%), Positives = 125/270 (46%), Gaps = 32/270 (12%)
 Frame = +3

Query  627   PVVE-------WLRKLGLAKYEELFIQQEID-WDTLQWLTEEDLCKIGVSALGPRKKIVH  782
             P+VE       WL  L L  YE++ +   ID   TL+ L EE L  IGV  LG RKKI+ 
Sbjct  62    PIVEERLFLRAWLLSLQLEYYEDILVAHGIDSLATLKTLDEETLKTIGVHTLGARKKIIQ  121

Query  783   ALSELRKENTKEVE----------FQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKV  932
              LS+     T   +             ++ K+V  D     L    +   +  +  + + 
Sbjct  122   NLSDCEFPPTFATDGGNTCLSLASLHLSSDKSVCKDDPNNALPSHESQSLKNKSPMSSRA  181

Query  933   HATSCGQNEVGRSLMYSSNKSVKKNPAKST---KYKDIPVWCSIPGTPFRVDAFKYLRR-  1100
                  G       + Y+++ +V      S    K K  P    +PGT F VD+FK   + 
Sbjct  182   PKEPSGAERKLYPIFYANHNNVNMIETASVQDKKSKGHPFSKRVPGTSFTVDSFKMAGQG  241

Query  1101  DCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINI-  1277
             DC  +FL+HFH+DH  GLT  F  G I+CS +TA L+  ++G+  + I +L LNQ   + 
Sbjct  242   DCRQFFLSHFHSDHTMGLTSRFQAGVIFCSRITASLIRSQLGVKDEYICVLELNQSCYVQ  301

Query  1278  ---------AGIDVTCFDANHCPGAIIILF  1340
                       G  VT  DANHCPG+++ LF
Sbjct  302   DEGKSTRGTMGATVTVLDANHCPGSVMFLF  331



>ref|XP_003061601.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54231.1| predicted protein [Micromonas pusilla CCMP1545]
Length=698

 Score =   186 bits (472),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 147/230 (64%), Gaps = 8/230 (3%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIH--TLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEA  1530
             VL TGD RF   M   P     +     ++LDTTYC+P++ FP Q+ V++ V  A++AE 
Sbjct  454   VLATGDCRFHASMTLDPGLLRIQERRPAVMLDTTYCDPKHAFPPQEEVLKAVAVAVKAEN  513

Query  1531  FNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDED--MQFFTLNE  1704
             FNP+ LFL G+YTIGKER+F E A+AL KK+YV   K ++L  LG   +   M   T ++
Sbjct  514   FNPKCLFLFGTYTIGKERVFFEAAKALGKKVYVGKQKRQVLDALGDAIDKTYMDSVTTDD  573

Query  1705  LESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPG-KRWQQGT  1881
              E+++HVVP+ +  +F R+  I   Y  RY  ++A  PTGW+  K  K     KR Q+G+
Sbjct  574   TETNLHVVPMGST-SFARMKTILRYYKNRYDTVIAFKPTGWTFEKAAKTARATKRTQRGS  632

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSV-NNHGPESTRKMLSLLS  2028
             +I+Y +PYSEHSSF+EL+ F++++ P  I+P V N+ GP++ R M+ LL+
Sbjct  633   LIQYALPYSEHSSFTELRAFMRWLKPRAILPHVGNDRGPKAAR-MVRLLT  681


 Score =   110 bits (275),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 85/329 (26%), Positives = 140/329 (43%), Gaps = 31/329 (9%)
 Frame = +3

Query  435   CPLCGRDITDLNEE--QRQIHTNECIDKEDAPAEAVLSHRDTSFQ--CLGQVLDASPART  602
             CP+C R +  L +    R  H N C+D E    E      +   +   LG   D      
Sbjct  132   CPVCDRALRSLADTPLARVAHVNACLDDETGGWEGDEDDEEEVARDDALGATWDEGGEGE  191

Query  603   PQKLVARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEEDLCKIGVSALGPRKKIVH  782
                + A      W   +    +  + +++++ +D L+ LT+EDL  +GV  LG RK++  
Sbjct  192   WHDVAA------WCHAVDQPSFAPVAVERKLTFDALERLTDEDLRAMGVGTLGARKRLRA  245

Query  783   ALSELRKENTKEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEV  962
             A+    +E +                    + +  +   F  +        A     +  
Sbjct  246   AIEA--REVSPPPPPPTTTTTTGAGGWHPTREAVAVAPVFAFARGEAVAPSAAPSSSSGS  303

Query  963   GRSLMYSSNKSVKKNPAKSTKYKDIPV----------WCSIPGTPFRVDAFKYLRRD---  1103
             GR +    +K  K  P  S+  + +P           W  +PGT F VD F+   +    
Sbjct  304   GRHVDAPPSKRRKDRPRPSSS-RYVPAAAQDLPPPPPWIRVPGTTFIVDGFRGYGKSHSG  362

Query  1104  -CSHWFLTHFHADHYQGLTRSFCHGK--IYCSSVTAKLVNMKIGIPWDNIQILPLNQRIN  1274
              C +WFLTHFHADHY GLTRS       ++CS  TA+L  +++GI    ++ + + +   
Sbjct  363   WCKNWFLTHFHADHYAGLTRSTPSEGCVVWCSRPTARLCQLRLGISKSRLRAVDVGRDFI  422

Query  1275  IAGIDVTCFDANHCPGAIIILFE--PSNG  1355
             + G+      ANHCPGA++I+F+  P  G
Sbjct  423   VEGVKCRFVHANHCPGAVMIVFDDIPGGG  451



>ref|XP_002509150.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70408.1| predicted protein [Micromonas sp. RCC299]
Length=671

 Score =   196 bits (497),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 146/230 (63%), Gaps = 8/230 (3%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQP--CKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEA  1530
             VL TGD R+   M   P+      +   ++LDTTYC+P + FP Q  V+  V +A++AE+
Sbjct  432   VLATGDCRYHPGMKTDPTLAALASRRPAVMLDTTYCSPAHVFPPQCEVLAAVRDAVKAES  491

Query  1531  FNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLG--FPDEDMQFFTLNE  1704
             FNPR LFL G+YTIGKER+F E A+AL KK+YV   K+++L  LG    D D    T ++
Sbjct  492   FNPRVLFLFGTYTIGKERVFFEAAKALGKKVYVGKQKMKVLDALGSAIDDADRDMITADD  551

Query  1705  LESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPG-KRWQQGT  1881
               +++HVVP+ +  +F R+  I   Y  RY  IVA  PTGW+    KK     KR Q+G 
Sbjct  552   QATNLHVVPMGST-SFGRMKTILRYYKNRYDTIVAFKPTGWTFEAAKKHARATKRTQRGA  610

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSV-NNHGPESTRKMLSLLS  2028
             +I+Y VPYSEHSSF EL+ FVKF+ P  ++P V N+ GP++ R+M+ LL+
Sbjct  611   MIQYSVPYSEHSSFDELRAFVKFLKPRAVLPHVGNDRGPKA-RRMVQLLT  659


 Score = 97.8 bits (242),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 71/116 (61%), Gaps = 9/116 (8%)
 Frame = +3

Query  1044  WCSIPGTPFRVDAFKYLRRD-----CSHWFLTHFHADHYQGLTRSFCHGK--IYCSSVTA  1202
             W  +PGT F VD F+   +      C HWFLTHFHADHY+GLT+S       ++CS  TA
Sbjct  319   WIRVPGTRFIVDGFQGYGKSHGGWWCRHWFLTHFHADHYRGLTKSTPPPGCLVWCSRPTA  378

Query  1203  KLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFE--PSNGCLA  1364
             +L   ++GI  D ++ + + + I + G+  T  DANHCPGA++I+F+  P+   LA
Sbjct  379   ELCASRLGIQRDRLRAVDVGRTIVVDGVRCTFIDANHCPGAVMIVFDGIPAGPVLA  434



>ref|XP_003081832.1| putative SNM1 (ISS), partial [Ostreococcus tauri]
Length=374

 Score =   179 bits (453),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 140/232 (60%), Gaps = 11/232 (5%)
 Frame = +1

Query  1357  VLHTGDFRFC-----DEMMEIPSFQPCKIHTLILDTTYCNPQYD-FPKQDAVIQFVIEAI  1518
             VLHTGDFRF      DE +   +  P K   LILDTTYC+ ++D FP Q+ V+  V EA+
Sbjct  125   VLHTGDFRFSARLARDETLVRIAASP-KRPILILDTTYCSLEHDAFPTQEYVLNAVREAL  183

Query  1519  QAEAF--NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFF  1692
               E      R LFL G+YT+GKE++F E AR L +K+YV AAK  +L  L    ++ +  
Sbjct  184   THEDNLDGARKLFLFGTYTVGKEKVFFEAARTLGRKVYVGAAKRSVLDALSLTRDEREAL  243

Query  1693  TLNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKT-PGKRW  1869
             T ++  +++HVVP+ +  +F ++  I   Y  R+  +VA  PTGW+    KK +    R 
Sbjct  244   TRDDKRTNLHVVPMGS-TSFSKMASILKYYKSRFDTVVAFRPTGWTFSANKKTSRASSRR  302

Query  1870  QQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             Q+G +++Y +PYSEHSS SEL+ F++FI+P +I P V N G E    ML LL
Sbjct  303   QRGRLVQYGLPYSEHSSLSELRAFIRFINPRSIFPHVGNDGGEKLNDMLKLL  354


 Score =   107 bits (267),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 68/105 (65%), Gaps = 3/105 (3%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRD--CSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKL  1208
             P W   PGT F VD F++ L R   C  WFLTHFHADH++GLT++F  G IY +  T +L
Sbjct  11    PCWIRPPGTRFIVDGFEWDLGRGGACETWFLTHFHADHHRGLTKTFDKGIIYGTKETLEL  70

Query  1209  VNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFE  1343
             V MKI +P   ++ L +     + G+ VT  DANHCPGA++ILFE
Sbjct  71    VRMKIQVPALRLRALEIGVPARVDGVQVTFIDANHCPGAVMILFE  115



>ref|XP_001635152.1| predicted protein [Nematostella vectensis]
 gb|EDO43089.1| predicted protein [Nematostella vectensis]
Length=338

 Score =   179 bits (454),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/226 (43%), Positives = 136/226 (60%), Gaps = 4/226 (2%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQF-VIEAIQAEA  1530
              +LHTGDFR   EM   P+     I TL LDTTYC+PQY FPKQ+  I F V +A QA +
Sbjct  110   TILHTGDFRASREMESYPALANKTIDTLYLDTTYCDPQYTFPKQEETINFAVTKAAQAVS  169

Query  1531  FNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE  1710
              NP+TL + G+YTIGKE++F+ IA+ L  K+ V + K RIL  L   D      T ++ E
Sbjct  170   ENPKTLIVCGTYTIGKEKVFLAIAKELGCKVTVQSDKKRILDSLE-SDFIQSVITTDKSE  228

Query  1711  SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIR  1890
               IHV+P+  L N + L+   +Q+ G+++ +VA  PTGW    G   +  +   +G I  
Sbjct  229   GRIHVLPMGKL-NHQHLSSYMDQFKGKFTRVVAFKPTGWEHKSG-PLSATRPVTKGPISI  286

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
             Y VPYSEHSS+ E+K+FV+F  P  I+P+VN H   S  KM  + +
Sbjct  287   YGVPYSEHSSYEEMKRFVQFTRPTKIVPTVNVHSVSSREKMTEIFN  332


 Score =   106 bits (265),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IP TPF VDAF+Y        +FL+HFH DHY GL + F H  IYCS VTA LV 
Sbjct  3     PFYKKIPDTPFVVDAFRYGSIPGIKVYFLSHFHYDHYGGLKKGFSH-PIYCSKVTANLVE  61

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              KI +    I+ LP++  + +  + VT  DANHCPGA+++LFE  NG
Sbjct  62    SKIKVSQRYIKALPMDTPVIVDKVQVTLLDANHCPGAVLLLFELPNG  108



>emb|CEF99524.1| DNA repair metallo-beta-lactamase [Ostreococcus tauri]
Length=382

 Score =   178 bits (452),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/232 (42%), Positives = 140/232 (60%), Gaps = 11/232 (5%)
 Frame = +1

Query  1357  VLHTGDFRFC-----DEMMEIPSFQPCKIHTLILDTTYCNPQYD-FPKQDAVIQFVIEAI  1518
             VLHTGDFRF      DE +   +  P K   LILDTTYC+ ++D FP Q+ V+  V EA+
Sbjct  133   VLHTGDFRFSARLARDETLVRIAASP-KRPILILDTTYCSLEHDAFPTQEYVLNAVREAL  191

Query  1519  QAEAF--NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFF  1692
               E      R LFL G+YT+GKE++F E AR L +K+YV AAK  +L  L    ++ +  
Sbjct  192   THEDNLDGARKLFLFGTYTVGKEKVFFEAARTLGRKVYVGAAKRSVLDALSLTRDEREAL  251

Query  1693  TLNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKT-PGKRW  1869
             T ++  +++HVVP+ +  +F ++  I   Y  R+  +VA  PTGW+    KK +    R 
Sbjct  252   TRDDKRTNLHVVPMGS-TSFSKMASILKYYKSRFDTVVAFRPTGWTFSANKKTSRASSRR  310

Query  1870  QQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             Q+G +++Y +PYSEHSS SEL+ F++FI+P +I P V N G E    ML LL
Sbjct  311   QRGRLVQYGLPYSEHSSLSELRAFIRFINPRSIFPHVGNDGGEKLNDMLKLL  362


 Score =   107 bits (267),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 68/105 (65%), Gaps = 3/105 (3%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRD--CSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKL  1208
             P W   PGT F VD F++ L R   C  WFLTHFHADH++GLT++F  G IY +  T +L
Sbjct  19    PCWIRPPGTRFIVDGFEWDLGRGGACETWFLTHFHADHHRGLTKTFDKGIIYGTKETLEL  78

Query  1209  VNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFE  1343
             V MKI +P   ++ L +     + G+ VT  DANHCPGA++ILFE
Sbjct  79    VRMKIQVPALRLRALEIGVPARVDGVQVTFIDANHCPGAVMILFE  123



>ref|XP_010239822.1| PREDICTED: DNA cross-link repair protein SNM1 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010239823.1| PREDICTED: DNA cross-link repair protein SNM1 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010239824.1| PREDICTED: DNA cross-link repair protein SNM1 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010239825.1| PREDICTED: DNA cross-link repair protein SNM1 isoform X1 [Brachypodium 
distachyon]
Length=480

 Score =   162 bits (411),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 133/221 (60%), Gaps = 5/221 (2%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAE-AFN  1536
             LHTGDFR    M   P  Q  +I+ L LDTTYCNP+Y FP Q+ VI FV+   Q      
Sbjct  251   LHTGDFRASKSMQSHPLLQTGRINLLYLDTTYCNPKYKFPPQEDVIDFVVRTAQRYLKKQ  310

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             P+TL ++G+Y+IGKE +++ I++AL   IY  A++ RIL   G+PD   +  + ++  S 
Sbjct  311   PKTLIVVGAYSIGKENVYLAISQALEVPIYTDASRRRILHSFGWPDLSKRISSCDQ-SSP  369

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTIIR  1890
             +HV+PL ++ + ++L +       R+  ++A  PTGW+  +  GK+    K   +G +  
Sbjct  370   LHVMPLASVQH-EKLTKYLETLNQRFLAVLAFRPTGWTFSEAAGKELDLIKPSSRGRVTI  428

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y VPYSEHSSF+EL+ F+KF+ P  +IP+VN     S  KM
Sbjct  429   YGVPYSEHSSFTELRDFLKFVRPQKVIPTVNVGNAASRYKM  469


 Score =   119 bits (297),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 77/126 (61%), Gaps = 7/126 (6%)
 Frame = +3

Query  981   SSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLT  1157
             S    V K PA    YK       IPGTPF VDAF+Y     CS +FL+HFH DHY GLT
Sbjct  128   SEENGVAKKPATCPFYK------KIPGTPFTVDAFRYGAVEGCSAYFLSHFHYDHYGGLT  181

Query  1158  RSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIIL  1337
             + +CHG IYC+++TA+LV M + I  + I  L LN    I G+ VT  +ANHCPGA +I 
Sbjct  182   KKWCHGPIYCTALTARLVKMLLSINSEYICPLELNTEYVIDGVTVTLLEANHCPGAALIH  241

Query  1338  FEPSNG  1355
             F  S+G
Sbjct  242   FRLSDG  247



>ref|XP_007903848.1| PREDICTED: DNA cross-link repair 1A protein [Callorhinchus milii]
Length=961

 Score =   172 bits (436),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 97/227 (43%), Positives = 134/227 (59%), Gaps = 4/227 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P     K+HTL LDTTYC+P+YDFP Q   IQF    A +A   
Sbjct  717   LLHTGDFRAQTSMERYPHLLGQKVHTLYLDTTYCSPEYDFPSQQQTIQFAASVAFEAVTL  776

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K+ V+  KL ILQCL   ++     T++   S
Sbjct  777   NPRTLIVCGTYSIGKEKIFLAIADVLGFKVCVSRDKLAILQCLE-SEQVNSAITVDWESS  835

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWS-LGKGKKKTPGKRWQQGTIIR  1890
               H++P+  + NFK L    +++ G+Y  I+A  PTGW+  G+       K   +G I  
Sbjct  836   QFHLLPMMQI-NFKGLQAHISKFPGKYDKILAFKPTGWTYCGQSVALLDIKPQIRGKITI  894

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD  2031
             Y +PYSEHSS+ E+KKFV+++ P  IIP+VNN   E    M  +  D
Sbjct  895   YGIPYSEHSSYLEMKKFVQWLQPVKIIPTVNNGNREERNLMERIFRD  941


 Score =   108 bits (271),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 89/147 (61%), Gaps = 8/147 (5%)
 Frame = +3

Query  927   KVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRD  1103
             K   ++ G+NE   S    +    KK+   +TK K  P +  IPGT F VDAF Y +   
Sbjct  576   KGEVSTPGKNE---SETEKNENGTKKHENGTTK-KPCPFYKKIPGTYFTVDAFCYGVIEG  631

Query  1104  CSHWFLTHFHADHYQGLTRSF-CHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIA  1280
             C+ +FLTHFH+DHY+GLT+ F C   IYCS +T  LV  K+ +  + I+ +P+N    + 
Sbjct  632   CTSYFLTHFHSDHYRGLTKKFKC--PIYCSKITGNLVRCKLRVEDEYIKTIPMNTECIVD  689

Query  1281  GIDVTCFDANHCPGAIIILFEPSNGCL  1361
             G+ V   +ANHCPGA+++LF+ ++G L
Sbjct  690   GVKVVLLEANHCPGAVMLLFQLASGKL  716



>ref|XP_006778797.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Myotis 
davidii]
 ref|XP_006778798.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Myotis 
davidii]
Length=1053

 Score =   169 bits (427),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 127/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             VLHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  823   VLHTGDFR-ADPTMERSLLMRLKVHTLYLDTTYCSPEYCFPSQQEVIQFAINTAFEAVTL  881

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  +  K+ ++  K + LQCL  P E     T +   +
Sbjct  882   NPRTLVVCGTYSIGKEKVFLAIADVIGSKVGMSREKYKTLQCLNIP-EINSLITTDMCNT  940

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +Y GRY  I+A  PTGW+             Q QG I  
Sbjct  941   LVHLLPMMQI-NFKGLQSHLKKYDGRYEQILAFRPTGWTHSNKLTSMADVVPQTQGNISI  999

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  1000  YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1030


 Score =   112 bits (280),  Expect(2) = 7e-66, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 3/132 (2%)
 Frame = +3

Query  963   GRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHAD  1139
             GR L   + KS   +PA   + +  P +  IPGT F VDAF+Y +   C+ +FLTHFH+D
Sbjct  691   GR-LQRGNRKSPYSSPAGELRKRTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSD  749

Query  1140  HYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCP  1319
             HY GL+++F    +YCS +T  L+  K+ +    I  LP++    + GI V   DANHCP
Sbjct  750   HYAGLSKNFTF-PVYCSEITGNLLKSKLHVEEQYIHPLPMDTECMVNGIKVVLLDANHCP  808

Query  1320  GAIIILFEPSNG  1355
             GA++ILF   NG
Sbjct  809   GAVMILFFLPNG  820



>ref|XP_002447746.1| hypothetical protein SORBIDRAFT_06g014970 [Sorghum bicolor]
 gb|EES12074.1| hypothetical protein SORBIDRAFT_06g014970 [Sorghum bicolor]
Length=496

 Score =   160 bits (405),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 130/221 (59%), Gaps = 5/221 (2%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAE-AFN  1536
             LHTGDFR    M   P  Q  +++ + LDTTYCNP+Y FP Q+ VI FV+   Q      
Sbjct  267   LHTGDFRASKSMQLHPLLQRGRVNLVYLDTTYCNPKYKFPPQEDVIDFVVRTAQRYLKKQ  326

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             P+TL ++G+Y+IGKE +++ I++AL   IY  A++ RIL   G+ D   +  + N+  S 
Sbjct  327   PKTLIVVGAYSIGKENVYLAISQALEVPIYTDASRRRILHSFGWSDLSKRICSCNQ-SSP  385

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTIIR  1890
             +HV+PL ++ N + L +      GR+  ++A  PTGW+  +  GK     K    G++  
Sbjct  386   LHVLPLGSV-NHENLKKYLETLSGRFLAVLAFRPTGWTFSEATGKHLDLIKPSCNGSVTI  444

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y VPYSEHSSF+EL+ FV F+ P  +IP+VN     S  KM
Sbjct  445   YGVPYSEHSSFTELRDFVMFLRPQKVIPTVNVGNATSRDKM  485


 Score =   119 bits (299),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLRRD-CSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGTPF VDAF+Y + + CS +FL+HFH DHY GLT+ +CHG IYCS++TA+LV 
Sbjct  157   PFYKKIPGTPFTVDAFRYGQVEGCSAYFLSHFHHDHYGGLTKKWCHGPIYCSALTARLVK  216

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             M + +  D I  L L+    I G+ VT  +ANHCPGA +I F+ S+G
Sbjct  217   MCLSVNSDYIYPLELDTNYVIEGVTVTLLEANHCPGAALIHFQLSDG  263



>ref|XP_008142549.1| PREDICTED: DNA cross-link repair 1A protein [Eptesicus fuscus]
Length=1067

 Score =   167 bits (424),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 129/211 (61%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             VLHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  837   VLHTGDFR-ADPTMERSLLVGLKVHTLYLDTTYCSPEYCFPSQQEVIQFAINTAFEAVTL  895

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  +  K+ ++  K + LQCL  P E     T +  ++
Sbjct  896   NPRTLVVCGTYSIGKEKVFLAIADVIGSKVGMSREKYKTLQCLNIP-EINSLITTDMSDA  954

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWS-LGKGKKKTPGKRWQQGTIIR  1890
              +H++P+  + NFK L     +Y GRY  I+A  PTGW+   K    T      +G I  
Sbjct  955   LVHLLPMMQI-NFKGLQSHLKKYDGRYEQILAFRPTGWTHSNKLTSMTDVVPQTKGNISI  1013

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  1014  YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1044


 Score =   112 bits (279),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 69/190 (36%), Positives = 104/190 (55%), Gaps = 16/190 (8%)
 Frame = +3

Query  807   NTKEVEFQKNAKKAVVDDTSKVKLSKLITDYF-QCSAAGTK----KVHATS-CGQNEVGR  968
             +TK    QK  K+    D+ +  + +  +DY    + AG      +V  TS CG+ + G 
Sbjct  654   STKRARHQK--KRLKKSDSIQEGMPQTRSDYLINKTKAGVNLSKDQVFITSPCGRLQRGN  711

Query  969   SLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHY  1145
             +      KS   +PA   + +  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY
Sbjct  712   A------KSPHFSPAGELRKRTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSDHY  765

Query  1146  QGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGA  1325
              GL+++F    +YCS +TA L+  K+ +    I  LP++    + G+ V   DANHCPGA
Sbjct  766   AGLSKNFT-SPVYCSEITANLLKNKLHVEEQYIHPLPMDTECIVNGVKVVLLDANHCPGA  824

Query  1326  IIILFEPSNG  1355
             ++ILF   NG
Sbjct  825   VMILFYLPNG  834



>ref|XP_001420404.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO98697.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=346

 Score =   179 bits (454),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 146/234 (62%), Gaps = 14/234 (6%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSF--------QPCKIHTLILDTTYCNPQYD-FPKQDAVIQFVI  1509
             VLHTGDFRF D M   P+          P  I  LILDTTYC+ ++D FP Q+ V++ V 
Sbjct  115   VLHTGDFRFHDGMRNDPTLLRITSDPSAPRPI--LILDTTYCSLEHDDFPTQERVLKAVR  172

Query  1510  EAI-QAEAFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQ  1686
             +A+   +  + R LFL G+YTIGKE++F+E A+ L +K+Y+  AK  ++  +    E+  
Sbjct  173   DAVVHEDLLSTRKLFLFGTYTIGKEKVFLEAAKVLNRKVYIGKAKRSVMDAIALDPEERS  232

Query  1687  FFTLNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPG-K  1863
               T ++ ++++HVVP+ +  +F ++  I   Y  R+  ++A  PTGW+    KK      
Sbjct  233   AMTHDDSKTNLHVVPMGS-TSFMKMASILKYYKSRFDTVIAFRPTGWTFSAQKKTARATS  291

Query  1864  RWQQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             R Q+G +I+Y +PYSEHSS +EL++FV+F++P  I P VNN G E+ ++ML+LL
Sbjct  292   RRQRGRLIQYGLPYSEHSSLNELREFVRFMNPKFIFPHVNNDGGENAKRMLTLL  345


 Score =   100 bits (250),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 67/105 (64%), Gaps = 3/105 (3%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLRRD---CSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKL  1208
             P W   PGT F VD F+Y       C HWFLTHFHADH++GLTR+F  G +Y +  T +L
Sbjct  1     PAWIRPPGTMFIVDGFEYAASSEARCEHWFLTHFHADHHRGLTRTFDRGVVYGTRTTTEL  60

Query  1209  VNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFE  1343
             V  KIG+P + ++++     + + G+DVT   ANHCPGA +I FE
Sbjct  61    VRTKIGVPRERLRVVEFGVVVRVDGVDVTFLRANHCPGAAMICFE  105



>ref|XP_008661391.1| PREDICTED: uncharacterized protein LOC100192920 isoform X1 [Zea 
mays]
 gb|AFW58146.1| hypothetical protein ZEAMMB73_659537 [Zea mays]
 gb|AFW58147.1| hypothetical protein ZEAMMB73_659537 [Zea mays]
Length=505

 Score =   162 bits (410),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 90/228 (39%), Positives = 131/228 (57%), Gaps = 5/228 (2%)
 Frame = +1

Query  1339  LNHPMAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAI  1518
             L+     LHTGDFR    M   P  Q  +++ + LDTTYCNP+Y FP Q+ VI FV+   
Sbjct  269   LSDGKTCLHTGDFRASKTMQSHPLLQRGRVNLVYLDTTYCNPKYKFPPQEDVIDFVVRTT  328

Query  1519  QAE-AFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFT  1695
             +      P+TL ++G+Y+IGKE +++ I++AL   IY  A++ RIL   G+PD   +  +
Sbjct  329   RRYLKKQPKTLIVVGAYSIGKENVYLAISQALEAHIYTDASRRRILYSFGWPDLSKRLCS  388

Query  1696  LNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRW  1869
              N+  S +HV+PL ++ N + L +      GR+  ++A  PTGW+  +  GK     K  
Sbjct  389   CNQ-SSSLHVLPLGSI-NHENLKKYLETLNGRFLAVLAFRPTGWTFSEATGKHLDLIKPS  446

Query  1870  QQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
                 +  Y VPYSEHSSF+EL+ FV F+ P  IIP+VN     S  KM
Sbjct  447   SNANVTIYGVPYSEHSSFTELRDFVMFLKPQKIIPTVNVGNATSRDKM  494


 Score =   117 bits (294),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLRRD-CSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGTPF VDAF+Y + + CS +FL+HFH DHY GLT+ +CHG IYCS++TA+LV 
Sbjct  166   PFYKKIPGTPFTVDAFRYGQVEGCSAYFLSHFHHDHYGGLTKKWCHGPIYCSALTARLVK  225

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             M + +  D I  L L+    I G+ VT  +ANHCPGA +I F  S+G
Sbjct  226   MCLSVNSDYICPLELDTEYVIEGVTVTLLEANHCPGAALIHFRLSDG  272



>ref|XP_005874573.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Myotis 
brandtii]
 ref|XP_005874574.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Myotis 
brandtii]
Length=1053

 Score =   166 bits (419),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 128/211 (61%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  823   ILHTGDFR-ADPTMERSLLMRLKVHTLYLDTTYCSPEYCFPSQQEVIQFAINTAFEAVTL  881

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  +  K+ ++  K + LQCL  P E     T +   +
Sbjct  882   NPRTLVVCGTYSIGKEKVFLAIADVIGSKVGMSREKYKTLQCLNIP-EINSLITTDMCNT  940

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWS-LGKGKKKTPGKRWQQGTIIR  1890
              +H++P+  + NFK L     +Y G+Y  I+A  PTGW+   K    T      +G I  
Sbjct  941   LVHLLPMMQI-NFKGLQSHLKKYDGKYEQILAFRPTGWTHSNKLTSITDVVPQTKGNISI  999

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  1000  YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1030


 Score =   113 bits (282),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 3/132 (2%)
 Frame = +3

Query  963   GRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHAD  1139
             GR L   + KS   +PA   + +  P +  IPGT F VDAF+Y +   C+ +FLTHFH+D
Sbjct  691   GR-LQRGNRKSPYSSPAGELRKRTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSD  749

Query  1140  HYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCP  1319
             HY GL+++F    +YCS +T  L+  K+ +    I  LP++    + GI V   DANHCP
Sbjct  750   HYAGLSKNFTF-PVYCSEITGNLLKSKLHVEEQYIHPLPMDTECMVNGIKVVLLDANHCP  808

Query  1320  GAIIILFEPSNG  1355
             GA++ILF   NG
Sbjct  809   GAVMILFYLPNG  820



>gb|EPQ12869.1| DNA cross-link repair 1A protein [Myotis brandtii]
Length=1028

 Score =   166 bits (419),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 128/211 (61%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  798   ILHTGDFR-ADPTMERSLLMRLKVHTLYLDTTYCSPEYCFPSQQEVIQFAINTAFEAVTL  856

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  +  K+ ++  K + LQCL  P E     T +   +
Sbjct  857   NPRTLVVCGTYSIGKEKVFLAIADVIGSKVGMSREKYKTLQCLNIP-EINSLITTDMCNT  915

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWS-LGKGKKKTPGKRWQQGTIIR  1890
              +H++P+  + NFK L     +Y G+Y  I+A  PTGW+   K    T      +G I  
Sbjct  916   LVHLLPMMQI-NFKGLQSHLKKYDGKYEQILAFRPTGWTHSNKLTSITDVVPQTKGNISI  974

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  975   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1005


 Score =   113 bits (282),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 79/132 (60%), Gaps = 3/132 (2%)
 Frame = +3

Query  963   GRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHAD  1139
             GR L   + KS   +PA   + +  P +  IPGT F VDAF+Y +   C+ +FLTHFH+D
Sbjct  666   GR-LQRGNRKSPYSSPAGELRKRTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSD  724

Query  1140  HYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCP  1319
             HY GL+++F    +YCS +T  L+  K+ +    I  LP++    + GI V   DANHCP
Sbjct  725   HYAGLSKNFTF-PVYCSEITGNLLKSKLHVEEQYIHPLPMDTECMVNGIKVVLLDANHCP  783

Query  1320  GAIIILFEPSNG  1355
             GA++ILF   NG
Sbjct  784   GAVMILFYLPNG  795



>ref|XP_005097518.1| PREDICTED: dentin sialophosphoprotein-like [Aplysia californica]
Length=876

 Score =   164 bits (416),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 94/234 (40%), Positives = 130/234 (56%), Gaps = 10/234 (4%)
 Frame = +1

Query  1339  LNHPMAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAI  1518
             L +   +LHTGDFR   EM +    +   I  L LDTTYCNP Y FP Q  VI FV+  +
Sbjct  620   LKNGTKILHTGDFRANPEMEQYQVLKNAVISELYLDTTYCNPSYAFPPQVDVIDFVVSLV  679

Query  1519  QAE-AFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFT  1695
                   NP+TL + G+YTIGKER+F  IA+ L  KI V + K ++L CL  P E     T
Sbjct  680   AKHMKANPQTLIVCGAYTIGKERIFTAIAKELDSKICVMSDKKKVLDCLEDP-ELKSRVT  738

Query  1696  LNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKG----KKKTPGK  1863
             L+  +  +HV+P+  L      + ++  +  ++  I+A  PTGW+        K   P  
Sbjct  739   LDWAQGQVHVLPMGKLNQKGLFDHLARHH--KFKSILAFQPTGWTHTDKTISLKDLRP--  794

Query  1864  RWQQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLL  2025
             +W    +  Y VPYSEHSSF ELK+FV+F  P  I+P+VNN  P S +KM ++ 
Sbjct  795   KWSSNGVTLYGVPYSEHSSFLELKRFVQFTRPLKILPTVNNGNPSSRQKMEAIF  848


 Score =   113 bits (283),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 72/116 (62%), Gaps = 2/116 (2%)
 Frame = +3

Query  1011  AKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYC  1187
              K  K +  P +  IPGT   VDAF+Y +  DC  + LTHFH DHY GLT+ F    I+C
Sbjct  509   GKGVKGRKCPFYKKIPGTAITVDAFRYGVIPDCQAYVLTHFHYDHYGGLTKKFAQ-PIFC  567

Query  1188  SSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             S +TA LV  ++G+    I  LP+ Q   +AG+ +T  +ANHCPGA+IILFE  NG
Sbjct  568   SPITANLVESRLGVDSKWINRLPMWQPCQVAGVTLTLMEANHCPGAVIILFELKNG  623



>ref|XP_796713.3| PREDICTED: DNA cross-link repair 1A protein-like [Strongylocentrotus 
purpuratus]
Length=602

 Score =   177 bits (449),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 138/223 (62%), Gaps = 8/223 (4%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAFN  1536
             LHTGDFR   EM   P    C ++ L LDTTYC+PQY FP Q  VI+F ++ A+QA   N
Sbjct  353   LHTGDFRADAEMELYPQLSSCHVNQLYLDTTYCDPQYKFPSQTEVIEFAVKIAVQAVKSN  412

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
              +TL +  +YTIGKE++F  IA AL  K+YV + KL++L+CL   D+ M   T +   S 
Sbjct  413   KKTLIVCATYTIGKEKVFRAIAEALECKVYVDSRKLKVLECLE-DDDLMSLLTRDNKTSA  471

Query  1717  --IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPG--KRWQQGTI  1884
               +HV+ +  L N ++L +  +Q+  RY  I+A  PTGW+    K ++P   K  + G  
Sbjct  472   CGLHVIAMNML-NHQKLKEYLSQFSSRYDNILAFKPTGWT-HSDKVESPSDIKPSKSGKS  529

Query  1885  IRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
               Y +PYSEHSS+SE+K+FV+FIS   I+P+VNN  P+  + M
Sbjct  530   TIYGIPYSEHSSYSEMKRFVQFISADKILPTVNNGNPQKRKAM  572


 Score =   100 bits (250),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 97/175 (55%), Gaps = 11/175 (6%)
 Frame = +3

Query  867   KVKLSKLITDYFQCSA-AGTKKVHATSCGQNEVGRSLMYSSNKSVK---KNPAKSTKYKD  1034
             K K+ + I +  +C     ++K+    C +++   SL+   NK+        A +     
Sbjct  178   KEKVFRAIAEALECKVYVDSRKLKVLECLEDDDLMSLLTRDNKAATCRLHVIAMNMLNHQ  237

Query  1035  IPVWCSIP-----GTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSV  1196
             + V+  IP      T F VDAF+Y +   C  +FL+HFH DHY GLT+ F   ++YCS V
Sbjct  238   VSVFVVIPMSVKDDTSFTVDAFRYGVIPGCKAYFLSHFHYDHYGGLTKHF-DQQLYCSKV  296

Query  1197  TAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             T  LV  ++ +  + ++ILP+N+   + G++VT  +ANHCPGA++ L++  +G +
Sbjct  297   TGNLVISRLNVAAEYVKILPMNEPCKVDGVEVTLLEANHCPGAVMFLYKLKSGVI  351


 Score =   109 bits (272),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 58/131 (44%), Positives = 81/131 (62%), Gaps = 4/131 (3%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAFN  1536
             LHTGDFR   EM   P    C ++ L LDTTYC+PQY FP Q  VI+F ++ A+QA   N
Sbjct  105   LHTGDFRADAEMELYPQLSSCHVNQLYLDTTYCDPQYKFPSQTEVIEFAVKTAVQAVKSN  164

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES-  1713
              +TL +  +YTIGKE++F  IA AL  K+YV + KL++L+CL   D+ M   T +   + 
Sbjct  165   KKTLIVCATYTIGKEKVFRAIAEALECKVYVDSRKLKVLECLE-DDDLMSLLTRDNKAAT  223

Query  1714  -HIHVVPLWTL  1743
               +HV+ +  L
Sbjct  224   CRLHVIAMNML  234


 Score =   101 bits (251),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 69/104 (66%), Gaps = 2/104 (2%)
 Frame = +3

Query  1053  IPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGI  1229
             +P T F VDAF+Y +   C  +FL+HFH DHY GLT+ F   ++YCS VT  LV  +I +
Sbjct  1     MPDTSFTVDAFRYGVIPGCKAYFLSHFHYDHYGGLTKHF-DQQLYCSKVTGNLVITRIKV  59

Query  1230  PWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
               + ++ILP+N    + G++VT  +ANHCPGA++ L++  +G +
Sbjct  60    AAEYVKILPMNTPCKVDGVEVTLLEANHCPGAVMFLYKLKSGVI  103



>ref|XP_006088207.1| PREDICTED: DNA cross-link repair 1A protein [Myotis lucifugus]
Length=1053

 Score =   168 bits (426),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 129/211 (61%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             VLHTGDFR  D  ME    +  K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  823   VLHTGDFR-ADPTMERSLLKRLKVHTLYLDTTYCSPEYCFPSQQEVIQFAINTAFEAVTL  881

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  +  K+ ++  K + LQCL  P E     T +   +
Sbjct  882   NPRTLVVCGTYSIGKEKVFLAIADVIGSKVGMSREKYKTLQCLNIP-EINSLITTDMCNT  940

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWS-LGKGKKKTPGKRWQQGTIIR  1890
              +H++P+  + NFK L     +Y GRY  I+A  PTGW+   K    T      +G I  
Sbjct  941   LVHLLPMMQI-NFKGLQSHLKKYDGRYEQILAFRPTGWTHSNKLTSITDVVPQTKGNISI  999

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  1000  YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1030


 Score =   108 bits (271),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 78/132 (59%), Gaps = 3/132 (2%)
 Frame = +3

Query  963   GRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHAD  1139
             GR L   + KS   +PA   + +  P +  IPGT F VDAF+Y +   C+ +FLTHFH+D
Sbjct  691   GR-LQRGNRKSPYSSPAGELRKRTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSD  749

Query  1140  HYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCP  1319
             HY GL+++     +YCS +T  L+  K+ +    I  LP++    + GI V   DANHCP
Sbjct  750   HYAGLSKNSTF-PVYCSEITGNLLKSKLHVEEQYIHPLPMDTECIVNGIKVVLLDANHCP  808

Query  1320  GAIIILFEPSNG  1355
             GA++ILF   NG
Sbjct  809   GAVMILFYLPNG  820



>ref|XP_007440705.1| PREDICTED: DNA cross-link repair 1A protein isoform X3 [Python 
bivittatus]
Length=926

 Score =   159 bits (401),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 128/218 (59%), Gaps = 4/218 (2%)
 Frame = +1

Query  1336  SLNHPMAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-  1512
             SL +   +LHTGDFR    M   P     ++HT+ LDTTYC+P+Y FP Q  VIQF +  
Sbjct  686   SLPNGTVILHTGDFRGDPSMECCPFLSGWRVHTVYLDTTYCSPEYTFPSQQEVIQFAVST  745

Query  1513  AIQAEAFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFF  1692
             A +    NPRTL + G+Y++GKE++F+ IA  L  K  ++  K + LQCL     +    
Sbjct  746   AFERVTVNPRTLVVCGTYSVGKEKVFLAIAEVLGSKASMSQEKYKTLQCLESATIN-SLI  804

Query  1693  TLNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ  1872
             TLN   + +H++P+  + NFK L    N++   +  I+A  PTGW+   G       + Q
Sbjct  805   TLNWNNTLLHLLPMMQI-NFKNLQNHLNKFSENFDHILAFKPTGWTYSDGCCSLSDIQPQ  863

Query  1873  -QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              +G I  Y +PYSEHSSF E+K+F++++ P  I+P+VN
Sbjct  864   TRGNITIYGIPYSEHSSFLEMKRFIQWLKPQKIVPTVN  901


 Score =   118 bits (296),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = +3

Query  1008  PAKSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIY  1184
             PA++ + K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT+ F    IY
Sbjct  575   PAEAERKKQCPFYKKIPGTGFVVDAFQYGEIEGCTAYFLTHFHSDHYGGLTKKFTF-PIY  633

Query  1185  CSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             C+ +T  LV  K+G+    + ILP+++   I GI V   DANHCPGA +ILF   NG +
Sbjct  634   CNKITGNLVKNKLGVQEQYVHILPMDRECIINGIKVVLLDANHCPGAAMILFSLPNGTV  692



>ref|XP_004412852.1| PREDICTED: DNA cross-link repair 1A protein [Odobenus rosmarus 
divergens]
Length=1052

 Score =   167 bits (422),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/222 (43%), Positives = 132/222 (59%), Gaps = 7/222 (3%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  822   LLHTGDFR-ADPTMERSRLAGQKVHTLYLDTTYCSPEYSFPSQQEVIQFAINIAFEAVTL  880

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P+ +  F T +   S
Sbjct  881   NPRVLVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIPELN-SFITTDMCSS  939

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQ--GTII  1887
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+    K  T      Q  G I 
Sbjct  940   LVHLLPMMQI-NFKALQSHLKKCGGKYDQILAFRPTGWTHS-SKLTTIADIIPQTKGNIS  997

Query  1888  RYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
              Y +PYSEHSS+ E+K+FV+++ P  IIP+VN    +S R M
Sbjct  998   IYGIPYSEHSSYLEMKQFVQWLKPQKIIPTVNAGTLKSRRTM  1039


 Score =   110 bits (274),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 82/141 (58%), Gaps = 10/141 (7%)
 Frame = +3

Query  939   TSCGQNEVGRSLMYSSNKSVKKNP-AKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSH  1112
             + CG+ + G       N  + ++P A   + +  P +  IPGT F VDAF+Y L   C+ 
Sbjct  687   SPCGRLQRG-------NTKIPESPHAGQLRTRTCPFYKKIPGTGFTVDAFQYGLVEGCTA  739

Query  1113  WFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDV  1292
             +FLTHFH+DHY GL+++F    IYCS +T  L+  K+ I    I  LP++    + G+ V
Sbjct  740   YFLTHFHSDHYAGLSKNFTF-PIYCSEITGNLLKSKLHIQKQYIHPLPMDTECIVNGVKV  798

Query  1293  TCFDANHCPGAIIILFEPSNG  1355
                DANHCPGA++ILF   NG
Sbjct  799   VLLDANHCPGAVMILFYLPNG  819



>ref|XP_007440703.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Python 
bivittatus]
 ref|XP_007440704.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Python 
bivittatus]
Length=1007

 Score =   159 bits (401),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 128/218 (59%), Gaps = 4/218 (2%)
 Frame = +1

Query  1336  SLNHPMAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-  1512
             SL +   +LHTGDFR    M   P     ++HT+ LDTTYC+P+Y FP Q  VIQF +  
Sbjct  767   SLPNGTVILHTGDFRGDPSMECCPFLSGWRVHTVYLDTTYCSPEYTFPSQQEVIQFAVST  826

Query  1513  AIQAEAFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFF  1692
             A +    NPRTL + G+Y++GKE++F+ IA  L  K  ++  K + LQCL     +    
Sbjct  827   AFERVTVNPRTLVVCGTYSVGKEKVFLAIAEVLGSKASMSQEKYKTLQCLESATIN-SLI  885

Query  1693  TLNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ  1872
             TLN   + +H++P+  + NFK L    N++   +  I+A  PTGW+   G       + Q
Sbjct  886   TLNWNNTLLHLLPMMQI-NFKNLQNHLNKFSENFDHILAFKPTGWTYSDGCCSLSDIQPQ  944

Query  1873  -QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              +G I  Y +PYSEHSSF E+K+F++++ P  I+P+VN
Sbjct  945   TRGNITIYGIPYSEHSSFLEMKRFIQWLKPQKIVPTVN  982


 Score =   118 bits (295),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 75/119 (63%), Gaps = 2/119 (2%)
 Frame = +3

Query  1008  PAKSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIY  1184
             PA++ + K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT+ F    IY
Sbjct  656   PAEAERKKQCPFYKKIPGTGFVVDAFQYGEIEGCTAYFLTHFHSDHYGGLTKKFTF-PIY  714

Query  1185  CSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             C+ +T  LV  K+G+    + ILP+++   I GI V   DANHCPGA +ILF   NG +
Sbjct  715   CNKITGNLVKNKLGVQEQYVHILPMDRECIINGIKVVLLDANHCPGAAMILFSLPNGTV  773



>ref|XP_004763881.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Mustela 
putorius furo]
 ref|XP_004763882.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Mustela 
putorius furo]
 ref|XP_004795115.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Mustela 
putorius furo]
 ref|XP_004795116.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Mustela 
putorius furo]
Length=1053

 Score =   165 bits (417),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/221 (43%), Positives = 132/221 (60%), Gaps = 6/221 (3%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       KIHTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  824   LLHTGDFR-ADPTMERSRLAGQKIHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFEAVTL  882

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P+ +  F T +   S
Sbjct  883   NPRVLIVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIPELN-SFITTDMCSS  941

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+      +      Q +G I  
Sbjct  942   RVHLLPMMQI-NFKALQSHLKKCGGKYQ-ILAFRPTGWTHSNKLTRIADIIPQTKGNISI  999

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN    +S R M
Sbjct  1000  YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTLKSRRTM  1040


 Score =   111 bits (278),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 76/125 (61%), Gaps = 3/125 (2%)
 Frame = +3

Query  987   NKSVKKNP-AKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTR  1160
             N  + ++P A   + +  P +  IPGT F VDAF+Y L   C+ +FLTHFH+DHY GL++
Sbjct  698   NSKIPESPNAGQLRTRTCPFYKKIPGTGFTVDAFQYGLVEGCTAYFLTHFHSDHYAGLSK  757

Query  1161  SFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILF  1340
             +F    IYCS +T  L+  K+ I    I  LP++    + GI V   DANHCPGA++ILF
Sbjct  758   NFTF-PIYCSEITGNLLKSKLHIQKQYIHPLPMDTECIVNGIKVVLLDANHCPGAVMILF  816

Query  1341  EPSNG  1355
                NG
Sbjct  817   HLPNG  821



>ref|XP_001783805.1| predicted protein [Physcomitrella patens]
 gb|EDQ51397.1| predicted protein [Physcomitrella patens]
Length=334

 Score =   166 bits (421),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 130/212 (61%), Gaps = 5/212 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAE-AF  1533
             +LHTGDFR C  M + P     +I +L LDTTYCNP+Y+FP Q+ VI  V++   A  + 
Sbjct  105   ILHTGDFRACKSMQDYPELLGARITSLYLDTTYCNPKYNFPLQEDVINHVVKLTSAALSR  164

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TL  +G+Y+IGKER+++ IA+AL  +IY    ++R L+ L +PD   +  + +   S
Sbjct  165   NPKTLVTVGAYSIGKERVYLGIAKALSLRIYADKRRVRTLRALDWPDLTDRLCS-DASSS  223

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTII  1887
              +HV+P+  L N  +L          YS ++A  PTGW+  +  G   +  K  + G + 
Sbjct  224   RLHVLPISHL-NATKLRAYMQSLHPTYSAVLAFRPTGWTYSEKIGSNLSELKPQRSGVVT  282

Query  1888  RYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              Y VPYSEHSS+SEL++FVKF+ P  ++ +VN
Sbjct  283   IYGVPYSEHSSYSELQEFVKFLRPQKVLATVN  314


 Score =   109 bits (273),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 71/104 (68%), Gaps = 1/104 (1%)
 Frame = +3

Query  1053  IPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGI  1229
             +PGTPF VDAFK+     C  +FLTHFH+DHY GLTRS+ HG I+C+ +TA+LV+M +G+
Sbjct  1     MPGTPFTVDAFKFGAVEGCKAYFLTHFHSDHYGGLTRSWSHGPIFCTEITARLVSMHLGV  60

Query  1230  PWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
                 ++ + L     + G+ V   +ANHCPGA +ILF+ S G L
Sbjct  61    DSHWLRPMKLGCVSIVEGVKVQFLEANHCPGAALILFQTSCGQL  104



>ref|XP_002512800.1| DNA cross-link repair protein pso2/snm1, putative [Ricinus communis]
 gb|EEF49303.1| DNA cross-link repair protein pso2/snm1, putative [Ricinus communis]
Length=493

 Score =   158 bits (399),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 87/230 (38%), Positives = 138/230 (60%), Gaps = 5/230 (2%)
 Frame = +1

Query  1339  LNHPMAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAI  1518
             L++ +  LHTGDFR    M         K++ L LDTTYCNP+Y FP ++ V+ +V+   
Sbjct  258   LSNGLCYLHTGDFRASKVMQSYHLLVNQKVNALYLDTTYCNPKYKFPSKEDVLNYVVRVT  317

Query  1519  QA-EAFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFT  1695
             +      P TL ++G+Y+IGKE +++ I++AL  KIY +A++ +IL+  G+ D      T
Sbjct  318   KDFLKQQPETLIVVGAYSIGKECVYLSISKALGVKIYASASRRQILESFGWSDLSRSLCT  377

Query  1696  LNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRW  1869
               + ++ +HV+P+ +L   + L     +Y+ +Y  ++A  PTGW+  +  GKK    +  
Sbjct  378   QPK-DTPLHVLPISSL-RVETLKDYLKKYINQYRAVLAFRPTGWTYSENVGKKLDLIRPI  435

Query  1870  QQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLS  2019
              +G +  Y VPYSEHSSF+ELK+FV+F+ P  IIP+VN   P +  KM S
Sbjct  436   SKGNVTIYGVPYSEHSSFTELKEFVEFLKPDKIIPTVNVGNPTNREKMQS  485


 Score =   117 bits (293),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 57/115 (50%), Positives = 76/115 (66%), Gaps = 1/115 (1%)
 Frame = +3

Query  1014  KSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCS  1190
             KS K +  P +  IPGTPF VDAF+Y   ++CS +FLTHFHADHY GLT+ + HG IYC+
Sbjct  147   KSIKPRVCPFYKKIPGTPFTVDAFRYGPIQNCSAYFLTHFHADHYGGLTKGWSHGPIYCT  206

Query  1191  SVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              +TA+L+ + + +    I  L LN    I G+ VT  +ANHCPGA ++ F  SNG
Sbjct  207   QLTARLLKLCLYVNSSFIHPLDLNTEYAIEGVRVTLLEANHCPGAALLHFRLSNG  261



>ref|XP_535018.3| PREDICTED: DNA cross-link repair 1A protein isoform X3 [Canis 
lupus familiaris]
 ref|XP_005637801.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Canis 
lupus familiaris]
 ref|XP_005637802.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Canis 
lupus familiaris]
Length=1049

 Score =   165 bits (417),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 131/221 (59%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  819   LLHTGDFR-ADPTMERSRLAGQKVHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFEAVTR  877

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  ++ ++  K + LQCL  PD +  F T +   S
Sbjct  878   NPRVLVVCGTYSIGKEKVFLAIADVLGSRVAMSQEKYKTLQCLNIPDLN-SFITTDMCNS  936

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G ++ I+A  PTGW+             Q +G I  
Sbjct  937   LVHLLPMMQI-NFKALQSHLKKCGGEFNQILAFRPTGWTHSNQLTNIRDIVPQIKGNISI  995

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ ELK+FV+++ P  IIP+VN    +S R M
Sbjct  996   YGIPYSEHSSYLELKRFVQWLKPQKIIPTVNVGTLKSRRTM  1036


 Score =   110 bits (275),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 83/141 (59%), Gaps = 10/141 (7%)
 Frame = +3

Query  939   TSCGQNEVGRSLMYSSNKSVKKNP-AKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSH  1112
             ++CG+ + G       N  + ++P A   + K  P +  IPGT F VDAF+Y L   C+ 
Sbjct  684   SACGRLQRG-------NMKIPESPNAGQLRKKTCPFYKKIPGTGFTVDAFQYGLVEGCTA  736

Query  1113  WFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDV  1292
             +FLTHFH+DHY GL+++F    +YCS +T  L+  K+ +    I  LP++    + G+ V
Sbjct  737   YFLTHFHSDHYAGLSKNFTF-PVYCSEITGNLLKSKLHVQKQYIHPLPMDTECIVNGVKV  795

Query  1293  TCFDANHCPGAIIILFEPSNG  1355
                DANHCPGA++ILF   NG
Sbjct  796   VLLDANHCPGAVMILFYLPNG  816



>ref|XP_006920909.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Pteropus 
alecto]
 ref|XP_006920910.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Pteropus 
alecto]
Length=1054

 Score =   165 bits (417),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 124/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
              LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF +  A +A   
Sbjct  824   TLHTGDFR-ADPTMERSLLAGQKVHTLYLDTTYCSPEYSFPSQQEVIQFAVNTAFEAVTL  882

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  883   NPRTLVVCGTYSIGKEKVFLAIADVLGSKVGMSKEKYKTLQCLNIP-EINSLITTDMCSS  941

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L        GRY  I+A  PTGW+             Q +G I  
Sbjct  942   LVHLLPMMKI-NFKGLQSHLKTCDGRYDQILAFRPTGWTHSNKLTSIADVIPQTKGNIAI  1000

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  1001  YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1031


 Score =   110 bits (274),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 102/199 (51%), Gaps = 20/199 (10%)
 Frame = +3

Query  762   PRKKIVHALSELRKENTKEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHAT  941
             P K++       +K ++ + E QK    +   +  +V+LSK     F  SA+G       
Sbjct  642   PSKRLQWQRKRRKKSDSLQEETQKTDHLSNRTEAGRVRLSK--EKVFIKSASG-------  692

Query  942   SCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWF  1118
               G +     +  SSN       A   + +  P +  IPGT F VDAF+Y L   C+ +F
Sbjct  693   --GLHRGNMKIPESSN-------AGELRKRTCPFYKKIPGTSFTVDAFQYGLVEGCTAYF  743

Query  1119  LTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTC  1298
             LTHFH+DHY GL+++F    +YCS +T  L+  K+ +    I  LP++    + G+ V  
Sbjct  744   LTHFHSDHYAGLSKNFTF-PVYCSEITGNLLKSKLHVQEQYIHSLPVDTECVVNGVKVVL  802

Query  1299  FDANHCPGAIIILFEPSNG  1355
              DANHCPGA++ILF   NG
Sbjct  803   LDANHCPGAVMILFYLPNG  821



>ref|XP_002913597.1| PREDICTED: DNA cross-link repair 1A protein-like [Ailuropoda 
melanoleuca]
 gb|EFB23324.1| hypothetical protein PANDA_001409 [Ailuropoda melanoleuca]
Length=1049

 Score =   164 bits (416),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 131/221 (59%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       ++HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  819   LLHTGDFR-ADPTMERSRLAGQRVHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFEAVTL  877

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P+ +  F T +   S
Sbjct  878   NPRVLVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIPELN-SFITTDMCSS  936

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  ++A  PTGW+             Q +G I  
Sbjct  937   LVHLLPMMQI-NFKALQSHLKKCGGKYDQVLAFRPTGWTHSNKLTSIADIIPQTKGNISI  995

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN    +S R M
Sbjct  996   YGIPYSEHSSYLEIKRFVQWLKPQKIIPTVNVGTLKSRRTM  1036


 Score =   110 bits (274),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 66/199 (33%), Positives = 102/199 (51%), Gaps = 23/199 (12%)
 Frame = +3

Query  768   KKIVHALSELRKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATS  944
             K+  H    LRK ++ +E   QK ++     ++  + L K             K    + 
Sbjct  638   KRSQHQRKRLRKSDSLQEGAHQKRSRHLKRTESGTINLRK------------DKVFIKSP  685

Query  945   CGQNEVGRSLMYSSNKSVKKNP-AKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWF  1118
             CG+ + G       N  + ++P A   + +  P +  IPGT F VDAF+Y L   C+ +F
Sbjct  686   CGRLQRG-------NTKIPESPSAGQLRTRTCPFYKKIPGTGFTVDAFQYGLVEGCTAYF  738

Query  1119  LTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTC  1298
             LTHFH+DHY GL+++F    IYCS +T  L+  K+ +    +  LP++    + G+ V  
Sbjct  739   LTHFHSDHYAGLSKNFTF-PIYCSEITGNLLRSKLHVQKQYVHPLPMDTECIVNGVKVVL  797

Query  1299  FDANHCPGAIIILFEPSNG  1355
              DANHCPGA++ILF   NG
Sbjct  798   LDANHCPGAVMILFYLPNG  816



>ref|XP_001090942.1| PREDICTED: DNA cross-link repair 1A protein [Macaca mulatta]
Length=1039

 Score =   162 bits (411),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 127/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  809   ILHTGDFR-ADPSMEHSLLADQKVHMLYLDTTYCSPEYTFPSQQEVIQFAINTAFEALTL  867

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP TL + G+Y+IGKE++F+ IA  L  K+ ++  K + L+CL  P E     T +   S
Sbjct  868   NPHTLVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLRCLNIP-EINSLITTDMCSS  926

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +Y G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  927   LVHLLPMMQI-NFKGLQNHLKKYGGKYNQILAFRPTGWTHSNKFPRIADVIPQTKGNISI  985

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  986   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1016


 Score =   112 bits (279),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 100/190 (53%), Gaps = 21/190 (11%)
 Frame = +3

Query  798   RKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSL  974
             RK+N+ +E  +QK +   +  ++  V LSK+    F  SA G         G     + +
Sbjct  638   RKKNSLQEGVYQKRSDHLINTESEAVNLSKV--KVFTKSAHG---------GLQRGNKKI  686

Query  975   MYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQG  1151
               SSN          ++ K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY G
Sbjct  687   PESSN-------VGGSRKKTCPFYKKIPGTGFTVDAFQYGMVEGCTAYFLTHFHSDHYAG  739

Query  1152  LTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAII  1331
             L++ F    +YCS +T  L+  K+ +    I  LPL+    + G+ V   DANHCPGA++
Sbjct  740   LSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHTLPLDIECVVNGVKVVLLDANHCPGAVM  798

Query  1332  ILFEPSNGCL  1361
             ILF   NG +
Sbjct  799   ILFYLPNGTV  808



>gb|EHH19386.1| hypothetical protein EGK_20079 [Macaca mulatta]
 gb|EHH65033.1| hypothetical protein EGM_18373 [Macaca fascicularis]
Length=1039

 Score =   162 bits (410),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 127/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  809   ILHTGDFR-ADPSMEHSLLADQKVHMLYLDTTYCSPEYTFPSQQEVIQFAINTAFEALTL  867

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP TL + G+Y+IGKE++F+ IA  L  K+ ++  K + L+CL  P E     T +   S
Sbjct  868   NPHTLVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLRCLNIP-EINSLITTDMCSS  926

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +Y G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  927   LVHLLPMMQI-NFKGLQNHLKKYGGKYNQILAFRPTGWTHSNKFPRIADVIPQTKGNISI  985

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  986   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1016


 Score =   112 bits (279),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 100/190 (53%), Gaps = 21/190 (11%)
 Frame = +3

Query  798   RKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSL  974
             RK+N+ +E  +QK +   +  ++  V LSK+    F  SA G         G     + +
Sbjct  638   RKKNSLQEGVYQKRSDHLINTESEAVNLSKV--KVFTKSAHG---------GLQRGNKKI  686

Query  975   MYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQG  1151
               SSN          ++ K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY G
Sbjct  687   PESSN-------VGGSRKKTCPFYKKIPGTGFTVDAFQYGMVEGCTAYFLTHFHSDHYAG  739

Query  1152  LTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAII  1331
             L++ F    +YCS +T  L+  K+ +    I  LPL+    + G+ V   DANHCPGA++
Sbjct  740   LSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHTLPLDIECVVNGVKVVLLDANHCPGAVM  798

Query  1332  ILFEPSNGCL  1361
             ILF   NG +
Sbjct  799   ILFYLPNGTV  808



>ref|XP_003512940.1| PREDICTED: DNA cross-link repair 1A protein [Cricetulus griseus]
 ref|XP_007651477.1| PREDICTED: DNA cross-link repair 1A protein [Cricetulus griseus]
 ref|XP_007651478.1| PREDICTED: DNA cross-link repair 1A protein [Cricetulus griseus]
 gb|EGW13321.1| DNA cross-link repair 1A protein [Cricetulus griseus]
Length=1022

 Score =   165 bits (417),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 128/215 (60%), Gaps = 11/215 (5%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEA  1530
             A+LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A  
Sbjct  791   AILHTGDFR-ADPSMERSLLAGQKVHTLYLDTTYCSPEYTFPSQQEVIQFAINTAFEAVT  849

Query  1531  FNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE  1710
              NPR L + G+Y IGKE++F+ IA  L  K+ ++  K + L+CL  PD +    T +   
Sbjct  850   LNPRALVVCGTYCIGKEKVFLAIADVLGSKVGMSQEKYKTLKCLNLPDVN-SLITTDMCS  908

Query  1711  SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKG----KKKTPGKRWQQG  1878
             S +H++P+  + NFK L     +  G+Y  I+A  PTGW+           TP K+   G
Sbjct  909   SLVHLLPMMQI-NFKGLQSHLEKCDGKYDQILAFRPTGWTHSNRITSIADITPQKK---G  964

Query  1879  TIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  965   KISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  999


 Score =   109 bits (272),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL++ F    IYCS +T  LV 
Sbjct  684   PFYKRIPGTGFTVDAFQYGEVEGCTAYFLTHFHSDHYAGLSKDF-ERPIYCSEITGNLVK  742

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I  LP++    + G+ V   DANHCPGA +ILF P NG
Sbjct  743   KKLRVQEQYIHQLPMDTECIVDGVKVVLLDANHCPGASMILFRPPNG  789



>ref|XP_005566541.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Macaca 
fascicularis]
 ref|XP_005566542.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Macaca 
fascicularis]
Length=1039

 Score =   162 bits (410),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 127/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  809   ILHTGDFR-ADPSMEHSLLADQKVHMLYLDTTYCSPEYTFPSQQEVIQFAINTAFEALTL  867

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP TL + G+Y+IGKE++F+ IA  L  K+ ++  K + L+CL  P E     T +   S
Sbjct  868   NPHTLVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLRCLNIP-EINSLITTDMCSS  926

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +Y G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  927   LVHLLPMMQI-NFKGLQNHLKKYGGKYNQILAFRPTGWTHSNKFPRIADVIPQTKGNISI  985

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  986   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1016


 Score =   111 bits (278),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 100/190 (53%), Gaps = 21/190 (11%)
 Frame = +3

Query  798   RKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSL  974
             RK+N+ +E  +QK +   +  ++  V LSK+    F  SA G         G     + +
Sbjct  638   RKKNSLQEGVYQKRSDHLINTESEAVNLSKV--KVFTKSAHG---------GLQRGNKKI  686

Query  975   MYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQG  1151
               SSN          ++ K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY G
Sbjct  687   PESSN-------VGGSRKKTCPFYKKIPGTGFTVDAFQYGMVEGCTAYFLTHFHSDHYAG  739

Query  1152  LTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAII  1331
             L++ F    +YCS +T  L+  K+ +    I  LPL+    + G+ V   DANHCPGA++
Sbjct  740   LSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHTLPLDIECVVNGVKVVLLDANHCPGAVM  798

Query  1332  ILFEPSNGCL  1361
             ILF   NG +
Sbjct  799   ILFYLPNGTV  808



>ref|XP_003922238.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Saimiri 
boliviensis boliviensis]
Length=1048

 Score =   166 bits (420),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 129/221 (58%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  818   ILHTGDFR-ADPSMERSLLANRKVHMLYLDTTYCSPEYTFPSQQEVIQFAINTAFEAVTL  876

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  877   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EINSLITTDMCSS  935

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +Y G+Y  I+A  PTGW+             Q +G I  
Sbjct  936   LVHLLPMMQI-NFKSLQSHLKKYGGKYDQILAFKPTGWTHSNKFTSIADVIPQTKGNISI  994

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN    +S R M
Sbjct  995   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTGKSRRTM  1035


 Score =   108 bits (269),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 68/191 (36%), Positives = 97/191 (51%), Gaps = 21/191 (11%)
 Frame = +3

Query  795   LRKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRS  971
             L+K N+ +E  +QK +      ++  V LSK+    F  SA G         G     + 
Sbjct  646   LKKSNSPQEGAYQKRSDHLTNAESETVNLSKV--KVFTKSAHG---------GLQRRNKK  694

Query  972   LMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQ  1148
             +  SSN           + K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY 
Sbjct  695   IPESSN-------VGELRKKTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSDHYA  747

Query  1149  GLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAI  1328
             GL++ F    +YCS +T  L+  K+ +    I  LPL     + G+ V   DANHCPGA+
Sbjct  748   GLSKHFIF-PVYCSEITGNLLKNKLHVQEQYIHPLPLETECIVNGVKVVLLDANHCPGAV  806

Query  1329  IILFEPSNGCL  1361
             +ILF   NG +
Sbjct  807   MILFCLPNGTV  817



>gb|ERE79288.1| DNA cross-link repair 1A protein [Cricetulus griseus]
Length=1022

 Score =   164 bits (416),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 128/215 (60%), Gaps = 11/215 (5%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEA  1530
             A+LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A  
Sbjct  791   AILHTGDFR-ADPSMERSLLAGQKVHTLYLDTTYCSPEYTFPSQQEVIQFAINTAFEAVT  849

Query  1531  FNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE  1710
              NPR L + G+Y IGKE++F+ IA  L  K+ ++  K + L+CL  PD +    T +   
Sbjct  850   LNPRALVVCGTYCIGKEKVFLAIADVLGSKVGMSQEKYKTLKCLNLPDVN-SLITTDMCS  908

Query  1711  SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKG----KKKTPGKRWQQG  1878
             S +H++P+  + NFK L     +  G+Y  I+A  PTGW+           TP K+   G
Sbjct  909   SLVHLLPMMQI-NFKGLQSHLEKCDGKYDQILAFRPTGWTHSNRITSIADITPQKK---G  964

Query  1879  TIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  965   KISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  999


 Score =   109 bits (272),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL++ F    IYCS +T  LV 
Sbjct  684   PFYKRIPGTGFTVDAFQYGEVEGCTAYFLTHFHSDHYAGLSKDF-ERPIYCSEITGNLVK  742

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I  LP++    + G+ V   DANHCPGA +ILF P NG
Sbjct  743   KKLRVQEQYIHQLPMDTECIVDGVKVVLLDANHCPGASMILFRPPNG  789



>ref|XP_007615820.1| PREDICTED: DNA cross-link repair 1A protein [Cricetulus griseus]
 ref|XP_007615821.1| PREDICTED: DNA cross-link repair 1A protein [Cricetulus griseus]
 ref|XP_007615822.1| PREDICTED: DNA cross-link repair 1A protein [Cricetulus griseus]
 ref|XP_007615823.1| PREDICTED: DNA cross-link repair 1A protein [Cricetulus griseus]
 ref|XP_007615824.1| PREDICTED: DNA cross-link repair 1A protein [Cricetulus griseus]
Length=1014

 Score =   164 bits (416),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 128/215 (60%), Gaps = 11/215 (5%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEA  1530
             A+LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A  
Sbjct  783   AILHTGDFR-ADPSMERSLLAGQKVHTLYLDTTYCSPEYTFPSQQEVIQFAINTAFEAVT  841

Query  1531  FNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE  1710
              NPR L + G+Y IGKE++F+ IA  L  K+ ++  K + L+CL  PD +    T +   
Sbjct  842   LNPRALVVCGTYCIGKEKVFLAIADVLGSKVGMSQEKYKTLKCLNLPDVN-SLITTDMCS  900

Query  1711  SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKG----KKKTPGKRWQQG  1878
             S +H++P+  + NFK L     +  G+Y  I+A  PTGW+           TP K+   G
Sbjct  901   SLVHLLPMMQI-NFKGLQSHLEKCDGKYDQILAFRPTGWTHSNRITSIADITPQKK---G  956

Query  1879  TIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  957   KISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  991


 Score =   109 bits (272),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL++ F    IYCS +T  LV 
Sbjct  676   PFYKRIPGTGFTVDAFQYGEVEGCTAYFLTHFHSDHYAGLSKDF-ERPIYCSEITGNLVK  734

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I  LP++    + G+ V   DANHCPGA +ILF P NG
Sbjct  735   KKLRVQEQYIHQLPMDTECIVDGVKVVLLDANHCPGASMILFRPPNG  781



>ref|XP_008683015.1| PREDICTED: LOW QUALITY PROTEIN: DNA cross-link repair 1A protein 
[Ursus maritimus]
Length=1046

 Score =   165 bits (417),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 131/221 (59%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       ++HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  816   LLHTGDFR-ADPTMERSRLAGQRVHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFEAVTL  874

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P+ +  F T +   S
Sbjct  875   NPRVLVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIPELN-SFITTDMCSS  933

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+             Q +G I  
Sbjct  934   LVHLLPMMQI-NFKALQSHLKKCGGKYDQILAFRPTGWTHSNKLTSIADIIPQTKGNISI  992

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN    +S R M
Sbjct  993   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTLKSRRTM  1033


 Score =   108 bits (271),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 82/141 (58%), Gaps = 10/141 (7%)
 Frame = +3

Query  939   TSCGQNEVGRSLMYSSNKSVKKNP-AKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSH  1112
             + CG+ + G       N  + ++P A   + +  P +  IPGT F VDAF+Y L   C+ 
Sbjct  681   SPCGRLQRG-------NTKIPESPSAGQLRTRTCPFYKKIPGTGFTVDAFQYGLVEGCTA  733

Query  1113  WFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDV  1292
             +FLTHFH+DHY GL+++F    IYCS +T  L+  K+ +    +  LP++    + G+ V
Sbjct  734   YFLTHFHSDHYAGLSKNFTF-PIYCSEITGNLLRSKLHVQKQYVHPLPMDTECIVNGVKV  792

Query  1293  TCFDANHCPGAIIILFEPSNG  1355
                DANHCPGA++ILF   NG
Sbjct  793   VLLDANHCPGAVMILFYLPNG  813



>ref|XP_001926894.1| PREDICTED: DNA cross-link repair 1A protein [Sus scrofa]
Length=1058

 Score =   165 bits (418),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 131/221 (59%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  828   ILHTGDFR-ADPTMERSLLAGQKVHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFEAVTL  886

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP TL + G+Y+IGKE++F+ IA  L  K+ ++  K   L+CL  P E   F T +   S
Sbjct  887   NPHTLVVCGTYSIGKEKVFLAIADVLGSKVGMSKEKYNTLRCLNIP-EINSFITTDMCNS  945

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     ++ G+Y+ I+A  PTGW+             Q +G I  
Sbjct  946   LVHLLPMMQI-NFKGLQNHLKKFGGKYNQILAFRPTGWTHSNKLTSIADVLPQTKGNISI  1004

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN    +S R M
Sbjct  1005  YGIPYSEHSSYPEMKRFVQWLKPRIIIPTVNVGTVKSRRTM  1045


 Score =   108 bits (270),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 77/129 (60%), Gaps = 2/129 (2%)
 Frame = +3

Query  972   LMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQ  1148
             L   + K+ + + A   + +  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY 
Sbjct  698   LQRGNTKTPESSNAGKLRKRTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSDHYA  757

Query  1149  GLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAI  1328
             GL+++F    +YCS VT  L+  K+ +    I  LP++    + G+ V   DANHCPGA+
Sbjct  758   GLSKNFTF-PVYCSEVTGNLLKSKLHVQEQYIHPLPIDTECVVNGVKVVLLDANHCPGAV  816

Query  1329  IILFEPSNG  1355
             ++LF   NG
Sbjct  817   MVLFHLPNG  825



>ref|XP_005063481.1| PREDICTED: DNA cross-link repair 1A protein [Mesocricetus auratus]
Length=1023

 Score =   164 bits (416),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/215 (44%), Positives = 126/215 (59%), Gaps = 11/215 (5%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAI-QAEA  1530
             AVLHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I A  +A  
Sbjct  792   AVLHTGDFR-ADPSMERSLLAGRKVHTLFLDTTYCSPEYTFPSQQEVIQFAINAAFEAVT  850

Query  1531  FNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE  1710
              NPR L + G+Y IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   
Sbjct  851   LNPRALIVCGTYCIGKEKVFLAIADVLGSKVGMSPEKYKTLQCLNIP-EVNSLITTDMCS  909

Query  1711  SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKG----KKKTPGKRWQQG  1878
             S +H++P+  + NFK L     +  G+Y  I+A  PTGW+           TP     +G
Sbjct  910   SLVHLLPMMQI-NFKGLQSHLKKCGGKYDQILAFRPTGWTHSNNITSIADITP---QTKG  965

Query  1879  TIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  966   NISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1000


 Score =   109 bits (272),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL++ F    IYCS +T  L+ 
Sbjct  685   PFYKRIPGTGFTVDAFQYGEVEGCTAYFLTHFHSDHYAGLSKDFAL-PIYCSEITGNLLK  743

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I  LP++    + G+ V   DANHCPGA +ILF P NG
Sbjct  744   KKLRVQEQYIHQLPMDTECTVDGVKVVLLDANHCPGAAMILFRPPNG  790



>ref|XP_006879983.1| PREDICTED: DNA cross-link repair 1A protein [Elephantulus edwardii]
Length=1042

 Score =   166 bits (419),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 132/214 (62%), Gaps = 11/214 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  812   MLHTGDFR-ADPSMERSLLASRKVHTLYLDTTYCSPEYSFPSQQQVIQFAINTAFEAVTL  870

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K+ ++  K   L+CL  P+ +    T +   +
Sbjct  871   NPRTLVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKFMTLRCLNIPEMNA-LITTDMSRA  929

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW----SLGKGKKKTPGKRWQQGT  1881
              +H++P+  + NFK L +   ++ G+Y+ I+A  PTGW    +L +     P ++   G 
Sbjct  930   FVHLLPMMQI-NFKGLQKYLQKHDGKYNQILAFRPTGWTHSNTLMRISDIVPQRK---GN  985

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             I  Y +PYSEHSSF E+K+FV+++ P  IIP+VN
Sbjct  986   ISIYGIPYSEHSSFLEMKRFVQWLKPQKIIPTVN  1019


 Score =   107 bits (268),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 68/109 (62%), Gaps = 2/109 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL++ F    +YCS +T+ L+ 
Sbjct  704   PFYKKIPGTGFTVDAFQYGSIEGCTAYFLTHFHSDHYAGLSKHFT-SPVYCSEITSNLLK  762

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
              K+ +    I  LP++    + G+ V   DANHCPGA++ILF   NG +
Sbjct  763   KKLRVQEQYIHPLPMDTECVVDGVKVVLLDANHCPGAVMILFHLPNGTV  811



>ref|XP_004701334.1| PREDICTED: DNA cross-link repair 1A protein, partial [Echinops 
telfairi]
Length=1024

 Score =   162 bits (410),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
              LHTGDFR  D  ME       ++HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  794   TLHTGDFR-ADPTMERSLLAGLRVHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFEAVTL  852

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K   L+CL  PD D    T +   +
Sbjct  853   NPRVLVVCGTYSIGKEKVFLAIADVLGSKVAMSQEKYTTLRCLNIPDMD-SLITTDMCGA  911

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  +  FK L +      G+Y+ I+A  PTGW+      +T     Q +G I  
Sbjct  912   LVHLLPMMQI-TFKGLQKHLKACGGKYNQILAFRPTGWTHSNKLTRTADIAPQTRGNISI  970

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  971   YGIPYSEHSSYLEMKRFVQWLKPKKIIPTVN  1001


 Score =   110 bits (276),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 72/118 (61%), Gaps = 2/118 (2%)
 Frame = +3

Query  1011  AKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYC  1187
             A+  + +  P +  IPGT F VDAF+Y L   C+ +FLTHFH+DHY GL+R F    +YC
Sbjct  677   AEGLRKRQCPFYKQIPGTGFTVDAFQYGLIEGCTAYFLTHFHSDHYSGLSRKFT-APVYC  735

Query  1188  SSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             S +T  L+  K+ +    I  LP++    + G+ V   DANHCPGA++ILF   NG +
Sbjct  736   SQITGNLLKSKLHVQEQYIHPLPMDTECIVNGVKVVLLDANHCPGAVMILFYLPNGTV  793



>gb|ETL82175.1| hypothetical protein L917_17606 [Phytophthora parasitica]
Length=668

 Score =   161 bits (407),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 126/228 (55%), Gaps = 21/228 (9%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPC------------------KIHTLILDTTYCNPQYDFPKQ  1485
             LHTGDFRF   M+E  + QP                   ++  + LDTTYC+P+Y FP Q
Sbjct  357   LHTGDFRFNRRMLEYHALQPHIPTGNETIDHNGKIVGLQRLDGVYLDTTYCDPKYTFPTQ  416

Query  1486  DAVIQFVIEAIQAEAFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLG  1665
                I   +E +       + L+L GSYTIGKERLF+EIAR   KK+ V+ AKL+I++  G
Sbjct  417   QVAIDHALELVDKHIKQEKVLYLFGSYTIGKERLFMEIARKFQKKVCVSKAKLKIIETFG  476

Query  1666  FPDEDMQFFTLNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGK  1845
             +P E++Q  T     +++HVV +  L     L  +  ++  R+  IVA  PTGW+     
Sbjct  477   WPSEEIQLLTTEPAATNLHVVRMQDL-QMDNLTVLLAKHRLRFRQIVAFRPTGWTFSGKN  535

Query  1846  KKTPGKRWQQ--GTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              ++         G I  Y +PYSEHSSF+EL  FV+ ++P +IIP+VN
Sbjct  536   PRSISTCCTDPSGKIHVYGIPYSEHSSFAELCDFVQVVNPVSIIPTVN  583


 Score =   112 bits (279),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/333 (29%), Positives = 154/333 (46%), Gaps = 47/333 (14%)
 Frame = +3

Query  438   PLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKLV  617
             P C +D++  +E QR  H N C+D+    AE V        Q   +V +          V
Sbjct  41    PTCSQDLSSCDERQRTEHVNRCLDR----AETVSGGAKDKRQEAAEVAE----------V  86

Query  618   ARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEED------LCKIGVSALGPRKKIV  779
              +   VE   +L   +  EL  Q E+  +   + +E +      +C   +S +   ++I 
Sbjct  87    GKSISVEEETELLQTQVAEL-TQVEMAEEAEDYDSESECGYVCKICGFDMSEIDLMRRIR  145

Query  780   HAL-----SELRKENTKEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATS  944
             H         +R ++  EVE      + +V    K +    +      S+AG ++    +
Sbjct  146   HVKLCGQKFGVRPQDMGEVE----QAETIVRRLEKKEEPPDVVAIMMKSSAGKEETSVAA  201

Query  945   CGQNEVGRSLMYSSNKSVKKN------PAKSTKYKDI-------PVWCSIPGT--PFRVD  1079
               ++ V   LM  S  +   N      P K T+ K I       P +  I GT  PF VD
Sbjct  202   IERSNVFDVLMRGSKTAAVLNSRKRPVPFKFTR-KAIQRRRLLYPDFKCIQGTDPPFIVD  260

Query  1080  AFKYL-RRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILP  1256
              F+Y  + + S +FLTHFH+DHY GLT++F  G IYC+ +TAKLV  ++G+    +  + 
Sbjct  261   GFQYACKENSSIYFLTHFHSDHYGGLTKNFDCGIIYCNEITAKLVVQELGVQSKYVHPVG  320

Query  1257  LNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             +N  + +A + VT  DANHCPG+ IILF   +G
Sbjct  321   MNTPVLVADVQVTFMDANHCPGSAIILFRLKDG  353



>ref|XP_004362808.1| DNA repair metallo-beta-lactamase domain-containing protein [Dictyostelium 
fasciculatum]
 gb|EGG24957.1| DNA repair metallo-beta-lactamase domain-containing protein [Dictyostelium 
fasciculatum]
Length=922

 Score =   156 bits (395),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 125/220 (57%), Gaps = 9/220 (4%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAFNP  1539
             LHTGDFR+   M E P  +   I  L LD T+C+P Y FP Q  VIQ V++ IQ E  + 
Sbjct  397   LHTGDFRYHHRMKEYPLLKDIAISRLYLDNTFCDPTYVFPPQQEVIQEVVKIIQKEN-DG  455

Query  1540  RTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESHI  1719
             RT+FL G+YTIGKER+ +E+++   KKI V+  K +I+ CL   D D   FT +E  +  
Sbjct  456   RTVFLFGTYTIGKERILMEVSKNQRKKICVSQDKKQIIACL---DLDQTMFTTDETITPF  512

Query  1720  HVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRYEV  1899
             H VP+ TL  F  L         RY  +VA  PTGW+  + KK    +R+  G +  Y V
Sbjct  513   HAVPMGTL-RFDSLRGRLEALKPRYGRVVAFRPTGWT--QSKKSITHQRY--GAVTLYSV  567

Query  1900  PYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLS  2019
              YSEHSS++EL + +    P  IIP+V+   P    ++LS
Sbjct  568   AYSEHSSYNELLQCIDHFRPTEIIPTVDCSTPNHVSRILS  607


 Score =   116 bits (291),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 70/100 (70%), Gaps = 0/100 (0%)
 Frame = +3

Query  1053  IPGTPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIP  1232
             I GT F VD F+Y  ++ +H+FLTHFH+DHY GLT++F  G +YC+  T KLV+ K+G+ 
Sbjct  294   IHGTKFLVDGFQYKSKEYTHYFLTHFHSDHYVGLTKTFSFGNVYCTEETGKLVHSKLGVQ  353

Query  1233  WDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSN  1352
              + I+ +P N+ I I G+ V   DANHCPG+ +ILF  +N
Sbjct  354   PNFIKAMPWNRFITIEGVRVAMLDANHCPGSAMILFHVNN  393



>ref|XP_002756651.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Callithrix 
jacchus]
 ref|XP_009008556.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Callithrix 
jacchus]
Length=1046

 Score =   165 bits (418),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 127/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       ++H L LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  816   ILHTGDFR-ADPSMERSLLANREVHVLYLDTTYCSPEYTFPSQQEVIQFAINTAFEAVTL  874

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  PD +    T +   S
Sbjct  875   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIPDIN-SLITTDMCSS  933

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +Y G+Y  I+A  PTGW+      +      Q +G I  
Sbjct  934   LVHLLPMMQI-NFKGLQSHLKKYGGKYDQILAFRPTGWTHSNKFTRIADVIPQTKGNISI  992

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSSF E+K+FV+++ P  IIP+VN
Sbjct  993   YGIPYSEHSSFLEMKRFVQWLKPQKIIPTVN  1023


 Score =   107 bits (268),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 69/191 (36%), Positives = 97/191 (51%), Gaps = 21/191 (11%)
 Frame = +3

Query  795   LRKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRS  971
             L+K N+ +E   QK A      ++  V LSK+    F  SA G         G     + 
Sbjct  644   LKKSNSPQEGAHQKRADHLTNAESETVNLSKV--KVFTKSAHG---------GLQRRDKK  692

Query  972   LMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQ  1148
             +  SSN           + K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY 
Sbjct  693   IPESSN-------VGELRKKSCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSDHYA  745

Query  1149  GLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAI  1328
             GL++ F    +YCS +T  L+  K+ +    I  LPL+    + G+ V   DANHCPGA+
Sbjct  746   GLSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHPLPLDTECIVNGVKVVLLDANHCPGAV  804

Query  1329  IILFEPSNGCL  1361
             +ILF   NG +
Sbjct  805   MILFCLPNGTV  815



>ref|XP_008569249.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Galeopterus 
variegatus]
Length=1053

 Score =   166 bits (420),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             VLHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  823   VLHTGDFR-ADPSMERSLLAAQKVHTLYLDTTYCSPEYTFPSQQEVIQFAINTAFEAVTL  881

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   +
Sbjct  882   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EINSLITTDMCST  940

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +Y G+Y  I+A  PTGW+             Q +G I  
Sbjct  941   LVHLLPMMQI-NFKGLQSHLRKYGGKYDQILAFRPTGWTHSNKLTSIADVIPQTKGNISI  999

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  1000  YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1030


 Score =   107 bits (266),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 72/119 (61%), Gaps = 2/119 (2%)
 Frame = +3

Query  1011  AKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYC  1187
             A   + K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY GL+++F    +YC
Sbjct  706   AGELRKKTCPFYKKIPGTGFTVDAFQYGVIEGCTAYFLTHFHSDHYAGLSKNFTF-PVYC  764

Query  1188  SSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCLA  1364
             S +T  L+  K+ +    +  LP++    + G+ V   DANHCPGA++ILF   NG + 
Sbjct  765   SEITGNLLKNKLHVQGKYVHPLPIDTECIVNGVKVVLLDANHCPGAVMILFYLPNGTVV  823



>gb|EKC33595.1| DNA cross-link repair 1A protein [Crassostrea gigas]
Length=1051

 Score =   167 bits (424),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/230 (44%), Positives = 131/230 (57%), Gaps = 10/230 (4%)
 Frame = +1

Query  1339  LNHPMAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAI  1518
             L    A LHTGDFR    M + P+    +I  L LDTTYCNP Y FP Q  VI F +  +
Sbjct  798   LRDGRAFLHTGDFRADPSMEKYPALTGVRISQLYLDTTYCNPTYAFPPQSEVIDFTVNLV  857

Query  1519  QAE-AFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQF--  1689
             + E   NPRTL + GSYTIGKER+F+ IA AL  KI V   K  IL CL    ED+    
Sbjct  858   RQELQRNPRTLIVCGSYTIGKERIFIAIADALGCKICVMRDKKNILDCL----EDISLRE  913

Query  1690  -FTLNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK-GKKKTPGK  1863
                LN  +S +HV+P+  L N K L + S +    Y  I+AI PTGW+  K    +    
Sbjct  914   RICLNFNDSCLHVLPMNKL-NPKALLEHSGKLKPSYGNILAIEPTGWTFSKVSSLQEIRP  972

Query  1864  RWQQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             ++ +  +  Y +PYSEHSS+ EL++FV+F+ P  IIP+VN   P S  KM
Sbjct  973   KYNRDGVKIYGIPYSEHSSYLELQRFVQFVKPGKIIPTVNVGNPASRAKM  1022


 Score =   105 bits (261),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 69/107 (64%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IP T F VDAF Y +   C+ + L+HFH DHY G+T+SF    IYCS +TA LV 
Sbjct  696   PFYKKIPDTGFTVDAFSYGVIPGCTGYILSHFHYDHYTGMTKSFSQ-PIYCSKITANLVI  754

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              KI +    +  LPLN+   + G+++T  +ANHCPG+++ILF+  +G
Sbjct  755   SKIKVKESFVHTLPLNKATVVNGVELTFLEANHCPGSVLILFKLRDG  801



>gb|ELT87607.1| hypothetical protein CAPTEDRAFT_226585 [Capitella teleta]
Length=657

 Score =   159 bits (403),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 102/247 (41%), Positives = 142/247 (57%), Gaps = 11/247 (4%)
 Frame = +1

Query  1339  LNHPMAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAI  1518
             L +  ++LHTGDFR   +M   P+ Q  KI  L LDTTYC+P Y FP Q  VI F ++  
Sbjct  403   LENGRSILHTGDFRANVDMESYPALQGVKISQLYLDTTYCDPNYAFPPQRDVIDFAVKL-  461

Query  1519  QAEAFN---PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQF  1689
              AE F+   P  L ++GSYTIGKER+F+ IA AL  KI +T  K  +++CL  P   +Q 
Sbjct  462   -AEDFHRHQPNGLIVVGSYTIGKERIFLAIAEALSCKICITRDKQIVMECLDDPC--VQR  518

Query  1690  FTLNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGK--  1863
                 E  + +HV+P+  L  +  L +  N+   R+  ++A+ PTGWS   G         
Sbjct  519   MLTREPSAVVHVLPMNHL-RYDTLLEYLNKLKPRFDSVLALQPTGWSHSSGGGGGLDAIR  577

Query  1864  -RWQQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD*YS  2040
              +  QG I  Y VPYSEHSSF E+K+FV+FI P  IIP+VNN   ES +KM  +    ++
Sbjct  578   PKRSQGNITIYGVPYSEHSSFLEMKRFVQFIRPEKIIPTVNNGSAESRQKMEKIFHSWFN  637

Query  2041  LKTTYSR  2061
              K + S+
Sbjct  638   EKCSPSK  644


 Score =   113 bits (282),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 100/205 (49%), Gaps = 17/205 (8%)
 Frame = +3

Query  759   GPRKKIVHALSE----LRKENTKEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTK  926
             G  K  ++ +S+       E    VE  +  KK  V D+++  L          S  G+K
Sbjct  213   GASKTTLNVISDDVQNFESERNNIVEINEERKKIFVKDSNQTSL---------LSFFGSK  263

Query  927   KVHATSCGQNEVGRSLM-YSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRR  1100
                 +S  QN     L    ++ S  K P  +   K  P +  IPGT F VDAF Y    
Sbjct  264   NSKPSS-NQNSAATQLKPLKTDNSGNKQPWTARIKKQCPFYKKIPGTSFTVDAFNYGAIP  322

Query  1101  DCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIA  1280
              C  +FL+HFH DHY GLT+ F   +IYC  VT  LV  K+G+    ++ L +N    I 
Sbjct  323   GCRAYFLSHFHYDHYGGLTKKF-QQQIYCCKVTGNLVERKLGVASKRVRKLEMNTLYVIE  381

Query  1281  GIDVTCFDANHCPGAIIILFEPSNG  1355
             G++VT  DANHCPG+++ LF   NG
Sbjct  382   GVEVTLLDANHCPGSVLFLFRLENG  406



>gb|ETI35238.1| hypothetical protein F443_18372 [Phytophthora parasitica P1569]
 gb|ETM35382.1| hypothetical protein L914_17690 [Phytophthora parasitica]
Length=666

 Score =   161 bits (407),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 126/228 (55%), Gaps = 21/228 (9%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPC------------------KIHTLILDTTYCNPQYDFPKQ  1485
             LHTGDFRF   M+E  + QP                   ++  + LDTTYC+P+Y FP Q
Sbjct  359   LHTGDFRFNRRMLEYHALQPHIPTGNETIDHNGKIVGLQRLDGVYLDTTYCDPKYTFPTQ  418

Query  1486  DAVIQFVIEAIQAEAFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLG  1665
                I   +E +       + L+L GSYTIGKERLF+EIAR   KK+ V+ AKL+I++  G
Sbjct  419   QVAIDHALELVDKHIRQEKVLYLFGSYTIGKERLFMEIARKFQKKVCVSKAKLKIIETFG  478

Query  1666  FPDEDMQFFTLNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGK  1845
             +P E++Q  T     +++HVV +  L     L  +  ++  R+  IVA  PTGW+     
Sbjct  479   WPSEEIQLLTTEPAATNLHVVRMQDL-QMDNLTVLLAKHRLRFRQIVAFRPTGWTFSGKN  537

Query  1846  KKTPGKRWQQ--GTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              ++         G I  Y +PYSEHSSF+EL  FV+ ++P +IIP+VN
Sbjct  538   PRSISTCCTDPSGKIHVYGIPYSEHSSFAELCDFVQVVNPVSIIPTVN  585


 Score =   111 bits (278),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/335 (29%), Positives = 154/335 (46%), Gaps = 49/335 (15%)
 Frame = +3

Query  438   PLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKLV  617
             P C +D++  +E QR  H N C+D+    AE V        Q   +V +          V
Sbjct  41    PTCSQDLSSCDERQRTEHVNRCLDR----AETVSGGAKDKRQEAAEVAE----------V  86

Query  618   ARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEED--------LCKIGVSALGPRKK  773
              +   VE   +L   +  EL  Q E+  +   + +E +        +C   +S +   ++
Sbjct  87    GKSISVEEETELLQTQVAEL-TQVEMAEEAEDYDSESESECGYVCKICGFDMSEIDLMRR  145

Query  774   IVHAL-----SELRKENTKEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHA  938
             I H         +R ++  EVE      + +V    K +    +      S+AG ++   
Sbjct  146   IRHVKLCGQKFGVRPQDMGEVE----QAETIVRRLEKKEEPPDVVAIMMKSSAGKEETSV  201

Query  939   TSCGQNEVGRSLMYSSNKSVKKN------PAKSTKYKDI-------PVWCSIPGT--PFR  1073
              +  ++ V   LM  S  +   N      P K T+ K I       P +  I GT  PF 
Sbjct  202   AAIERSNVFDVLMRGSKTAAVLNSRKRPVPFKFTR-KAIQRRRLLYPDFKCIQGTDPPFI  260

Query  1074  VDAFKYL-RRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQI  1250
             VD F+Y  + + S +FLTHFH+DHY GLT++F  G IYC+ +TAKLV  ++G+    +  
Sbjct  261   VDGFQYACKENSSIYFLTHFHSDHYGGLTKNFDCGIIYCNEITAKLVVQELGVQSKYVHP  320

Query  1251  LPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             + +N  + +A + VT  DANHCPG+ IILF   +G
Sbjct  321   VGMNTPVLVADVQVTFMDANHCPGSAIILFRLKDG  355



>ref|XP_008049340.1| PREDICTED: DNA cross-link repair 1A protein [Tarsius syrichta]
Length=1051

 Score =   159 bits (402),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 123/211 (58%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  821   ILHTGDFR-ADPSMERSLLAGQKVHMLYLDTTYCSPEYTFPSQQEVIQFAINTAFETVTL  879

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  880   NPRALVVCGTYSIGKEKVFLAIADVLGSKVAMSQEKYKTLQCLSIP-EINSLITTDMCSS  938

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+             Q +G I  
Sbjct  939   LVHLLPMMQI-NFKGLQSHLKKCGGKYDQILAFRPTGWTHSNQLSSIADVIPQTKGNISI  997

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  998   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1028


 Score =   113 bits (283),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 92/167 (55%), Gaps = 21/167 (13%)
 Frame = +3

Query  894   DYFQCSAAGTKKVHATSCGQNEVGRSLMYSSN------KSVKKNPAKST----KYKDIPV  1043
             DYF         ++ T CG   + ++ +++ +      +  KK P  S     + K  P 
Sbjct  664   DYF---------INNTECGTVHLRKNKVFTKSTHGRLQRGNKKIPESSNVEEFRKKTCPF  714

Query  1044  WCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMK  1220
             +  IPGT F VDAF+Y L   C+ +FLTHFH+DHY GL++ F    IYCS +T  LV  K
Sbjct  715   YKKIPGTGFTVDAFQYGLVEGCTAYFLTHFHSDHYAGLSKHFT-CPIYCSEITGNLVKNK  773

Query  1221  IGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             + +    I  LP++    ++G+ VT  DANHCPGA++ILF   NG +
Sbjct  774   LHVQEQYIHPLPMDTECIVSGVKVTLLDANHCPGAVMILFHLPNGTV  820



>ref|XP_005320745.1| PREDICTED: DNA cross-link repair 1A protein [Ictidomys tridecemlineatus]
Length=1044

 Score =   167 bits (422),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 128/211 (61%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             VLHTGDFR  D  ME       KIHTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  814   VLHTGDFR-ADPSMERSLLAGQKIHTLYLDTTYCSPEYTFPSQQEVIQFAINTAFEAVTL  872

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ +A  L  K+ ++  K + L+CL  PD +    T +   S
Sbjct  873   NPRTLVVCGTYSIGKEKVFLAVADVLGSKVGMSREKFQTLRCLNMPDIN-PLITTDMWSS  931

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +Y G+Y  I+A  PTGW+             Q +G I  
Sbjct  932   LVHLLPMMQI-NFKGLQNHLKKYDGKYDRILAFRPTGWTHSSKFSSIADITPQTKGNISI  990

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  991   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1021


 Score =   105 bits (262),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 71/118 (60%), Gaps = 2/118 (2%)
 Frame = +3

Query  1011  AKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYC  1187
             A   + K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY GL+++F    +YC
Sbjct  697   AGELRKKTCPFYKKIPGTSFTVDAFQYGVVEGCTAYFLTHFHSDHYAGLSKNFTF-PVYC  755

Query  1188  SSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             S +T  L+  K+ +    +  LP++    + G+ V   DANHCPGA +ILF   NG +
Sbjct  756   SEITGNLLKSKLHVQEQYVHPLPMDTECLVDGVRVVLLDANHCPGATMILFYLPNGAV  813



>gb|ETK75504.1| hypothetical protein L915_17879 [Phytophthora parasitica]
 gb|ETL28938.1| hypothetical protein L916_17779 [Phytophthora parasitica]
 gb|ETP05072.1| hypothetical protein F441_18247 [Phytophthora parasitica CJ01A1]
 gb|ETP33218.1| hypothetical protein F442_18199 [Phytophthora parasitica P10297]
Length=666

 Score =   161 bits (407),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 126/228 (55%), Gaps = 21/228 (9%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPC------------------KIHTLILDTTYCNPQYDFPKQ  1485
             LHTGDFRF   M+E  + QP                   ++  + LDTTYC+P+Y FP Q
Sbjct  359   LHTGDFRFNRRMLEYHALQPHIPTGNETIDHNGKIVGLQRLDGVYLDTTYCDPKYTFPTQ  418

Query  1486  DAVIQFVIEAIQAEAFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLG  1665
                I   +E +       + L+L GSYTIGKERLF+EIAR   KK+ V+ AKL+I++  G
Sbjct  419   QVAIDHALELVDKHIKQEKVLYLFGSYTIGKERLFMEIARKFQKKVCVSKAKLKIIETFG  478

Query  1666  FPDEDMQFFTLNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGK  1845
             +P E++Q  T     +++HVV +  L     L  +  ++  R+  IVA  PTGW+     
Sbjct  479   WPSEEIQLLTTEPAATNLHVVRMQDL-QMDNLTVLLAKHRLRFRQIVAFRPTGWTFSGKN  537

Query  1846  KKTPGKRWQQ--GTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              ++         G I  Y +PYSEHSSF+EL  FV+ ++P +IIP+VN
Sbjct  538   PRSISTCCTDPSGKIHVYGIPYSEHSSFAELCDFVQVVNPVSIIPTVN  585


 Score =   111 bits (278),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/335 (29%), Positives = 154/335 (46%), Gaps = 49/335 (15%)
 Frame = +3

Query  438   PLCGRDITDLNEEQRQIHTNECIDKEDAPAEAVLSHRDTSFQCLGQVLDASPARTPQKLV  617
             P C +D++  +E QR  H N C+D+    AE V        Q   +V +          V
Sbjct  41    PTCSQDLSSCDERQRTEHVNRCLDR----AETVSGGAKDKRQEAAEVAE----------V  86

Query  618   ARPPVVEWLRKLGLAKYEELFIQQEIDWDTLQWLTEED--------LCKIGVSALGPRKK  773
              +   VE   +L   +  EL  Q E+  +   + +E +        +C   +S +   ++
Sbjct  87    GKSISVEEETELLQTQVAEL-TQVEMAEEAEDYDSESESECGYVCKICGFDMSEIDLMRR  145

Query  774   IVHAL-----SELRKENTKEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHA  938
             I H         +R ++  EVE      + +V    K +    +      S+AG ++   
Sbjct  146   IRHVKLCGQKFGVRPQDMGEVE----QAETIVRRLEKKEEPPDVVAIMMKSSAGKEETSV  201

Query  939   TSCGQNEVGRSLMYSSNKSVKKN------PAKSTKYKDI-------PVWCSIPGT--PFR  1073
              +  ++ V   LM  S  +   N      P K T+ K I       P +  I GT  PF 
Sbjct  202   AAIERSNVFDVLMRGSKTAAVLNSRKRPVPFKFTR-KAIQRRRLLYPDFKCIQGTDPPFI  260

Query  1074  VDAFKYL-RRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQI  1250
             VD F+Y  + + S +FLTHFH+DHY GLT++F  G IYC+ +TAKLV  ++G+    +  
Sbjct  261   VDGFQYACKENSSIYFLTHFHSDHYGGLTKNFDCGIIYCNEITAKLVVQELGVQSKYVHP  320

Query  1251  LPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             + +N  + +A + VT  DANHCPG+ IILF   +G
Sbjct  321   VGMNTPVLVADVQVTFMDANHCPGSAIILFRLKDG  355



>ref|XP_004428151.1| PREDICTED: DNA cross-link repair 1A protein [Ceratotherium simum 
simum]
Length=1044

 Score =   167 bits (423),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 127/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       KIHTL LDTTYCNP+Y FP Q  VIQFVI  A +A   
Sbjct  814   MLHTGDFR-ADPTMERSLLAGQKIHTLYLDTTYCNPKYSFPSQQEVIQFVINTAFEAVTL  872

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K+ ++  K + L+CL  P E     T +   S
Sbjct  873   NPRTLVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLRCLNIP-EINSLITTDMCNS  931

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+             Q +G I  
Sbjct  932   LVHLLPMMQI-NFKGLQSHLKKCDGKYDQILAFRPTGWTHSNKLTSIADVVPQTKGNISI  990

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y VPYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  991   YGVPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1021


 Score =   105 bits (261),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 2/112 (2%)
 Frame = +3

Query  1023  KYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVT  1199
             + K  P +  IPGT F VDAF+Y L   C+ +FLTHFH+DHY GL+++     +YCS VT
Sbjct  701   RKKTCPFYKKIPGTGFTVDAFQYGLIEGCTAYFLTHFHSDHYAGLSKNVTF-PVYCSRVT  759

Query  1200  AKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
               L+  K+ +    I  LP++    + G+ V   DANHCPGA++ILF   NG
Sbjct  760   GNLLKCKLHVKEQYIHPLPVDTECIVNGVKVVLLDANHCPGAVMILFYLPNG  811



>ref|XP_003961638.1| PREDICTED: DNA cross-link repair 1A protein-like [Takifugu rubripes]
Length=894

 Score =   167 bits (422),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/222 (42%), Positives = 131/222 (59%), Gaps = 6/222 (3%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEI-PSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEA  1530
             VLHTGDFR  D  ME+ P    C++ TL LDTTYC+P+Y FP Q  VI F    A +  A
Sbjct  661   VLHTGDFR-ADPSMELYPELLSCRVQTLYLDTTYCSPEYTFPTQQEVINFAASTAFELVA  719

Query  1531  FNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE  1710
              NPRTL + GSY++GKE++F  +A  L  K+ ++  K   + CL   ++  Q  T +   
Sbjct  720   LNPRTLVVCGSYSVGKEKVFFALADVLGSKVSLSRDKYNTMCCLE-SEQVKQCITTDWKA  778

Query  1711  SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTII  1887
             + +HV+P+  L  FK+L Q   ++  +Y  +VA  PTGW+  +  +   G      G I 
Sbjct  779   ARVHVLPMMQL-TFKKLEQHLARFSSQYDQLVAFKPTGWTFSQQVESVGGIEPDVSGNIS  837

Query  1888  RYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
              Y +PYSEHSSF E+K+FV+++ P  IIP+VNN   ES R M
Sbjct  838   IYGIPYSEHSSFVEMKRFVQWLQPLKIIPTVNNGSWESRRAM  879


 Score =   105 bits (262),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 66/102 (65%), Gaps = 2/102 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F +DAF+Y +    + +FLTHFH+DHY GLT+S     +YC+ +T  LV 
Sbjct  553   PFYKKIPGTKFAIDAFRYGMIEGITAYFLTHFHSDHYGGLTKSSTF-PVYCNKITGNLVK  611

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILF  1340
              K+ +    I +LP+N ++ + G+ V   +ANHCPGA ++LF
Sbjct  612   SKLKVAEPYIHVLPMNTQVTVEGVTVVLLEANHCPGAAMLLF  653



>ref|XP_009593049.1| PREDICTED: DNA cross-link repair protein SNM1 [Nicotiana tomentosiformis]
Length=464

 Score =   159 bits (401),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 134/223 (60%), Gaps = 5/223 (2%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAFN-  1536
             LHTGDFR    M   P     +I+ L LDTTYCNP+Y FP ++ V++FV+   +    N 
Sbjct  236   LHTGDFRASKLMQSYPLLASQRINILYLDTTYCNPKYRFPSKEEVLKFVVGVTRTYLNNY  295

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             P+T+ ++G+Y+IGKE ++  I++AL  KIY  A++ RILQ  G+        T N  ++ 
Sbjct  296   PKTIVVVGAYSIGKEHVYFAISKALRVKIYANASRRRILQSFGWAGISENLST-NRKDTP  354

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTIIR  1890
             +H++P+ +L  F+ L +      G+Y+ ++A  PTGW+  +  G+     K   +G I  
Sbjct  355   LHILPISSL-KFEMLERYLASQDGQYTSMLAFRPTGWTYSETIGENLNLIKPTSKGNITI  413

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLS  2019
             Y VPYSEHSSF+EL++FV+F+ P  IIP+VN     +  KM S
Sbjct  414   YGVPYSEHSSFTELQEFVQFLRPEKIIPTVNVGNAVNREKMHS  456


 Score =   113 bits (282),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGTPF VDAF+Y   + CS +FL+HFHADHY GLT+ + HG IYC+++TA+LV 
Sbjct  126   PFYKRIPGTPFTVDAFRYGPVKGCSAYFLSHFHADHYIGLTKVWSHGHIYCTNLTARLVR  185

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             + + +    I  L L    ++ GI VT  DANHCPGA +I F   NG
Sbjct  186   ICLNVSPSFICPLELGTEYDLKGIKVTMLDANHCPGAALIHFRLPNG  232



>ref|XP_007962318.1| PREDICTED: DNA cross-link repair 1A protein isoform X3 [Chlorocebus 
sabaeus]
Length=902

 Score =   160 bits (406),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  672   ILHTGDFR-ADPSMEHSLLADQKVHMLYLDTTYCSPEYTFPSQQEVIQFAINTAFEALTL  730

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP  L + G+Y+IGKE++F+ IA  L  K+ ++  K + L+CL  P E     T +   S
Sbjct  731   NPHALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLRCLNIP-EINSLITTDMCSS  789

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +Y G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  790   LVHLLPMMQI-NFKGLQNHLKKYGGKYNQILAFRPTGWTHSNKFPRIADIIPQTKGNISI  848

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  849   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  879


 Score =   110 bits (275),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 99/190 (52%), Gaps = 21/190 (11%)
 Frame = +3

Query  798   RKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSL  974
             +K N+ +E  +QK +   +  ++  V LSK+    F  SA G         G     + +
Sbjct  501   KKSNSLQEGVYQKRSDHLINTESEAVNLSKV--KVFTKSAHG---------GLQRGNKKI  549

Query  975   MYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQG  1151
               SSN          ++ K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY G
Sbjct  550   PESSN-------VGGSRKKTCPFYKKIPGTGFTVDAFQYGMVEGCTAYFLTHFHSDHYAG  602

Query  1152  LTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAII  1331
             L++ F    +YCS +T  L+  K+ +    I  LPL+    + G+ V   DANHCPGA++
Sbjct  603   LSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHPLPLDTECVVNGVKVVLLDANHCPGAVM  661

Query  1332  ILFEPSNGCL  1361
             ILF   NG +
Sbjct  662   ILFYLPNGTV  671



>ref|XP_006446878.1| hypothetical protein CICLE_v10015161mg [Citrus clementina]
 gb|ESR60118.1| hypothetical protein CICLE_v10015161mg [Citrus clementina]
Length=464

 Score =   160 bits (404),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 88/232 (38%), Positives = 135/232 (58%), Gaps = 5/232 (2%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQ-AEAFN  1536
             LHTGDFR    M   P     +++ L LDTTYCNP+Y FP ++ V+ +V+   +      
Sbjct  231   LHTGDFRASRLMQSYPLLVNHRVNVLYLDTTYCNPKYKFPSKEDVLNYVVRVTKNCLKKQ  290

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             P+TL ++G+Y+IGKE +F+ I++AL  KIY  A++ R+LQ   +P+      T    ++ 
Sbjct  291   PKTLVVVGAYSIGKESVFLAISKALGVKIYANASRRRVLQSFDWPELSGNLCTQGN-DTL  349

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTIIR  1890
             +HV+P+ +L  F+ L      Y  +Y+ ++A  PTGW+  +  G +    +   +G I  
Sbjct  350   LHVLPMSSL-KFETLKDYLKPYGNQYAAVLAFRPTGWTYSETVGNQLDLIRPLSRGNITI  408

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD*YSLK  2046
             Y VPYSEHSSF+EL++FV+F+ P  IIP+VN     S  KM S   +  S K
Sbjct  409   YGVPYSEHSSFTELREFVQFLRPDKIIPTVNVWNAASREKMQSFFREWLSCK  460


 Score =   111 bits (278),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 74/126 (59%), Gaps = 1/126 (1%)
 Frame = +3

Query  981   SSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLT  1157
             +SN   K    K    +  P +  IPGTPF VDAF+Y   + CS +FLTHFH DHY GL 
Sbjct  102   ASNGKSKATHLKKIADRSCPFYKKIPGTPFTVDAFRYGSIKGCSAYFLTHFHYDHYGGLG  161

Query  1158  RSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIIL  1337
             + + HG IYCS +TA+LV M + +    I  L LN    I G+ VT  +ANHCPGA +I 
Sbjct  162   KRWSHGPIYCSPLTARLVRMCLLVNPSYIHPLELNTEHVIDGVKVTLLEANHCPGAALIH  221

Query  1338  FEPSNG  1355
             F   +G
Sbjct  222   FRLQDG  227



>ref|XP_004316647.1| PREDICTED: DNA cross-link repair 1A protein [Tursiops truncatus]
Length=1051

 Score =   161 bits (408),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 126/221 (57%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  821   ILHTGDFR-ADPTMERSLLAGQKVHTLYLDTTYCSPEYCFPSQQEVIQFAINTAFETVTL  879

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K   LQC   P E     T +   S
Sbjct  880   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSKEKYSTLQCFNIP-EINSLITTDMCNS  938

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+         G   Q +G I  
Sbjct  939   LVHLLPMMQI-NFKGLQNHLKKCGGKYDQILAFRPTGWTHSNKLTSMAGIIPQTKGNISI  997

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN     S R M
Sbjct  998   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTLRSRRTM  1038


 Score =   109 bits (273),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 101/199 (51%), Gaps = 21/199 (11%)
 Frame = +3

Query  765   RKKIVHALSELRKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHAT  941
             RK+  H    L+K ++ +E   QK++      +   VKLSK     F  SA G       
Sbjct  639   RKRSQHQRKRLKKSDSLQEGVHQKSSGHRNKTEPGTVKLSK--DRVFVKSAHG-------  689

Query  942   SCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRD-CSHWF  1118
                       L   + K  + + A   + +  P +  IPGT F VDAF+Y   + C+ +F
Sbjct  690   ---------RLQRGNTKIPESSNAGELRKRTCPFYKKIPGTGFTVDAFRYGSVEGCTAYF  740

Query  1119  LTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTC  1298
             LTHFH+DHY GL+++F    +YCS +T  L+  K+ +P   I  LP +    + G+ V  
Sbjct  741   LTHFHSDHYAGLSKNFTF-PVYCSEITGNLLKSKLHVPEQYIHPLPTDTECIVNGVKVVL  799

Query  1299  FDANHCPGAIIILFEPSNG  1355
              DANHCPGA++ILF   NG
Sbjct  800   LDANHCPGAVMILFYLPNG  818



>ref|XP_003787201.1| PREDICTED: DNA cross-link repair 1A protein [Otolemur garnettii]
Length=1042

 Score =   162 bits (409),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 92/217 (42%), Positives = 127/217 (59%), Gaps = 17/217 (8%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  812   ILHTGDFR-ADPSMERSLLAGQKVHTLYLDTTYCSPEYTFPSQQEVIQFAINTAFEAVTL  870

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP  L + G+Y+IGKE++F+ IA  LC K+ ++  K + L+CL  P E     T +   S
Sbjct  871   NPCALVVCGTYSIGKEKVFLAIADVLCSKVAMSQEKYKTLRCLNIP-EINSLITTDMCSS  929

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGKRWQ  1872
              +H++P+  + NFK L     +  G+Y  I+A  PTGW       S+     KT      
Sbjct  930   LVHLLPMMQI-NFKDLQSHLKKCGGKYDQILAFRPTGWTHSNKLTSIADVIPKT------  982

Query  1873  QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             +G I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  983   KGNISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1019


 Score =   109 bits (272),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 98/195 (50%), Gaps = 21/195 (11%)
 Frame = +3

Query  786   LSELRKENTKEVEFQKNAKKAVVDDTSKVKLSKL-ITDYFQCSAAGTKKVHATSCGQNEV  962
             L   RK   K    Q+ A++   DD +K   + L  +  F+ SA G              
Sbjct  635   LQRQRKRLKKSNSLQEGAREKRSDDLTKSGTTNLRKSRAFRKSAPGG-------------  681

Query  963   GRSLMYSSNKSVKKNP-AKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHA  1136
                 +   N+ + ++P     + K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+
Sbjct  682   ----LQRENEKISESPNIGELRKKTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHS  737

Query  1137  DHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHC  1316
             DHY GL++ F    +YCS +T  L+  K+ +    I  LP++    + G+ V   DANHC
Sbjct  738   DHYAGLSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHPLPMDTECVVNGVKVVLLDANHC  796

Query  1317  PGAIIILFEPSNGCL  1361
             PGA++ILF   NG +
Sbjct  797   PGAVMILFYLPNGTI  811



>ref|XP_010587275.1| PREDICTED: DNA cross-link repair 1A protein [Loxodonta africana]
 ref|XP_010587276.1| PREDICTED: DNA cross-link repair 1A protein [Loxodonta africana]
Length=1048

 Score =   162 bits (409),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 127/214 (59%), Gaps = 11/214 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       ++HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  818   ILHTGDFR-ADPTMERSLLVNWRVHTLYLDTTYCSPEYCFPSQQEVIQFAINTAFEAVTL  876

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K   LQCL  P E     T +   +
Sbjct  877   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSREKYTTLQCLNIP-EINSLITTDMCSA  935

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW----SLGKGKKKTPGKRWQQGT  1881
              +H++P+  + NFK L +   +Y G+Y  ++A  PTGW    +L       P  R   G 
Sbjct  936   LVHLLPMMQI-NFKGLQKHLKKYGGKYDQVLAFQPTGWTHSNTLTSIADIIPQTR---GN  991

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  992   ISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1025


 Score =   109 bits (272),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 72/118 (61%), Gaps = 2/118 (2%)
 Frame = +3

Query  1011  AKSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYC  1187
             A   + +  P +  IPGT F VDAF+Y    DC+ +FLTHFH+DHY GL++SF    +YC
Sbjct  701   AGGLRKRSCPFYKKIPGTGFTVDAFQYGSIEDCTAYFLTHFHSDHYAGLSKSFT-SPVYC  759

Query  1188  SSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             S +T  L+  K+ +    I  LP++    + G+ V   DANHCPGA+++LF   NG +
Sbjct  760   SEITGNLLKNKLHVQEQYIHPLPMDTECIVNGVKVVLLDANHCPGAVMVLFCLPNGTV  817



>ref|XP_001495731.2| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Equus 
caballus]
 ref|XP_005602276.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Equus 
caballus]
Length=1043

 Score =   162 bits (409),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 128/217 (59%), Gaps = 17/217 (8%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       ++HTL LDTTYC+P+Y FP Q  VIQFVI  A +A   
Sbjct  813   MLHTGDFR-ADPSMERSLLASQRVHTLYLDTTYCSPEYSFPSQQEVIQFVINTAFEAVTL  871

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP TL + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  872   NPCTLVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EINSLITTDMCNS  930

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGKRWQ  1872
              +H++P+  + NFK L     +  G+Y  I+A  PTGW       S+     +T      
Sbjct  931   LVHLLPMMQI-NFKGLQSHLKKCGGKYDRILAFRPTGWTHSNKLTSIADVLPRT------  983

Query  1873  QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             +G I  Y VPYSEHSSF E+K+FV+++ P  IIP+VN
Sbjct  984   KGNISIYGVPYSEHSSFLEMKRFVQWLKPQKIIPTVN  1020


 Score =   108 bits (271),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 82/140 (59%), Gaps = 8/140 (6%)
 Frame = +3

Query  939   TSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHW  1115
             ++CG+ + G + +  S+       A   + K  P +  IPGT F VDAF+Y L   C+ +
Sbjct  678   SACGKLQRGNTKIPESSN------AGELRKKTCPFYKKIPGTGFTVDAFQYGLVEGCTAY  731

Query  1116  FLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVT  1295
             FLTHFH+DHY GL+++F    +YCS +T  L+  K+ +    I  LP++    + G+ V 
Sbjct  732   FLTHFHSDHYAGLSKNFTF-PVYCSEITGNLLKCKLHVQEQYIHPLPMDTGCIVNGVKVV  790

Query  1296  CFDANHCPGAIIILFEPSNG  1355
               DANHCPGA++ILF   NG
Sbjct  791   FLDANHCPGAVMILFYLPNG  810



>ref|XP_005826807.1| hypothetical protein GUITHDRAFT_76035 [Guillardia theta CCMP2712]
 gb|EKX39827.1| hypothetical protein GUITHDRAFT_76035 [Guillardia theta CCMP2712]
Length=317

 Score =   170 bits (430),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 128/203 (63%), Gaps = 14/203 (7%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIP---SFQPC---KIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQ  1521
             LHTGDFRF  +  E P   SF      KI  L LDTTYC+P+++FP Q+  I+FV E ++
Sbjct  122   LHTGDFRFHPKFSEDPVLSSFTSTGSRKIDHLFLDTTYCSPEHEFPAQEDAIRFVGELVK  181

Query  1522  AEAF-NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTL  1698
             + AF N  TLFL+GSYTIGKE +F++ AR    K+YV  AK ++L+CL   +ED Q  T 
Sbjct  182   SNAFANRETLFLVGSYTIGKEEVFLQAARESGCKLYVHPAKKKVLECLELKEEDQQRLTT  241

Query  1699  NELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQG  1878
                E+ +HVVP+  + NFK+++       G+Y  +V I PTGW+       + G R ++G
Sbjct  242   VAHEARLHVVPMGCI-NFKQMSAYLGMAKGKYKTVVGIRPTGWTF------SGGPRQERG  294

Query  1879  TIIRYEVPYSEHSSFSELKKFVK  1947
              ++ Y VPYSEHSSFSE++  VK
Sbjct  295   PLVIYGVPYSEHSSFSEIRSMVK  317


 Score =   101 bits (251),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 65/103 (63%), Gaps = 1/103 (1%)
 Frame = +3

Query  1050  SIPG-TPFRVDAFKYLRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIG  1226
             S+PG + F VD F        H+ L+HFHADHY GL + F  GKIYC+ VTA+LV +KIG
Sbjct  16    SVPGASSFTVDNFHVRNSVVKHYILSHFHADHYAGLRKKFNSGKIYCTPVTARLVKLKIG  75

Query  1227  IPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             +  D++  +  +  + I G  VT   ANHCPG+ +ILFE  +G
Sbjct  76    VSADHLVAVAYHSPLLIEGTRVTFLPANHCPGSALILFETPDG  118



>ref|XP_004493109.1| PREDICTED: DNA cross-link repair protein SNM1-like isoform X1 
[Cicer arietinum]
Length=520

 Score =   159 bits (402),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 87/227 (38%), Positives = 134/227 (59%), Gaps = 5/227 (2%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAE-AFN  1536
             LHTGDFR C  M     F   +++ L LDTTYCNP+Y FP ++ V+ +V++  +     +
Sbjct  292   LHTGDFRACKLMQGYNLFVNKRVNVLYLDTTYCNPKYKFPFKEDVLNYVVKITKNHLKMH  351

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             PRTL ++G+Y+IGKE +++ I++AL  KIY  A++ RIL   G PD   +  T N   + 
Sbjct  352   PRTLVVVGAYSIGKECVYLAISKALGVKIYANASRRRILLAYGSPDYSDRLCT-NGNNTL  410

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTIIR  1890
             +HV+P+ +L   + L +    Y  +++ ++A  PTGW+  +  G      +   +G I  
Sbjct  411   LHVLPMSSL-RIETLKEYLKTYKEQFTSVLAFRPTGWTFSEKIGNDLELIRPVSRGNITT  469

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD  2031
             Y VPYSEHSSF+EL+ FV+F+ P  I+P+VN     +  KM S   D
Sbjct  470   YGVPYSEHSSFTELRDFVQFLRPDKIVPTVNVGNSANREKMQSYFGD  516


 Score =   111 bits (278),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 104/211 (49%), Gaps = 29/211 (14%)
 Frame = +3

Query  810   TKEVEFQKNAKKAVVDDTSKVKLSKL--ITDYFQCSAAGTKKVHATSCGQ-NEVGRSLMY  980
             + EV  Q++  +  +    K+K + L  I  + +    G+ +V     G  +EVG   + 
Sbjct  78    SPEVHKQRDPARDSISSGKKLKQANLFQIWGFKRNVDVGSVEVEPNQGGYCDEVGEGSVS  137

Query  981   SSNKSVK---------------KNPAKSTKYKDI----------PVWCSIPGTPFRVDAF  1085
             S  K VK               +NP  STK K            P +  +PGT F VDAF
Sbjct  138   SERKIVKPGNWGSILRDKGKVVENPKSSTKRKSFSGENRVTRSCPFYKKMPGTNFTVDAF  197

Query  1086  KY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLN  1262
             +Y    +CS +FL+HFHADHY GL++ + HG IYCS +T +LV M + +    I  L  +
Sbjct  198   RYGCVEECSAYFLSHFHADHYGGLSKKWSHGPIYCSPLTGRLVQMCLYVNPSYIFPLEFD  257

Query  1263  QRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
                 I G  VT  DANHCPGA +I FE  NG
Sbjct  258   TEYVIEGTKVTLIDANHCPGAALIHFELPNG  288



>ref|XP_008505037.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Equus 
przewalskii]
 ref|XP_008505045.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Equus 
przewalskii]
Length=1043

 Score =   162 bits (409),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 128/217 (59%), Gaps = 17/217 (8%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       ++HTL LDTTYC+P+Y FP Q  VIQFVI  A +A   
Sbjct  813   MLHTGDFR-ADPSMERSLLASQRVHTLYLDTTYCSPEYSFPSQQEVIQFVINTAFEAVTL  871

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP TL + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  872   NPCTLVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EINSLITTDMCNS  930

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGKRWQ  1872
              +H++P+  + NFK L     +  G+Y  I+A  PTGW       S+     +T      
Sbjct  931   LVHLLPMMQI-NFKGLQSHLKKCGGKYDRILAFRPTGWTHSNKLTSIADVLPRT------  983

Query  1873  QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             +G I  Y VPYSEHSSF E+K+FV+++ P  IIP+VN
Sbjct  984   KGNISIYGVPYSEHSSFLEMKRFVQWLKPQKIIPTVN  1020


 Score =   108 bits (271),  Expect(2) = 7e-63, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 82/140 (59%), Gaps = 8/140 (6%)
 Frame = +3

Query  939   TSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHW  1115
             ++CG+ + G + +  S+       A   + K  P +  IPGT F VDAF+Y L   C+ +
Sbjct  678   SACGKLQRGNTKIPESSN------AGELRKKTCPFYKKIPGTGFTVDAFQYGLVEGCTAY  731

Query  1116  FLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVT  1295
             FLTHFH+DHY GL+++F    +YCS +T  L+  K+ +    I  LP++    + G+ V 
Sbjct  732   FLTHFHSDHYAGLSKNFTF-PVYCSEITGNLLKCKLHVQEQYIHPLPMDTGCIVNGVKVV  790

Query  1296  CFDANHCPGAIIILFEPSNG  1355
               DANHCPGA++ILF   NG
Sbjct  791   FLDANHCPGAVMILFYLPNG  810



>gb|KDP41886.1| hypothetical protein JCGZ_26904 [Jatropha curcas]
Length=481

 Score =   162 bits (411),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 88/230 (38%), Positives = 137/230 (60%), Gaps = 5/230 (2%)
 Frame = +1

Query  1351  MAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQA-E  1527
             +  LHTGDFR  + M         +++ L LDTTYCNP+Y FP ++ V+ FV+   +   
Sbjct  250   VCYLHTGDFRASEFMQSYSLLVNHRVNMLYLDTTYCNPKYKFPSKEDVLSFVVRVTKDFL  309

Query  1528  AFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNEL  1707
                P+TL ++G+Y+IGKE +++ I++AL  KIY  A++ RIL   G+ D      T  + 
Sbjct  310   KRQPKTLVVVGAYSIGKECVYIAISKALGVKIYANASRRRILHSFGWSDLSSSLCTQAK-  368

Query  1708  ESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGT  1881
             ++ +HVVP+ +L  F+ L      Y+ +Y+ ++A  PTGW+  +  GK+    +   +G 
Sbjct  369   DTPLHVVPISSL-RFETLKDYLKTYINQYAAVLAFRPTGWTYSESVGKQLDLIRPISKGN  427

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD  2031
             I  Y VPYSEHSSF+ELK+FV+F+ P  I+P+VN   P +  KM S   +
Sbjct  428   ITIYGVPYSEHSSFTELKEFVEFLKPDKIVPTVNVGNPANREKMQSYFRE  477


 Score =   108 bits (270),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 69/110 (63%), Gaps = 1/110 (1%)
 Frame = +3

Query  1029  KDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
             ++ P +  IPGT F VDAF+Y     CS +FLTHFH DHY GLT+ + HG IYC+ +TA+
Sbjct  140   RNCPFYKKIPGTAFSVDAFRYGSIEGCSAYFLTHFHYDHYGGLTKGWSHGPIYCTPLTAR  199

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             L+ + + +    I+ L LN    I G+ VT  +ANHCPGA +I F    G
Sbjct  200   LLKLCLSVNSSFIRYLELNTEYVIEGVTVTLLEANHCPGAALIHFRLPTG  249



>ref|XP_010085270.1| PREDICTED: DNA cross-link repair 1A protein [Pterocles gutturalis]
Length=991

 Score =   159 bits (401),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 125/214 (58%), Gaps = 10/214 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P+    ++HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  758   ILHTGDFRADPSMERYPALVGQQVHTLYLDTTYCSPEYTFPSQQEVIQFAVNTAFETVTL  817

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K  V+  K + LQCL     D    +++   +
Sbjct  818   NPRTLVVCGTYSIGKEKVFLAIAEVLGSKASVSRDKYKTLQCLESAAVD-SLISVDWDST  876

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKK----TPGKRWQQGT  1881
              +HV+P+  + NFK L    N++   +  ++A  PTGW+            P KR   G 
Sbjct  877   LLHVLPMMQI-NFKGLQDHLNKFSENFDQVLAFKPTGWTYSDSCLSLVDIKPQKR---GK  932

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  933   ITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  966


 Score =   112 bits (279),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +3

Query  1005  NPAKSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKI  1181
             +P + T  K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT++F    I
Sbjct  639   SPGEVTSKKHCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYCGLTKNFMF-PI  697

Query  1182  YCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             YC+ +T  LV  K+ +  + I +LP++    + GI V   DANHCPGA +ILF   +G +
Sbjct  698   YCNKITGNLVKSKLRVKEEYIHVLPMDTECTVNGIKVVLLDANHCPGATMILFYLPSGTV  757



>ref|XP_007173181.1| PREDICTED: DNA cross-link repair 1A protein [Balaenoptera acutorostrata 
scammoni]
Length=1054

 Score =   163 bits (413),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 126/221 (57%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  824   ILHTGDFR-ADPTMERSLLAGQKVHTLYLDTTYCSPEYSFPSQQEVIQFAVNTAFETLTL  882

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K   LQC   P E     T +   S
Sbjct  883   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSKEKYNTLQCFNIP-EINSLITTDMCNS  941

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +Y G+Y  I+A  PTGW+             Q +G I  
Sbjct  942   LVHLLPMMQI-NFKGLQNHLKKYGGKYDQILAFRPTGWTHSNKLTSMADIIPQTKGNISI  1000

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN     S R M
Sbjct  1001  YGIPYSEHSSYPEMKRFVQWLKPQKIIPTVNVGTLRSRRTM  1041


 Score =   107 bits (266),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 67/107 (63%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y L   C+ +FLTHFH+DHY GL+++F    +YCS +T  L+ 
Sbjct  716   PFYKKIPGTGFTVDAFQYGLVEGCTAYFLTHFHSDHYAGLSKNFTF-PVYCSEITGNLLK  774

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I  LP +    + G+ V   DANHCPGA++ILF   NG
Sbjct  775   SKLHVQEQYIHPLPTDTECIVNGVKVVLLDANHCPGAVMILFYLPNG  821



>ref|XP_009213650.1| PREDICTED: DNA cross-link repair 1A protein [Papio anubis]
 ref|XP_009213651.1| PREDICTED: DNA cross-link repair 1A protein [Papio anubis]
 ref|XP_009213652.1| PREDICTED: DNA cross-link repair 1A protein [Papio anubis]
Length=1039

 Score =   160 bits (405),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  809   ILHTGDFR-ADPSMEHSLLADQKVHMLYLDTTYCSPEYTFPSQQEVIQFAINTAFEALTL  867

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP  L + G+Y+IGKE++F+ IA  L  K+ ++  K + L+CL  P E     T +   S
Sbjct  868   NPHALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLRCLNIP-EINSLITTDMCSS  926

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +Y G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  927   LVHLLPMMQI-NFKGLQNHLKKYGGKYNQILAFRPTGWTHSNKFPRIADVIPQTKGNISI  985

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  986   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1016


 Score =   110 bits (274),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 99/190 (52%), Gaps = 21/190 (11%)
 Frame = +3

Query  798   RKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSL  974
             +K N+ +E  +QK +   +  ++  V LSK+    F  SA G         G     + +
Sbjct  638   KKSNSLQEGVYQKRSDHLINTESEAVNLSKV--KVFTKSAHG---------GLQRGNKKI  686

Query  975   MYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQG  1151
               SSN          ++ K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY G
Sbjct  687   PESSN-------VGGSRKKTCPFYKKIPGTGFTVDAFQYGMVEGCTAYFLTHFHSDHYAG  739

Query  1152  LTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAII  1331
             L++ F    +YCS +T  L+  K+ +    I  LPL+    + G+ V   DANHCPGA++
Sbjct  740   LSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHPLPLDTECVVNGVKVVLLDANHCPGAVM  798

Query  1332  ILFEPSNGCL  1361
             ILF   NG +
Sbjct  799   ILFYLPNGTV  808



>ref|XP_007962316.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Chlorocebus 
sabaeus]
Length=1040

 Score =   160 bits (405),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  810   ILHTGDFR-ADPSMEHSLLADQKVHMLYLDTTYCSPEYTFPSQQEVIQFAINTAFEALTL  868

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP  L + G+Y+IGKE++F+ IA  L  K+ ++  K + L+CL  P E     T +   S
Sbjct  869   NPHALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLRCLNIP-EINSLITTDMCSS  927

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +Y G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  928   LVHLLPMMQI-NFKGLQNHLKKYGGKYNQILAFRPTGWTHSNKFPRIADIIPQTKGNISI  986

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  987   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1017


 Score =   110 bits (275),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 99/190 (52%), Gaps = 21/190 (11%)
 Frame = +3

Query  798   RKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSL  974
             +K N+ +E  +QK +   +  ++  V LSK+    F  SA G         G     + +
Sbjct  639   KKSNSLQEGVYQKRSDHLINTESEAVNLSKV--KVFTKSAHG---------GLQRGNKKI  687

Query  975   MYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQG  1151
               SSN          ++ K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY G
Sbjct  688   PESSN-------VGGSRKKTCPFYKKIPGTGFTVDAFQYGMVEGCTAYFLTHFHSDHYAG  740

Query  1152  LTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAII  1331
             L++ F    +YCS +T  L+  K+ +    I  LPL+    + G+ V   DANHCPGA++
Sbjct  741   LSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHPLPLDTECVVNGVKVVLLDANHCPGAVM  799

Query  1332  ILFEPSNGCL  1361
             ILF   NG +
Sbjct  800   ILFYLPNGTV  809



>ref|XP_010239826.1| PREDICTED: DNA cross-link repair protein SNM1 isoform X2 [Brachypodium 
distachyon]
Length=455

 Score =   151 bits (382),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 124/203 (61%), Gaps = 5/203 (2%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAE-AFN  1536
             LHTGDFR    M   P  Q  +I+ L LDTTYCNP+Y FP Q+ VI FV+   Q      
Sbjct  251   LHTGDFRASKSMQSHPLLQTGRINLLYLDTTYCNPKYKFPPQEDVIDFVVRTAQRYLKKQ  310

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             P+TL ++G+Y+IGKE +++ I++AL   IY  A++ RIL   G+PD   +  + ++  S 
Sbjct  311   PKTLIVVGAYSIGKENVYLAISQALEVPIYTDASRRRILHSFGWPDLSKRISSCDQ-SSP  369

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTIIR  1890
             +HV+PL ++ + ++L +       R+  ++A  PTGW+  +  GK+    K   +G +  
Sbjct  370   LHVMPLASVQH-EKLTKYLETLNQRFLAVLAFRPTGWTFSEAAGKELDLIKPSSRGRVTI  428

Query  1891  YEVPYSEHSSFSELKKFVKFISP  1959
             Y VPYSEHSSF+EL+ F+KF+ P
Sbjct  429   YGVPYSEHSSFTELRDFLKFVRP  451


 Score =   119 bits (297),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 77/126 (61%), Gaps = 7/126 (6%)
 Frame = +3

Query  981   SSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLT  1157
             S    V K PA    YK       IPGTPF VDAF+Y     CS +FL+HFH DHY GLT
Sbjct  128   SEENGVAKKPATCPFYK------KIPGTPFTVDAFRYGAVEGCSAYFLSHFHYDHYGGLT  181

Query  1158  RSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIIL  1337
             + +CHG IYC+++TA+LV M + I  + I  L LN    I G+ VT  +ANHCPGA +I 
Sbjct  182   KKWCHGPIYCTALTARLVKMLLSINSEYICPLELNTEYVIDGVTVTLLEANHCPGAALIH  241

Query  1338  FEPSNG  1355
             F  S+G
Sbjct  242   FRLSDG  247



>ref|XP_009051023.1| hypothetical protein LOTGIDRAFT_213948 [Lottia gigantea]
 gb|ESO98324.1| hypothetical protein LOTGIDRAFT_213948 [Lottia gigantea]
Length=436

 Score =   176 bits (446),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 139/228 (61%), Gaps = 8/228 (4%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             VLHTGDFR    M + P  +  KI+ L LDTTYCNP Y FP Q  VI F I+ A++  A 
Sbjct  189   VLHTGDFRAHPTMEDYPELKNNKINDLYLDTTYCNPDYAFPFQQDVINFAIKIAVKTLAD  248

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDM-QFFTLNELE  1710
             NP+T  + G+YTIGKER+F  +A A+  K+ V   K  IL CL   DE++ +  TLN  E
Sbjct  249   NPKTCIVCGTYTIGKERVFKAVASAINSKVCVKRDKKSILDCL--EDEELNKMVTLNPAE  306

Query  1711  SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKG--KKKTPGKRWQQGTI  1884
             + +HV+P+  L NF  L++   ++  +++ I+   PTGW+  K     +    ++ +  I
Sbjct  307   ATVHVLPM-KLLNFNSLSEYLEKH-PQFTSILVFEPTGWTHSKKTISLEHVQPKYSRNAI  364

Query  1885  IRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
               Y +PYSEHSSF ELK+FV+F+ P  IIP+VNN  P S RKM  L +
Sbjct  365   THYGIPYSEHSSFLELKRFVQFLKPTRIIPTVNNGNPASRRKMEDLFA  412


 Score = 94.4 bits (233),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 64/110 (58%), Gaps = 2/110 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IP T F VDAF+Y     C+ + LTHFH DHY GLT+ F    IYCS +T  LV 
Sbjct  81    PFYKKIPETGFTVDAFRYGEIPGCTAYILTHFHYDHYCGLTKKF-KQPIYCSQITGNLVE  139

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCLA  1364
              K+ +    I  LP+N+   + G+++   +ANHCPGA+II     +G L 
Sbjct  140   SKLKVEVQYINRLPMNKPCAVNGVELMLREANHCPGAVIIFMRLPSGRLV  189



>dbj|BAD90139.1| mKIAA0086 protein [Mus musculus]
Length=984

 Score =   166 bits (420),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  754   ILHTGDFR-ADPSMERSRLAGRKVHTLFLDTTYCSPEYTFPSQQEVIQFAINTAFEAVTL  812

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +  +S
Sbjct  813   NPRALVVCGTYCIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EVSSLITTDMCDS  871

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+       T     Q +G I  
Sbjct  872   LVHLLPMMQI-NFKGLQSHLKKCGGKYDQILAFRPTGWTHSNNITSTADIIPQTRGNISI  930

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  931   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  961


 Score =   104 bits (259),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 2/109 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL++ F    +YCS +T  L+ 
Sbjct  646   PFYKRIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYAGLSKDFTR-PVYCSEITGNLLK  704

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
              K+ +    I+ LP++    +  + V   DANHCPGA +ILF+  NG +
Sbjct  705   KKLRVQEQYIRQLPMDTECVVDSVKVVLLDANHCPGATMILFQLPNGAV  753



>gb|EDL01762.1| DNA cross-link repair 1A, PSO2 homolog (S. cerevisiae), isoform 
CRA_b [Mus musculus]
Length=1029

 Score =   166 bits (420),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  799   ILHTGDFR-ADPSMERSRLAGRKVHTLFLDTTYCSPEYTFPSQQEVIQFAINTAFEAVTL  857

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +  +S
Sbjct  858   NPRALVVCGTYCIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EVSSLITTDMCDS  916

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+       T     Q +G I  
Sbjct  917   LVHLLPMMQI-NFKGLQSHLKKCGGKYDQILAFRPTGWTHSNNITSTADIIPQTRGNISI  975

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  976   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1006


 Score =   103 bits (258),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 2/109 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL++ F    +YCS +T  L+ 
Sbjct  691   PFYKRIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYAGLSKDFTR-PVYCSEITGNLLK  749

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
              K+ +    I+ LP++    +  + V   DANHCPGA +ILF+  NG +
Sbjct  750   KKLRVQEQYIRQLPMDTECVVDSVKVVLLDANHCPGATMILFQLPNGAV  798



>ref|XP_006844683.1| hypothetical protein AMTR_s00016p00244350 [Amborella trichopoda]
 gb|ERN06358.1| hypothetical protein AMTR_s00016p00244350 [Amborella trichopoda]
Length=479

 Score =   161 bits (407),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 132/211 (63%), Gaps = 5/211 (2%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAE-AFN  1536
             LHTGDFR C EM   P      ++ L LDTTYCNP+Y FP ++ V+ FV+   ++  A  
Sbjct  251   LHTGDFRACREMQSHPLLMAQMVNVLYLDTTYCNPKYRFPLKEDVVNFVVRITKSSVAKQ  310

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             P+TL ++G+Y+IGKE +++ I+ AL  +IYV +++ RILQ  G+   D +  +  +  + 
Sbjct  311   PKTLIVVGAYSIGKEHVYLAISEALGVQIYVDSSRKRILQSYGWSGLDKRLCSDGK-STP  369

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTIIR  1890
             +HV+P+ +L + +RL +    Y  +Y  ++A  PTGW+  +  G +    K   +G I  
Sbjct  370   LHVLPISSL-HPERLKKYLEAYRHQYLSVLAFRPTGWTFSEKIGSQLDLIKPNSKGNITI  428

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y VPYSEHSSF+EL+ FV+F+ P  IIP+VN
Sbjct  429   YGVPYSEHSSFTELRDFVQFLRPEKIIPTVN  459


 Score =   108 bits (271),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 83/135 (61%), Gaps = 5/135 (4%)
 Frame = +3

Query  954   NEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHF  1130
             ++ GR L+ SS++    NP  S + +  P +  I GTPF VDAF+Y L   C+ +FL+HF
Sbjct  117   DQSGRKLLRSSDEI---NP-NSNQQRTCPFYKKIHGTPFTVDAFRYGLIEGCAAYFLSHF  172

Query  1131  HADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDAN  1310
             H DHY GL++ + HG IYC+ +TA+LV + + +    I  + L+    I G+ VT  +AN
Sbjct  173   HYDHYGGLSKKWSHGPIYCTHLTARLVKLSLSVNPRFICPMELDTEYIIEGVKVTMLEAN  232

Query  1311  HCPGAIIILFEPSNG  1355
             HCPGA +I F   +G
Sbjct  233   HCPGAALIHFRLKDG  247



>ref|XP_010361519.1| PREDICTED: DNA cross-link repair 1A protein [Rhinopithecus roxellana]
Length=1040

 Score =   160 bits (404),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 125/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  810   ILHTGDFR-ADPSMEHSLLADQKVHMLYLDTTYCSPEYTFPSQQEVIQFAINTAFEALTL  868

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP  L + G+Y+IGKE++F+ IA  L  K+ +T  K + LQCL  P E     T +   S
Sbjct  869   NPHALVVCGTYSIGKEKVFLAIADVLGSKVGMTQEKYKTLQCLNIP-EINSLITTDMCSS  927

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  928   LVHLLPMMQI-NFKGLQNHLKKCGGKYNQILAFRPTGWTHSNKFTRIADVIPQTKGNISI  986

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  987   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1017


 Score =   110 bits (274),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 67/190 (35%), Positives = 99/190 (52%), Gaps = 21/190 (11%)
 Frame = +3

Query  798   RKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSL  974
             +K N+ +E  +QK +   +  ++  V LSK+    F  SA G         G     + +
Sbjct  639   KKSNSLQEGVYQKRSDHLINTESEAVNLSKV--KVFTKSAHG---------GLQRGNKKI  687

Query  975   MYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQG  1151
               SSN          ++ K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY G
Sbjct  688   PESSN-------VGGSRKKTCPFYKKIPGTGFTVDAFQYGMVEGCTAYFLTHFHSDHYAG  740

Query  1152  LTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAII  1331
             L++ F    +YCS +T  L+  K+ +    I  LPL+    + G+ V   DANHCPGA++
Sbjct  741   LSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHPLPLDTECVVNGVKVVLLDANHCPGAVM  799

Query  1332  ILFEPSNGCL  1361
             ILF   NG +
Sbjct  800   ILFYLPNGTV  809



>sp|Q9JIC3.2|DCR1A_MOUSE RecName: Full=DNA cross-link repair 1A protein; AltName: Full=SNM1 
homolog A [Mus musculus]
Length=1026

 Score =   166 bits (420),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  796   ILHTGDFR-ADPSMERSRLAGRKVHTLFLDTTYCSPEYTFPSQQEVIQFAINTAFEAVTL  854

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +  +S
Sbjct  855   NPRALVVCGTYCIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EVSSLITTDMCDS  913

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+       T     Q +G I  
Sbjct  914   LVHLLPMMQI-NFKGLQSHLKKCGGKYDQILAFRPTGWTHSNNITSTADIIPQTRGNISI  972

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  973   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1003


 Score =   104 bits (259),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 2/109 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL++ F    +YCS +T  L+ 
Sbjct  688   PFYKRIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYAGLSKDFTR-PVYCSEITGNLLK  746

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
              K+ +    I+ LP++    +  + V   DANHCPGA +ILF+  NG +
Sbjct  747   KKLRVQEQYIRQLPMDTECVVDSVKVVLLDANHCPGATMILFQLPNGAV  795



>ref|XP_006002870.1| PREDICTED: DNA cross-link repair 1A protein [Latimeria chalumnae]
Length=1028

 Score =   159 bits (403),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 90/233 (39%), Positives = 133/233 (57%), Gaps = 4/233 (2%)
 Frame = +1

Query  1339  LNHPMAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-A  1515
             L +   VLHTGDFR    M   P+    KIHTL LDTTYC+P+Y FP Q+  I F    A
Sbjct  783   LPNGTTVLHTGDFRADPSMECYPALIGQKIHTLYLDTTYCSPEYTFPTQEEAITFASSVA  842

Query  1516  IQAEAFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFT  1695
              +    NPRTL + G+Y++GKE++F+ IA  L  K+ ++  K   +QCL          T
Sbjct  843   FETVTLNPRTLVVCGTYSVGKEKVFLAIADVLGCKVSMSREKYNTMQCLE-SKSIKSLIT  901

Query  1696  LNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSL-GKGKKKTPGKRWQ  1872
             ++   + +HV+ +  + NFK LN   N++ G+Y  ++A  PTGW+  G+       K   
Sbjct  902   VDWDSTQLHVLSMMQV-NFKGLNMHLNKFSGKYDQVLAFRPTGWTYSGQCDSVADTKPQT  960

Query  1873  QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD  2031
             +G I  Y +PYSEHSS+ E+K FV+++ P  IIP+VN    ++ + M  L S+
Sbjct  961   RGNITIYGIPYSEHSSYLEMKHFVQWVRPNKIIPTVNVGKWQARKAMEKLFSE  1013


 Score =   110 bits (275),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 69/110 (63%), Gaps = 2/110 (2%)
 Frame = +3

Query  1029  KDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
             K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLTRSF +  IYCS +T  
Sbjct  678   KQCPFYKKIPGTAFVVDAFQYGAIEGCTAYFLTHFHSDHYVGLTRSFKY-PIYCSCITGN  736

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             LV  K+ +    I+ LP+N    + GI V   DANHCPGA ++LF   NG
Sbjct  737   LVKSKLQVEDQYIKKLPMNTACIVDGIKVILLDANHCPGAAMLLFHLPNG  786



>ref|XP_004919436.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004919437.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004919438.1| PREDICTED: DNA cross-link repair 1A protein isoform X3 [Xenopus 
(Silurana) tropicalis]
Length=929

 Score =   161 bits (407),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 125/211 (59%), Gaps = 4/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P+    ++HTL LDTTYC+P+Y FP Q   IQF +  A +    
Sbjct  698   ILHTGDFRADRSMESYPALIGQRVHTLYLDTTYCSPEYTFPPQQEAIQFAVNTAFETVTL  757

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             + RTL + G+Y +GKE++F+ IA  L  K+ ++  K R +QCL   D      T +   +
Sbjct  758   HSRTLVVCGTYAVGKEKVFLAIADVLGCKVCMSQDKYRTMQCLESAD-IRSVVTTDWHST  816

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +HV+P+  + NFK LN    ++ G+Y  ++A  PTGW+           R + +G +  
Sbjct  817   ALHVLPMMQV-NFKGLNVHLGKFSGKYDRVLAFKPTGWTYSDSSASVADIRPEIRGKVTM  875

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+SELK+FV+++ P  IIP+VN
Sbjct  876   YGIPYSEHSSYSELKRFVQWLKPQKIIPTVN  906


 Score =   108 bits (271),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 69/110 (63%), Gaps = 2/110 (2%)
 Frame = +3

Query  1029  KDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
             K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY GLT+ F    IYCS +T  
Sbjct  587   KQCPFYKKIPGTGFTVDAFQYGQIEGCTAYFLTHFHSDHYGGLTKKF-RCPIYCSMITGN  645

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             LV  K+ +  + I  LP+N    + GI V   +ANHCPGA+++LF   NG
Sbjct  646   LVQSKLRVESEFINTLPMNTECVVDGIRVVLLEANHCPGAVLLLFRLPNG  695



>ref|NP_061301.3| DNA cross-link repair 1A protein [Mus musculus]
 ref|XP_006527279.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Mus musculus]
 ref|XP_006527280.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Mus musculus]
Length=1047

 Score =   166 bits (420),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  817   ILHTGDFR-ADPSMERSRLAGRKVHTLFLDTTYCSPEYTFPSQQEVIQFAINTAFEAVTL  875

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +  +S
Sbjct  876   NPRALVVCGTYCIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EVSSLITTDMCDS  934

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+       T     Q +G I  
Sbjct  935   LVHLLPMMQI-NFKGLQSHLKKCGGKYDQILAFRPTGWTHSNNITSTADIIPQTRGNISI  993

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  994   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1024


 Score =   103 bits (258),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 2/109 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL++ F    +YCS +T  L+ 
Sbjct  709   PFYKRIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYAGLSKDFTR-PVYCSEITGNLLK  767

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
              K+ +    I+ LP++    +  + V   DANHCPGA +ILF+  NG +
Sbjct  768   KKLRVQEQYIRQLPMDTECVVDSVKVVLLDANHCPGATMILFQLPNGAV  816



>ref|XP_006135033.1| PREDICTED: DNA cross-link repair 1A protein [Pelodiscus sinensis]
Length=1051

 Score =   157 bits (398),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 88/215 (41%), Positives = 128/215 (60%), Gaps = 14/215 (7%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P     +IHTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  799   ILHTGDFRADPFMERYPLLMNRRIHTLYLDTTYCSPEYTFPSQQEVIQFAINTAFETVTL  858

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+YTIGKE++F+ IA+ L  K+ ++  K + LQCL     +    T++   +
Sbjct  859   NPRTLVVCGTYTIGKEKVFLAIAQVLGSKVSMSPDKYKTLQCLESAAVN-SLITVDWNNT  917

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKG-----KKKTPGKRWQQG  1878
              +H++P+  + NFK L    N++  ++  ++A  PTGW+         K +T GK     
Sbjct  918   LLHLLPMMQI-NFKGLQNHLNKFSEKFDQVLAFRPTGWTYSNSCHAVIKPQTRGK-----  971

Query  1879  TIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  972   -ITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1005


 Score =   112 bits (279),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 70/115 (61%), Gaps = 2/115 (2%)
 Frame = +3

Query  1020  TKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSV  1196
             TK K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT+ F    IYC+ V
Sbjct  685   TKNKKCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYSGLTKKFTF-PIYCNKV  743

Query  1197  TAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             T  LV  K+ +    I ILP++    + GI V   DANHCPGA +ILF   NG +
Sbjct  744   TGNLVKSKLQVQEQYIHILPMDTECIVNGIKVVLLDANHCPGATMILFCLPNGTV  798



>ref|XP_004975484.1| PREDICTED: LOW QUALITY PROTEIN: DNA cross-link repair protein 
SNM1-like [Setaria italica]
Length=503

 Score =   152 bits (384),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 130/213 (61%), Gaps = 11/213 (5%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAFN  1536
             LHTGDFR    M   P  Q  +++ L LDTTYCNP+Y FP Q+ VI FV+  A +  A  
Sbjct  272   LHTGDFRASRSMQLHPLLQRGRVNLLYLDTTYCNPKYKFPPQEDVIDFVVRTARRYLAKQ  331

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             P+TL ++G+Y+IGKE +++ I++AL   IY  A++ RIL    +PD   +  + N  +S 
Sbjct  332   PKTLIVVGAYSIGKENVYLAISQALDVPIYTDASRRRILHSFDWPDLSKRICSCN--QSS  389

Query  1717  IHVVPLWTL--ANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTI  1884
             +HV+PL ++   N K+  +  NQ   ++  ++A  PTGW+  +  GK+    K    G++
Sbjct  390   LHVLPLGSVNHENLKKYLETLNQ---KFVAVLAFRPTGWTFSEATGKQLDLIKPSSNGSV  446

Query  1885  IRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
               Y VPYSEHSSF+EL+ FV F+ P  +I SVN
Sbjct  447   TIYGVPYSEHSSFTELRDFVMFLRP-QVIRSVN  478


 Score =   117 bits (293),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 82/135 (61%), Gaps = 5/135 (4%)
 Frame = +3

Query  966   RSLMYSSNKSVKKNPAKSTKY----KDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHF  1130
             RS  +S  K  +  P ++       +  P +  IPGTPF VDAF+Y     CS +FL+HF
Sbjct  134   RSGSWSGRKRQRGGPGEAAPAAMNPRTCPFYKKIPGTPFTVDAFRYGEVEGCSAYFLSHF  193

Query  1131  HADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDAN  1310
             H DHY GLT+ +CHG I+CS++TA+LV M + +  D I  L L+    I G+ VT  +AN
Sbjct  194   HHDHYGGLTKKWCHGPIFCSALTARLVKMCLSVNSDYICPLELDTEYVIEGVTVTLLEAN  253

Query  1311  HCPGAIIILFEPSNG  1355
             HCPGA +I F  S+G
Sbjct  254   HCPGAALIHFRLSDG  268



>ref|NP_001093331.1| uncharacterized protein LOC733261 [Xenopus laevis]
 gb|AAI46633.1| LOC733261 protein [Xenopus laevis]
Length=932

 Score =   159 bits (403),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 85/213 (40%), Positives = 129/213 (61%), Gaps = 6/213 (3%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEA  1530
             +VLHTGDFR    M   P+    ++HTL LDTTYC+P+Y FP Q   IQF +  A +   
Sbjct  698   SVLHTGDFRADRSMESYPALIGQRVHTLYLDTTYCSPEYTFPPQQETIQFAVNIAFETVT  757

Query  1531  FNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE  1710
               PRTL + G+Y++GKE++F+ IA  L  K+ ++  K + +QCL    ED++     +  
Sbjct  758   LYPRTLVVCGTYSVGKEKVFLAIADVLGCKVCMSQDKYKTMQCLE--SEDIRSLVTTDWH  815

Query  1711  S-HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTI  1884
             S  +HV+P+  + NFK LN    ++ G+Y  ++A  PTGW+           + + +G +
Sbjct  816   STALHVLPMMQV-NFKGLNVHLGKFPGKYDRVLAFKPTGWTYSDSSVLVADIKPEIRGKV  874

Query  1885  IRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
               Y +PYSEHSS+SELK+FV+++ P  IIP+VN
Sbjct  875   TVYGIPYSEHSSYSELKRFVQWLKPQKIIPTVN  907


 Score =   110 bits (274),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 69/110 (63%), Gaps = 2/110 (2%)
 Frame = +3

Query  1029  KDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
             K  P +  IPGT F VDAF+Y +   CS +FLTHFH+DHY GLT+ F    IYCS +T  
Sbjct  588   KQCPFYKKIPGTGFAVDAFQYGQIEGCSAYFLTHFHSDHYGGLTKKF-RFPIYCSKITGN  646

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             LV  K+ +  + I  LP+N    + GI V   +ANHCPGA+++LF   NG
Sbjct  647   LVQNKLRVESEFINTLPMNTECVVNGIRVVLLEANHCPGAVLLLFRLPNG  696



>ref|XP_004680481.1| PREDICTED: DNA cross-link repair 1A protein [Condylura cristata]
Length=1029

 Score =   159 bits (403),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 126/221 (57%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  799   ILHTGDFR-ADPSMERSFLAGQKVHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFEAVTL  857

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  858   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EIKSLITTDMCSS  916

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  +  FK L     +   +Y  I+A  PTGW+             Q +G I  
Sbjct  917   LVHLLPMMQIT-FKGLQSHLEKCGRKYDQILAFRPTGWTHSNKFTSVSDIIPQTKGNISI  975

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN     S R M
Sbjct  976   YGIPYSEHSSYKEMKRFVQWLKPQKIIPTVNVGTSASRRTM  1016


 Score =   109 bits (273),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 68/107 (64%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y L   C+ +FLTHFH+DHY GL++ F    IYCS +T  L+ 
Sbjct  691   PFYKKIPGTGFTVDAFQYGLVEGCTAYFLTHFHSDHYAGLSKHFTL-PIYCSEITGNLLK  749

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I  LP++    + GI+V   DANHCPGA++ILF   NG
Sbjct  750   SKLHVQEQYIHPLPMDTACTVNGINVVLLDANHCPGAVMILFYLPNG  796



>ref|XP_009781327.1| PREDICTED: DNA cross-link repair protein SNM1 [Nicotiana sylvestris]
Length=464

 Score =   158 bits (399),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 88/223 (39%), Positives = 133/223 (60%), Gaps = 5/223 (2%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAFN-  1536
             LHTGDFR    M   P     +I+ L LDTTYCNP+Y FP ++ V++FV+   +    N 
Sbjct  236   LHTGDFRASKLMQSYPLLASQRINILYLDTTYCNPKYRFPSKEEVLKFVVGVTRTYLNNY  295

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             P+T+ ++G+Y+IGKE ++  I++AL  KIY  A++ RILQ  G+        T N  ++ 
Sbjct  296   PKTIVVVGAYSIGKEHVYFAISKALGVKIYANASRRRILQSFGWAGISENLST-NRKDTP  354

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTIIR  1890
             +H++P+ +L  F+ L +      G+Y+ ++A  PTGW+  +  G+     K   +G I  
Sbjct  355   LHILPISSL-KFEMLERYLASQDGQYTRMLAFRPTGWTYSETIGENLNLIKPTSKGNITI  413

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLS  2019
             Y VPYSEHSSF+EL++FV+F+ P  IIP+VN        KM S
Sbjct  414   YGVPYSEHSSFTELQEFVQFLRPEKIIPTVNVGNAVYREKMQS  456


 Score =   111 bits (277),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGTPF VDAF+Y   + CS +FL+HFHADHY GLT+ + HG IYC+++TA+LV 
Sbjct  126   PFYKRIPGTPFTVDAFRYGPVKGCSAYFLSHFHADHYIGLTKVWSHGPIYCTNLTARLVR  185

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             + + +    I  L L    ++ GI V+  DANHCPGA +I F   NG
Sbjct  186   ICLNVSPSFICPLELGTEYDLKGIKVSMLDANHCPGAALIHFRLPNG  232



>ref|XP_004459940.1| PREDICTED: LOW QUALITY PROTEIN: DNA cross-link repair 1A protein 
[Dasypus novemcinctus]
Length=1066

 Score =   158 bits (400),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 124/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  836   ILHTGDFR-ADPTMERSLLAGQKVHMLYLDTTYCSPEYSFPSQQEVIQFAINTAFEAVTL  894

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K+ +   K + L+CL  P E     T +   +
Sbjct  895   NPRTLVVCGTYSIGKEKVFLAIADVLGSKVGMVQEKYKTLRCLNIP-EVNSLITTDMDRA  953

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+             Q +G I  
Sbjct  954   LVHLLPMMQI-NFKGLQSHLKKCGGKYDQILAFRPTGWTHSNKLTSIADIIPQTKGNISI  1012

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  1013  YGIPYSEHSSYLEMKRFVQWLKPEKIIPTVN  1043


 Score =   110 bits (276),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 77/131 (59%), Gaps = 2/131 (2%)
 Frame = +3

Query  972   LMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQ  1148
             L   S K  + + A   + K  P +  IPGT F VDAF+Y L   C+ +FLTHFH+DHY 
Sbjct  706   LQRESTKIPESSNAGELRKKTCPFYKKIPGTGFTVDAFQYGLVDGCTAYFLTHFHSDHYA  765

Query  1149  GLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAI  1328
             GL++SF    +YCS +T  L+  K+ +    I  LP++    + GI V   DANHCPGA+
Sbjct  766   GLSKSFTF-PVYCSEITGSLLRSKLHVQEQYIHPLPMDTECIVNGIKVVLLDANHCPGAV  824

Query  1329  IILFEPSNGCL  1361
             +ILF   NG +
Sbjct  825   MILFYLPNGTV  835



>ref|XP_006468937.1| PREDICTED: DNA cross-link repair protein SNM1-like isoform X1 
[Citrus sinensis]
Length=464

 Score =   160 bits (404),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 88/232 (38%), Positives = 135/232 (58%), Gaps = 5/232 (2%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQ-AEAFN  1536
             LHTGDFR    M   P     +++ L LDTTYCNP+Y FP ++ V+ +V+   +      
Sbjct  231   LHTGDFRASRLMQSYPLLVNHRVNVLYLDTTYCNPKYKFPSKEDVLNYVVRVTKNCLKKQ  290

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             P+TL ++G+Y+IGKE +F+ I++AL  KIY  A++ R+LQ   +P+      T    ++ 
Sbjct  291   PKTLVVVGAYSIGKESVFLAISKALGVKIYANASRRRVLQSFDWPELSGNLCTQGN-DTL  349

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTIIR  1890
             +HV+P+ +L  F+ L      Y  +Y+ ++A  PTGW+  +  G +    +   +G I  
Sbjct  350   LHVLPMSSL-KFETLKDYLKPYGNQYAAVLAFRPTGWTYSETVGNQLDLIRPLSRGNITI  408

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD*YSLK  2046
             Y VPYSEHSSF+EL++FV+F+ P  IIP+VN     S  KM S   +  S K
Sbjct  409   YGVPYSEHSSFTELREFVQFLRPDKIIPTVNVWNAASREKMQSFFREWLSCK  460


 Score =   109 bits (273),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 1/110 (1%)
 Frame = +3

Query  1029  KDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
             +  P +  IPGTPF VDAF+Y   + CS +FLTHFH DHY GL + + HG IYCS +TA+
Sbjct  118   RSCPFYKKIPGTPFTVDAFRYGSIKGCSAYFLTHFHYDHYGGLGKRWSHGPIYCSPLTAR  177

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             LV M + +    I  L LN    I G+ VT  +ANHCPGA +I F   +G
Sbjct  178   LVRMCLLVNPSYIHPLELNTEHVIDGVKVTLLEANHCPGAALIHFRLQDG  227



>ref|XP_005387865.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Chinchilla 
lanigera]
 ref|XP_005387866.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Chinchilla 
lanigera]
Length=1047

 Score =   159 bits (402),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/214 (43%), Positives = 124/214 (58%), Gaps = 11/214 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             VLHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  817   VLHTGDFR-ADPSMERSLLAGQKVHVLYLDTTYCSPEYTFPSQQEVIQFAINTAFEAVTQ  875

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y IGKE++F+ IA  L  K+ ++  K + L+CL    E     T +   S
Sbjct  876   NPRALVVCGTYCIGKEKVFLAIADVLGSKVGMSEEKYKTLRCLNI-SEINSLITTDMYNS  934

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKG----KKKTPGKRWQQGT  1881
              +H++P+  + NFK L     +Y G+Y  I+A  PTGW+           TP  +   G 
Sbjct  935   LVHLLPMMQI-NFKNLQSHLKKYGGKYDQILAFRPTGWTHSNKLTCIADVTPKTK---GN  990

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  991   ISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1024


 Score =   110 bits (274),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 68/109 (62%), Gaps = 2/109 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL+RSF    IYCS VTA L+ 
Sbjct  709   PFYKKIPGTGFTVDAFQYGAVEGCTAYFLTHFHSDHYAGLSRSFTF-PIYCSEVTASLLK  767

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
              K+ +    I  LP++    I G+ V   DANHCPGA +ILF   NG +
Sbjct  768   SKLHVQEQYIHPLPMDTECIINGVRVILLDANHCPGAAMILFYLPNGTV  816



>ref|XP_006162825.1| PREDICTED: LOW QUALITY PROTEIN: DNA cross-link repair 1A protein 
[Tupaia chinensis]
Length=976

 Score =   163 bits (412),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/214 (43%), Positives = 127/214 (59%), Gaps = 11/214 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
              LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQ  I  A +A   
Sbjct  746   TLHTGDFR-ADPSMERSLLTGQKVHTLYLDTTYCSPEYTFPSQQEVIQSAINTAFEAVTL  804

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR+L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  805   NPRSLVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EINSLITTDMCSS  863

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWS----LGKGKKKTPGKRWQQGT  1881
              +H++P+  + NFK L     ++ G+Y  I+A  PTGW+    L +     P  R   G 
Sbjct  864   LVHLLPMMQI-NFKGLQSHLKKFGGKYDQILAFRPTGWTHSSKLSRITDVIPQTR---GN  919

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  920   ISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  953


 Score =   106 bits (264),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 69/110 (63%), Gaps = 2/110 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY GL+++F    +YCS +T  L+ 
Sbjct  638   PFYKKIPGTGFTVDAFQYGMVEGCTAYFLTHFHSDHYAGLSKNFT-CPVYCSEITGNLLK  696

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCLA  1364
              K+ +    I  LP++    + GI V   DANHCPGA++ILF   NG + 
Sbjct  697   NKLHMQEQYIHPLPMDTECVVNGIRVVLLDANHCPGAVMILFYLPNGTVT  746



>ref|XP_006527281.1| PREDICTED: DNA cross-link repair 1A protein isoform X3 [Mus musculus]
Length=511

 Score =   166 bits (421),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  281   ILHTGDFR-ADPSMERSRLAGRKVHTLFLDTTYCSPEYTFPSQQEVIQFAINTAFEAVTL  339

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +  +S
Sbjct  340   NPRALVVCGTYCIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EVSSLITTDMCDS  398

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+       T     Q +G I  
Sbjct  399   LVHLLPMMQI-NFKGLQSHLKKCGGKYDQILAFRPTGWTHSNNITSTADIIPQTRGNISI  457

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  458   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  488


 Score =   102 bits (254),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 48/126 (38%), Positives = 73/126 (58%), Gaps = 2/126 (2%)
 Frame = +3

Query  987   NKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRS  1163
             N ++ ++       +  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL++ 
Sbjct  156   NMNISESSGAGEVRRTCPFYKRIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYAGLSKD  215

Query  1164  FCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFE  1343
             F    +YCS +T  L+  K+ +    I+ LP++    +  + V   DANHCPGA +ILF+
Sbjct  216   FTR-PVYCSEITGNLLKKKLRVQEQYIRQLPMDTECVVDSVKVVLLDANHCPGATMILFQ  274

Query  1344  PSNGCL  1361
               NG +
Sbjct  275   LPNGAV  280



>ref|XP_010028912.1| PREDICTED: DNA cross-link repair protein SNM1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW55741.1| hypothetical protein EUGRSUZ_I01572 [Eucalyptus grandis]
Length=531

 Score =   153 bits (387),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 83/234 (35%), Positives = 139/234 (59%), Gaps = 7/234 (3%)
 Frame = +1

Query  1339  LNHPMAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAI  1518
             L++    LHTGDFR    M   P     ++  L LDTTYCNP+Y FP ++ V+ +V+   
Sbjct  291   LSNGQCYLHTGDFRASKLMQAYPLLANQRVDVLYLDTTYCNPRYKFPSKEDVLSYVVRV-  349

Query  1519  QAEAF---NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQF  1689
              +  F    P+TL ++G+Y+IGKE +++ +++AL  KI+   ++ RILQ   +  E  + 
Sbjct  350   -SNDFLKKRPKTLIVVGAYSIGKECVYLALSKALGVKIHADTSRRRILQSFNW-SELSER  407

Query  1690  FTLNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRW  1869
              + N  ++++HV+P+ +L  F+ L+     Y  +Y+ ++A  PTGW+  +  + +  K  
Sbjct  408   ISSNPKDTNLHVLPISSL-RFEILDSYLKSYGNQYTDVLAFRPTGWTYSERTQLSLIKPI  466

Query  1870  QQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD  2031
              +G +  Y VPYSEHSSF+EL++FV+F+ P+ IIP+VN     +  KM S   +
Sbjct  467   SKGKVTIYGVPYSEHSSFTELREFVQFLRPSKIIPTVNVGNASTRDKMQSYFQE  520


 Score =   115 bits (288),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 1/107 (1%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGTPF VDAF+Y     CS +FLTHFHADHY GL + + HG IYC+ +TA+LV 
Sbjct  188   PFYKKIPGTPFTVDAFRYGCVEGCSAYFLTHFHADHYGGLRKGWSHGPIYCTPLTARLVR  247

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             M + +    I+ L LN+   I G+ VT  +ANHCPGA +I F  SNG
Sbjct  248   MCLYVDPLFIRPLELNEEHIIGGVRVTLLEANHCPGAALIHFRLSNG  294



>ref|XP_007107018.1| PREDICTED: DNA cross-link repair 1A protein isoform X4 [Physeter 
catodon]
Length=921

 Score =   160 bits (405),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 125/221 (57%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  691   ILHTGDFR-ADPTMERSLLAGQKVHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFETVTL  749

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K   LQC   P E     T +   S
Sbjct  750   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSKEKYNTLQCFNIP-EINSLITTDMCNS  808

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+             Q +G I  
Sbjct  809   LVHLLPMMQI-NFKGLQNHLKKCGGKYDQILAFRPTGWTHSNKLTSMADIIPQTKGNISI  867

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN     S R M
Sbjct  868   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTLRSRRTM  908


 Score =   108 bits (270),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 67/107 (63%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y L   C+ +FLTHFH+DHY GL++SF    +YCS +T  L+ 
Sbjct  583   PFYKKIPGTGFTVDAFQYGLVEGCTAYFLTHFHSDHYAGLSKSFTF-PVYCSEITGNLLK  641

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I  LP +    + G+ V   DANHCPGA++ILF   NG
Sbjct  642   SKLHMQEQYIHPLPTDTECIVNGVKVVLLDANHCPGAVMILFYLPNG  688



>ref|XP_006831434.1| PREDICTED: DNA cross-link repair 1A protein [Chrysochloris asiatica]
Length=1056

 Score =   162 bits (410),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       KIHTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  826   ILHTGDFR-ADPSMERSLLANQKIHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFEAVTL  884

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K   LQCL  P E     T +   +
Sbjct  885   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYSTLQCLNIP-EMSSLITTDMCSA  943

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L +   +  G+Y+ I+A  PTGW+             Q +G I  
Sbjct  944   LVHILPMMQV-NFKGLQRHLKRCAGKYNQILAFRPTGWTHCNKLTSIADLIPQTKGNITI  1002

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  1003  YGIPYSEHSSYLEMKRFVQWLRPQKIIPTVN  1033


 Score =   106 bits (265),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +3

Query  1011  AKSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYC  1187
             A+  + +  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL+++F    +YC
Sbjct  709   ARGLRQRKCPFYKKIPGTGFTVDAFQYGPIEGCTAYFLTHFHSDHYAGLSKNFT-SPLYC  767

Query  1188  SSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILF  1340
             S +T  LV  K+ +    I  LP++    + G+ V   DANHCPGA++ILF
Sbjct  768   SEITGNLVKSKLHVQEQYIHPLPMDTECPVNGVRVVLLDANHCPGAVMILF  818



>ref|XP_007665881.1| PREDICTED: DNA cross-link repair 1A protein [Ornithorhynchus 
anatinus]
 ref|XP_007665882.1| PREDICTED: DNA cross-link repair 1A protein [Ornithorhynchus 
anatinus]
 ref|XP_001513453.2| PREDICTED: DNA cross-link repair 1A protein [Ornithorhynchus 
anatinus]
Length=1006

 Score =   157 bits (398),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 84/211 (40%), Positives = 125/211 (59%), Gaps = 4/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P     KIH L LDTTYC+P+Y FP Q  VIQF    A ++   
Sbjct  775   ILHTGDFRADPSMKRYPKLIGQKIHMLYLDTTYCSPEYSFPSQQEVIQFAANTAFESINL  834

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP TL + G+Y+IGKE++F+ IA  L  K+ ++  K + L+CL   +E     T +   +
Sbjct  835   NPHTLVICGTYSIGKEKVFIAIAEVLGSKVSMSQEKYKTLRCLEL-EEVNSLITTDWSST  893

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLG-KGKKKTPGKRWQQGTIIR  1890
              +H++P+  +  FK L    +++ G+Y+ ++A  PTGW+   K    +  K   +G I  
Sbjct  894   KVHLLPMMQIT-FKGLQSHLSKFGGKYNQVLAFKPTGWTYSEKSSSISDIKPETRGNITI  952

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K FV+++ P  IIP+VN
Sbjct  953   YGIPYSEHSSYLEMKHFVQWLKPQKIIPTVN  983


 Score =   110 bits (276),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 69/107 (64%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y    DC+ +FLTHFH+DHY GL++ F +  IYC+ +T  LV 
Sbjct  667   PFYKKIPGTGFTVDAFQYGAIDDCTAYFLTHFHSDHYGGLSKKFTY-PIYCNKITGNLVK  725

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I ILP++    + GI V   DANHCPGA+++LF   NG
Sbjct  726   SKLKVQEQYIHILPMDTVCIVNGIKVVLLDANHCPGAVMLLFYLPNG  772



>ref|XP_010929555.1| PREDICTED: LOW QUALITY PROTEIN: DNA cross-link repair protein 
SNM1 [Elaeis guineensis]
Length=550

 Score =   163 bits (412),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 131/219 (60%), Gaps = 4/219 (2%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAFN  1536
             LHTGDFR C +M   P     +I+ L LDTTYCNP+Y FP ++ V+ F++  A +     
Sbjct  325   LHTGDFRACKQMQSYPLLLNHRINVLYLDTTYCNPKYRFPPKEDVVNFIVRTARKCLEKQ  384

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             P+TL  +G+Y+IGKE ++V I++AL   IY  +++ RILQ  G+P+   +  +  +  S 
Sbjct  385   PKTLIAVGAYSIGKEHVYVSISQALEVPIYTDSSRRRILQSFGWPELSRKLCSCGQ-SSP  443

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQGTIIRYE  1896
             +HV+P+ +    + L +  N Y  +++ ++A  PTGW+   G      K   +G I  Y 
Sbjct  444   LHVLPI-SFLRHENLCEYLNTYKQQFAAVLAFRPTGWTYS-GTTLDLIKPSSKGNITLYG  501

Query  1897  VPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             VPYSEHSSF EL+ FVKF+ P  IIP+VN   P +  KM
Sbjct  502   VPYSEHSSFIELRDFVKFLKPHKIIPTVNVGNPTNREKM  540


 Score =   105 bits (263),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 71/114 (62%), Gaps = 1/114 (1%)
 Frame = +3

Query  1017  STKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSS  1193
             S ++   P +  IPGTPF VDAF+Y     CS +FL+HFH DHY GL++ + HG IYC+ 
Sbjct  208   SDRHPVCPFYKKIPGTPFTVDAFRYGPIEGCSAYFLSHFHHDHYGGLSKKWSHGPIYCTP  267

Query  1194  VTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             +TA+LV + + I    I  L L+    I G  VT  +ANHCPGA +I F  SNG
Sbjct  268   LTARLVKLCLSINSLYICPLELDTEHVIEGTKVTLLEANHCPGAALIHFRLSNG  321



>gb|KDO63501.1| hypothetical protein CISIN_1g012419mg [Citrus sinensis]
Length=464

 Score =   159 bits (402),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 88/232 (38%), Positives = 135/232 (58%), Gaps = 5/232 (2%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQ-AEAFN  1536
             LHTGDFR    M   P     +++ L LDTTYCNP+Y FP ++ V+ +V+   +      
Sbjct  231   LHTGDFRASRLMQSYPLLVNHRVNVLYLDTTYCNPKYKFPSKEDVLNYVVRLTKNCLKKQ  290

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             P+TL ++G+Y+IGKE +F+ I++AL  KIY  A++ R+LQ   +P+      T    ++ 
Sbjct  291   PKTLVVVGAYSIGKESVFLAISKALGVKIYANASRRRVLQSFDWPELSGNLCTQGN-DTL  349

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTIIR  1890
             +HV+P+ +L  F+ L      Y  +Y+ ++A  PTGW+  +  G +    +   +G I  
Sbjct  350   LHVLPMSSL-KFETLKDYLKPYGNQYAAVLAFRPTGWTYSETVGNQLDLIRPLSRGNITI  408

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD*YSLK  2046
             Y VPYSEHSSF+EL++FV+F+ P  IIP+VN     S  KM S   +  S K
Sbjct  409   YGVPYSEHSSFTELREFVQFLRPDKIIPTVNVWNAASREKMQSFFREWLSCK  460


 Score =   109 bits (272),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 69/110 (63%), Gaps = 1/110 (1%)
 Frame = +3

Query  1029  KDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
             +  P +  IPGTPF VDAF+Y   + CS +FLTHFH DHY GL + + HG IYCS +TA+
Sbjct  118   RSCPFYKKIPGTPFTVDAFRYGSIKGCSAYFLTHFHYDHYGGLGKRWSHGPIYCSPLTAR  177

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             LV M + +    I  L LN    I G+ VT  +ANHCPGA +I F   +G
Sbjct  178   LVRMCLLVNPSYIHPLELNTEHVIDGVKVTLLEANHCPGAALIHFRLQDG  227



>ref|XP_007084889.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Panthera 
tigris altaica]
 ref|XP_007084890.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Panthera 
tigris altaica]
Length=1049

 Score =   159 bits (401),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 126/214 (59%), Gaps = 11/214 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR     ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  819   LLHTGDFR-AHPTMERSLLAGQKVHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFEAVTL  877

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P+ +    T +   S
Sbjct  878   NPRVLVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIPELN-SLITTDMCNS  936

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKR----WQQGT  1881
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+      K  G        +G 
Sbjct  937   LVHLLPMMQI-NFKALQSHLKKCGGKYDQILAFRPTGWTHS---NKLTGIADIIPQTKGN  992

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  993   ISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1026


 Score =   109 bits (273),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 97/193 (50%), Gaps = 18/193 (9%)
 Frame = +3

Query  780   HALSELRKENTKEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNE  959
             H    LRK ++ +    +     ++D T    L+      F  SA          CG+ +
Sbjct  641   HQRKRLRKSDSLQAGAHQKRSHRLIDRTESETLNLRKDKVFVKSA----------CGRLQ  690

Query  960   VGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHA  1136
              G + +  S+       A   + K  P +  IPGT F VDAF+Y L   C+ +FLTHFH+
Sbjct  691   RGNTKIPESSN------AGQLRKKTCPFYKKIPGTGFTVDAFQYGLVEGCTAYFLTHFHS  744

Query  1137  DHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHC  1316
             DHY GL+++F    +YCS +T  L+  K+ +    +  LP++    + G+ V   DANHC
Sbjct  745   DHYAGLSKNFTF-PVYCSEITGNLLKSKLHMQKQYVHPLPMDTECIVNGVKVILLDANHC  803

Query  1317  PGAIIILFEPSNG  1355
             PGA++ILF   NG
Sbjct  804   PGAVMILFYLPNG  816



>ref|XP_003994466.1| PREDICTED: DNA cross-link repair 1A protein [Felis catus]
Length=1049

 Score =   159 bits (402),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 126/214 (59%), Gaps = 11/214 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR     ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  819   LLHTGDFR-AHPTMERSLLAGQKVHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFEAVTL  877

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P+ +    T +   S
Sbjct  878   NPRVLVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIPELN-SLITTDMCNS  936

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKR----WQQGT  1881
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+      K  G        +G 
Sbjct  937   LVHLLPMMQI-NFKALQSHLKKCGGKYDQILAFRPTGWTHS---NKLTGIADIIPQTKGN  992

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  993   ISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1026


 Score =   109 bits (272),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 64/193 (33%), Positives = 97/193 (50%), Gaps = 18/193 (9%)
 Frame = +3

Query  780   HALSELRKENTKEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNE  959
             H    LRK ++ +    +     ++D T    L+      F  SA          CG+ +
Sbjct  641   HQRKRLRKSDSLQAGAHQKRSHRLIDRTESETLNLRKDKVFVKSA----------CGRLQ  690

Query  960   VGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHA  1136
              G + +  S+       A   + K  P +  IPGT F VDAF+Y L   C+ +FLTHFH+
Sbjct  691   RGNTNIPESSN------AGQLRKKTCPFYKKIPGTGFTVDAFQYGLVEGCTAYFLTHFHS  744

Query  1137  DHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHC  1316
             DHY GL+++F    +YCS +T  L+  K+ +    +  LP++    + G+ V   DANHC
Sbjct  745   DHYAGLSKNFTF-PVYCSEITGNLLKSKLHMQKQYVHPLPMDTECIVNGVKVILLDANHC  803

Query  1317  PGAIIILFEPSNG  1355
             PGA++ILF   NG
Sbjct  804   PGAVMILFYLPNG  816



>emb|CDY13651.1| BnaA06g32720D [Brassica napus]
Length=415

 Score =   164 bits (415),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 91/228 (40%), Positives = 137/228 (60%), Gaps = 7/228 (3%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF--  1533
             LHTGDFR   +M   P     ++H L LDTTYCNP+Y FP ++ V+ +V+  I  E    
Sbjct  187   LHTGDFRASKQMQTHPLLFNRRVHVLYLDTTYCNPRYKFPSKEDVLSYVVR-ITKEFLRK  245

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
              PRTL ++GSY+IGKE +++ IA+AL  K++  A++ RIL+  G+ D      T  +  +
Sbjct  246   QPRTLIVVGSYSIGKECVYLAIAKALGVKVFANASRRRILESFGWDDISKSLCTDGK-AT  304

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTII  1887
              +HV+P+  L  F+RL++    Y  +Y  ++A  PTGW+  +  G+     +   +G + 
Sbjct  305   CLHVLPMSAL-KFERLDEHLKVYREQYGAVLAFRPTGWTYSEKVGEHLDMIRPTSRGKVT  363

Query  1888  RYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD  2031
              Y VPYSEHSSF+EL++FV+F+ P  IIP+VN    ES  KM S   +
Sbjct  364   IYGVPYSEHSSFTELREFVQFLRPDKIIPTVNISNAESREKMQSCFRE  411


 Score =   104 bits (259),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 103/174 (59%), Gaps = 5/174 (3%)
 Frame = +3

Query  840   KKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSLMYSSNKSVKKNP-AK  1016
             +K    +++K K +K  TD FQ    G +K   +S   +   R    +S K V+++P A 
Sbjct  13    QKFTPPESNKKKTTKQ-TDLFQ--VWGLQKPSPSSSPASSSARKTSTASGKRVRESPWAN  69

Query  1017  STKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSS  1193
              +  +  P +  +PGTPF VDAF+Y   + CS +FLTHFHADHY GLT+++ HG IYCSS
Sbjct  70    DSTPRQCPFYKKLPGTPFTVDAFRYGCVQGCSAYFLTHFHADHYIGLTKAWSHGPIYCSS  129

Query  1194  VTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             +T++L+ + + +    I  L L+    I G+ VT  +ANHCPGA +I F   +G
Sbjct  130   LTSRLLRLSLSVNPSFIHPLELDVEYTINGVKVTLIEANHCPGAALIHFRLLDG  183



>ref|XP_004374916.1| PREDICTED: DNA cross-link repair 1A protein [Trichechus manatus 
latirostris]
Length=1054

 Score =   160 bits (404),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 89/211 (42%), Positives = 124/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P Y FP Q  VIQF I  A +A   
Sbjct  824   ILHTGDFR-ADPTMERSLLGSQKVHILYLDTTYCSPGYSFPSQQEVIQFAINTAFEAVTL  882

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K   LQCL  P  +    T +   +
Sbjct  883   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYTTLQCLNIPAIN-SLITTDMCNA  941

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L +   +Y G+Y  I+A  PTGW+             Q +G I  
Sbjct  942   LVHLLPMMQI-NFKGLQKHLKKYGGKYDQILAFRPTGWTHSNTLTSIADIIPQTKGNISI  1000

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  1001  YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1031


 Score =   108 bits (270),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 72/118 (61%), Gaps = 2/118 (2%)
 Frame = +3

Query  1011  AKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYC  1187
             A+  + +  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL+++F    +YC
Sbjct  707   AEGLRKRRCPFYKKIPGTGFTVDAFQYGFIEGCTAYFLTHFHSDHYAGLSKNFT-SPVYC  765

Query  1188  SSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             S +T  L+  K+ +    I  LP++    + GI V   DANHCPGA+++LF   NG +
Sbjct  766   SEITGNLLKKKLHVQEQYIHPLPMDTECIVNGIKVVLLDANHCPGAVMLLFYLPNGTV  823



>ref|XP_007107015.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Physeter 
catodon]
 ref|XP_007107016.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Physeter 
catodon]
 ref|XP_007107017.1| PREDICTED: DNA cross-link repair 1A protein isoform X3 [Physeter 
catodon]
Length=1054

 Score =   160 bits (404),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/221 (42%), Positives = 125/221 (57%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  824   ILHTGDFR-ADPTMERSLLAGQKVHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFETVTL  882

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K   LQC   P E     T +   S
Sbjct  883   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSKEKYNTLQCFNIP-EINSLITTDMCNS  941

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+             Q +G I  
Sbjct  942   LVHLLPMMQI-NFKGLQNHLKKCGGKYDQILAFRPTGWTHSNKLTSMADIIPQTKGNISI  1000

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN     S R M
Sbjct  1001  YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTLRSRRTM  1041


 Score =   108 bits (270),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 67/107 (63%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y L   C+ +FLTHFH+DHY GL++SF    +YCS +T  L+ 
Sbjct  716   PFYKKIPGTGFTVDAFQYGLVEGCTAYFLTHFHSDHYAGLSKSFTF-PVYCSEITGNLLK  774

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I  LP +    + G+ V   DANHCPGA++ILF   NG
Sbjct  775   SKLHMQEQYIHPLPTDTECIVNGVKVVLLDANHCPGAVMILFYLPNG  821



>emb|CDX83638.1| BnaC07g23780D [Brassica napus]
Length=414

 Score =   166 bits (419),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 93/228 (41%), Positives = 137/228 (60%), Gaps = 7/228 (3%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAF--  1533
             LHTGDFR   +M   P     ++H L LDTTYCNP+Y FP ++ V+ +V+  I  E    
Sbjct  186   LHTGDFRASKQMQTHPLLFNRRVHVLYLDTTYCNPRYKFPSKEDVLSYVVR-ITKEFLRK  244

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
              PRTL ++GSY+IGKE +++ IA+AL  K++  A++ RILQ  G+ D      T  +  +
Sbjct  245   QPRTLIVVGSYSIGKECVYLAIAKALGVKVFANASRRRILQSFGWDDISNSLCTDGK-AT  303

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTII  1887
              +HV+P+  L  F+RL++    Y  +Y  ++A  PTGW+  +  G+     K   +G + 
Sbjct  304   CLHVLPMSAL-KFERLDEHLKVYREQYGAVLAFRPTGWTYSEKVGEHLDLIKPTSKGEVT  362

Query  1888  RYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD  2031
              Y VPYSEHSSF+EL++FV+F+ P  IIP+VN    ES  KM S   +
Sbjct  363   IYGVPYSEHSSFTELREFVQFLRPDKIIPTVNISNAESREKMQSCFRE  410


 Score =   102 bits (254),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 81/126 (64%), Gaps = 1/126 (1%)
 Frame = +3

Query  981   SSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLT  1157
             +S K ++ +P  +   +  P +  +PGTPF VDAF+Y   + CS +FLTHFHADHY GLT
Sbjct  57    ASGKRLRDSPWANDTPRQCPFYKKLPGTPFTVDAFRYGCVQGCSAYFLTHFHADHYIGLT  116

Query  1158  RSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIIL  1337
             +S+ HG IYCSS+T++L+ + + +    I  L L+    I G+ VT  +ANHCPGA +I 
Sbjct  117   KSWSHGPIYCSSLTSRLLTLSLSVNPSFIHPLELDVEYTINGVKVTLVEANHCPGAALIH  176

Query  1338  FEPSNG  1355
             F   +G
Sbjct  177   FRLLDG  182



>ref|XP_006044044.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Bubalus 
bubalis]
Length=1055

 Score =   164 bits (414),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 129/221 (58%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  825   ILHTGDFR-ADPSMERSLLGCHKVHTLYLDTTYCSPEYSFPSQQEVIQFAINAAFETVTL  883

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ V+  K   LQC   P E   F T +   S
Sbjct  884   NPRALVVCGTYSIGKEKIFLAIADVLGSKVGVSKEKYNTLQCFNIP-EVSSFITTDMCNS  942

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  943   LVHLLPMMQI-NFKGLQNHLKKCGGKYNQILAFRPTGWTHSNKLTRLADIIPQTKGNISI  1001

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN    +S R M
Sbjct  1002  YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTLKSRRTM  1042


 Score =   103 bits (258),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 65/102 (64%), Gaps = 2/102 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL+++F    IYCS +T  L+ 
Sbjct  717   PFYKKIPGTGFTVDAFQYGWVEGCTAYFLTHFHSDHYAGLSKNFTF-PIYCSKITGNLLK  775

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILF  1340
              K+ +    I  LP++    + GI V   DANHCPGA++ILF
Sbjct  776   SKLHVQEQYIHPLPIDTECIVNGIKVILLDANHCPGAVMILF  817



>ref|XP_004050168.1| PREDICTED: DNA cross-link repair 1A protein [Gorilla gorilla 
gorilla]
Length=1040

 Score =   157 bits (398),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 125/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VI+F I  A +A   
Sbjct  810   ILHTGDFR-ADPSMEHSLLADQKVHMLYLDTTYCSPEYTFPSQQEVIRFAINTAFEAVTL  868

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP  L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  869   NPHALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EINSLITTDMCSS  927

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  928   LVHLLPMMQI-NFKGLQSHLKKCRGKYNQILAFRPTGWTHSNKFTRIADVIPQTKGNISI  986

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  987   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1017


 Score =   110 bits (275),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 99/190 (52%), Gaps = 21/190 (11%)
 Frame = +3

Query  798   RKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSL  974
             RK N+ +E   QK +   +  ++  V LSK+    F  SA G         G     + +
Sbjct  639   RKSNSLQEGACQKRSDHLINTESEAVNLSKV--KVFTKSAHG---------GLQRGNKKI  687

Query  975   MYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQG  1151
               SSN        + ++ K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY G
Sbjct  688   PESSN-------GEGSRKKTCPFYKKIPGTGFTVDAFQYGMVEGCTAYFLTHFHSDHYAG  740

Query  1152  LTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAII  1331
             L++ F    +YCS +T  L+  K+ +    I  LPL+    + G+ V   DANHCPGA++
Sbjct  741   LSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHPLPLDTECIVNGVKVVLLDANHCPGAVM  799

Query  1332  ILFEPSNGCL  1361
             ILF   NG +
Sbjct  800   ILFYLPNGTV  809



>ref|XP_008488343.1| PREDICTED: DNA cross-link repair 1A protein [Calypte anna]
Length=995

 Score =   157 bits (398),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 128/224 (57%), Gaps = 16/224 (7%)
 Frame = +1

Query  1336  SLNHPMAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-  1512
             SL     +LHTGDFR    M   P+    K+HTL LDTTYC+P+Y FP Q  VIQF +  
Sbjct  755   SLPSGTVILHTGDFRADPSMERYPALVAQKVHTLYLDTTYCSPEYTFPSQQEVIQFAVNT  814

Query  1513  AIQAEAFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFF  1692
             A +    NPRTL + G+Y+IGKE++F+ IA  L  K  ++  K + LQCL    E     
Sbjct  815   AFETVTLNPRTLVVCGTYSIGKEKVFLAIAEVLGSKASMSRDKYKTLQCL----ESAAVS  870

Query  1693  TLNELE---SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKK----  1851
             +L  ++   + +HV+P+  + NFK L    N++   +  ++A  PTGW+           
Sbjct  871   SLISVDWDGTLLHVLPMMQI-NFKGLQDHLNKFSENFDQVLAFRPTGWTYSDSCLSLVDI  929

Query  1852  TPGKRWQQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              P KR   G I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  930   KPQKR---GKITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  970


 Score =   110 bits (275),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 74/118 (63%), Gaps = 2/118 (2%)
 Frame = +3

Query  1011  AKSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYC  1187
              + T+ K  P++  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT++F    IYC
Sbjct  645   GEGTRNKHCPLYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYCGLTKNFMF-PIYC  703

Query  1188  SSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             + +T  LV  K+ +  + I +LP++    + GI V   DANHCPGA +ILF   +G +
Sbjct  704   NKITGNLVKSKLRVKEEYIHVLPMDTECIVNGIKVLLLDANHCPGATMILFSLPSGTV  761



>ref|XP_006183557.1| PREDICTED: DNA cross-link repair 1A protein [Camelus ferus]
 ref|XP_010968136.1| PREDICTED: DNA cross-link repair 1A protein [Camelus bactrianus]
Length=1053

 Score =   160 bits (405),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 125/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       ++HTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  823   ILHTGDFR-ADPTMERSLLADHRVHTLYLDTTYCSPEYTFPSQQEVIQFAINTAFETVTL  881

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P+ +    T +   S
Sbjct  882   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSKEKYKTLQCLNIPEMN-SLITTDMCNS  940

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L        G+Y+ ++A  PTGW+             Q +G I  
Sbjct  941   LVHLLPMMQI-NFKGLQNHLKTCGGKYNQVLAFRPTGWTHSNKLTSVADVIPQTKGNISI  999

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  1000  YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1030


 Score =   107 bits (267),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 68/107 (64%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLRRD-CSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y   + C+ +FLTHFH+DHY GL+++F    +YCS +T  LV 
Sbjct  715   PFYKKIPGTGFTVDAFQYGHVEGCTAYFLTHFHSDHYAGLSKNFTF-PVYCSEITGNLVK  773

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I  LP++    + G+ +   DANHCPGA+++LF   NG
Sbjct  774   SKLRVQEQYIHPLPIDTECIVNGVKIVLLDANHCPGAVMVLFRLPNG  820



>ref|XP_006652237.1| PREDICTED: LOW QUALITY PROTEIN: DNA cross-link repair protein 
SNM1-like [Oryza brachyantha]
Length=471

 Score =   155 bits (391),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 127/213 (60%), Gaps = 9/213 (4%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAE-AFN  1536
             LHTGDFR    M   P  Q  +I+ L LDTTYC+P+Y FP ++ VI FV+   Q      
Sbjct  238   LHTGDFRASKSMQLHPLLQIGRINLLYLDTTYCSPKYKFPPKEDVIDFVVRTAQRYLQKE  297

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             P+TL ++G+Y+IGKE +++ I++AL   IY   ++ RIL   G+ D   +  + N+  S 
Sbjct  298   PKTLIVVGAYSIGKENVYLAISKALEVPIYTDPSRRRILHSFGWSDLSKRICSCNQ-SSL  356

Query  1717  IHVVPLWTL--ANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTI  1884
             +HV+PL ++   N KR  +  NQ   R+  ++A  PTGWS  +  GK+    K    G +
Sbjct  357   LHVLPLSSVRHENLKRYLETLNQ---RFVAVLAFRPTGWSFSESTGKQLDLIKPSSSGRV  413

Query  1885  IRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
               Y VPYSEHSSF+EL+ FV F+ P  +IP+VN
Sbjct  414   TIYGVPYSEHSSFTELRDFVMFLRPEKVIPTVN  446


 Score =   112 bits (281),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLRRDCSH-WFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGTPF VDAF+Y   + SH +FL+HFH DHY GLT+ +CHG IYC+ +TA+LV 
Sbjct  128   PFYKKIPGTPFTVDAFRYGVVEGSHAYFLSHFHHDHYGGLTKKWCHGPIYCTVITARLVK  187

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             M + +  + I  L L++   I G+ VT  +ANHCPGA +I F   +G
Sbjct  188   MCLSVNSEYICPLELDKEYVIEGVAVTLLEANHCPGAALIHFRLGDG  234



>ref|XP_006044045.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Bubalus 
bubalis]
Length=1050

 Score =   164 bits (414),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 129/221 (58%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  820   ILHTGDFR-ADPSMERSLLGCHKVHTLYLDTTYCSPEYSFPSQQEVIQFAINAAFETVTL  878

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ V+  K   LQC   P E   F T +   S
Sbjct  879   NPRALVVCGTYSIGKEKIFLAIADVLGSKVGVSKEKYNTLQCFNIP-EVSSFITTDMCNS  937

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  938   LVHLLPMMQI-NFKGLQNHLKKCGGKYNQILAFRPTGWTHSNKLTRLADIIPQTKGNISI  996

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN    +S R M
Sbjct  997   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTLKSRRTM  1037


 Score =   103 bits (258),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 65/102 (64%), Gaps = 2/102 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL+++F    IYCS +T  L+ 
Sbjct  712   PFYKKIPGTGFTVDAFQYGWVEGCTAYFLTHFHSDHYAGLSKNFTF-PIYCSKITGNLLK  770

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILF  1340
              K+ +    I  LP++    + GI V   DANHCPGA++ILF
Sbjct  771   SKLHVQEQYIHPLPIDTECIVNGIKVILLDANHCPGAVMILF  812



>ref|XP_010981522.1| PREDICTED: DNA cross-link repair 1A protein [Camelus dromedarius]
Length=1053

 Score =   160 bits (405),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 125/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       ++HTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  823   ILHTGDFR-ADPTMERSLLADHRVHTLYLDTTYCSPEYTFPSQQEVIQFAINTAFETVTL  881

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P+ +    T +   S
Sbjct  882   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSKEKYKTLQCLNIPEMN-SLITTDMCNS  940

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L        G+Y+ ++A  PTGW+             Q +G I  
Sbjct  941   LVHLLPMMQI-NFKGLQNHLKTCGGKYNQVLAFRPTGWTHSNKLTSVADVIPQTKGNISI  999

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  1000  YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1030


 Score =   107 bits (267),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 68/107 (64%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLRRD-CSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y   + C+ +FLTHFH+DHY GL+++F    +YCS +T  LV 
Sbjct  715   PFYKKIPGTGFTVDAFQYGHVEGCTAYFLTHFHSDHYAGLSKNFTF-PVYCSEITGNLVK  773

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I  LP++    + G+ +   DANHCPGA+++LF   NG
Sbjct  774   SKLRVQEQYIHPLPIDTECIVNGVKIVLLDANHCPGAVMVLFRLPNG  820



>ref|XP_008828437.1| PREDICTED: DNA cross-link repair 1A protein [Nannospalax galili]
Length=1050

 Score =   162 bits (409),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 125/214 (58%), Gaps = 11/214 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             VLHTGDFR  D  ME       KIHTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  820   VLHTGDFR-ADPSMERSLLAGRKIHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFETVTL  878

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  879   NPRALVVCGTYCIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EINSLITTDMSSS  937

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKG----KKKTPGKRWQQGT  1881
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+         + TP  +   G 
Sbjct  938   MVHLLPMMQI-NFKGLQSHLKKCDGKYDQILAFRPTGWTHSNNITSIAEVTPQTK---GK  993

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  994   ISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1027


 Score =   105 bits (263),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 71/118 (60%), Gaps = 2/118 (2%)
 Frame = +3

Query  1011  AKSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYC  1187
             AK  + +  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL+++F    +YC
Sbjct  703   AKEFRKRTCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYAGLSKNFTL-PVYC  761

Query  1188  SSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             S +T  L+  K+ +    I  LP++    + G+ V   DANHCPGA +ILF   NG +
Sbjct  762   SEITGSLLKNKLRVQEQYIHQLPMDTECVVDGVKVVLLDANHCPGAAMILFHLPNGAV  819



>ref|XP_004265868.1| PREDICTED: DNA cross-link repair 1A protein [Orcinus orca]
Length=1051

 Score =   161 bits (408),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 126/221 (57%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  821   ILHTGDFR-ADPTMERSLLAGQKVHTLYLDTTYCSPEYCFPSQQEVIQFAINTAFETVTL  879

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K   LQC   P E     T +   S
Sbjct  880   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSKEKYSTLQCFNIP-EINSLITTDMCNS  938

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+         G   Q +G I  
Sbjct  939   LVHLLPMMQI-NFKGLQNHLKKCGGKYDQILAFRPTGWTHSNKLTSMAGIIPQTKGNISI  997

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN     S R M
Sbjct  998   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTLRSRRTM  1038


 Score =   106 bits (264),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 68/199 (34%), Positives = 100/199 (50%), Gaps = 21/199 (11%)
 Frame = +3

Query  765   RKKIVHALSELRKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHAT  941
             RK+  H    L+K ++ +E   QK++      +   VKLSK     F  SA G       
Sbjct  639   RKRSQHQRKRLKKSDSLQEGVHQKSSGHRNKTEPGTVKLSK--DRVFVKSAHG-------  689

Query  942   SCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRD-CSHWF  1118
                       L   + K  + + A   + +  P +  IPGT F VDAF+Y   + C+ +F
Sbjct  690   ---------RLQRGNTKIPESSNAGELRKRTCPFYKKIPGTGFTVDAFRYGSVEGCTAYF  740

Query  1119  LTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTC  1298
             LTHFH+DHY GL+++F    +YCS +T  L+  K+ +    I  LP +    + G+ V  
Sbjct  741   LTHFHSDHYAGLSKNFTF-PVYCSEITGNLLKSKLHVQEQYIHPLPTDTECIVNGVKVVL  799

Query  1299  FDANHCPGAIIILFEPSNG  1355
              DANHCPGA++ILF   NG
Sbjct  800   LDANHCPGAVMILFYLPNG  818



>gb|EEE60929.1| hypothetical protein OsJ_14663 [Oryza sativa Japonica Group]
Length=517

 Score =   154 bits (388),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 129/224 (58%), Gaps = 11/224 (5%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEA----IQAE  1527
             LHTGDFR    M   P  Q  +I+ L LDTTYCNP+Y FP ++ VI F +      +Q E
Sbjct  252   LHTGDFRASKSMQLYPLLQRGQINLLYLDTTYCNPKYKFPPKEDVIDFAVRTAKRYLQKE  311

Query  1528  AFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNEL  1707
                P+TL ++G+Y+IGKE +++ I++AL   IY  A++ RIL   G+ D   +    +  
Sbjct  312   ---PKTLIVVGAYSIGKENVYLAISKALQVPIYTDASRRRILHAFGWSDLS-KMICSDSQ  367

Query  1708  ESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGT  1881
              S +HV+PL +L + + L +       R+  ++A  PTGW+  +  G +    K   +G 
Sbjct  368   SSSLHVLPLSSLRH-ENLQKYLETLKQRFLAVLAFRPTGWTFSEETGNQLDLIKPSSRGK  426

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             I  Y VPYSEHSSFSEL++FV F+ P  +IP+VN     S  KM
Sbjct  427   ITIYGVPYSEHSSFSELREFVMFLRPQKVIPTVNVGNAASRDKM  470


 Score =   113 bits (283),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGTPF VDAF+Y     C+ +FL+HFH DHY GLT+ +CHG IYC+++TA+LV 
Sbjct  142   PFYKKIPGTPFTVDAFRYGAVEGCNAYFLSHFHHDHYGGLTKKWCHGPIYCTALTARLVK  201

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             M + +  + I  L L++   I G+ VT  +ANHCPGA +I F   +G
Sbjct  202   MCLSVNPEYICPLELDKEYVIEGVSVTLLEANHCPGAALIHFRLGDG  248



>ref|XP_004579866.1| PREDICTED: DNA cross-link repair 1A protein [Ochotona princeps]
Length=1049

 Score =   162 bits (411),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 129/221 (58%), Gaps = 4/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P     K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  818   MLHTGDFRADPSMERSPLLAGQKVHTLYLDTTYCSPEYTFPSQQEVIQFAISTAFEAVTL  877

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  878   NPRVLVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLKSP-EINSLITTDMCSS  936

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +HV+P+  + NFK L     ++  +Y  I+A  PTGW+      +      Q +G I  
Sbjct  937   LVHVLPMMQI-NFKGLQNHLKKFGEKYDEILAFRPTGWTHSDKLTRITDVIPQIKGNISI  995

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN    +S R M
Sbjct  996   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTWKSRRTM  1036


 Score =   104 bits (260),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 68/114 (60%), Gaps = 2/114 (2%)
 Frame = +3

Query  1023  KYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVT  1199
             + K  P +  IPGT F VDAF+Y     CS +FLTHFH+DHY GL+++     +YCS +T
Sbjct  705   RKKKCPFYKKIPGTTFTVDAFQYGTVEGCSAYFLTHFHSDHYAGLSKNSTF-PVYCSEIT  763

Query  1200  AKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
               L+  K+ +    I  LP++    + G+ V   DANHCPGA +ILF   NG +
Sbjct  764   GNLLKNKLHVQEHYIHTLPMDTECVVNGVKVVLLDANHCPGATMILFHLPNGTV  817



>ref|XP_005293937.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Chrysemys 
picta bellii]
 ref|XP_005293938.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Chrysemys 
picta bellii]
Length=1060

 Score =   160 bits (404),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 128/211 (61%), Gaps = 4/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M + P     KIHTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  806   MLHTGDFRADPSMEQCPLLISRKIHTLYLDTTYCSPEYTFPSQQEVIQFAINTAFETVTL  865

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA+ L  K+ ++  K + LQCL     +    T++   +
Sbjct  866   NPRTLVVCGTYSIGKEKVFLAIAQVLGSKVSMSQDKYKTLQCLESAAVN-SLITMDWNNT  924

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L    N++  ++  ++A  PTGW+           + Q +G I  
Sbjct  925   LLHLLPMMQI-NFKGLQNHLNKFSEKFDQVLAFRPTGWTYSDSCHTLADIKPQTRGKITI  983

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  984   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1014


 Score =   107 bits (267),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 69/117 (59%), Gaps = 2/117 (2%)
 Frame = +3

Query  1014  KSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCS  1190
             + TK K  P +  IPGT F VDAF+Y     C  +FLTHFH+DHY GLT+  C   IYC+
Sbjct  690   EGTKNKKCPFYKKIPGTGFTVDAFQYGEIEGCVAYFLTHFHSDHYTGLTKK-CTFPIYCN  748

Query  1191  SVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
              +T  LV  K+ +    +  LP++    + GI V   DANHCPGA +ILF   NG +
Sbjct  749   KITGNLVKSKLRVQEQYVHTLPMDTECIVNGIKVVLLDANHCPGATMILFCLPNGTV  805



>ref|XP_003223488.1| PREDICTED: DNA cross-link repair 1A protein [Anolis carolinensis]
Length=967

 Score =   155 bits (391),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 89/218 (41%), Positives = 128/218 (59%), Gaps = 16/218 (7%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEA  1530
             A+LHTGDFR    M   P     KI+TL LDTTYC+P+Y FP Q  +IQF    A +   
Sbjct  733   AILHTGDFRAHPSMERYPFLIGRKINTLYLDTTYCSPEYTFPSQQEMIQFAANTAFEIVT  792

Query  1531  FNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE  1710
              NPRTL + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL    E     TL+   
Sbjct  793   LNPRTLVVCGTYSIGKEKVFLAIANVLGSKVSMSQEKYKTLQCLE-STEINSLITLDWNN  851

Query  1711  SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGKRW  1869
             + +H++P+  + NFK L    +++  ++  I+A  PTGW       SL   + +T     
Sbjct  852   TLLHLLPMMQI-NFKGLQNHLSKFSAKFDQILAFKPTGWTYSDQCYSLNDIQPQT-----  905

Query  1870  QQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              +G I  Y +PYSEHSSF E+K+FV+++ P  IIP+VN
Sbjct  906   -RGNITIYGIPYSEHSSFVEMKRFVQWLKPQKIIPTVN  942


 Score =   112 bits (279),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 70/115 (61%), Gaps = 2/115 (2%)
 Frame = +3

Query  1014  KSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCS  1190
             + T+ K  P +  IPGT F VDAF+Y     C  +FLTHFH+DHY GLT+ F    IYC+
Sbjct  618   EGTRKKQCPFYKKIPGTSFVVDAFQYGEIEGCKGYFLTHFHSDHYGGLTKKFTF-PIYCN  676

Query  1191  SVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              +T  LV  K+ +  + I ILP+N    I GI V   DANHCPGA +ILF   NG
Sbjct  677   KITGNLVKSKLRVLEEYIHILPMNTECIIDGIKVVLLDANHCPGAAMILFAFPNG  731



>ref|XP_003624539.1| DNA cross-link repair protein SNM1 [Medicago truncatula]
 gb|ABD33168.1| DNA repair metallo-beta-lactamase [Medicago truncatula]
 gb|AES80757.1| DNA cross-link repair protein [Medicago truncatula]
Length=511

 Score =   159 bits (403),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 132/227 (58%), Gaps = 5/227 (2%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAEAFN-  1536
             LHTGDFR C  M +   F   +++ L LDTTYCNP+Y FP +D V+ +V++         
Sbjct  283   LHTGDFRACKLMQDYHLFVNKRVNVLYLDTTYCNPKYKFPSKDDVLNYVVKITNNHLKKY  342

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             PRTL ++G+Y+IGKE +++ I++AL  KI+V A++ RIL     PD   +  T N   + 
Sbjct  343   PRTLVVVGAYSIGKECVYLAISKALGVKIHVNASRRRILLAYDCPDYSDRLCT-NGNNTL  401

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGTIIR  1890
             +HV+P+ +L   + L +    Y  +++ ++A  PTGW+  +  G      K    G I  
Sbjct  402   LHVLPMSSL-RIETLKEYLKTYKEQFTSVLAFRPTGWTFSEKIGNDLALIKPVSNGNITT  460

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD  2031
             Y VPYSEHSSF+EL+ FV+F+ P  IIP+VN     +  KM S   D
Sbjct  461   YGVPYSEHSSFTELRDFVQFLRPDKIIPTVNVGNAANREKMQSYFRD  507


 Score =   107 bits (267),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 68/107 (64%), Gaps = 1/107 (1%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  +PGT F VDAF+Y    +CS +FL+HFHADHY GL++ + HG IYCS +T +LV 
Sbjct  173   PFYKKMPGTNFTVDAFRYGCVEECSAYFLSHFHADHYGGLSKKWSHGPIYCSPLTGRLVQ  232

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             M + +    I  L  +    I GI VT  DANHCPGA +I FE  NG
Sbjct  233   MCLYVNPSYICPLEFDTEYVIDGIKVTLIDANHCPGAALIHFELPNG  279



>ref|NP_001099671.1| DNA cross-link repair 1A protein [Rattus norvegicus]
 ref|XP_006231696.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Rattus 
norvegicus]
 ref|XP_006231697.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Rattus 
norvegicus]
 gb|EDL94499.1| DNA cross-link repair 1A, PSO2 homolog (S. cerevisiae) (predicted) 
[Rattus norvegicus]
Length=1026

 Score =   160 bits (405),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 123/214 (57%), Gaps = 11/214 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
              LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q   IQF I  A +A   
Sbjct  796   TLHTGDFR-ADPSMERSLLASRKVHTLFLDTTYCSPEYTFPSQQEAIQFAINTAFEAVTL  854

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  855   NPRALIVCGTYCIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EVSSLITTDMCNS  913

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKG----KKKTPGKRWQQGT  1881
              +H++P+  + NFK L     +  G++  I+A  PTGW+           TP     +G 
Sbjct  914   LVHLLPMMQI-NFKGLQNHLKKCGGKFDQILAFRPTGWTHSNNITSIADITP---QTKGN  969

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  970   IAIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1003


 Score =   106 bits (265),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 67/109 (61%), Gaps = 2/109 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL++ F    IYCS +T  L+ 
Sbjct  688   PFYKRIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYAGLSKDFTR-PIYCSEITGSLLK  746

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
              K+ +    I  LP++    + G+ V   DANHCPGA +ILF+  NG +
Sbjct  747   KKLRVQEQYIHQLPMDTECIVDGVKVVLLDANHCPGATMILFQLPNGAV  795



>ref|NP_001052690.1| Os04g0401800 [Oryza sativa Japonica Group]
 emb|CAD40784.2| OSJNBb0012E08.8 [Oryza sativa Japonica Group]
 dbj|BAF14604.1| Os04g0401800 [Oryza sativa Japonica Group]
 emb|CAH66404.1| OSIGBa0155K12.7 [Oryza sativa Indica Group]
Length=481

 Score =   154 bits (388),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 89/224 (40%), Positives = 129/224 (58%), Gaps = 11/224 (5%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEA----IQAE  1527
             LHTGDFR    M   P  Q  +I+ L LDTTYCNP+Y FP ++ VI F +      +Q E
Sbjct  252   LHTGDFRASKSMQLYPLLQRGQINLLYLDTTYCNPKYKFPPKEDVIDFAVRTAKRYLQKE  311

Query  1528  AFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNEL  1707
                P+TL ++G+Y+IGKE +++ I++AL   IY  A++ RIL   G+ D   +    +  
Sbjct  312   ---PKTLIVVGAYSIGKENVYLAISKALQVPIYTDASRRRILHAFGWSDLS-KMICSDSQ  367

Query  1708  ESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGT  1881
              S +HV+PL +L + + L +       R+  ++A  PTGW+  +  G +    K   +G 
Sbjct  368   SSSLHVLPLSSLRH-ENLQKYLETLKQRFLAVLAFRPTGWTFSEETGNQLDLIKPSSRGK  426

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             I  Y VPYSEHSSFSEL++FV F+ P  +IP+VN     S  KM
Sbjct  427   ITIYGVPYSEHSSFSELREFVMFLRPQKVIPTVNVGNAASRDKM  470


 Score =   113 bits (282),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGTPF VDAF+Y     C+ +FL+HFH DHY GLT+ +CHG IYC+++TA+LV 
Sbjct  142   PFYKKIPGTPFTVDAFRYGAVEGCNAYFLSHFHHDHYGGLTKKWCHGPIYCTALTARLVK  201

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             M + +  + I  L L++   I G+ VT  +ANHCPGA +I F   +G
Sbjct  202   MCLSVNPEYICPLELDKEYVIEGVSVTLLEANHCPGAALIHFRLGDG  248



>ref|XP_005048822.1| PREDICTED: DNA cross-link repair 1A protein [Ficedula albicollis]
Length=974

 Score =   160 bits (405),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 128/217 (59%), Gaps = 16/217 (7%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P+    ++HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  741   ILHTGDFRADPSMERYPALMGQQVHTLYLDTTYCSPEYTFPAQQEVIQFAVNIAFETVTL  800

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K  V+  K + LQCL     +    +++   +
Sbjct  801   NPRTLVVCGTYSIGKEKVFLAIAEVLGSKASVSREKYKTLQCLESAAVN-SLISVDWKGT  859

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGKRWQ  1872
              +HV+P+  + NFKRL    N++   +  I+A  PTGW       SL   K +T GK   
Sbjct  860   LLHVLPMMQI-NFKRLQDHLNKFSENFDQILAFKPTGWTYSDSCLSLEDIKPQTRGK---  915

Query  1873  QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
                I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  916   ---ITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  949


 Score =   106 bits (265),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = +3

Query  1023  KYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVT  1199
             + K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT++F    IYC+ VT
Sbjct  628   RKKHCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYCGLTKNF-RFPIYCNKVT  686

Query  1200  AKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
               LV  K+ +    + +LP++ +  + GI V   DANHCPGA +ILF   +G +
Sbjct  687   GNLVKSKLRVQEQFVHVLPMDTQCVVNGIKVMLLDANHCPGATMILFYLPSGAV  740



>gb|AAH97815.1| LOC733261 protein [Xenopus laevis]
Length=526

 Score =   157 bits (396),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 85/218 (39%), Positives = 130/218 (60%), Gaps = 6/218 (3%)
 Frame = +1

Query  1339  LNHPMAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-A  1515
             L +  +VLHTGDFR    M   P+    ++HTL LDTTYC+P+Y FP Q   IQF +  A
Sbjct  287   LPNGTSVLHTGDFRADRSMESYPALIGQRVHTLYLDTTYCSPEYTFPPQQETIQFAVNIA  346

Query  1516  IQAEAFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFT  1695
              +     P TL + G+Y++GKE++F+ IA  L  K+ ++  K + +QCL    ED++   
Sbjct  347   FEMVTLYPCTLVVCGTYSVGKEKVFLAIADVLGCKVCMSQDKYKTMQCL--ESEDIRSLV  404

Query  1696  LNELES-HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ  1872
               +  S  +HV+P+  + NFK LN    ++ G+Y  ++A  PTGW+           + +
Sbjct  405   TTDWHSTALHVLPMMQV-NFKGLNVHLGKFPGKYDRVLAFKPTGWTYSDSSVLVADIKPE  463

Query  1873  -QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              +G +  Y +PYSEHSS+SELK+FV+++ P  IIP+VN
Sbjct  464   IRGKVTVYGIPYSEHSSYSELKRFVQWLKPQKIIPTVN  501


 Score =   109 bits (273),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 69/110 (63%), Gaps = 2/110 (2%)
 Frame = +3

Query  1029  KDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
             K  P +  IPGT F VDAF+Y +   CS +FLTHFH+DHY GLT+ F    IYCS +T  
Sbjct  182   KQCPFYKKIPGTGFAVDAFQYGQIEGCSAYFLTHFHSDHYGGLTKKF-RFPIYCSKITGN  240

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             LV  K+ +  + I  LP+N    + GI V   +ANHCPGA+++LF   NG
Sbjct  241   LVQNKLRVESEFINTLPMNTECVVNGIRVVLLEANHCPGAVLLLFRLPNG  290



>ref|XP_005416424.1| PREDICTED: DNA cross-link repair 1A protein [Geospiza fortis]
Length=968

 Score =   159 bits (402),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 128/220 (58%), Gaps = 22/220 (10%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P+    K+HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  735   ILHTGDFRADPSMERYPALMGQKVHTLYLDTTYCSPEYTFPAQQEVIQFAVNIAFETVTL  794

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE-  1710
             NPRTL + G+Y+IGKE++F+ IA  L  K  V+  K + LQCL    E     +L  ++ 
Sbjct  795   NPRTLVVCGTYSIGKEKVFLAIAEVLGSKASVSRDKYKTLQCL----ESAAVNSLISVDW  850

Query  1711  --SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGK  1863
               + +HV+P+  + NFK L    N++   +  I+A  PTGW       SL   K +T GK
Sbjct  851   KGTLLHVLPMMQI-NFKGLQDHLNKFSENFDQILAFKPTGWTYSDSCLSLEDIKPQTRGK  909

Query  1864  RWQQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
                   I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  910   ------ITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  943


 Score =   107 bits (267),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = +3

Query  1029  KDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
             K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT++F    IYC+ +T  
Sbjct  624   KHCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYSGLTKNF-RFPIYCNKITGN  682

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             LV  K+ +    + +LP++    ++GI V   DANHCPGA +ILF   +G +
Sbjct  683   LVKSKLRVQEQYVHVLPMDTPCVVSGIKVLLLDANHCPGAAMILFYLPSGAV  734



>ref|XP_006978498.1| PREDICTED: DNA cross-link repair 1A protein [Peromyscus maniculatus 
bairdii]
Length=1022

 Score =   160 bits (406),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/214 (43%), Positives = 125/214 (58%), Gaps = 11/214 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAI-QAEAF  1533
             VLHTGDFR  D  ME       ++HTL LDTTYC+P+Y FP Q  VIQF I A  +A   
Sbjct  792   VLHTGDFR-ADPSMERSLLACHQVHTLYLDTTYCSPEYTFPSQQDVIQFAINAAFEAVTL  850

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y IGKE++F+ IA  L  K+ ++  K + LQC   P E     T +   +
Sbjct  851   NPRALIVCGTYCIGKEKVFLAIADVLGSKVGMSQEKYKTLQCFNIP-EVSSLITTDMCST  909

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW----SLGKGKKKTPGKRWQQGT  1881
              +H++P+  + NFK L     +  G+Y  IVA  PTGW    S+      TP     +G 
Sbjct  910   LVHLLPMMQI-NFKGLQNHLKKCGGKYDQIVAFRPTGWTHSNSITSIADITP---QTKGN  965

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             I  Y +PYSEHSSF E+K+FV+++ P  IIP+VN
Sbjct  966   ISIYGIPYSEHSSFLEMKRFVQWLKPQKIIPTVN  999


 Score =   105 bits (262),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 2/109 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL++ F    IYCS +T  L+ 
Sbjct  684   PFYKRIPGTGFTVDAFQYGEVAGCTAYFLTHFHSDHYAGLSKDFTL-PIYCSEITGNLLK  742

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
              K+ +    +  LP++    + G+ V   DANHCPGA+++LF   NG +
Sbjct  743   KKLRVQEQYVHQLPMDTECTVDGVKVVLLDANHCPGAVMVLFRLPNGAV  791



>dbj|BAK63673.1| DNA cross-link repair 1A protein [Pan troglodytes]
Length=576

 Score =   158 bits (399),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 125/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VI+F I  A +A   
Sbjct  346   ILHTGDFR-ADPSMERSLLADQKVHMLYLDTTYCSPEYTFPSQQEVIRFAINTAFEAVTL  404

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP  L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  405   NPHALVVCGTYSIGKEKVFLAIADVLGSKVGMSREKYKTLQCLNIP-EINSLITTDMCSS  463

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  464   LVHLLPMMQI-NFKGLQSHLKKCGGKYNQILAFRPTGWTHSNKFTRIADVIPQTKGNISI  522

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  523   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  553


 Score =   108 bits (269),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 98/190 (52%), Gaps = 21/190 (11%)
 Frame = +3

Query  798   RKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSL  974
             RK N+ +E   QK +   +  ++  V LSK+    F  SA G         G     + +
Sbjct  175   RKSNSLQEGACQKRSDHLINTESEAVNLSKV--KVFTKSAHG---------GLQRGNKKI  223

Query  975   MYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQG  1151
               SSN          ++ K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY G
Sbjct  224   PESSN-------VGGSRKKTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSDHYAG  276

Query  1152  LTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAII  1331
             L++ F    +YCS +T  L+  K+ +    I  LPL+    + G+ V   DANHCPGA++
Sbjct  277   LSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHPLPLDTECIVNGVKVVLLDANHCPGAVM  335

Query  1332  ILFEPSNGCL  1361
             ILF   NG +
Sbjct  336   ILFYLPNGTV  345



>ref|NP_055696.3| DNA cross-link repair 1A protein [Homo sapiens]
 ref|NP_001258745.1| DNA cross-link repair 1A protein [Homo sapiens]
 ref|XP_006718153.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Homo 
sapiens]
 sp|Q6PJP8.3|DCR1A_HUMAN RecName: Full=DNA cross-link repair 1A protein; AltName: Full=SNM1 
homolog A; Short=hSNM1; Short=hSNM1A [Homo sapiens]
 gb|AAH13124.1| DNA cross-link repair 1A (PSO2 homolog, S. cerevisiae) [Homo 
sapiens]
 dbj|BAG09599.1| DNA cross-link repair 1A protein [synthetic construct]
 gb|AIC50463.1| DCLRE1A, partial [synthetic construct]
Length=1040

 Score =   157 bits (397),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 125/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VI+F I  A +A   
Sbjct  810   ILHTGDFR-ADPSMERSLLADQKVHMLYLDTTYCSPEYTFPSQQEVIRFAINTAFEAVTL  868

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP  L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  869   NPHALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EINSLITTDMCSS  927

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  928   LVHLLPMMQI-NFKGLQSHLKKCGGKYNQILAFRPTGWTHSNKFTRIADVIPQTKGNISI  986

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  987   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1017


 Score =   108 bits (271),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 98/190 (52%), Gaps = 21/190 (11%)
 Frame = +3

Query  798   RKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSL  974
             RK N+ +E   QK +   +  ++  V LSK+    F  SA G         G     + +
Sbjct  639   RKSNSLQEGACQKRSDHLINTESEAVNLSKV--KVFTKSAHG---------GLQRGNKKI  687

Query  975   MYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQG  1151
               SSN          ++ K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY G
Sbjct  688   PESSN-------VGGSRKKTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSDHYAG  740

Query  1152  LTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAII  1331
             L++ F    +YCS +T  L+  K+ +    I  LPL+    + G+ V   DANHCPGA++
Sbjct  741   LSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHPLPLDTECIVNGVKVVLLDANHCPGAVM  799

Query  1332  ILFEPSNGCL  1361
             ILF   NG +
Sbjct  800   ILFYLPNGTV  809



>ref|XP_002321063.2| hypothetical protein POPTR_0014s13570g [Populus trichocarpa]
 gb|EEE99378.2| hypothetical protein POPTR_0014s13570g [Populus trichocarpa]
Length=477

 Score =   167 bits (422),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 138/226 (61%), Gaps = 5/226 (2%)
 Frame = +1

Query  1351  MAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAE-  1527
             +  LHTGDFR    M   P     +++ L LDTTYCNP+Y FP ++ V+ +V+   ++  
Sbjct  246   LCYLHTGDFRASKLMQAHPLLANNRVNVLYLDTTYCNPKYKFPSKEDVLSYVVRVTKSSL  305

Query  1528  AFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNEL  1707
                P+TL ++G+Y+IGKE +++ I++AL  KIY   ++ RILQ  G+PD      T   +
Sbjct  306   KKQPKTLVVVGAYSIGKESVYLAISKALGVKIYANNSRRRILQSFGWPDLSTNLCT-KAI  364

Query  1708  ESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW--SLGKGKKKTPGKRWQQGT  1881
             ++ +HV+P+ +L  ++ L      ++ +Y+ ++A  PTGW  S G G++    +   +G 
Sbjct  365   DTCLHVLPISSL-RYETLKDYLKNHVNQYAAVLAFRPTGWTYSEGLGRELDLIRPSTRGN  423

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLS  2019
             I  Y VPYSEHSSF+EL+ FV+F+ P  IIP+VN   P++  KM S
Sbjct  424   ITIYGVPYSEHSSFTELRDFVEFLKPDKIIPTVNVGNPDNRDKMQS  469


 Score = 99.4 bits (246),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 73/126 (58%), Gaps = 2/126 (2%)
 Frame = +3

Query  981   SSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLT  1157
             S  K+   +P K  + +  P +  IP T F VDAF+Y     CS +FLTHFH DHY GLT
Sbjct  121   SQGKAASSSP-KHNRPRACPFYKRIPDTGFSVDAFRYGPIPGCSAYFLTHFHYDHYGGLT  179

Query  1158  RSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIIL  1337
             + + HG IYC+ +TA+L+ + + +    I  L L+    I G+ VT  +ANHCPGA ++ 
Sbjct  180   KGWSHGPIYCTPLTARLLTICLSLNSLYIHPLELDTEYVIQGVKVTLLEANHCPGAALLH  239

Query  1338  FEPSNG  1355
             F    G
Sbjct  240   FRLPTG  245



>ref|XP_010407076.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Corvus 
cornix cornix]
Length=971

 Score =   160 bits (404),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 128/217 (59%), Gaps = 16/217 (7%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P+    ++HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  738   ILHTGDFRADPSMERYPALMAQQVHTLYLDTTYCSPEYTFPSQQEVIQFAVNIAFETVTL  797

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K  ++  K + LQCL  P  +    +++   +
Sbjct  798   NPRTLVVCGTYSIGKEKVFLAIAEVLGSKASMSRDKYKTLQCLESPTVN-SLISVDWKGT  856

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGKRWQ  1872
              +HV+P+  + NFK L    N++   +  ++A  PTGW       SL   K +T GK   
Sbjct  857   LLHVLPMMQI-NFKGLQDHLNKFSENFDQVLAFKPTGWTYSDSCLSLEDIKPQTRGK---  912

Query  1873  QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
                I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  913   ---ITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  946


 Score =   106 bits (264),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 70/114 (61%), Gaps = 2/114 (2%)
 Frame = +3

Query  1023  KYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVT  1199
             + K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DH+ GLT++F    IYC+ +T
Sbjct  625   RKKQCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHFCGLTKNF-RFPIYCNKIT  683

Query  1200  AKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
               LV  K+ +    + +LP+N    + GI V   DANHCPGA +ILF   +G +
Sbjct  684   GNLVKSKLRVQEQYVHVLPMNTECVVNGIKVLLLDANHCPGATMILFYLPSGTV  737



>ref|XP_010824273.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Bos taurus]
 ref|XP_010818357.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Bos taurus]
Length=1056

 Score =   162 bits (410),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 128/221 (58%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  826   ILHTGDFR-ADPSMERSLLGCHKVHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFETVTL  884

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K   LQC   P E   F T +   S
Sbjct  885   NPRALVVCGTYSIGKEKIFLAIADVLGSKVGMSKEKYNTLQCFNIP-EVSSFITTDMCNS  943

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+             Q +G I  
Sbjct  944   LVHLLPMMQI-NFKGLQNHLKKCGGKYNQILAFRPTGWTHSNKLTSLADIIPQTKGNISI  1002

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN    +S R M
Sbjct  1003  YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGSLKSRRTM  1043


 Score =   103 bits (258),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL+++F    IYCS +T  L+ 
Sbjct  718   PFYKKIPGTGFTVDAFQYGWVEGCTAYFLTHFHSDHYAGLSKNFTF-PIYCSKITGNLLK  776

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I  LP +    + GI V   DANHCPGA++ILF   NG
Sbjct  777   SKLHVQEQYIHPLPTDTECIVNGIKVILLDANHCPGAVMILFCLPNG  823



>ref|NP_001008683.1| DNA cross-link repair 1A protein [Gallus gallus]
 sp|Q5QJC4.1|DCR1A_CHICK RecName: Full=DNA cross-link repair 1A protein; AltName: Full=SNM1 
homolog A; Short=chSNM1A [Gallus gallus]
 gb|AAR27404.1| SNM1A [Gallus gallus]
Length=972

 Score =   160 bits (405),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 87/212 (41%), Positives = 126/212 (59%), Gaps = 4/212 (2%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEA  1530
             A+LHTGDFR    M   P+    KIHTL LDTTYC+P+Y FP Q  VIQF +  A +   
Sbjct  738   AILHTGDFRADPSMERYPALIGQKIHTLYLDTTYCSPEYTFPSQQEVIQFAVNTAFEMVT  797

Query  1531  FNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE  1710
              NPRTL + G+Y+IGKE++F+ IA  L  K  ++  K + LQCL     +    T+N   
Sbjct  798   LNPRTLVVCGTYSIGKEKVFLAIAEVLGSKASMSRDKYKTLQCLESAAVN-SLITMNWDG  856

Query  1711  SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTII  1887
             + +H++P+  + NFK L    N++   +  ++A  PTGW+           + Q +G I 
Sbjct  857   TLLHILPMMQI-NFKGLQDHLNKFSENFDQVLAFKPTGWTYSDSCLSVMDIKPQTRGNIT  915

Query  1888  RYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  916   IYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  947


 Score =   105 bits (263),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 67/107 (63%), Gaps = 2/107 (2%)
 Frame = +3

Query  1023  KYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVT  1199
             + K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT++F    +YC+ +T
Sbjct  626   RKKQCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYCGLTKNFVF-PLYCNKIT  684

Query  1200  AKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILF  1340
               LV  K+ +    I +LP++    + GI V   DANHCPGA +ILF
Sbjct  685   GNLVKSKLRVKEQYINVLPMDTECIVNGIKVLLLDANHCPGATMILF  731



>gb|AAT09762.1| DNA cross-link repair 1A (PSO2 homolog, S. cerevisiae) [Homo 
sapiens]
 gb|EAW49489.1| DNA cross-link repair 1A (PSO2 homolog, S. cerevisiae), isoform 
CRA_a [Homo sapiens]
 gb|EAW49490.1| DNA cross-link repair 1A (PSO2 homolog, S. cerevisiae), isoform 
CRA_a [Homo sapiens]
Length=1040

 Score =   157 bits (397),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 125/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VI+F I  A +A   
Sbjct  810   ILHTGDFR-ADPSMERSLLADQKVHMLYLDTTYCSPEYTFPSQQEVIRFAINTAFEAVTL  868

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP  L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  869   NPHALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EINSLITTDMCSS  927

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  928   LVHLLPMMQI-NFKGLQSHLKKCGGKYNQILAFRPTGWTHSNKFTRIADVIPQTKGNISI  986

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  987   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1017


 Score =   108 bits (271),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 98/190 (52%), Gaps = 21/190 (11%)
 Frame = +3

Query  798   RKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSL  974
             RK N+ +E   QK +   +  ++  V LSK+    F  SA G         G     + +
Sbjct  639   RKSNSLQEGACQKRSDHLINTESEAVNLSKV--KVFTKSAHG---------GLQRGNKKI  687

Query  975   MYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQG  1151
               SSN          ++ K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY G
Sbjct  688   PESSN-------VGGSRKKTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSDHYAG  740

Query  1152  LTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAII  1331
             L++ F    +YCS +T  L+  K+ +    I  LPL+    + G+ V   DANHCPGA++
Sbjct  741   LSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHPLPLDTECIVNGVKVVLLDANHCPGAVM  799

Query  1332  ILFEPSNGCL  1361
             ILF   NG +
Sbjct  800   ILFYLPNGTV  809



>dbj|BAA07646.2| KIAA0086 [Homo sapiens]
Length=1044

 Score =   157 bits (397),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 125/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VI+F I  A +A   
Sbjct  814   ILHTGDFR-ADPSMERSLLADQKVHMLYLDTTYCSPEYTFPSQQEVIRFAINTAFEAVTL  872

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP  L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  873   NPHALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EINSLITTDMCSS  931

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  932   LVHLLPMMQI-NFKGLQSHLKKCGGKYNQILAFRPTGWTHSNKFTRIADVIPQTKGNISI  990

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  991   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1021


 Score =   108 bits (270),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 98/190 (52%), Gaps = 21/190 (11%)
 Frame = +3

Query  798   RKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSL  974
             RK N+ +E   QK +   +  ++  V LSK+    F  SA G         G     + +
Sbjct  643   RKSNSLQEGACQKRSDHLINTESEAVNLSKV--KVFTKSAHG---------GLQRGNKKI  691

Query  975   MYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQG  1151
               SSN          ++ K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY G
Sbjct  692   PESSN-------VGGSRKKTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSDHYAG  744

Query  1152  LTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAII  1331
             L++ F    +YCS +T  L+  K+ +    I  LPL+    + G+ V   DANHCPGA++
Sbjct  745   LSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHPLPLDTECIVNGVKVVLLDANHCPGAVM  803

Query  1332  ILFEPSNGCL  1361
             ILF   NG +
Sbjct  804   ILFYLPNGTV  813



>gb|AAH62582.1| DNA cross-link repair 1A (PSO2 homolog, S. cerevisiae) [Homo 
sapiens]
Length=1040

 Score =   157 bits (397),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 125/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VI+F I  A +A   
Sbjct  810   ILHTGDFR-ADPSMERSLLADQKVHMLYLDTTYCSPEYTFPSQQEVIRFAINTAFEAVTL  868

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP  L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  869   NPHALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EINSLITTDMCSS  927

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  928   LVHLLPMMQI-NFKGLQSHLKKCGGKYNQILAFRPTGWTHSNKFTRIADVIPQTKGNISI  986

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  987   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1017


 Score =   108 bits (270),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 98/190 (52%), Gaps = 21/190 (11%)
 Frame = +3

Query  798   RKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSL  974
             RK N+ +E   QK +   +  ++  V LSK+    F  SA G         G     + +
Sbjct  639   RKSNSLQEGACQKRSDHLINTESEAVNLSKV--KVFTKSAHG---------GLQRGNKKI  687

Query  975   MYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQG  1151
               SSN          ++ K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY G
Sbjct  688   PESSN-------VGGSRKKTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSDHYAG  740

Query  1152  LTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAII  1331
             L++ F    +YCS +T  L+  K+ +    I  LPL+    + G+ V   DANHCPGA++
Sbjct  741   LSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHPLPLDTECIVNGVKVVLLDANHCPGAVM  799

Query  1332  ILFEPSNGCL  1361
             ILF   NG +
Sbjct  800   ILFYLPNGTV  809



>ref|XP_010857605.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Bison 
bison bison]
 ref|XP_010857606.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Bison 
bison bison]
Length=1056

 Score =   162 bits (411),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 128/221 (58%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  826   ILHTGDFR-ADPSMERSLLGCHKVHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFETVTL  884

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K   LQC   P E   F T +   S
Sbjct  885   NPRALVVCGTYSIGKEKIFLAIADVLGSKVGMSKEKYNTLQCFNIP-EVSSFITTDMCNS  943

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+             Q +G I  
Sbjct  944   LVHLLPMMQI-NFKGLQNHLKKCGGKYNQILAFRPTGWTHSNKLTSLADIIPQTKGNISI  1002

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN    +S R M
Sbjct  1003  YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGSLKSRRTM  1043


 Score =   103 bits (257),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL+++F    IYCS +T  L+ 
Sbjct  718   PFYKKIPGTGFTVDAFQYGWVEGCTAYFLTHFHSDHYAGLSKNFTF-PIYCSKITGNLLK  776

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I  LP +    + GI V   DANHCPGA++ILF   NG
Sbjct  777   SKLHVQEQYIHPLPTDTECIVNGIKVILLDANHCPGAVMILFCLPNG  823



>ref|XP_010824274.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Bos taurus]
 ref|XP_010818358.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Bos taurus]
 tpg|DAA14742.1| TPA: Snm1-like [Bos taurus]
Length=1051

 Score =   162 bits (410),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 128/221 (58%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  821   ILHTGDFR-ADPSMERSLLGCHKVHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFETVTL  879

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K   LQC   P E   F T +   S
Sbjct  880   NPRALVVCGTYSIGKEKIFLAIADVLGSKVGMSKEKYNTLQCFNIP-EVSSFITTDMCNS  938

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+             Q +G I  
Sbjct  939   LVHLLPMMQI-NFKGLQNHLKKCGGKYNQILAFRPTGWTHSNKLTSLADIIPQTKGNISI  997

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN    +S R M
Sbjct  998   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGSLKSRRTM  1038


 Score =   103 bits (258),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL+++F    IYCS +T  L+ 
Sbjct  713   PFYKKIPGTGFTVDAFQYGWVEGCTAYFLTHFHSDHYAGLSKNFTF-PIYCSKITGNLLK  771

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I  LP +    + GI V   DANHCPGA++ILF   NG
Sbjct  772   SKLHVQEQYIHPLPTDTECIVNGIKVILLDANHCPGAVMILFCLPNG  818



>ref|XP_010407085.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Corvus 
cornix cornix]
Length=866

 Score =   159 bits (403),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 128/217 (59%), Gaps = 16/217 (7%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P+    ++HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  633   ILHTGDFRADPSMERYPALMAQQVHTLYLDTTYCSPEYTFPSQQEVIQFAVNIAFETVTL  692

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K  ++  K + LQCL  P  +    +++   +
Sbjct  693   NPRTLVVCGTYSIGKEKVFLAIAEVLGSKASMSRDKYKTLQCLESPTVN-SLISVDWKGT  751

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGKRWQ  1872
              +HV+P+  + NFK L    N++   +  ++A  PTGW       SL   K +T GK   
Sbjct  752   LLHVLPMMQI-NFKGLQDHLNKFSENFDQVLAFKPTGWTYSDSCLSLEDIKPQTRGK---  807

Query  1873  QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
                I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  808   ---ITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  841


 Score =   106 bits (264),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 70/114 (61%), Gaps = 2/114 (2%)
 Frame = +3

Query  1023  KYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVT  1199
             + K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DH+ GLT++F    IYC+ +T
Sbjct  520   RKKQCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHFCGLTKNF-RFPIYCNKIT  578

Query  1200  AKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
               LV  K+ +    + +LP+N    + GI V   DANHCPGA +ILF   +G +
Sbjct  579   GNLVKSKLRVQEQYVHVLPMNTECVVNGIKVLLLDANHCPGATMILFYLPSGTV  632



>ref|XP_003825653.1| PREDICTED: DNA cross-link repair 1A protein [Pan paniscus]
 ref|XP_008949180.1| PREDICTED: DNA cross-link repair 1A protein [Pan paniscus]
 ref|XP_008949181.1| PREDICTED: DNA cross-link repair 1A protein [Pan paniscus]
Length=1040

 Score =   157 bits (397),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 125/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VI+F I  A +A   
Sbjct  810   ILHTGDFR-ADPSMERSLLADQKVHMLYLDTTYCSPEYTFPSQQEVIRFAINTAFEAVTL  868

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP  L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  869   NPHALVVCGTYSIGKEKVFLAIADVLGSKVGMSREKYKTLQCLNIP-EINSLITTDMCSS  927

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  928   LVHLLPMMQI-NFKGLQSHLKKCGGKYNQILAFRPTGWTHSNKFTRIADVIPQTKGNISI  986

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  987   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1017


 Score =   108 bits (271),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 98/190 (52%), Gaps = 21/190 (11%)
 Frame = +3

Query  798   RKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSL  974
             RK N+ +E   QK +   +  ++  V LSK+    F  SA G         G     + +
Sbjct  639   RKSNSLQEGACQKRSDHLINTESEAVNLSKV--KVFTKSAHG---------GLQRGNKKI  687

Query  975   MYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQG  1151
               SSN          ++ K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY G
Sbjct  688   PESSN-------VGGSRKKTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSDHYAG  740

Query  1152  LTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAII  1331
             L++ F    +YCS +T  L+  K+ +    I  LPL+    + G+ V   DANHCPGA++
Sbjct  741   LSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHPLPLDTECIVNGVKVVLLDANHCPGAVM  799

Query  1332  ILFEPSNGCL  1361
             ILF   NG +
Sbjct  800   ILFYLPNGTV  809



>ref|XP_008632652.1| PREDICTED: DNA cross-link repair 1A protein [Corvus brachyrhynchos]
Length=971

 Score =   159 bits (403),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 128/217 (59%), Gaps = 16/217 (7%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P+    ++HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  738   ILHTGDFRADPSMERYPALMAQQVHTLYLDTTYCSPEYTFPSQQEVIQFAVNIAFETVTL  797

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K  ++  K + LQCL  P  +    +++   +
Sbjct  798   NPRTLVVCGTYSIGKEKVFLAIAEVLGSKASMSRDKYKTLQCLESPTVN-SLISVDWKGT  856

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGKRWQ  1872
              +HV+P+  + NFK L    N++   +  ++A  PTGW       SL   K +T GK   
Sbjct  857   LLHVLPMMQI-NFKGLQDHLNKFSENFDQVLAFKPTGWTYSDSCLSLEDIKPQTRGK---  912

Query  1873  QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
                I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  913   ---ITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  946


 Score =   106 bits (264),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 70/114 (61%), Gaps = 2/114 (2%)
 Frame = +3

Query  1023  KYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVT  1199
             + K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DH+ GLT++F    IYC+ +T
Sbjct  625   RKKQCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHFCGLTKNF-RFPIYCNKIT  683

Query  1200  AKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
               LV  K+ +    + +LP+N    + GI V   DANHCPGA +ILF   +G +
Sbjct  684   GNLVKSKLRVQEQYVHVLPMNTECVVNGIKVLLLDANHCPGATMILFYLPSGTV  737



>ref|XP_009666936.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Struthio 
camelus australis]
Length=1001

 Score =   157 bits (396),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 85/211 (40%), Positives = 125/211 (59%), Gaps = 4/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P     K+HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  768   ILHTGDFRADPSMERYPPLIGRKVHTLYLDTTYCSPEYTFPSQQEVIQFAVNTAFETVTL  827

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K  ++  K + LQCL     +    +++  +S
Sbjct  828   NPRTLVVCGTYSIGKEKVFLAIAEVLGSKASMSRDKYKTLQCLESAAVN-SLISMDWDDS  886

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +HV+P+  + NFK L    N++   +  ++A  PTGW+           + Q +G I  
Sbjct  887   LLHVLPMMQI-NFKGLQDHLNKFSENFDQVLAFKPTGWTYSDSCLSLVDIKPQTRGRITI  945

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  946   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  976


 Score =   108 bits (271),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +3

Query  1011  AKSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYC  1187
              + T+ K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT++F    IYC
Sbjct  651   GEGTRKKQCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYCGLTKNFIF-PIYC  709

Query  1188  SSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILF  1340
             + +T  LV  K+ +    I +LP++    + GI V   DANHCPGA +ILF
Sbjct  710   NKITGNLVKSKLRVEEQYIHVLPMDTECIVNGIKVLLLDANHCPGATMILF  760



>ref|XP_008661392.1| PREDICTED: uncharacterized protein LOC100192920 isoform X2 [Zea 
mays]
Length=479

 Score =   148 bits (373),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 85/226 (38%), Positives = 123/226 (54%), Gaps = 27/226 (12%)
 Frame = +1

Query  1339  LNHPMAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAI  1518
             L+     LHTGDFR    M   P  Q  +++ + LDTTYCNP+Y FP Q+ VI FV+   
Sbjct  269   LSDGKTCLHTGDFRASKTMQSHPLLQRGRVNLVYLDTTYCNPKYKFPPQEDVIDFVVRTT  328

Query  1519  QAE-AFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFT  1695
             +      P+TL ++G+Y+IGKE +++ I++AL   IY  A++ RIL   G+PD   +  +
Sbjct  329   RRYLKKQPKTLIVVGAYSIGKENVYLAISQALEAHIYTDASRRRILYSFGWPDLSKRLCS  388

Query  1696  LNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQ  1875
              N+  S +HV+PL ++ N + L +      GR+  ++A  PTG                 
Sbjct  389   CNQ-SSSLHVLPLGSI-NHENLKKYLETLNGRFLAVLAFRPTG-----------------  429

Query  1876  GTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
                    VPYSEHSSF+EL+ FV F+ P  IIP+VN     S  KM
Sbjct  430   -------VPYSEHSSFTELRDFVMFLKPQKIIPTVNVGNATSRDKM  468


 Score =   117 bits (294),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 74/107 (69%), Gaps = 1/107 (1%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLRRD-CSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGTPF VDAF+Y + + CS +FL+HFH DHY GLT+ +CHG IYCS++TA+LV 
Sbjct  166   PFYKKIPGTPFTVDAFRYGQVEGCSAYFLSHFHHDHYGGLTKKWCHGPIYCSALTARLVK  225

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             M + +  D I  L L+    I G+ VT  +ANHCPGA +I F  S+G
Sbjct  226   MCLSVNSDYICPLELDTEYVIEGVTVTLLEANHCPGAALIHFRLSDG  272



>ref|XP_006598988.1| PREDICTED: DNA cross-link repair protein SNM1-like isoform X2 
[Glycine max]
Length=503

 Score =   159 bits (401),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 132/227 (58%), Gaps = 7/227 (3%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAE-AFN  1536
             LHTGDFR C  M         +++ L LDTTYCNP+Y FP ++ V+ +V++  +     +
Sbjct  277   LHTGDFRACKLMQAYHLLVNQRVNVLYLDTTYCNPKYRFPSKEEVLNYVVKITKNHLKIH  336

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             PRTL ++G+Y+IGKE +++ I++AL  KIY  A++ RILQ  G+PD   +  T N   + 
Sbjct  337   PRTLVVVGAYSIGKECVYLAISKALGVKIYANASRRRILQAFGWPDLSDKLCT-NGNNTL  395

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPG--KRWQQGTIIR  1890
             +HV+P+ +L   + L      Y  +++ I+A  PTGW+  +         K   +G I  
Sbjct  396   LHVLPMSSL---RTLKDYLKTYKEQFTAILAFRPTGWTFSEKISNDLELIKPVSKGNITI  452

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD  2031
             Y VPYSEHSSFSEL+ FV+ + P  IIP+VN     +  KM S   D
Sbjct  453   YGVPYSEHSSFSELQDFVQVLRPDKIIPTVNVGNAANREKMQSYFRD  499


 Score =   107 bits (267),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 77/148 (52%), Gaps = 22/148 (15%)
 Frame = +3

Query  915   AGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-  1091
             A + +    SCG+N V RS                      P +  +PGT F VDAF+Y 
Sbjct  147   AKSSRKRKGSCGENRVTRS---------------------CPFYKKMPGTMFTVDAFRYG  185

Query  1092  LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRI  1271
                 CS +FLTHFH DHY GL++ + HG IYCS +T +LV M + +    I  L  N+  
Sbjct  186   CVEGCSAYFLTHFHCDHYGGLSKKWSHGPIYCSPLTGRLVQMCLSVNPLYIHPLEFNEEH  245

Query  1272  NIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              I G+ VT  +ANHCPGA +I F   NG
Sbjct  246   VIDGVKVTLLEANHCPGAALIHFNLPNG  273



>ref|XP_010857607.1| PREDICTED: DNA cross-link repair 1A protein isoform X2 [Bison 
bison bison]
Length=1051

 Score =   162 bits (410),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 128/221 (58%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  821   ILHTGDFR-ADPSMERSLLGCHKVHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFETVTL  879

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K   LQC   P E   F T +   S
Sbjct  880   NPRALVVCGTYSIGKEKIFLAIADVLGSKVGMSKEKYNTLQCFNIP-EVSSFITTDMCNS  938

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+             Q +G I  
Sbjct  939   LVHLLPMMQI-NFKGLQNHLKKCGGKYNQILAFRPTGWTHSNKLTSLADIIPQTKGNISI  997

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN    +S R M
Sbjct  998   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGSLKSRRTM  1038


 Score =   103 bits (257),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL+++F    IYCS +T  L+ 
Sbjct  713   PFYKKIPGTGFTVDAFQYGWVEGCTAYFLTHFHSDHYAGLSKNFTF-PIYCSKITGNLLK  771

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I  LP +    + GI V   DANHCPGA++ILF   NG
Sbjct  772   SKLHVQEQYIHPLPTDTECIVNGIKVILLDANHCPGAVMILFCLPNG  818



>ref|XP_005888713.1| PREDICTED: DNA cross-link repair 1A protein [Bos mutus]
 gb|ELR61536.1| DNA cross-link repair 1A protein [Bos mutus]
Length=1051

 Score =   162 bits (410),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 128/221 (58%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  821   ILHTGDFR-ADPSMERSLLGCHKVHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFETVTL  879

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K   LQC   P E   F T +   S
Sbjct  880   NPRALVVCGTYSIGKEKIFLAIADVLGSKVGMSREKYNTLQCFSIP-EVSSFITTDMCNS  938

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+             Q +G I  
Sbjct  939   LVHLLPMMQI-NFKGLQNHLKKCGGKYNQILAFRPTGWTHSNKLTSLADIIPQTKGNISI  997

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN    +S R M
Sbjct  998   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGSLKSRRTM  1038


 Score =   103 bits (257),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL+++F    IYCS +T  L+ 
Sbjct  713   PFYKKIPGTGFTVDAFQYGWVEGCTAYFLTHFHSDHYAGLSKNFTF-PIYCSKITGNLLK  771

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I  LP +    + GI V   DANHCPGA++ILF   NG
Sbjct  772   SKLHVQEQYIHPLPTDTECIVNGIKVILLDANHCPGAVMILFCLPNG  818



>ref|XP_508045.2| PREDICTED: DNA cross-link repair 1A protein [Pan troglodytes]
 ref|XP_009457548.1| PREDICTED: DNA cross-link repair 1A protein [Pan troglodytes]
 ref|XP_009457549.1| PREDICTED: DNA cross-link repair 1A protein [Pan troglodytes]
 ref|XP_009457550.1| PREDICTED: DNA cross-link repair 1A protein [Pan troglodytes]
Length=1040

 Score =   157 bits (396),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 125/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VI+F I  A +A   
Sbjct  810   ILHTGDFR-ADPSMERSLLADQKVHMLYLDTTYCSPEYTFPSQQEVIRFAINTAFEAVTL  868

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP  L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  869   NPHALVVCGTYSIGKEKVFLAIADVLGSKVGMSREKYKTLQCLNIP-EINSLITTDMCSS  927

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  928   LVHLLPMMQI-NFKGLQSHLKKCGGKYNQILAFRPTGWTHSNKFTRIADVIPQTKGNISI  986

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  987   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1017


 Score =   108 bits (271),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 98/190 (52%), Gaps = 21/190 (11%)
 Frame = +3

Query  798   RKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHATSCGQNEVGRSL  974
             RK N+ +E   QK +   +  ++  V LSK+    F  SA G         G     + +
Sbjct  639   RKSNSLQEGACQKRSDHLINTESEAVNLSKV--KVFTKSAHG---------GLQRGNKKI  687

Query  975   MYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQG  1151
               SSN          ++ K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY G
Sbjct  688   PESSN-------VGGSRKKTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSDHYAG  740

Query  1152  LTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAII  1331
             L++ F    +YCS +T  L+  K+ +    I  LPL+    + G+ V   DANHCPGA++
Sbjct  741   LSKHFTF-PVYCSEITGNLLKNKLHVQEQYIHPLPLDTECIVNGVKVVLLDANHCPGAVM  799

Query  1332  ILFEPSNGCL  1361
             ILF   NG +
Sbjct  800   ILFYLPNGTV  809



>ref|XP_010632899.1| PREDICTED: DNA cross-link repair 1A protein [Fukomys damarensis]
 gb|KFO28983.1| DNA cross-link repair 1A protein [Fukomys damarensis]
Length=1034

 Score =   155 bits (392),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 90/214 (42%), Positives = 122/214 (57%), Gaps = 11/214 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             VLHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  804   VLHTGDFR-ADPSMERSLLAGRKVHMLYLDTTYCSPEYTFPSQQEVIQFAINTAFEAVTL  862

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y IGKE++F+ IA  L  K+ ++  K + L+CL    E     T +   S
Sbjct  863   NPRALVVCGTYCIGKEKVFLAIADVLGSKVGMSEEKYKTLRCLNI-SEINSLITTDMRSS  921

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKG----KKKTPGKRWQQGT  1881
              +H++P+  + NFK L     +Y  +Y  I+A  PTGW+           TP  +   G 
Sbjct  922   LVHLLPMMQI-NFKSLRSHLRKYAEKYDQILAFRPTGWTHSNKLTCIADVTPQTK---GN  977

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             I  Y +PYSEHSS+ E+K FV+++ P  IIP+VN
Sbjct  978   ISIYGIPYSEHSSYLEMKHFVQWLKPQKIIPTVN  1011


 Score =   110 bits (275),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 69/201 (34%), Positives = 102/201 (51%), Gaps = 21/201 (10%)
 Frame = +3

Query  768   KKIVHALSELRKENTKEVEFQKNAKKAV-VDDTSKVKLSKLITDYFQCSAAGTKKVHATS  944
             +K  H     +K N++E   QK +   +  +  S VKLSK  T     S  G ++   T 
Sbjct  623   EKSQHQRKRQKKSNSQEGTHQKRSGHLINTESESGVKLSKEKT--LIKSVPGRQQRENT-  679

Query  945   CGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRD-CSHWFL  1121
                            K  K + A+  + +  P +  IPGT F VDAF+Y   + C+ +FL
Sbjct  680   ---------------KVTKSSDAEELRRRTCPFYKKIPGTGFTVDAFQYGEVEGCTAYFL  724

Query  1122  THFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCF  1301
             THFH+DHY GL+++F    +YCS +T  L+  K+ +    I  LP++    + G+ VT  
Sbjct  725   THFHSDHYAGLSKNFTF-PVYCSEITGNLLKCKLHVQEQYIHPLPMDTECIVNGVKVTLL  783

Query  1302  DANHCPGAIIILFEPSNGCLA  1364
             DANHCPGA +ILF   NG + 
Sbjct  784   DANHCPGAAMILFYLPNGTVV  804



>ref|XP_003548485.1| PREDICTED: DNA cross-link repair protein SNM1-like isoform X1 
[Glycine max]
Length=505

 Score =   158 bits (400),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 89/227 (39%), Positives = 132/227 (58%), Gaps = 5/227 (2%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEAIQAE-AFN  1536
             LHTGDFR C  M         +++ L LDTTYCNP+Y FP ++ V+ +V++  +     +
Sbjct  277   LHTGDFRACKLMQAYHLLVNQRVNVLYLDTTYCNPKYRFPSKEEVLNYVVKITKNHLKIH  336

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             PRTL ++G+Y+IGKE +++ I++AL  KIY  A++ RILQ  G+PD   +  T N   + 
Sbjct  337   PRTLVVVGAYSIGKECVYLAISKALGVKIYANASRRRILQAFGWPDLSDKLCT-NGNNTL  395

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPG--KRWQQGTIIR  1890
             +HV+P+ +L   + L      Y  +++ I+A  PTGW+  +         K   +G I  
Sbjct  396   LHVLPMSSL-RVETLKDYLKTYKEQFTAILAFRPTGWTFSEKISNDLELIKPVSKGNITI  454

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD  2031
             Y VPYSEHSSFSEL+ FV+ + P  IIP+VN     +  KM S   D
Sbjct  455   YGVPYSEHSSFSELQDFVQVLRPDKIIPTVNVGNAANREKMQSYFRD  501


 Score =   107 bits (267),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 77/148 (52%), Gaps = 22/148 (15%)
 Frame = +3

Query  915   AGTKKVHATSCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-  1091
             A + +    SCG+N V RS                      P +  +PGT F VDAF+Y 
Sbjct  147   AKSSRKRKGSCGENRVTRS---------------------CPFYKKMPGTMFTVDAFRYG  185

Query  1092  LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRI  1271
                 CS +FLTHFH DHY GL++ + HG IYCS +T +LV M + +    I  L  N+  
Sbjct  186   CVEGCSAYFLTHFHCDHYGGLSKKWSHGPIYCSPLTGRLVQMCLSVNPLYIHPLEFNEEH  245

Query  1272  NIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              I G+ VT  +ANHCPGA +I F   NG
Sbjct  246   VIDGVKVTLLEANHCPGAALIHFNLPNG  273



>ref|XP_005747454.1| PREDICTED: DNA cross-link repair 1A protein-like [Pundamilia 
nyererei]
Length=931

 Score =   161 bits (407),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 132/225 (59%), Gaps = 11/225 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             VLHTGDFR    M   P    C+I TL LDTTYC+P+Y FP+Q  VI F    A +    
Sbjct  698   VLHTGDFRADPSMETYPELLSCRIQTLYLDTTYCSPEYTFPRQQEVINFAASTAFELVTL  757

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQF---FTLNE  1704
             NPRTL + GSY++GKE++F+ +A  L  K+ ++  K   + CL    E  Q     T + 
Sbjct  758   NPRTLVVCGSYSVGKEKVFLALAEVLGSKVCLSRDKYNTMCCL----ESEQIKGRLTTDW  813

Query  1705  LESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQ-GT  1881
               + +HV+P+  L+ F++L     ++  +Y  +VA  PTGW+  +  +     + Q+ G 
Sbjct  814   KAAQVHVLPMMQLS-FRKLQDHLARFSRQYDQLVAFKPTGWTFSQQIESVEDIQPQKSGN  872

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKML  2016
             I  Y +PYSEHSSF ELK+FV+++ P  IIP+VNN G  ++RK +
Sbjct  873   ITIYGIPYSEHSSFLELKRFVQWLQPLKIIPTVNN-GSWASRKAM  916


 Score =   104 bits (260),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 81/144 (56%), Gaps = 4/144 (3%)
 Frame = +3

Query  918   GTKKVHATSCGQNEV-GRSLMYSSNK-SVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY  1091
              T+ ++ +  GQ EV GRS      +   + N     +    P +  IPGT F +DAF+Y
Sbjct  548   ATETINPSVDGQGEVWGRSGTTGRRRWRNRVNADGEVQLPRCPFYKKIPGTKFAIDAFRY  607

Query  1092  LR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQR  1268
              +    + +FLTHFH+DHY GLT++     IYC+ +T  LV  K+ +    + ILP+N  
Sbjct  608   GQIEGIAAYFLTHFHSDHYGGLTKA-STVPIYCNRITGNLVKSKLRVAEQYVHILPMNTE  666

Query  1269  INIAGIDVTCFDANHCPGAIIILF  1340
             + + G+ V   DANHCPGA ++LF
Sbjct  667   VTVEGVRVILLDANHCPGAAMLLF  690



>ref|XP_010182241.1| PREDICTED: DNA cross-link repair 1A protein [Mesitornis unicolor]
Length=999

 Score =   159 bits (402),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 127/217 (59%), Gaps = 16/217 (7%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P+     +HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  766   ILHTGDFRADPSMERYPALMGQHVHTLYLDTTYCSPEYTFPSQQEVIQFAVNTAFETVTL  825

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE-  1710
             NPRTL + G+Y+IGKE++F+ IA  L  K  ++  K +ILQCL    E     +L  ++ 
Sbjct  826   NPRTLVVCGTYSIGKEKVFLAIAEVLGSKASMSRDKYKILQCL----ESAAVNSLISVDW  881

Query  1711  --SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKK----TPGKRWQ  1872
               + +HV+P+  + NFK L    N++   +  ++A  PTGW+     +      P KR  
Sbjct  882   NGTLLHVLPMMQI-NFKALQDHLNKFSQNFDQVLAFKPTGWTYSNSCRSLVDIKPQKR--  938

Query  1873  QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              G I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  939   -GKITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  974


 Score =   106 bits (264),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 77/146 (53%), Gaps = 9/146 (6%)
 Frame = +3

Query  927   KVHATSCGQNEV-------GRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAF  1085
             +V   S  +NE        GR       K +    ++  + K  P +  IPGT F VDAF
Sbjct  614   QVQGESSSKNEAFADVRSGGRQRWRKKIKGLSSPTSEGKRKKQCPFYKKIPGTGFAVDAF  673

Query  1086  KYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLN  1262
             +Y     C+ +FLTHFH+DHY GLT+ F    +YC+ +T  LV  K+ +    I +LP+ 
Sbjct  674   QYGEIEGCTAYFLTHFHSDHYCGLTKKFTF-PVYCNKITGNLVKSKLRVQEQYIHVLPME  732

Query  1263  QRINIAGIDVTCFDANHCPGAIIILF  1340
                 + GI V   DANHCPGA +ILF
Sbjct  733   TECIVNGIKVLLLDANHCPGATMILF  758



>ref|XP_009078554.1| PREDICTED: DNA cross-link repair 1A protein [Acanthisitta chloris]
Length=987

 Score =   158 bits (400),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/220 (42%), Positives = 127/220 (58%), Gaps = 22/220 (10%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P+    ++HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  754   ILHTGDFRADPSMERCPALLGQQVHTLYLDTTYCSPEYTFPSQQEVIQFAVNTAFETVTL  813

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE-  1710
             NPRTL + G+Y IGKE++F+ IA  L  K  V+  K R LQCL    E     +L  ++ 
Sbjct  814   NPRTLVVCGTYAIGKEKVFLAIAEVLGSKASVSRDKYRTLQCL----ESAAVNSLISVDW  869

Query  1711  --SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGK  1863
               + +HV+P+  + NFK L    N++   +  I+A  PTGW       SL   K +T GK
Sbjct  870   NGTLLHVLPMMQI-NFKALQDHLNKFSENFDQILAFKPTGWTYSDSCLSLVDIKPRTRGK  928

Query  1864  RWQQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
                   I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  929   ------ITIYGIPYSEHSSYVEMKRFVQWLKPQKIIPTVN  962


 Score =   107 bits (266),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 71/114 (62%), Gaps = 2/114 (2%)
 Frame = +3

Query  1023  KYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVT  1199
             + K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT++F    IYC+ +T
Sbjct  641   RKKHCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYCGLTKNF-RFPIYCNKIT  699

Query  1200  AKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             A LV  K+ +    + +LP++    + GI V   DANHCPGA +ILF   +G +
Sbjct  700   ANLVKSKLRVQEQFVHVLPMDTECMVNGIKVLLLDANHCPGATMILFYLPSGTV  753



>ref|XP_007440706.1| PREDICTED: DNA cross-link repair 1A protein isoform X4 [Python 
bivittatus]
Length=842

 Score =   159 bits (401),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 128/218 (59%), Gaps = 4/218 (2%)
 Frame = +1

Query  1336  SLNHPMAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-  1512
             SL +   +LHTGDFR    M   P     ++HT+ LDTTYC+P+Y FP Q  VIQF +  
Sbjct  602   SLPNGTVILHTGDFRGDPSMECCPFLSGWRVHTVYLDTTYCSPEYTFPSQQEVIQFAVST  661

Query  1513  AIQAEAFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFF  1692
             A +    NPRTL + G+Y++GKE++F+ IA  L  K  ++  K + LQCL     +    
Sbjct  662   AFERVTVNPRTLVVCGTYSVGKEKVFLAIAEVLGSKASMSQEKYKTLQCLESATIN-SLI  720

Query  1693  TLNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ  1872
             TLN   + +H++P+  + NFK L    N++   +  I+A  PTGW+   G       + Q
Sbjct  721   TLNWNNTLLHLLPMMQI-NFKNLQNHLNKFSENFDHILAFKPTGWTYSDGCCSLSDIQPQ  779

Query  1873  -QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              +G I  Y +PYSEHSSF E+K+F++++ P  I+P+VN
Sbjct  780   TRGNITIYGIPYSEHSSFLEMKRFIQWLKPQKIVPTVN  817


 Score =   106 bits (265),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 66/104 (63%), Gaps = 2/104 (2%)
 Frame = +3

Query  1053  IPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGI  1229
             I GT F VDAF+Y     C+ +FLTHFH+DHY GLT+ F    IYC+ +T  LV  K+G+
Sbjct  506   IKGTGFVVDAFQYGEIEGCTAYFLTHFHSDHYGGLTKKFTF-PIYCNKITGNLVKNKLGV  564

Query  1230  PWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
                 + ILP+++   I GI V   DANHCPGA +ILF   NG +
Sbjct  565   QEQYVHILPMDRECIINGIKVVLLDANHCPGAAMILFSLPNGTV  608



>ref|XP_009634186.1| PREDICTED: DNA cross-link repair 1A protein [Egretta garzetta]
Length=998

 Score =   155 bits (392),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 128/220 (58%), Gaps = 22/220 (10%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             VLHTGDFR    M   P+    ++HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  765   VLHTGDFRADPSMERYPALISQQVHTLYLDTTYCSPEYTFPSQQEVIQFAVNTAFETVTL  824

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE-  1710
             NPRTL + G+Y+IGKE++F+ IA  L  K  ++  K + LQCL    E     +L  ++ 
Sbjct  825   NPRTLVVCGTYSIGKEKVFLAIAEVLGSKASMSRDKYKTLQCL----ESAAVNSLISVDW  880

Query  1711  --SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGK  1863
               + +HV+P+  + NFK L    N++   +  ++A  PTGW       SL   K +T GK
Sbjct  881   DGTLLHVLPMMQI-NFKGLQDHLNKFSENFDQVLAFKPTGWTYSDSCLSLVDIKPQTRGK  939

Query  1864  RWQQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
                   I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  940   ------ITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  973


 Score =   110 bits (274),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +3

Query  1011  AKSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYC  1187
              + T+ K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT++F    IYC
Sbjct  648   GEGTRKKHCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYSGLTKNFMF-PIYC  706

Query  1188  SSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILF  1340
             + +T  LV  K+ +    I +LP++    + GI V   DANHCPGA +ILF
Sbjct  707   NKITGNLVKSKLRVKEQYIHVLPMDTECIVNGIKVVLLDANHCPGATMILF  757



>dbj|BAD82911.1| Snm1 [Oryza sativa Japonica Group]
Length=485

 Score =   152 bits (383),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 90/229 (39%), Positives = 132/229 (58%), Gaps = 12/229 (5%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIEA----IQAE  1527
             LHTGDFR    M   P  Q  +I+ L LDTTYCNP+Y FP ++ VI F +      +Q E
Sbjct  252   LHTGDFRASKSMQLYPLLQRGQINLLYLDTTYCNPKYKFPPKEDVIDFAVRTAKRYLQKE  311

Query  1528  AFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNEL  1707
                P+TL ++G+Y+IGKE +++ I++AL   IY  A++ RIL   G+ D   +    +  
Sbjct  312   ---PKTLIVVGAYSIGKENVYLAISKALQVPIYTDASRRRILHAFGWSDLS-KMICSDSQ  367

Query  1708  ESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGK--GKKKTPGKRWQQGT  1881
              S +HV+PL +L + + L +       R+  ++A  PTGW+  +  G +    K   +G 
Sbjct  368   SSSLHVLPLSSLRH-ENLQKYLETLKQRFLAVLAFRPTGWTFSEETGNQLDLIKPSSRGK  426

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLS  2028
             I  Y VPYSEHSSFSEL++FV F+ P  +IP+VN  G  ++R   S  S
Sbjct  427   ITIYGVPYSEHSSFSELREFVMFLRPQKVIPTVNV-GNAASRDNASTFS  474


 Score =   113 bits (283),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 72/107 (67%), Gaps = 1/107 (1%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGTPF VDAF+Y     C+ +FL+HFH DHY GLT+ +CHG IYC+++TA+LV 
Sbjct  142   PFYKKIPGTPFTVDAFRYGAVEGCNAYFLSHFHHDHYGGLTKKWCHGPIYCTALTARLVK  201

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             M + +  + I  L L++   I G+ VT  +ANHCPGA +I F   +G
Sbjct  202   MCLSVNPEYICPLELDKEYVIEGVSVTLLEANHCPGAALIHFRLGDG  248



>ref|XP_009906463.1| PREDICTED: DNA cross-link repair 1A protein [Picoides pubescens]
Length=992

 Score =   157 bits (396),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 90/220 (41%), Positives = 128/220 (58%), Gaps = 22/220 (10%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P+    ++HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  748   ILHTGDFRADPSMERYPALIGQQVHTLYLDTTYCSPEYTFPSQQEVIQFAVNTAFETVTL  807

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE-  1710
             NPRTL + G+Y+IGKE++F+ IA  L  K  ++  K + LQCL    E     +L  +E 
Sbjct  808   NPRTLVVCGTYSIGKEKVFLAIAEVLGSKASMSRDKYKTLQCL----ESAAVNSLISVEW  863

Query  1711  --SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGK  1863
               + +HV+P+  + NFK L    N++   +  ++A  PTGW       SL   K +T GK
Sbjct  864   AGTLLHVLPMMQV-NFKGLQDHLNKFSENFDQVLAFRPTGWTYSDSCFSLADIKPQTRGK  922

Query  1864  RWQQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
                   I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  923   ------ITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  956


 Score =   108 bits (270),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 54/127 (43%), Positives = 76/127 (60%), Gaps = 4/127 (3%)
 Frame = +3

Query  990   KSVKKNPA--KSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTR  1160
             K +K  P   + T+ K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT+
Sbjct  622   KKIKDLPTTDEGTRKKHCPFYKKIPGTGFTVDAFRYGEIEGCTAYFLTHFHSDHYCGLTK  681

Query  1161  SFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILF  1340
             +F    IYC+ +T  LV  K+ +    + +LP++    + GI V   DANHCPGA +ILF
Sbjct  682   NFMF-PIYCNKITGNLVKSKLRVQEQYVHVLPMDTECVVNGIRVVLLDANHCPGATMILF  740

Query  1341  EPSNGCL  1361
                +G +
Sbjct  741   YLPSGTV  747



>ref|XP_009984180.1| PREDICTED: DNA cross-link repair 1A protein [Tauraco erythrolophus]
Length=992

 Score =   155 bits (391),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 87/217 (40%), Positives = 127/217 (59%), Gaps = 16/217 (7%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P+    ++HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  759   ILHTGDFRADPSMERYPALISQQVHTLYLDTTYCSPEYTFPSQQEVIQFAVNTAFETVTL  818

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K  ++  K + LQCL     +    +++   +
Sbjct  819   NPRTLVVCGTYSIGKEKVFLAIAEVLGSKASMSHDKYKTLQCLESAAVN-SLISVDWAGT  877

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGKRWQ  1872
              +HV+P+  + NFK L    N++   +  ++A  PTGW       SL   K +T GK   
Sbjct  878   LLHVLPMMQI-NFKGLQDHLNKFSENFDQVLAFRPTGWTYSDSCLSLVDIKPQTRGK---  933

Query  1873  QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
                I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  934   ---ITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  967


 Score =   110 bits (274),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 79/127 (62%), Gaps = 4/127 (3%)
 Frame = +3

Query  990   KSVKKNPA--KSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTR  1160
             K++K+ PA  + T+ K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT+
Sbjct  633   KTLKEFPATAEGTRKKHCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYCGLTK  692

Query  1161  SFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILF  1340
             +F    IYC+ +T  LV  K+ +    + +LP++    + GI V   DANHCPGA +ILF
Sbjct  693   NFMF-PIYCNKITGNLVKSKLRVKEQCVHVLPMDTECIVNGIKVVLLDANHCPGATMILF  751

Query  1341  EPSNGCL  1361
                +G +
Sbjct  752   YLPSGTV  758



>ref|XP_007939779.1| PREDICTED: DNA cross-link repair 1A protein [Orycteropus afer 
afer]
Length=1051

 Score =   157 bits (397),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 90/224 (40%), Positives = 128/224 (57%), Gaps = 11/224 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME        +H L LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  821   ILHTGDFR-ADPTMERSLLANQTVHVLYLDTTYCSPEYSFPSQQEVIQFAINIAFETVTL  879

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K   LQCL  P+ +    T +   +
Sbjct  880   NPRALVVCGTYSIGKEKIFLAIADVLGSKVGMSQEKYTTLQCLNIPEMN-SLITTDMKST  938

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWS----LGKGKKKTPGKRWQQGT  1881
              +H++P+  + NFK L +   +  G+Y  I+A  PTGW+    L +     P  +   G 
Sbjct  939   WVHLLPMMQI-NFKGLQRHLKKCGGKYDQILAFRPTGWTHSNKLTRISDIIPETK---GN  994

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN     S R M
Sbjct  995   ISIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTSRSRRTM  1038


 Score =   107 bits (268),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 69/109 (63%), Gaps = 2/109 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY GL+R+F    +YCS +T  L+ 
Sbjct  713   PFYKKIPGTGFTVDAFQYGQIEGCTAYFLTHFHSDHYAGLSRNFT-SPVYCSEITGNLLK  771

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
              K+ +    I  LP++    + G+ V   DANHCPGA++ILF   NG +
Sbjct  772   NKLHVQEQYIHPLPVDTECLVNGVKVVLLDANHCPGAVMILFYLPNGTV  820



>ref|XP_004567549.1| PREDICTED: DNA cross-link repair 1A protein-like [Maylandia zebra]
Length=931

 Score =   160 bits (406),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 131/225 (58%), Gaps = 11/225 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             VLHTGDFR    M   P    C+I TL LDTTYC+P+Y FP+Q  VI F    A +    
Sbjct  698   VLHTGDFRADPSMETYPELLSCRIQTLYLDTTYCSPEYTFPRQQEVINFAASTAFELVTL  757

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQF---FTLNE  1704
             NPRTL + GSY++GKE++F+ +A  L  K+ ++  K   + CL    E  Q     T + 
Sbjct  758   NPRTLVVCGSYSVGKEKVFLALAEVLGSKVCLSRDKYNTMCCL----ESEQIKGRLTTDW  813

Query  1705  LESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQ-GT  1881
               + +HV+P+  L+ F++L     ++  +Y  +VA  PTGW+  +  +     + Q+ G 
Sbjct  814   KAAQVHVLPMMQLS-FRKLQDHLARFSHQYDQLVAFKPTGWTFSQQIESVEDIQPQKSGN  872

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKML  2016
             I  Y +PYSEHSSF ELK+FV+++ P  IIP+VNN G  + RK +
Sbjct  873   ITIYGIPYSEHSSFLELKRFVQWLQPLKIIPTVNN-GSWANRKAM  916


 Score =   104 bits (260),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 81/144 (56%), Gaps = 4/144 (3%)
 Frame = +3

Query  918   GTKKVHATSCGQNEV-GRSLMYSSNK-SVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY  1091
              T+ ++ +  GQ EV GRS      +   + N     +    P +  IPGT F +DAF+Y
Sbjct  548   ATETINPSVDGQGEVWGRSGTTGRRRWRNRVNADGEVQLPRCPFYKKIPGTKFAIDAFRY  607

Query  1092  LR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQR  1268
              +    + +FLTHFH+DHY GLT++     IYC+ +T  LV  K+ +    + ILP+N  
Sbjct  608   GQIEGIAAYFLTHFHSDHYGGLTKT-STVPIYCNRITGNLVKSKLRVAEQYVHILPMNTE  666

Query  1269  INIAGIDVTCFDANHCPGAIIILF  1340
             + + G+ V   DANHCPGA ++LF
Sbjct  667   VTVEGVRVILLDANHCPGAAMLLF  690



>ref|XP_007469680.1| PREDICTED: DNA cross-link repair 1A protein [Lipotes vexillifer]
Length=1054

 Score =   157 bits (397),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 124/221 (56%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
              LHTGDFR  D  ME       ++HTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  824   TLHTGDFR-ADPTMERSLLAGQRVHTLYLDTTYCSPEYCFPSQQEVIQFAINTAFETVTL  882

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K   LQC   P E     T +   S
Sbjct  883   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSKEKYNTLQCFNIP-EINSLITTDMCNS  941

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+             Q +G I  
Sbjct  942   LVHLLPMMQI-NFKGLQNHLKKCGGKYDQILAFRPTGWTHSNKLTSMADIIPQTKGNISI  1000

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN     S R M
Sbjct  1001  YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTLRSRRTM  1041


 Score =   107 bits (268),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 69/199 (35%), Positives = 100/199 (50%), Gaps = 21/199 (11%)
 Frame = +3

Query  765   RKKIVHALSELRKENT-KEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTKKVHAT  941
             RK+  H    L+K ++ +E   QK++      +   VKLSK     F  SA G       
Sbjct  642   RKRSQHQRKRLKKSDSLQEGVHQKSSGHRNKTEPGTVKLSK--DRVFIKSAHG-------  692

Query  942   SCGQNEVGRSLMYSSNKSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWF  1118
                       L   + K  + + A   + +  P +  IPGT F VDAF+Y L   C+ +F
Sbjct  693   ---------RLQRGNTKIPESSNAGELRKRTCPFYKKIPGTGFTVDAFQYGLVEGCTAYF  743

Query  1119  LTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTC  1298
             LTHFH+DHY GL+++F    +YCS +T  L+  K+ +    I  LP +    + G+ V  
Sbjct  744   LTHFHSDHYAGLSKNFTF-PVYCSEITGNLLKSKLHVQEQYIHPLPTDTECIVNGVKVVL  802

Query  1299  FDANHCPGAIIILFEPSNG  1355
              DANHCPGA++ILF   NG
Sbjct  803   LDANHCPGAVMILFYLPNG  821



>ref|XP_005481144.1| PREDICTED: DNA cross-link repair 1A protein [Zonotrichia albicollis]
Length=969

 Score =   157 bits (398),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 91/220 (41%), Positives = 128/220 (58%), Gaps = 22/220 (10%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P+    KIHTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  736   ILHTGDFRADPSMERYPALMGQKIHTLYLDTTYCSPEYTFPAQQEVIQFAVNIAFETVTL  795

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE-  1710
             NPRTL + G+Y+IGKE++F+ IA  L  K  ++  K + LQCL    E     +L  ++ 
Sbjct  796   NPRTLVVCGTYSIGKEKVFLAIAEVLGSKASMSRDKYKTLQCL----ESAAVNSLISVDW  851

Query  1711  --SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGK  1863
               + +HV+P+  + NFK L    N++   +  I+A  PTGW       SL   K +T GK
Sbjct  852   KGTLLHVLPMMQI-NFKGLQDHLNKFSENFDQILAFKPTGWTYSDSCLSLEDIKPQTRGK  910

Query  1864  RWQQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
                   +  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  911   ------VTIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  944


 Score =   107 bits (266),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 76/127 (60%), Gaps = 4/127 (3%)
 Frame = +3

Query  990   KSVKKNP--AKSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTR  1160
             K  K++P   +  + K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT+
Sbjct  610   KKFKESPTTGEEPRKKHCPFYKKIPGTGFAVDAFQYGEIEGCTAYFLTHFHSDHYSGLTK  669

Query  1161  SFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILF  1340
             +F    IYC+ +T  LV  K+ +    + +LP++    + GI V   DANHCPGA +ILF
Sbjct  670   NF-RFPIYCNKITGNLVKSKLRVQEQYVHVLPMDTPCVVNGIKVLLLDANHCPGAAMILF  728

Query  1341  EPSNGCL  1361
                +G +
Sbjct  729   YLPSGAV  735



>ref|XP_009704602.1| PREDICTED: DNA cross-link repair 1A protein [Cariama cristata]
Length=995

 Score =   157 bits (396),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 126/214 (59%), Gaps = 10/214 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P+    ++HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  762   ILHTGDFRADPSMERYPALIGQQVHTLYLDTTYCSPEYTFPSQQEVIQFAVNTAFETVTL  821

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K  ++  K + LQCL    E     +L  ++ 
Sbjct  822   NPRTLVVCGTYSIGKEKVFLAIAEVLGSKASMSRDKYKTLQCL----ESAAVNSLISVDW  877

Query  1714  H---IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGT  1881
             H   +HV+P+  + NFK L    N++   +  I+A  PTGW+           + Q +G 
Sbjct  878   HGTLLHVLPMMQI-NFKGLQDHLNKFSENFDQILAFKPTGWTYSDSCLSLVDIKPQTRGN  936

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  937   ITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  970


 Score =   107 bits (268),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 50/111 (45%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +3

Query  1011  AKSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYC  1187
              + T+ K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT++F    IYC
Sbjct  645   GEGTRKKHCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYCGLTKNFMF-PIYC  703

Query  1188  SSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILF  1340
             + +T  LV  K+ +    + +LP++    + GI V   DANHCPGA +ILF
Sbjct  704   NKITGNLVKSKLRVKEQYVHVLPMDTECLVNGIKVVLLDANHCPGAAMILF  754



>ref|XP_006791284.1| PREDICTED: DNA cross-link repair 1A protein-like [Neolamprologus 
brichardi]
Length=931

 Score =   160 bits (405),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 90/225 (40%), Positives = 131/225 (58%), Gaps = 11/225 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             VLHTGDFR    M   P    C+I TL LDTTYC+P+Y FP+Q  VI F    A +    
Sbjct  698   VLHTGDFRADPSMETYPELLSCRIQTLYLDTTYCSPEYTFPRQQEVINFAASTAFELVTL  757

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQF---FTLNE  1704
             NPRTL + GSY++GKE++F+ +A  L  K+ ++  K   + CL    E  Q     T + 
Sbjct  758   NPRTLVVCGSYSVGKEKVFLALAEVLGSKVCLSRDKYNTMCCL----ESEQIKGRLTTDW  813

Query  1705  LESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQ-GT  1881
               + +HV+P+  L+ F++L     ++  +Y  +VA  PTGW+  +  +     + Q+ G 
Sbjct  814   KAAQVHVLPMMQLS-FRKLQDHLARFSRQYDQLVAFKPTGWTFSQQIESVEDIQPQKSGN  872

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKML  2016
             I  Y +PYSEHSSF ELK+FV+++ P  IIP+VNN G  + RK +
Sbjct  873   ITIYGIPYSEHSSFLELKRFVQWLQPLKIIPTVNN-GSWANRKAM  916


 Score =   104 bits (260),  Expect(2) = 5e-61, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 81/144 (56%), Gaps = 4/144 (3%)
 Frame = +3

Query  918   GTKKVHATSCGQNEV-GRSLMYSSNK-SVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKY  1091
              T+ ++ +  GQ EV GRS      +   + N     +    P +  IPGT F +DAF+Y
Sbjct  548   ATETINPSVDGQGEVWGRSGATGRRRWRNRVNADGEVQLPRCPFYKKIPGTKFAIDAFRY  607

Query  1092  LR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQR  1268
              +    + +FLTHFH+DHY GLT++     IYC+ +T  LV  K+ +    + ILP+N  
Sbjct  608   GQIEGITAYFLTHFHSDHYGGLTKT-STVPIYCNRITGNLVKSKLRVAEQYVHILPMNTE  666

Query  1269  INIAGIDVTCFDANHCPGAIIILF  1340
             + + G+ V   DANHCPGA ++LF
Sbjct  667   VTVEGVRVILLDANHCPGAAMLLF  690



>ref|XP_006630896.1| PREDICTED: DNA cross-link repair 1A protein-like [Lepisosteus 
oculatus]
Length=990

 Score =   156 bits (395),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 91/229 (40%), Positives = 134/229 (59%), Gaps = 9/229 (4%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             VLHTGDFR    M   P     K+ TL LDTTYC+P+Y FP Q  VI F    A +    
Sbjct  741   VLHTGDFRADPSMERYPELLGSKVQTLYLDTTYCSPEYTFPTQQEVISFAANTAFEHMTL  800

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+TL + G+Y+IGKE++F+ IA  L  K+ V+  K   + CL   D   +  T++   +
Sbjct  801   NPQTLIVCGTYSIGKEKVFLAIAEVLGCKVCVSRDKYNTMCCLES-DSIRERLTMDWNAT  859

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ---QGTI  1884
              +HV+P+  + NFK L    N++ G+Y+ I+A  PTGW+     + T  +  Q   +G I
Sbjct  860   QMHVLPMMQI-NFKGLQTHLNKFSGKYNQILAFKPTGWTF--SSQNTCVESIQPVVRGNI  916

Query  1885  IRYEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKMLSLLSD  2031
               Y +PYSEHSS+ E+K+FV+++ P  I+P+V N G   +RK + +L D
Sbjct  917   SIYGIPYSEHSSYLEMKRFVQWLKPEKILPTV-NVGSWRSRKEMEMLFD  964


 Score =   108 bits (269),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 51/115 (44%), Positives = 70/115 (61%), Gaps = 2/115 (2%)
 Frame = +3

Query  1014  KSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCS  1190
             +S   K  P +  IPGT F VDAF+Y      + +FLTHFH+DHY GL +SF    I+C+
Sbjct  625   ESENTKQCPFYKKIPGTGFAVDAFQYGPIEGITGYFLTHFHSDHYSGLKKSF-RLPIFCN  683

Query  1191  SVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              +T  LV  K+ +    + ILP+N    + G+ VT  DANHCPGA ++LF+  NG
Sbjct  684   KITGNLVKSKLRVEEQYVNILPMNAECTVEGVSVTLLDANHCPGAAMLLFQLPNG  738



>ref|XP_009085421.1| PREDICTED: DNA cross-link repair 1A protein [Serinus canaria]
Length=970

 Score =   154 bits (388),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 88/217 (41%), Positives = 126/217 (58%), Gaps = 16/217 (7%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P+    K+ TL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  737   ILHTGDFRADPSMERYPALMGQKVQTLYLDTTYCSPEYTFPAQQEVIQFAVNIAFETVTL  796

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K  ++  K + LQCL     +    +++   +
Sbjct  797   NPRTLVVCGTYSIGKEKVFLAIAEVLGSKASMSRDKYKTLQCLESAAVN-SLISVDWKGT  855

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGKRWQ  1872
              +HV+P+  + NFK L    N++   +  I+A  PTGW       SL   K +T GK   
Sbjct  856   LLHVLPMMQI-NFKCLQDHLNKFSENFDQILAFKPTGWTYSDSCLSLEDIKPQTRGK---  911

Query  1873  QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
                I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  912   ---ITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  945


 Score =   110 bits (276),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 72/114 (63%), Gaps = 2/114 (2%)
 Frame = +3

Query  1023  KYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVT  1199
             + K  P +  IPGT F VDAF+Y    DC+ +FLTHFH+DHY GLT++F    IYC+ VT
Sbjct  624   RKKHCPFYKKIPGTGFTVDAFQYGEIEDCTAYFLTHFHSDHYSGLTKNF-RFPIYCNKVT  682

Query  1200  AKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
               LV  K+ +    + +LP++ +  + GI V   DANHCPGA +ILF   +G +
Sbjct  683   GNLVKSKLRVQEQYVHVLPMDTQCVVNGIKVLLLDANHCPGAAMILFYLPSGAV  736



>ref|XP_002821207.1| PREDICTED: DNA cross-link repair 1A protein [Pongo abelii]
Length=1039

 Score =   157 bits (397),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 88/211 (42%), Positives = 125/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+H L LDTTYC+P+Y FP Q  VI+F I  A +A   
Sbjct  809   ILHTGDFR-ADPSMERSLLADQKVHMLYLDTTYCSPEYTFPSQQEVIRFAINTAFEAVTL  867

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP  L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +   S
Sbjct  868   NPHALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EINSLITTDMCSS  926

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+      +      Q +G I  
Sbjct  927   LVHLLPMMQI-NFKGLQSHLKKCGGKYNQILAFRPTGWTHSNKFTRIADVIPQTKGNISI  985

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  986   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1016


 Score =   107 bits (267),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 69/112 (62%), Gaps = 2/112 (2%)
 Frame = +3

Query  1029  KDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
             K  P +  IPGT F VDAF+Y +   C+ +FLTHFH+DHY GL++ F    +YCS +T  
Sbjct  698   KTCPFYKKIPGTGFTVDAFQYGVVEGCTAYFLTHFHSDHYAGLSKHFTF-PVYCSEITGN  756

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             L+  K+ +    I  LPL+    + G+ V   DANHCPGA++ILF   NG +
Sbjct  757   LLKNKLHVQEQYIHPLPLDTECIVNGVKVVLLDANHCPGAVMILFYLPNGTV  808



>ref|XP_008798364.1| PREDICTED: DNA cross-link repair protein SNM1 isoform X1 [Phoenix 
dactylifera]
Length=547

 Score =   159 bits (403),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 87/221 (39%), Positives = 128/221 (58%), Gaps = 5/221 (2%)
 Frame = +1

Query  1360  LHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAFN  1536
             LHTGDFR C +M   P      I+ L LDTTYCNP+Y FP ++ V+ F++  A +     
Sbjct  319   LHTGDFRACKQMESYPLLLSHHINVLYLDTTYCNPKYRFPPKEDVVDFIVRTARKCLEKQ  378

Query  1537  PRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELESH  1716
             P+TL  +G+Y+IGKE ++  I++AL   IY  +++ RILQ   +P+   +  +     S 
Sbjct  379   PKTLIAVGAYSIGKEHVYAAISQALEVPIYTDSSRRRILQSFDWPELSRKLCSCGRT-SP  437

Query  1717  IHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLG--KGKKKTPGKRWQQGTIIR  1890
             +HV+P+ +    + L++    Y  +Y+ ++A  PTGW+     G +    K   +G I  
Sbjct  438   LHVLPI-SFLRHENLSEYLKTYKQQYAAVLAFRPTGWTYSGTTGNQLDLIKPSSKGNITI  496

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y VPYSEHSSF EL+ FVKF+ P  IIP+VN   P S  KM
Sbjct  497   YGVPYSEHSSFPELRDFVKFLKPDKIIPTVNAGNPTSREKM  537


 Score =   105 bits (261),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 68/107 (64%), Gaps = 1/107 (1%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGTPF VDAF+      CS +FL+HFH DHY GL++ + HG IYC+ +TA+LV 
Sbjct  209   PSYKKIPGTPFTVDAFRRGPIEGCSAYFLSHFHHDHYGGLSKKWSHGPIYCTPLTARLVK  268

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
             M + +    I+ L L+    I G  VT  +ANHCPGA +I F  SNG
Sbjct  269   MCLSVNALYIRPLELDAEHVIEGTKVTLLEANHCPGAALIHFRLSNG  315



>ref|XP_009474331.1| PREDICTED: DNA cross-link repair 1A protein [Nipponia nippon]
Length=996

 Score =   156 bits (395),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 85/214 (40%), Positives = 126/214 (59%), Gaps = 10/214 (5%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P+    ++HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  763   ILHTGDFRADPSMERYPALIGQQVHTLYLDTTYCSPEYTFPSQQEVIQFAVNTAFETVTL  822

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE-  1710
             NPRTL + G+Y IGKE++F+ IA  L  K  ++  K + LQCL    E     +L  ++ 
Sbjct  823   NPRTLVVCGTYAIGKEKVFLAIAEVLGSKASMSRDKYKTLQCL----ESAAVNSLISVDW  878

Query  1711  --SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGT  1881
               + +HV+P+  + NFK L    N++   +  ++A  PTGW+     +     + Q +G 
Sbjct  879   DGTLLHVLPMMQI-NFKGLQDHLNKFSANFDQVLAFKPTGWTYSDSCRSLVDIKPQTRGK  937

Query  1882  IIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  938   ITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  971


 Score =   108 bits (269),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 70/114 (61%), Gaps = 2/114 (2%)
 Frame = +3

Query  1002  KNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGK  1178
             +   + T+ K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT++F    
Sbjct  643   RTTGEETRKKHCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYCGLTKNFMF-P  701

Query  1179  IYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILF  1340
             IYC+ +T  LV  K+ +    I +LP++    + GI V   DANHCPGA +ILF
Sbjct  702   IYCNKITGNLVKSKLRVQEQYIHVLPMDTECIVNGIKVLLLDANHCPGATMILF  755



>ref|XP_005520813.1| PREDICTED: DNA cross-link repair 1A protein [Pseudopodoces humilis]
Length=945

 Score =   158 bits (399),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 89/217 (41%), Positives = 127/217 (59%), Gaps = 16/217 (7%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR    M   P+    K+HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  712   ILHTGDFRADPSMERYPALMGQKVHTLYLDTTYCSPEYTFPSQQEVIQFAVNIAFETVTL  771

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K  ++  K + LQCL   +      +++   +
Sbjct  772   NPRTLVVCGTYSIGKEKVFLAIAEVLGSKASMSRDKYKTLQCLE-SEAVNSLISVDWKGT  830

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGKRWQ  1872
              +HV+P+  + NFK L    N++   +  I+A  PTGW       SL   K +T GK   
Sbjct  831   LLHVLPMMQI-NFKGLQDHLNRFSENFDQILAFKPTGWTYSDSCLSLEDIKPQTRGK---  886

Query  1873  QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
                I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  887   ---ITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  920


 Score =   106 bits (265),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 70/112 (63%), Gaps = 2/112 (2%)
 Frame = +3

Query  1029  KDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAK  1205
             K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT++F    IYC+ VT  
Sbjct  601   KHCPFYKKIPGTGFTVDAFRYGEIEGCTAYFLTHFHSDHYCGLTKNF-RFPIYCNKVTGN  659

Query  1206  LVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             LV  K+ +    + +LP++ +  + GI V   DANHCPGA +ILF   +G +
Sbjct  660   LVKSKLRVQEQYVHVLPMDTQCVVDGIKVLLLDANHCPGATMILFYLPSGAV  711



>ref|XP_002718799.1| PREDICTED: DNA cross-link repair 1A protein [Oryctolagus cuniculus]
Length=1043

 Score =   159 bits (401),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 91/212 (43%), Positives = 126/212 (59%), Gaps = 7/212 (3%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  +  ME       K+H L LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  813   MLHTGDFR-ANPSMERSLLAGQKVHVLYLDTTYCSPEYTFPSQQEVIQFAINTAFEAVTL  871

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K + L+CL  P E     T +   S
Sbjct  872   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSQEKYKTLRCLNIP-EINSLITTDMCNS  930

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQQ--GTII  1887
              +H++P+  + NFK L     ++ G+Y  I+A  PTGW+    K  T      Q  G I 
Sbjct  931   LVHLLPMMQI-NFKGLQSHLKKFGGKYDEILAFRPTGWTHSD-KLTTMADVIPQTKGNIS  988

Query  1888  RYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              Y +PYSEHSSF E+K+FV+++ P  IIP+VN
Sbjct  989   IYGIPYSEHSSFLEMKRFVQWLKPQKIIPTVN  1020


 Score =   105 bits (263),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 71/118 (60%), Gaps = 2/118 (2%)
 Frame = +3

Query  1011  AKSTKYKDIPVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYC  1187
             A+  + +  P +  IPGT F VDAF+Y +   CS +FLTHFH+DHY GL+++     +YC
Sbjct  696   ARELRKRTCPFYKKIPGTGFTVDAFQYGMIEGCSAYFLTHFHSDHYAGLSKNSTF-PVYC  754

Query  1188  SSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
             + +T  L+  K+ +    I  LP++    + G+ V   DANHCPGA +ILF   NG +
Sbjct  755   TEITGNLLKNKLHVQEQYIHTLPMDTECVVNGVKVVLLDANHCPGAAMILFHLPNGTV  812



>ref|XP_006200255.1| PREDICTED: LOW QUALITY PROTEIN: DNA cross-link repair 1A protein 
[Vicugna pacos]
Length=1052

 Score =   156 bits (394),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 87/211 (41%), Positives = 124/211 (59%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       ++HTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  822   ILHTGDFR-ADPTMERSLLADHRVHTLYLDTTYCSPEYTFPSQQEVIQFAINTAFETVTL  880

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y+IGKE++F+ IA  L  K+ ++  K + LQCL   + +    T +   S
Sbjct  881   NPRALVVCGTYSIGKEKVFLAIADVLGSKVGMSKEKYKTLQCLNILEMN-SLITTDMCNS  939

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L        G+Y+ I+A  PTGW+             Q +G I  
Sbjct  940   LVHLLPMMQI-NFKGLQNHLKTCGGKYNQILAFRPTGWTHSNKLTSIADVIPQTKGNISI  998

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  999   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1029


 Score =   108 bits (270),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 75/123 (61%), Gaps = 2/123 (2%)
 Frame = +3

Query  990   KSVKKNPAKSTKYKDIPVWCSIPGTPFRVDAFKYLRRD-CSHWFLTHFHADHYQGLTRSF  1166
             K+ + + A   + +  P +  IPGT F VDAF+Y   + C+ +FLTHFH+DHY GL+++F
Sbjct  698   KTPESDHAGELRKRTCPFYKKIPGTGFTVDAFQYGHVEGCTAYFLTHFHSDHYAGLSKNF  757

Query  1167  CHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEP  1346
                 +YCS +T  LV  K+ +    I  LP++    + G+ +   DANHCPGA++ILF  
Sbjct  758   TF-PVYCSEITGNLVKSKLRVQEQYIHALPIDTECIVNGVKIILLDANHCPGAVMILFRL  816

Query  1347  SNG  1355
              NG
Sbjct  817   PNG  819



>ref|XP_009948705.1| PREDICTED: DNA cross-link repair 1A protein [Leptosomus discolor]
Length=974

 Score =   157 bits (396),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 94/230 (41%), Positives = 130/230 (57%), Gaps = 28/230 (12%)
 Frame = +1

Query  1336  SLNHPMAVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-  1512
             SL     +LHTGDFR    M   P+    ++HTL LDTTYC+P+Y FP Q  VIQF +  
Sbjct  734   SLPSGTVILHTGDFRADPSMERYPALVGQQVHTLYLDTTYCSPEYTFPSQQEVIQFAVNT  793

Query  1513  AIQAEAFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFF  1692
             A +    NPRTL + G+Y+IGKE++F+ IA  L  K  V+  K + LQCL       +  
Sbjct  794   AFETVTLNPRTLVVCGTYSIGKEKVFLAIAEVLGSKASVSRDKYKTLQCL-------ESA  846

Query  1693  TLNELES------HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SL  1833
             T+N L S       +HV+P+  + NFK L    N++   +  ++A  PTGW       SL
Sbjct  847   TVNSLISVDWDGTLLHVLPMMQI-NFKGLQDHLNKFSENFDQVLAFKPTGWTYSDSCLSL  905

Query  1834  GKGKKKTPGKRWQQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
                K +T GK      I  Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  906   VDIKPQTRGK------ITIYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  949


 Score =   107 bits (267),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 76/127 (60%), Gaps = 4/127 (3%)
 Frame = +3

Query  990   KSVKKNPA--KSTKYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTR  1160
             K  K+ PA  +  + K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT+
Sbjct  615   KKFKELPATGEGARKKHCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYCGLTK  674

Query  1161  SFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILF  1340
             +F    IYC+ +T  LV  K+ +    I +LP++    + GI V   DANHCPGA +ILF
Sbjct  675   NFSF-PIYCNKITGNLVKSKLRVKEQYIHVLPMDTECIVNGIKVLLLDANHCPGATMILF  733

Query  1341  EPSNGCL  1361
                +G +
Sbjct  734   SLPSGTV  740



>emb|CCA20296.1| DNA crosslink repair protein putative [Albugo laibachii Nc14]
Length=662

 Score =   159 bits (403),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 84/223 (38%), Positives = 127/223 (57%), Gaps = 13/223 (6%)
 Frame = +1

Query  1351  MAVLHTGDFRFCDEMMEIPSFQPC-----------KIHTLILDTTYCNPQYDFPKQDAVI  1497
             M+ LHTGDFRF   M+E P+ +P            ++  + LDTTY   ++DF  Q+ VI
Sbjct  419   MSFLHTGDFRFHPRMLEYPALRPFVDQESTQNEMQRLSGVYLDTTYAKSKFDFAPQEIVI  478

Query  1498  QFVIEAIQAEAFNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDE  1677
             + V+  ++      R +++ G+YTIGKER+F+E+A+   KK+ V+  K R+L C G+  E
Sbjct  479   KHVVGLMEKHYSTQRQMYIFGTYTIGKERVFMEVAKHFGKKMCVSKEKFRVLSCYGWDKE  538

Query  1678  DMQFFTLNELESHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSL-GKGKKKT  1854
             DM F T +  ++   V+P+ +L    RL+ +   Y  R+  +VA  PTGW+  G     +
Sbjct  539   DMDFITTDSGDTCFFVMPMHSL-RMDRLSGLLRSYSNRFDRVVAFRPTGWTFQGANASLS  597

Query  1855  PGKRWQQGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
               ++        Y +PYSEHSSFSEL +FVK   P  IIP+VN
Sbjct  598   KLQKDASDRFRVYGIPYSEHSSFSELCQFVKAFKPKTIIPTVN  640


 Score =   104 bits (260),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 77/134 (57%), Gaps = 8/134 (6%)
 Frame = +3

Query  975   MYSSNKSVKKNPAKSTKYKDIPV-----WCSIPGTP--FRVDAFKYLRRDCSH-WFLTHF  1130
             M S  KS KK    S   K +P      +  I GT   F VD F++  +D S  +FLTHF
Sbjct  284   MRSIGKSWKKPKLDSENAKRVPELKCPEYKIICGTKPRFIVDGFRFASKDLSSVYFLTHF  343

Query  1131  HADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDAN  1310
             H+DHY GLT+ F  G IYCS +TA LV MK+ +    I I+ +N  I I G++V   DAN
Sbjct  344   HSDHYIGLTKKFDAGTIYCSQITANLVMMKLRVDAKYICIVAMNTPIFIHGVEVIFLDAN  403

Query  1311  HCPGAIIILFEPSN  1352
             HCPGA IILF   N
Sbjct  404   HCPGACIILFRQKN  417



>ref|XP_010713110.1| PREDICTED: DNA cross-link repair 1A protein isoform X1 [Meleagris 
gallopavo]
Length=973

 Score =   158 bits (400),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 86/212 (41%), Positives = 126/212 (59%), Gaps = 4/212 (2%)
 Frame = +1

Query  1354  AVLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEA  1530
             A+LHTGDFR    M   P+    KIHTL LDTTYC+P+Y FP Q  VIQF +  A +   
Sbjct  739   AILHTGDFRADPSMERYPALIGQKIHTLYLDTTYCSPEYTFPSQQEVIQFAVNTAFEMVT  798

Query  1531  FNPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELE  1710
              NPRTL + G+Y+IGKE++F+ IA  L  K  ++  K + LQCL     +    ++N   
Sbjct  799   LNPRTLVVCGTYSIGKEKVFLAIAEVLGSKASMSRDKYKTLQCLESAAIN-SLISMNWDG  857

Query  1711  SHIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTII  1887
             + +H++P+  + NFK L    N++   +  ++A  PTGW+           + Q +G I 
Sbjct  858   TLLHILPMMQI-NFKGLQDHLNKFSENFDQVLAFKPTGWTYSDSCLSVMDIKPQTRGKIT  916

Query  1888  RYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
              Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  917   IYGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  948


 Score =   105 bits (263),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 67/107 (63%), Gaps = 2/107 (2%)
 Frame = +3

Query  1023  KYKDIPVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVT  1199
             + K  P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT++F    +YC+ +T
Sbjct  627   RKKQCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYCGLTKNFVF-PLYCNKIT  685

Query  1200  AKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILF  1340
               LV  K+ +    I +LP++    + GI V   DANHCPGA +ILF
Sbjct  686   GNLVKSKLQVKEQYINVLPMDTECIVNGIKVLLLDANHCPGATMILF  732



>ref|XP_005958454.1| PREDICTED: DNA cross-link repair 1A protein [Pantholops hodgsonii]
Length=1049

 Score =   158 bits (400),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 91/221 (41%), Positives = 128/221 (58%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +    
Sbjct  819   ILHTGDFR-ADPSMERSLLACQKVHTLYLDTTYCSPEYSFPSQQEVIQFAINTAFETVTL  877

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NP+ L + G+Y+IGKE++F+ IA  L  K+ ++  K   LQC   P E     T +  +S
Sbjct  878   NPQALVVCGTYSIGKEKIFLAIADVLGSKVGMSKEKYNTLQCFNIP-EVSSLITTDMCKS  936

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y+ I+A  PTGW+             Q +G I  
Sbjct  937   LVHLLPMMQI-NFKGLQNHLKKCGGKYNQILAFRPTGWTHSNKLTSLADIIPQTKGNISI  995

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN    +S R M
Sbjct  996   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVNVGTLKSRRTM  1036


 Score =   105 bits (263),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 67/107 (63%), Gaps = 2/107 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKY-LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL+++F    IYCS +T  L+ 
Sbjct  711   PFYKKIPGTGFTVDAFQYGWVEGCTAYFLTHFHSDHYAGLSKNFMF-PIYCSEITGNLLK  769

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              K+ +    I  LP++    + GI V   DANHCPGA++ILF   NG
Sbjct  770   SKLHVQEQYIHPLPIDTECIVNGIKVILLDANHCPGAVMILFYLPNG  816



>ref|XP_007520073.1| PREDICTED: DNA cross-link repair 1A protein [Erinaceus europaeus]
Length=1026

 Score =   162 bits (411),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 128/221 (58%), Gaps = 5/221 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       KIH L LDTTYC+P Y FP Q  VIQF I  A +A   
Sbjct  796   ILHTGDFR-ADPTMERSVLSGLKIHALYLDTTYCSPVYTFPSQQEVIQFAINTAFEAVTR  854

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K+ +T  K + L+CL  P E     T +   S
Sbjct  855   NPRTLVVCGTYSIGKEKVFLAIADILGSKVGMTQEKYKTLRCLNIP-EMNSLITTDMNSS  913

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++ +  + N K L     +Y G+Y  ++A  PTGW+             Q +G +  
Sbjct  914   QVHLLSMMQI-NIKSLQSHLKKYGGKYDQVLAFRPTGWTHSNKSVSLADVIPQTKGNVSI  972

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVNNHGPESTRKM  2013
             Y +PYSEHSS++ELK+FV+++ P  IIP+VN    ES + M
Sbjct  973   YGIPYSEHSSYTELKRFVQWLKPQKIIPTVNIGTIESRKTM  1013


 Score =   102 bits (253),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 69/208 (33%), Positives = 108/208 (52%), Gaps = 16/208 (8%)
 Frame = +3

Query  765   RKKIVHALSELR------KENTKEVEFQKNAKKAVVDDTSKVKLSKLITDYFQCSAAGTK  926
             ++K   +LS+L        E+  E+  Q+  ++   D+  +    K   D F  + A ++
Sbjct  591   KRKAEKSLSDLELDTNSLNESQLELPNQRRKRRKRSDNLQEGAHRKRSDDLF--NKAESE  648

Query  927   KVHAT---SCGQNEVGRSLMYSSNKSVKKNP-AKSTKYKDIPVWCSIPGTPFRVDAFKY-  1091
              VH     +  ++  GR L    N  + ++P A   + +  P +  IPGT F VDAF+Y 
Sbjct  649   AVHFNKYRNLKESATGRQL--KGNTKISESPTAGDLRKRTCPFYKKIPGTGFTVDAFQYG  706

Query  1092  LRRDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRI  1271
             L   C+ +FLTHFH+DHY GL++ F    IYCS +T  L+  K+ +    I  LP++   
Sbjct  707   LVEGCTAYFLTHFHSDHYAGLSKKFTF-PIYCSEITGNLLKNKLHVQEQYIHPLPMDTEC  765

Query  1272  NIAGIDVTCFDANHCPGAIIILFEPSNG  1355
              +  + V   DANHCPGA++ILF   NG
Sbjct  766   VVNNVTVVLLDANHCPGAVMILFYLLNG  793



>gb|AAF64472.1|AF241240_1 SNM1 protein [Mus musculus]
Length=1023

 Score =   166 bits (420),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 126/211 (60%), Gaps = 5/211 (2%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             +LHTGDFR  D  ME       K+HTL LDTTYC+P+Y FP Q  VIQF I  A +A   
Sbjct  793   ILHTGDFR-ADPSMERSRLAGRKVHTLFLDTTYCSPEYTFPSQQEVIQFAINTAFEAVTL  851

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPR L + G+Y IGKE++F+ IA  L  K+ ++  K + LQCL  P E     T +  +S
Sbjct  852   NPRALVVCGTYCIGKEKVFLAIADVLGSKVGMSQEKYKTLQCLNIP-EVSSLITTDMCDS  910

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGWSLGKGKKKTPGKRWQ-QGTIIR  1890
              +H++P+  + NFK L     +  G+Y  I+A  PTGW+       T     Q +G I  
Sbjct  911   LVHLLPMMQI-NFKGLQSHLKKCGGKYDQILAFRPTGWTHSNNITSTADIIPQTRGNISI  969

Query  1891  YEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
             Y +PYSEHSS+ E+K+FV+++ P  IIP+VN
Sbjct  970   YGIPYSEHSSYLEMKRFVQWLKPQKIIPTVN  1000


 Score = 98.2 bits (243),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 67/109 (61%), Gaps = 2/109 (2%)
 Frame = +3

Query  1038  PVWCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRSFCHGKIYCSSVTAKLVN  1214
             P +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GL++ F    +YCS +T  L+ 
Sbjct  685   PFYKRIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYAGLSKDFTR-PVYCSEITGNLLK  743

Query  1215  MKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFEPSNGCL  1361
              K+ +    I+ LP++    +  + V   DANHCPGA +ILF+  NG +
Sbjct  744   KKLRVQEQYIRQLPMDTECVVDSVKVVFVDANHCPGATMILFQLPNGAV  792



>ref|XP_008947360.1| PREDICTED: DNA cross-link repair 1A protein [Merops nubicus]
Length=994

 Score =   158 bits (399),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 127/217 (59%), Gaps = 16/217 (7%)
 Frame = +1

Query  1357  VLHTGDFRFCDEMMEIPSFQPCKIHTLILDTTYCNPQYDFPKQDAVIQFVIE-AIQAEAF  1533
             VLHTGDFR    M   P+    ++HTL LDTTYC+P+Y FP Q  VIQF +  A +    
Sbjct  761   VLHTGDFRADPSMERHPALLAQQVHTLYLDTTYCSPEYTFPSQQEVIQFAVNTAFETVTL  820

Query  1534  NPRTLFLIGSYTIGKERLFVEIARALCKKIYVTAAKLRILQCLGFPDEDMQFFTLNELES  1713
             NPRTL + G+Y+IGKE++F+ IA  L  K  ++  K + LQCL     +    +++   +
Sbjct  821   NPRTLIVCGTYSIGKEKVFLAIAEVLGSKASMSRDKYKTLQCLESAAVN-SLISVDWQGT  879

Query  1714  HIHVVPLWTLANFKRLNQISNQYMGRYSLIVAISPTGW-------SLGKGKKKTPGKRWQ  1872
              +HV+P+  + NFK L    N++   +  +VA  PTGW       SL   K +T GK   
Sbjct  880   LLHVLPMMQI-NFKSLQDHLNKFSENFDQVVAFKPTGWTYSDSCLSLVDIKPQTRGK---  935

Query  1873  QGTIIRYEVPYSEHSSFSELKKFVKFISPANIIPSVN  1983
                I  Y +PYSEHSS+ ELK+FV+++ P  IIP+VN
Sbjct  936   ---ITIYGIPYSEHSSYLELKRFVQWLKPQKIIPTVN  969


 Score =   106 bits (264),  Expect(2) = 8e-61, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 73/126 (58%), Gaps = 14/126 (11%)
 Frame = +3

Query  1023  KYKDIPV------------WCSIPGTPFRVDAFKYLR-RDCSHWFLTHFHADHYQGLTRS  1163
             KYKD+P             +  IPGT F VDAF+Y     C+ +FLTHFH+DHY GLT++
Sbjct  636   KYKDLPTTGEGARKKHCPFYKKIPGTGFTVDAFQYGEIEGCTAYFLTHFHSDHYCGLTKN  695

Query  1164  FCHGKIYCSSVTAKLVNMKIGIPWDNIQILPLNQRINIAGIDVTCFDANHCPGAIIILFE  1343
             F    IYC+ +T  LV  K+ +    + +LP++    + GI V   DANHCPGA ++LF 
Sbjct  696   FMF-PIYCNKITGNLVKSKLRVREQYVHVLPMDTECTVNGIKVLLLDANHCPGAAMLLFR  754

Query  1344  PSNGCL  1361
               +G +
Sbjct  755   LPSGAV  760



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7644097903856