BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16427_g1_i1 len=746 path=[125:0-70 196:71-94 22:95-745]

Length=746
                                                                      Score     E

gb|EYU24741.1|  hypothetical protein MIMGU_mgv1a016172mg                121   1e-30   
ref|XP_011070108.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    119   7e-30   
ref|XP_011081228.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    118   2e-29   
gb|EYU18564.1|  hypothetical protein MIMGU_mgv1a016162mg                118   2e-29   
ref|XP_007052129.1|  Bifunctional inhibitor/lipid-transfer protei...    116   2e-28   
ref|XP_011081229.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    115   3e-28   
ref|XP_006440349.1|  hypothetical protein CICLE_v10022832mg             115   4e-28   
ref|XP_006477234.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    114   7e-28   
ref|XP_010258985.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    114   8e-28   
ref|XP_010264242.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    114   1e-27   
gb|AEX33654.1|  lipid transfer protein                                  111   8e-27   
ref|XP_009775547.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    111   1e-26   
ref|XP_009595495.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    110   1e-26   
ref|XP_009595506.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    111   2e-26   
ref|XP_004245730.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    110   2e-26   
gb|KCW77749.1|  hypothetical protein EUGRSUZ_D02043                     110   3e-26   
ref|XP_010053451.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    109   4e-26   
ref|XP_010053929.1|  PREDICTED: 14 kDa proline-rich protein DC2.15      109   4e-26   
ref|XP_004306948.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    109   5e-26   
ref|XP_002271461.1|  PREDICTED: 14 kDa proline-rich protein DC2.15      109   6e-26   Vitis vinifera
ref|XP_009798523.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    109   6e-26   
emb|CBI31906.3|  unnamed protein product                                108   9e-26   
ref|XP_004245728.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    108   1e-25   
ref|XP_007218576.1|  hypothetical protein PRUPE_ppa013120mg             108   1e-25   
ref|XP_008362163.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    108   2e-25   
dbj|BAB16428.1|  P-rich protein EIG-I30                                 108   2e-25   Nicotiana tabacum [American tobacco]
ref|XP_008232632.1|  PREDICTED: lipid transfer protein EARLI 1-like     108   2e-25   
ref|XP_009375766.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    107   3e-25   
ref|XP_008232586.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    107   4e-25   
ref|XP_008232588.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    107   5e-25   
ref|XP_002511665.1|  14 kDa proline-rich protein DC2.15 precursor...    106   6e-25   Ricinus communis
ref|XP_004245749.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    106   7e-25   
ref|XP_004245729.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    106   7e-25   
ref|XP_009602607.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    106   9e-25   
ref|XP_004298648.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    105   2e-24   
ref|XP_004245752.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    105   2e-24   
ref|XP_007209690.1|  hypothetical protein PRUPE_ppa012402mg             106   2e-24   
gb|KDP28790.1|  hypothetical protein JCGZ_14561                         105   2e-24   
ref|XP_006355499.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    105   3e-24   
gb|EYU31726.1|  hypothetical protein MIMGU_mgv1a019851mg                104   3e-24   
dbj|BAF46299.1|  extensin like protein                                  104   3e-24   Ipomoea nil [qian niu]
ref|XP_006355500.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    104   4e-24   
ref|XP_008238562.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    104   4e-24   
ref|XP_008344389.1|  PREDICTED: lipid transfer protein EARLI 1-like     103   6e-24   
ref|XP_006847372.1|  hypothetical protein AMTR_s01045p00008470          103   8e-24   
gb|ABP35529.1|  proline-rich protein                                    103   1e-23   Ipomoea batatas [batate]
ref|XP_009373377.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    103   1e-23   
ref|XP_002270769.1|  PREDICTED: 14 kDa proline-rich protein DC2.15      102   1e-23   Vitis vinifera
ref|XP_009338026.1|  PREDICTED: vegetative cell wall protein gp1-...    107   2e-23   
ref|XP_008232631.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    102   2e-23   
ref|XP_009346905.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    101   5e-23   
ref|XP_009346906.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    101   5e-23   
ref|XP_009333675.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    102   6e-23   
ref|XP_002533292.1|  14 kDa proline-rich protein DC2.15 precursor...    101   6e-23   Ricinus communis
ref|XP_009333597.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    101   7e-23   
ref|XP_009795308.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    100   1e-22   
gb|KFK31985.1|  hypothetical protein AALP_AA6G185200                    100   1e-22   
ref|XP_010053452.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...    100   1e-22   
emb|CAA81526.1|  14 kDa polypeptide                                     100   1e-22   Catharanthus roseus [chatas]
ref|XP_011081227.1|  PREDICTED: pEARLI1-like lipid transfer prote...    100   1e-22   
emb|CAA59472.1|  hybrid proline-rich protein                            100   1e-22   Catharanthus roseus [chatas]
ref|XP_010676148.1|  PREDICTED: pEARLI1-like lipid transfer prote...    100   2e-22   
ref|XP_006841163.1|  hypothetical protein AMTR_s00086p00157840          100   2e-22   
ref|XP_006289141.1|  hypothetical protein CARUB_v10002564mg           99.0    4e-22   
ref|XP_002533293.1|  14 kDa proline-rich protein DC2.15 precursor...  98.6    5e-22   Ricinus communis
ref|XP_008786990.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  98.2    7e-22   
ref|XP_010093708.1|  hypothetical protein L484_019049                 98.2    7e-22   
ref|XP_006445312.1|  hypothetical protein CICLE_v10022835mg           98.2    7e-22   
ref|XP_007218581.1|  hypothetical protein PRUPE_ppa013196mg           98.2    8e-22   
ref|XP_008392581.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  98.2    9e-22   
ref|XP_004147199.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  98.2    9e-22   
ref|XP_010695115.1|  PREDICTED: putative lipid-binding protein AIR1B  97.4    1e-21   
gb|EYU30301.1|  hypothetical protein MIMGU_mgv1a018370mg              97.4    1e-21   
ref|XP_003588783.1|  14 kDa proline-rich protein DC2.15               98.2    1e-21   
ref|XP_003588785.1|  14 kDa proline-rich protein DC2.15               98.2    1e-21   
ref|NP_001233824.1|  arachidonic acid-induced DEA1 precursor          97.8    1e-21   
emb|CAN80712.1|  hypothetical protein VITISV_033379                   97.8    2e-21   Vitis vinifera
ref|XP_009589966.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  97.1    2e-21   
ref|XP_010088890.1|  hypothetical protein L484_020878                 97.4    2e-21   
ref|XP_002533291.1|  lipid binding protein, putative                  96.7    2e-21   Ricinus communis
gb|EYU30296.1|  hypothetical protein MIMGU_mgv1a015783mg              97.4    2e-21   
emb|CAI51313.1|  arachidonic acid-induced DEA1                        97.1    2e-21   Capsicum chinense [bonnet pepper]
gb|ABQ88334.1|  lipid transfer protein                                97.1    2e-21   Capsicum annuum
ref|XP_004235151.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  96.3    2e-21   
ref|XP_009388030.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  97.1    3e-21   
ref|XP_002533299.1|  14 kDa proline-rich protein DC2.15 precursor...  96.7    3e-21   Ricinus communis
ref|XP_008338137.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  96.7    3e-21   
ref|XP_006289733.1|  hypothetical protein CARUB_v10003301mg           96.7    4e-21   
ref|XP_006355477.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  96.7    4e-21   
ref|XP_006366743.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  96.3    4e-21   
ref|XP_011070106.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  96.3    4e-21   
gb|EPS71802.1|  hypothetical protein M569_02964                       96.7    5e-21   
ref|XP_003588779.1|  14 kDa proline-rich protein DC2.15               97.8    5e-21   
ref|XP_008238564.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  96.3    5e-21   
ref|XP_008232587.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  97.4    5e-21   
ref|XP_011001498.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.9    5e-21   
ref|XP_006369032.1|  HyPRP family protein                             95.9    5e-21   
ref|XP_006440347.1|  hypothetical protein CICLE_v10022825mg           95.9    5e-21   
ref|XP_004299468.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  96.7    6e-21   
ref|XP_003588784.1|  14 kDa proline-rich protein DC2.15               96.7    6e-21   
gb|AFK43955.1|  unknown                                               95.5    6e-21   
gb|AAD01800.1|  HyPRP                                                 96.3    6e-21   Fragaria x ananassa
ref|XP_009333630.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.9    7e-21   
ref|XP_007209745.1|  hypothetical protein PRUPE_ppa013010mg           95.9    7e-21   
gb|AES59035.2|  Lipid transfer protein                                96.7    7e-21   
ref|XP_002533294.1|  14 kDa proline-rich protein DC2.15 precursor...  95.9    8e-21   Ricinus communis
ref|XP_004299469.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.9    8e-21   
ref|XP_010906608.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.5    8e-21   
ref|XP_008448867.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.5    9e-21   
ref|XP_008808738.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.1    9e-21   
ref|XP_004299470.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.5    9e-21   
ref|XP_010422222.1|  PREDICTED: lipid transfer protein EARLI 1-li...  95.1    1e-20   
ref|XP_004242005.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.1    1e-20   
ref|XP_010433403.1|  PREDICTED: pEARLI1-like lipid transfer prote...  95.9    1e-20   
ref|XP_010422224.1|  PREDICTED: lipid transfer protein EARLI 1-like   95.1    1e-20   
gb|ABQ01426.1|  bimodular protein                                     95.9    1e-20   Medicago falcata [sickle alfalfa]
ref|XP_010919519.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.5    1e-20   
ref|XP_010455699.1|  PREDICTED: lipid transfer protein EARLI 1-like   95.1    1e-20   
ref|XP_010455698.1|  PREDICTED: lipid transfer protein EARLI 1-like   95.1    1e-20   
ref|XP_010099842.1|  hypothetical protein L484_008499                 94.7    1e-20   
gb|AAA32650.1|  bimodular protein                                     95.9    1e-20   Medicago sativa [alfalfa]
ref|XP_009411010.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  95.1    1e-20   
ref|XP_010422221.1|  PREDICTED: lipid transfer protein EARLI 1        95.5    1e-20   
ref|XP_010433379.1|  PREDICTED: lipid transfer protein EARLI 1-like   95.1    1e-20   
ref|XP_010933689.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.7    1e-20   
emb|CAN77080.1|  hypothetical protein VITISV_025477                   94.4    2e-20   Vitis vinifera
ref|XP_004498751.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.4    2e-20   
ref|XP_010041843.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.4    2e-20   
ref|XP_009376589.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.7    2e-20   
ref|XP_002436327.1|  hypothetical protein SORBIDRAFT_10g000510        94.4    2e-20   Sorghum bicolor [broomcorn]
ref|XP_008669243.1|  PREDICTED: uncharacterized protein LOC103646289  95.9    2e-20   
ref|XP_008381149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.4    2e-20   
ref|XP_002285197.1|  PREDICTED: putative lipid-binding protein At...  94.0    2e-20   Vitis vinifera
ref|XP_009333632.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.4    2e-20   
ref|XP_010676150.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.7    2e-20   
ref|XP_010433369.1|  PREDICTED: lipid transfer protein EARLI 1-like   94.0    3e-20   
ref|NP_566036.1|  protease inhibitor/seed storage/lipid transfer ...  94.0    3e-20   Arabidopsis thaliana [mouse-ear cress]
gb|EAY88189.1|  hypothetical protein OsI_09636                        95.1    3e-20   Oryza sativa Indica Group [Indian rice]
gb|KDP25650.1|  hypothetical protein JCGZ_20806                       93.6    3e-20   
ref|XP_010455695.1|  PREDICTED: pEARLI1-like lipid transfer prote...  94.7    3e-20   
dbj|BAG50511.1|  qLTG-3-1                                             95.1    3e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010093705.1|  hypothetical protein L484_019046                 93.2    3e-20   
ref|NP_001048668.1|  Os03g0103300                                     95.1    4e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002874775.1|  hypothetical protein ARALYDRAFT_490053           94.7    4e-20   
ref|XP_010422223.1|  PREDICTED: lipid transfer protein EARLI 1-li...  93.6    4e-20   
gb|ABF93505.1|  retrotransposon protein, putative, Ty1-copia subc...  94.7    4e-20   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ08379.1|  qLTG3-1                                              95.1    4e-20   
ref|XP_010422216.1|  PREDICTED: pEARLI1-like lipid transfer prote...  94.4    4e-20   
ref|XP_009598876.1|  PREDICTED: lipid transfer protein EARLI 1-like   92.4    4e-20   
ref|XP_010433390.1|  PREDICTED: lipid transfer protein EARLI 1-like   94.0    4e-20   
dbj|BAJ08384.1|  qLTG3-1                                              95.1    4e-20   
dbj|BAJ08383.1|  qLTG3-1                                              95.1    4e-20   
dbj|BAJ08381.1|  qLTG3-1                                              95.1    4e-20   
ref|XP_009796139.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  94.4    4e-20   
ref|XP_009616484.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.6    4e-20   
dbj|BAJ08382.1|  qLTG3-1                                              95.1    4e-20   
dbj|BAJ08386.1|  qLTG3-1                                              95.1    5e-20   
ref|XP_009388037.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.2    5e-20   
dbj|BAJ08385.1|  qLTG3-1                                              95.1    5e-20   
ref|XP_004298650.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.2    5e-20   
dbj|BAK05563.1|  predicted protein                                    94.7    5e-20   
tpg|DAA37198.1|  TPA: hypothetical protein ZEAMMB73_187029            93.6    5e-20   
ref|XP_008796819.1|  PREDICTED: lipid transfer protein EARLI 1-like   93.2    5e-20   
ref|XP_008786992.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.6    5e-20   
ref|NP_567391.1|  bifunctional inhibitor/lipid-transfer protein/s...  93.2    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_192984.1|  azelaic acid induced 1                              94.0    6e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008786988.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.2    6e-20   
emb|CDY31240.1|  BnaC08g15350D                                        93.2    6e-20   
ref|XP_010695114.1|  PREDICTED: lipid transfer protein EARLI 1-like   94.0    6e-20   
ref|XP_009333674.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.2    6e-20   
ref|XP_007161198.1|  hypothetical protein PHAVU_001G050300g           92.8    6e-20   
ref|XP_010919520.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.2    6e-20   
ref|XP_009623719.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.2    7e-20   
ref|XP_004235150.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.4    7e-20   
ref|XP_011036580.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.4    8e-20   
ref|XP_008796820.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.4    8e-20   
gb|KHG02760.1|  14 kDa proline-rich DC2                               92.8    8e-20   
ref|XP_009600481.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  93.6    8e-20   
dbj|BAA13150.1|  NT16 polypeptide                                     93.6    8e-20   Nicotiana tabacum [American tobacco]
gb|AFK41425.1|  unknown                                               92.8    8e-20   
dbj|BAA05471.1|  tumor-related protein                                91.3    9e-20   Nicotiana glauca x Nicotiana langsdorffii
ref|XP_009333598.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.8    9e-20   
ref|XP_002324869.2|  hypothetical protein POPTR_0018s01890g           92.4    9e-20   Populus trichocarpa [western balsam poplar]
ref|XP_003559027.1|  PREDICTED: putative glycine-rich cell wall s...  94.0    9e-20   
ref|NP_192985.1|  putative lipid transfer protein                     93.6    9e-20   Arabidopsis thaliana [mouse-ear cress]
gb|ABG91752.1|  HyPRP2                                                92.4    1e-19   Gossypium hirsutum [American cotton]
ref|XP_006295216.1|  hypothetical protein CARUB_v10024298mg           92.4    1e-19   
ref|XP_007052128.1|  Bifunctional inhibitor/lipid-transfer protei...  92.4    1e-19   
gb|KDP25651.1|  hypothetical protein JCGZ_20807                       94.7    1e-19   
ref|XP_010695112.1|  PREDICTED: lipid transfer protein EARLI 1-like   94.4    1e-19   
ref|XP_010422218.1|  PREDICTED: lipid transfer protein EARLI 1-like   92.8    1e-19   
emb|CDP19512.1|  unnamed protein product                              92.0    1e-19   
ref|XP_002271619.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    92.0    1e-19   Vitis vinifera
ref|XP_009801606.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.0    1e-19   
tpg|DAA42812.1|  TPA: hypothetical protein ZEAMMB73_664289            93.6    1e-19   
ref|XP_010695113.1|  PREDICTED: lipid transfer protein EARLI 1-like   93.2    1e-19   
ref|XP_009133710.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    92.0    1e-19   
ref|XP_010055514.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.0    1e-19   
ref|XP_007137003.1|  hypothetical protein PHAVU_009G092000g           92.8    1e-19   
emb|CDP09932.1|  unnamed protein product                              92.4    1e-19   
ref|XP_010430305.1|  PREDICTED: lipid transfer protein EARLI 1        92.4    2e-19   
ref|XP_006302912.1|  hypothetical protein CARUB_v10021046mg           92.8    2e-19   
ref|XP_010906606.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.7    2e-19   
ref|XP_006304906.1|  hypothetical protein CARUB_v10011959mg           92.0    2e-19   
ref|XP_009382414.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.0    2e-19   
ref|XP_008648736.1|  PREDICTED: pEARLI1-like lipid transfer prote...  91.7    2e-19   
ref|XP_011018292.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    92.0    2e-19   
ref|XP_010473467.1|  PREDICTED: lipid transfer protein EARLI 1-like   92.4    2e-19   
ref|XP_010418243.1|  PREDICTED: lipid transfer protein EARLI 1-like   92.4    2e-19   
ref|NP_176440.1|  bifunctional inhibitor/lipid-transfer protein/s...  92.0    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007039884.1|  Bifunctional inhibitor/lipid-transfer protei...  91.7    2e-19   
emb|CDX95635.1|  BnaC03g25160D                                        91.7    2e-19   
ref|XP_010695178.1|  PREDICTED: pEARLI1-like lipid transfer prote...  93.6    2e-19   
ref|XP_008448871.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.7    2e-19   
gb|KFK25909.1|  hypothetical protein AALP_AA8G178400                  92.0    2e-19   
ref|XP_004150818.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.7    2e-19   
ref|XP_006417266.1|  hypothetical protein EUTSA_v10009061mg           91.7    2e-19   
ref|XP_006368194.1|  HyPRP family protein                             91.7    2e-19   
ref|XP_004251936.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.3    2e-19   
ref|XP_006396753.1|  hypothetical protein EUTSA_v10029038mg           92.0    2e-19   
gb|KHN04347.1|  14 kDa proline-rich protein DC2.15                    91.3    2e-19   
ref|XP_010476166.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.7    2e-19   
ref|XP_006289038.1|  hypothetical protein CARUB_v10002422mg           92.0    2e-19   
ref|XP_002874777.1|  hypothetical protein ARALYDRAFT_911650           92.0    2e-19   
ref|XP_009110671.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    91.7    3e-19   
ref|XP_006396754.1|  hypothetical protein EUTSA_v10029528mg           92.0    3e-19   
ref|XP_011018291.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    91.3    3e-19   
gb|KDP25647.1|  hypothetical protein JCGZ_20803                       91.3    3e-19   
dbj|BAA11854.1|  extensin like protein                                91.7    3e-19   Populus nigra [black poplar]
ref|XP_009783445.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.0    3e-19   
ref|XP_010553463.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.7    3e-19   
ref|XP_010422217.1|  PREDICTED: lipid transfer protein EARLI 1-like   92.4    3e-19   
ref|XP_002880164.1|  hypothetical protein ARALYDRAFT_483654           91.3    3e-19   
ref|XP_009619251.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.0    3e-19   
ref|XP_009782706.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  92.0    3e-19   
ref|XP_009397884.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.3    3e-19   
ref|XP_004986077.1|  PREDICTED: putative glycine-rich cell wall s...  92.8    3e-19   
ref|XP_010264240.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.9    3e-19   
ref|XP_007039886.1|  14 kDa proline-rich protein DC2.15, putative     91.3    3e-19   
gb|KDP25648.1|  hypothetical protein JCGZ_20804                       93.6    3e-19   
ref|XP_010433400.1|  PREDICTED: lipid transfer protein EARLI 1-like   91.7    3e-19   
ref|XP_009148613.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.3    3e-19   
ref|XP_009796138.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.7    3e-19   
gb|KHN08148.1|  Putative lipid-binding protein                        92.0    3e-19   
gb|KFK43474.1|  hypothetical protein AALP_AA1G129700                  91.3    4e-19   
ref|XP_010657904.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    92.8    4e-19   
ref|XP_008808739.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.9    4e-19   
ref|XP_009619252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.7    4e-19   
ref|XP_010053450.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    90.5    4e-19   
ref|XP_010919517.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.7    4e-19   
ref|XP_003525814.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.9    4e-19   
ref|XP_007155640.1|  hypothetical protein PHAVU_003G218800g           92.4    4e-19   
gb|EPS73889.1|  hypothetical protein M569_00868                       90.9    4e-19   
ref|XP_007155639.1|  hypothetical protein PHAVU_003G218800g           92.4    4e-19   
ref|XP_010055513.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.9    4e-19   
sp|P14009.1|14KD_DAUCA  RecName: Full=14 kDa proline-rich protein...  90.9    5e-19   Daucus carota [carrots]
ref|XP_004291445.1|  PREDICTED: uncharacterized protein LOC101307558  91.7    5e-19   
ref|XP_002874776.1|  hypothetical protein ARALYDRAFT_911648           92.0    5e-19   
ref|XP_008437113.1|  PREDICTED: pEARLI1-like lipid transfer prote...  90.5    5e-19   
ref|XP_006289530.1|  hypothetical protein CARUB_v10003073mg           91.3    5e-19   
ref|XP_008392579.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.5    5e-19   
ref|XP_011076346.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  91.3    5e-19   
emb|CDY21275.1|  BnaC03g29590D                                        90.5    5e-19   
ref|XP_006397698.1|  hypothetical protein EUTSA_v10001680mg           90.5    5e-19   
ref|XP_010506455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.5    5e-19   
ref|XP_006366172.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.1    6e-19   
ref|XP_010906607.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.1    6e-19   
ref|XP_003549907.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.5    6e-19   
ref|XP_006652622.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.1    6e-19   
ref|NP_001053511.1|  Os04g0554500                                     90.1    6e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010508203.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.1    6e-19   
emb|CBI38878.3|  unnamed protein product                              90.1    6e-19   
ref|XP_009134275.1|  PREDICTED: lipid transfer protein EARLI 1-like   90.1    6e-19   
ref|XP_011033953.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.5    7e-19   
ref|NP_001053512.1|  Os04g0554600                                     90.1    7e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002874779.1|  hypothetical protein ARALYDRAFT_911652           90.1    7e-19   
ref|XP_004152410.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.5    7e-19   
ref|XP_010455696.1|  PREDICTED: lipid transfer protein EARLI 1-like   90.9    7e-19   
ref|XP_010676151.1|  PREDICTED: putative lipid-binding protein AIR1B  90.1    8e-19   
gb|ADA67933.1|  putative 14 kDa proline-rich protein DC2.15           90.1    8e-19   
ref|XP_007155641.1|  hypothetical protein PHAVU_003G218900g           90.1    8e-19   
ref|XP_004291444.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.1    8e-19   
ref|XP_010553781.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.7    9e-19   
ref|XP_010518131.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.1    9e-19   
ref|NP_001238293.1|  uncharacterized protein LOC100527330 precursor   90.1    9e-19   
ref|XP_006368193.1|  hypothetical protein POPTR_0001s00400g           89.7    9e-19   
gb|EAY95110.1|  hypothetical protein OsI_16927                        89.7    9e-19   
gb|ACE82175.1|  extensin-like protein                                 89.7    9e-19   
gb|KFK37310.1|  hypothetical protein AALP_AA4G240600                  89.7    1e-18   
ref|XP_010493743.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.7    1e-18   
ref|XP_008437101.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.7    1e-18   
ref|XP_004291440.1|  PREDICTED: putative lipid-binding protein At...  90.5    1e-18   
ref|XP_006396750.1|  hypothetical protein EUTSA_v10029060mg           89.7    1e-18   
emb|CDY61290.1|  BnaCnng37610D                                        89.7    1e-18   
ref|NP_001237154.1|  uncharacterized protein LOC100500124 precursor   89.7    1e-18   
ref|XP_009134272.1|  PREDICTED: lipid transfer protein EARLI 1-like   90.5    1e-18   
ref|XP_009795761.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.7    1e-18   
ref|XP_009397888.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.4    1e-18   
ref|XP_009591583.1|  PREDICTED: pEARLI1-like lipid transfer prote...  89.7    1e-18   
gb|KHN04346.1|  14 kDa proline-rich protein DC2.15                    89.7    1e-18   
ref|XP_010264239.1|  PREDICTED: putative lipid-binding protein At...  89.4    1e-18   
ref|XP_010933688.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.4    1e-18   
dbj|BAK03206.1|  predicted protein                                    89.7    1e-18   
ref|NP_001235008.1|  uncharacterized protein LOC100499716 precursor   90.5    1e-18   
ref|XP_004245748.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.4    1e-18   
gb|KHN04345.1|  14 kDa proline-rich protein DC2.15                    90.1    1e-18   
gb|ACU21436.1|  unknown                                               90.1    1e-18   
gb|ADD11814.1|  hybrid proline-rich protein                           89.4    2e-18   
emb|CDY21274.1|  BnaC03g29580D                                        90.1    2e-18   
ref|XP_003525810.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  90.1    2e-18   
ref|XP_010544621.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    89.4    2e-18   
ref|XP_009795762.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.7    2e-18   
dbj|BAP16240.1|  Os10g0554800                                         89.7    2e-18   
gb|EAY79472.1|  hypothetical protein OsI_34600                        89.7    2e-18   
ref|XP_003633921.2|  PREDICTED: putative lipid-binding protein At...  89.7    2e-18   
ref|XP_006355478.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.0    2e-18   
ref|XP_004235416.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.6    2e-18   
ref|NP_001065343.2|  Os10g0554800                                     89.7    2e-18   
ref|XP_010494894.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.0    2e-18   
ref|XP_002529775.1|  14 kDa proline-rich protein DC2.15 precursor...  89.4    2e-18   
ref|XP_004976454.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.0    2e-18   
ref|XP_009123402.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.0    2e-18   
emb|CDY32208.1|  BnaA03g54590D                                        89.0    2e-18   
gb|KDP25645.1|  hypothetical protein JCGZ_20801                       89.0    2e-18   
ref|XP_004291443.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.6    2e-18   
ref|XP_006355479.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.6    2e-18   
ref|XP_003526352.1|  PREDICTED: extensin-like                         90.9    2e-18   
ref|XP_002874778.1|  hypothetical protein ARALYDRAFT_911651           88.6    2e-18   
ref|NP_192986.1|  Bifunctional inhibitor/lipid-transfer protein/s...  89.7    2e-18   
ref|XP_008786991.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.6    2e-18   
ref|XP_004165754.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.0    2e-18   
ref|XP_006396751.1|  hypothetical protein EUTSA_v10029036mg           89.4    3e-18   
emb|CDY64848.1|  BnaC05g49400D                                        88.6    3e-18   
ref|XP_004516836.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.0    3e-18   
ref|XP_006289892.1|  hypothetical protein CARUB_v10003507mg           89.4    3e-18   
ref|XP_009783170.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.2    3e-18   
ref|XP_004245750.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.6    3e-18   
ref|XP_009795760.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  89.0    3e-18   
ref|NP_001047650.1|  Os02g0662000                                     88.6    3e-18   
gb|AIX10944.1|  PRP2-like protein                                     89.0    3e-18   
ref|XP_002271593.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    88.2    3e-18   
ref|XP_003608748.1|  14 kDa proline-rich protein DC2.15               89.4    3e-18   
gb|KDP25644.1|  hypothetical protein JCGZ_20800                       88.2    3e-18   
emb|CDX90833.1|  BnaA03g25130D                                        89.0    3e-18   
ref|XP_004235149.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.8    3e-18   
ref|XP_010519362.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.2    3e-18   
gb|AAC60566.1|  proline-rich SAC51                                    88.6    4e-18   
emb|CDY08680.1|  BnaC04g19890D                                        88.2    4e-18   
ref|XP_009113072.1|  PREDICTED: lipid transfer protein EARLI 1        88.6    4e-18   
gb|ACV74341.1|  proline-rich protein                                  88.2    4e-18   
ref|XP_004291441.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.6    4e-18   
emb|CAI48077.1|  extensin-like protein                                88.2    4e-18   
ref|XP_009601879.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.8    4e-18   
ref|XP_006289150.1|  hypothetical protein CARUB_v10002588mg           89.4    4e-18   
gb|AAM62750.1|  extA                                                  87.8    4e-18   
ref|XP_003608743.1|  14 kDa proline-rich protein DC2.15               88.2    4e-18   
ref|XP_009399043.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.8    4e-18   
ref|XP_003525817.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.8    4e-18   
ref|XP_002446915.1|  hypothetical protein SORBIDRAFT_06g024790        87.8    4e-18   
ref|XP_009617786.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.2    4e-18   
ref|XP_004516832.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  88.2    4e-18   
ref|XP_008646032.1|  PREDICTED: cortical cell-delineating protein...  87.8    4e-18   
ref|XP_010441524.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.8    5e-18   
ref|NP_199501.1|  Bifunctional inhibitor/lipid-transfer protein/s...  87.8    5e-18   
ref|XP_006391856.1|  hypothetical protein EUTSA_v10023747mg           88.2    5e-18   
ref|XP_008437106.1|  PREDICTED: lipid transfer protein EARLI 1-like   87.0    5e-18   
ref|XP_010455697.1|  PREDICTED: lipid transfer protein EARLI 1-like   88.2    5e-18   
ref|XP_004976456.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.4    5e-18   
ref|XP_002454527.1|  hypothetical protein SORBIDRAFT_04g032680        87.4    5e-18   
ref|XP_002446914.1|  hypothetical protein SORBIDRAFT_06g024780        87.4    5e-18   
ref|XP_007039887.1|  Bifunctional inhibitor/lipid-transfer protei...  87.8    6e-18   
gb|AFK37038.1|  unknown                                               87.8    6e-18   
ref|XP_008437108.1|  PREDICTED: lipid transfer protein EARLI 1-like   87.0    6e-18   
gb|EMS64339.1|  Cortical cell-delineating protein                     87.4    6e-18   
ref|NP_192987.1|  bifunctional inhibitor/lipid-transfer protein/s...  88.6    6e-18   
ref|XP_002454523.1|  hypothetical protein SORBIDRAFT_04g032640        87.0    6e-18   
ref|NP_001152585.1|  LOC100286225 precursor                           87.4    6e-18   
gb|ACN54400.1|  hybrid proline-rich protein                           87.4    7e-18   
ref|XP_010258987.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    87.4    7e-18   
gb|EMS61013.1|  Cortical cell-delineating protein                     87.4    7e-18   
gb|AAM75351.1|AF520576_1  extensin-like protein                       88.6    7e-18   
ref|XP_011039660.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.0    7e-18   
ref|XP_006600137.1|  PREDICTED: uncharacterized protein LOC100500...  87.4    7e-18   
ref|XP_006579357.1|  PREDICTED: uncharacterized protein LOC100499...  87.4    7e-18   
emb|CDY31241.1|  BnaC08g15360D                                        87.4    7e-18   
ref|XP_010493734.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.4    8e-18   
ref|XP_002454525.1|  hypothetical protein SORBIDRAFT_04g032660        87.0    8e-18   
ref|XP_004235155.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.7    8e-18   
ref|XP_011033419.1|  PREDICTED: putative lipid-binding protein At...  87.0    8e-18   
ref|XP_008663526.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.0    9e-18   
ref|XP_003549906.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.0    9e-18   
ref|XP_010494895.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.0    9e-18   
ref|XP_010493725.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.4    9e-18   
gb|KFK31980.1|  hypothetical protein AALP_AA6G184800                  87.8    9e-18   
gb|KHN33896.1|  14 kDa proline-rich protein DC2.15                    87.0    9e-18   
ref|NP_001152193.1|  cortical cell-delineating protein precursor      87.4    9e-18   
ref|NP_001238461.1|  uncharacterized protein LOC100499693 precursor   87.0    1e-17   
ref|XP_006417265.1|  hypothetical protein EUTSA_v10009083mg           87.0    1e-17   
ref|NP_001048667.1|  Os03g0103200                                     87.0    1e-17   
ref|XP_004516834.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.7    1e-17   
ref|XP_002454524.1|  hypothetical protein SORBIDRAFT_04g032650        86.7    1e-17   
ref|XP_004983700.1|  PREDICTED: keratin, type I cytoskeletal 9-like   89.0    1e-17   
ref|NP_199500.1|  bifunctional inhibitor/lipid-transfer protein/s...  86.7    1e-17   
emb|CDY21034.1|  BnaA08g24910D                                        86.7    1e-17   
gb|EYU30303.1|  hypothetical protein MIMGU_mgv1a016181mg              86.7    1e-17   
gb|EEE64488.1|  hypothetical protein OsJ_19338                        86.7    1e-17   
ref|XP_009110670.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    86.7    1e-17   
ref|XP_008238566.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.7    1e-17   
ref|XP_002467518.1|  hypothetical protein SORBIDRAFT_01g029450        88.6    1e-17   
gb|EAY88184.1|  hypothetical protein OsI_09631                        86.3    1e-17   
ref|XP_004976453.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.7    1e-17   
emb|CDP09931.1|  unnamed protein product                              86.3    1e-17   
gb|ACG33201.1|  cortical cell-delineating protein precursor           86.7    1e-17   
ref|XP_002309638.1|  hypothetical protein POPTR_0006s27220g           86.3    1e-17   
ref|XP_004516838.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  87.4    1e-17   
ref|XP_009782252.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.3    2e-17   
ref|XP_007155638.1|  hypothetical protein PHAVU_003G218700g           87.4    2e-17   
ref|XP_006376460.1|  hypothetical protein POPTR_0013s13240g           86.7    2e-17   
ref|NP_001152584.1|  cortical cell-delineating protein precursor      86.3    2e-17   
gb|AAK30571.1|AF346659_1  extensin-like protein                       86.7    2e-17   
gb|KDO61485.1|  hypothetical protein CISIN_1g047179mg                 86.3    2e-17   
ref|XP_010494893.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  86.3    2e-17   
ref|XP_009134276.1|  PREDICTED: putative lipid-binding protein AIR1   86.3    2e-17   
ref|XP_006282307.1|  hypothetical protein CARUB_v10028597mg           86.3    2e-17   
ref|XP_006653760.1|  PREDICTED: 36.4 kDa proline-rich protein-like    85.5    2e-17   
ref|XP_011002408.1|  PREDICTED: 36.4 kDa proline-rich protein iso...  87.0    2e-17   
gb|KHN09805.1|  14 kDa proline-rich protein DC2.15                    86.3    2e-17   
ref|XP_006306558.1|  hypothetical protein CARUB_v10012658mg           86.3    2e-17   
ref|XP_009114618.1|  PREDICTED: lipid transfer protein EARLI 1        87.0    2e-17   
ref|XP_010539640.1|  PREDICTED: lipid transfer protein EARLI 1-like   86.3    2e-17   
ref|XP_006440346.1|  hypothetical protein CICLE_v10022839mg           85.9    2e-17   
ref|XP_006289270.1|  hypothetical protein CARUB_v10002736mg           85.9    2e-17   
ref|XP_006380877.1|  hypothetical protein POPTR_0006s01020g           87.0    2e-17   
ref|XP_011090306.1|  PREDICTED: putative lipid-binding protein At...  85.9    2e-17   
ref|XP_009798258.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.9    2e-17   
ref|XP_006396747.1|  hypothetical protein EUTSA_v10029313mg           85.9    2e-17   
emb|CDX94514.1|  BnaC09g23220D                                        86.7    2e-17   
gb|AFW63295.1|  cortical cell-delineating protein                     85.9    3e-17   
ref|XP_003608741.1|  Cortical cell-delineating protein                85.9    3e-17   
ref|XP_006477231.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.9    3e-17   
ref|XP_003603362.1|  Proline-rich protein                             85.9    3e-17   
ref|XP_008437109.1|  PREDICTED: pEARLI1-like lipid transfer prote...  85.1    3e-17   
ref|XP_010553464.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    85.5    3e-17   
ref|XP_006375281.1|  hypothetical protein POPTR_0014s05870g           85.9    3e-17   
gb|ABK95307.1|  unknown                                               85.9    3e-17   
dbj|BAJ97112.1|  predicted protein                                    85.5    3e-17   
gb|AGQ04563.1|  LTP1                                                  85.9    3e-17   
ref|XP_006286053.1|  hypothetical protein CARUB_v10007585mg           85.9    3e-17   
ref|XP_011037359.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.9    3e-17   
ref|XP_010093706.1|  hypothetical protein L484_019047                 85.5    3e-17   
ref|XP_010448889.1|  PREDICTED: putative lipid-binding protein AIR1   85.5    3e-17   
gb|ABK95045.1|  unknown                                               86.7    3e-17   
gb|EMT32964.1|  Cortical cell-delineating protein                     85.5    3e-17   
gb|EAY95514.1|  hypothetical protein OsI_17360                        87.0    3e-17   
ref|XP_002511666.1|  14 kDa proline-rich protein DC2.15 precursor...  85.5    3e-17   
ref|XP_003559026.1|  PREDICTED: putative lipid-binding protein AIR1   85.9    3e-17   
gb|AGQ04564.1|  LTP1                                                  85.5    3e-17   
emb|CAE05204.3|  OSJNBa0070C17.11                                     85.9    3e-17   
ref|NP_001235642.1|  uncharacterized protein LOC100500016 precursor   85.5    3e-17   
ref|XP_006282240.1|  hypothetical protein CARUB_v10028513mg           85.5    3e-17   
ref|XP_010693053.1|  PREDICTED: ubiquitin carboxyl-terminal hydro...  91.7    3e-17   
gb|AGQ04562.1|  LTP1                                                  85.5    3e-17   
gb|EAY88183.1|  hypothetical protein OsI_09630                        85.5    4e-17   
ref|NP_001152564.1|  cortical cell-delineating protein precursor      85.5    4e-17   
ref|XP_009114615.1|  PREDICTED: putative lipid-binding protein AIR1   85.1    4e-17   
gb|EAY95515.1|  hypothetical protein OsI_17361                        85.9    4e-17   
ref|NP_001048666.1|  Os03g0103100                                     85.5    4e-17   
ref|XP_008658410.1|  PREDICTED: ctenidin-1-like                       87.4    4e-17   
ref|XP_011002404.1|  PREDICTED: 36.4 kDa proline-rich protein iso...  86.7    4e-17   
ref|XP_006282236.1|  hypothetical protein CARUB_v10028509mg           84.7    4e-17   
ref|XP_008437102.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.5    4e-17   
ref|XP_011081224.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.5    4e-17   
gb|EYU30298.1|  hypothetical protein MIMGU_mgv1a017316mg              84.0    4e-17   
ref|NP_001235888.1|  uncharacterized protein LOC100500033 precursor   85.1    4e-17   
ref|XP_004976455.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.1    4e-17   
ref|XP_002464967.1|  hypothetical protein SORBIDRAFT_01g029610        85.1    4e-17   
ref|XP_002446913.1|  hypothetical protein SORBIDRAFT_06g024770        85.1    4e-17   
ref|XP_009401672.1|  PREDICTED: pEARLI1-like lipid transfer prote...  85.1    4e-17   
gb|ABZ88708.1|  hypothetical HPS-like protein                         85.5    5e-17   
ref|XP_010919518.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.7    5e-17   
ref|XP_006347893.1|  PREDICTED: putative lipid-binding protein At...  84.7    5e-17   
ref|XP_008394102.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.7    5e-17   
gb|AFK47889.1|  unknown                                               84.3    5e-17   
ref|XP_010422226.1|  PREDICTED: putative lipid-binding protein AIR1   84.7    5e-17   
gb|AFK47547.1|  unknown                                               85.1    5e-17   
ref|NP_001053844.1|  Os04g0612300                                     86.7    5e-17   
gb|KDP28789.1|  hypothetical protein JCGZ_14560                       84.7    5e-17   
ref|XP_003608746.1|  14 kDa proline-rich protein DC2.15               85.1    5e-17   
ref|XP_009135928.1|  PREDICTED: putative lipid-binding protein AIR1   84.7    6e-17   
ref|XP_004152411.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  85.1    6e-17   
ref|XP_002863385.1|  hypothetical protein ARALYDRAFT_494287           84.7    6e-17   
ref|NP_001235027.1|  uncharacterized protein LOC100500229 precursor   84.7    6e-17   
ref|XP_008238565.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.3    6e-17   
ref|XP_002271792.1|  PREDICTED: 14 kDa proline-rich protein DC2.15    84.7    6e-17   
ref|XP_004229790.1|  PREDICTED: putative lipid-binding protein At...  84.3    6e-17   
gb|AGQ04556.1|  LTP1                                                  84.7    6e-17   
ref|XP_010258990.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.7    7e-17   
ref|NP_001235511.1|  uncharacterized protein LOC100500518 precursor   84.3    7e-17   
ref|XP_004152412.1|  PREDICTED: 14 kDa proline-rich protein DC2.1...  84.7    7e-17   
gb|EMS60376.1|  Cortical cell-delineating protein                     83.2    7e-17   



>gb|EYU24741.1| hypothetical protein MIMGU_mgv1a016172mg [Erythranthe guttata]
Length=132

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = +1

Query  163  MVSSTDVpcppppsgghghghhhgKAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCP  342
            MVSST VPCPPPPS  H H HHH KA CPKDTLKL VCANLLNDLVHLVVGSP K  CC 
Sbjct  22   MVSSTYVPCPPPPSHEHKHHHHHPKATCPKDTLKLGVCANLLNDLVHLVVGSPPKTPCCS  81

Query  343  LIDGLVDLDAAVCLCTAIKANVLGInlnvplslslvlnnCGKKVPEGFKCA  495
            LI GLVDL+AAVCLCTA+KANVLGINLNVP+SLSL+LN CGKKVP GF+CA
Sbjct  82   LIGGLVDLEAAVCLCTAVKANVLGINLNVPVSLSLLLNYCGKKVPSGFQCA  132



>ref|XP_011070108.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=137

 Score =   119 bits (299),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 73/87 (84%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KAKCPKDTLKL VCANLLNDLVHLVVG+P K  CC LI GL DL+AAVCLCTAIKANVLG
Sbjct  51   KAKCPKDTLKLGVCANLLNDLVHLVVGTPPKTPCCSLIGGLADLEAAVCLCTAIKANVLG  110

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLSL+LN CGKKVP GF+CA
Sbjct  111  INLNVPVSLSLLLNYCGKKVPSGFQCA  137



>ref|XP_011081228.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=133

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KAKCPKDTLKL VCANLLNDLVHLVVG+P K  CC LI+GL DL+AAVCLCTAIKANVLG
Sbjct  47   KAKCPKDTLKLGVCANLLNDLVHLVVGTPPKTPCCTLIEGLADLEAAVCLCTAIKANVLG  106

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLSL+LN CGKK P GF+CA
Sbjct  107  INLNVPVSLSLLLNYCGKKAPSGFQCA  133



>gb|EYU18564.1| hypothetical protein MIMGU_mgv1a016162mg [Erythranthe guttata]
Length=132

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CPKDTLKL VCANLLNDLVHLVVGSP K  CC LI GL DL+AAVCLCTA+KANVLG
Sbjct  46   KATCPKDTLKLGVCANLLNDLVHLVVGSPPKTPCCSLIGGLADLEAAVCLCTAVKANVLG  105

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLSL+LN CGKKVP GF+CA
Sbjct  106  INLNVPVSLSLLLNYCGKKVPSGFQCA  132



>ref|XP_007052129.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOX96286.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=139

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            A CP+DTLKL VCAN+LNDL+HLVVG+P K  CCPLI GL DL+AAVCLCTAIKAN+LGI
Sbjct  54   ASCPRDTLKLGVCANVLNDLIHLVVGTPPKTPCCPLIQGLADLEAAVCLCTAIKANILGI  113

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLNVP+SLSL+LN CGK VP+GF+CA
Sbjct  114  NLNVPVSLSLLLNYCGKNVPKGFQCA  139



>ref|XP_011081229.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=133

 Score =   115 bits (288),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KAKCPKDTLKL VCANLLNDLVHLVVG+P K  CC LI GL DL+AAVCLCTAIKANVLG
Sbjct  47   KAKCPKDTLKLGVCANLLNDLVHLVVGTPPKTPCCTLIKGLADLEAAVCLCTAIKANVLG  106

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
             +LN+PLSLSL+LN CGKKVP GF+CA
Sbjct  107  NDLNIPLSLSLLLNYCGKKVPTGFQCA  133



>ref|XP_006440349.1| hypothetical protein CICLE_v10022832mg [Citrus clementina]
 gb|ESR53589.1| hypothetical protein CICLE_v10022832mg [Citrus clementina]
 gb|KDO61488.1| hypothetical protein CISIN_1g035808mg [Citrus sinensis]
Length=131

 Score =   115 bits (287),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K  CP+DTLKL VCAN+LNDLVHLVVG+P K  CC LI GLVDL+AAVCLCTAIKAN+LG
Sbjct  45   KPTCPRDTLKLGVCANVLNDLVHLVVGTPPKTPCCSLIKGLVDLEAAVCLCTAIKANILG  104

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLSL+LN CGKKVP GF+CA
Sbjct  105  INLNVPVSLSLLLNFCGKKVPSGFQCA  131



>ref|XP_006477234.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
Length=134

 Score =   114 bits (285),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K  CP+DTLKL VCAN+LNDLVHLVVG+P K  CC LI GLVDL+AAVCLCTAIKAN+LG
Sbjct  48   KPTCPRDTLKLGVCANVLNDLVHLVVGTPPKTPCCSLIKGLVDLEAAVCLCTAIKANILG  107

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLSL+LN CGKKVP GF+CA
Sbjct  108  INLNVPVSLSLLLNFCGKKVPSGFQCA  134



>ref|XP_010258985.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=137

 Score =   114 bits (285),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP+DTLKL VCANLLNDLVHLVVG+P K  CC LI+GL DL+AAVCLCTAIKAN+LGI+
Sbjct  53   SCPRDTLKLGVCANLLNDLVHLVVGTPPKYPCCSLIEGLADLEAAVCLCTAIKANILGIH  112

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNVP+SLSL+LN CGKKVP GF+CA
Sbjct  113  LNVPVSLSLLLNYCGKKVPSGFQCA  137



>ref|XP_010264242.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=133

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP+DTLKL VCANLLNDLVHLV+G+P K  CC LI+GL DL+AAVCLCTAIKAN+LGI+
Sbjct  49   SCPRDTLKLGVCANLLNDLVHLVIGTPPKYPCCTLIEGLADLEAAVCLCTAIKANILGIH  108

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNVP+SLSL+LN CGKKVP GF+CA
Sbjct  109  LNVPVSLSLLLNYCGKKVPSGFQCA  133



>gb|AEX33654.1| lipid transfer protein [Uromyces hobsonii]
Length=137

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K KCPKDTLKL VCANLLNDLVHLVVG+P K  CC L+ GL DL+AA+CLCTAIKANVLG
Sbjct  48   KGKCPKDTLKLGVCANLLNDLVHLVVGAPPKTPCCTLLKGLADLEAALCLCTAIKANVLG  107

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVP+SLSL+LN CGKKVP GF+C
Sbjct  108  INLNVPVSLSLLLNYCGKKVPTGFQC  133



>ref|XP_009775547.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=154

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 79/88 (90%), Gaps = 1/88 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGS-PAKAHCCPLIDGLVDLDAAVCLCTAIKANVL  411
            K KCPKDTLKLKVCANLLNDLVHLV+GS PAK  CC LI GL DLDAAVCLCTAIKAN+L
Sbjct  67   KGKCPKDTLKLKVCANLLNDLVHLVIGSDPAKTPCCSLIHGLADLDAAVCLCTAIKANLL  126

Query  412  GInlnvplslslvlnnCGKKVPEGFKCA  495
            GINLNVPLSLSL+LNNCGK VP+ F+CA
Sbjct  127  GINLNVPLSLSLLLNNCGKYVPKDFQCA  154



>ref|XP_009595495.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=137

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 76/88 (86%), Gaps = 1/88 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGS-PAKAHCCPLIDGLVDLDAAVCLCTAIKANVL  411
              KCPKDTLKL VCANLLNDLVHLV+GS PAK  CC LI GL D+DAAVCLCTAIKANVL
Sbjct  50   NGKCPKDTLKLNVCANLLNDLVHLVIGSSPAKTECCSLIQGLADVDAAVCLCTAIKANVL  109

Query  412  GInlnvplslslvlnnCGKKVPEGFKCA  495
            GINLNVPLSLSL+LNNCGK  P+ F+CA
Sbjct  110  GINLNVPLSLSLLLNNCGKYAPKNFQCA  137



>ref|XP_009595506.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=148

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 76/88 (86%), Gaps = 1/88 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGS-PAKAHCCPLIDGLVDLDAAVCLCTAIKANVL  411
              KCPKDTLKL VCANLLNDLVHLV+GS PAK  CC LI GL D+DAAVCLCTAIKANVL
Sbjct  61   NGKCPKDTLKLNVCANLLNDLVHLVIGSSPAKTECCSLIQGLADVDAAVCLCTAIKANVL  120

Query  412  GInlnvplslslvlnnCGKKVPEGFKCA  495
            GINLNVPLSLSL+LNNCGK  P+ F+CA
Sbjct  121  GINLNVPLSLSLLLNNCGKYAPKNFQCA  148



>ref|XP_004245730.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=138

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 1/88 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGS-PAKAHCCPLIDGLVDLDAAVCLCTAIKANVL  411
            K KCPKDTLKL  CANLL DL+HLVVGS PAK  CC LI+GLVDLDAAVCLCTA+KANVL
Sbjct  51   KGKCPKDTLKLNACANLLGDLLHLVVGSSPAKTQCCSLIEGLVDLDAAVCLCTALKANVL  110

Query  412  GInlnvplslslvlnnCGKKVPEGFKCA  495
            GINLNVPLSLSL+LNNCGK  P+ F+CA
Sbjct  111  GINLNVPLSLSLLLNNCGKYAPKNFQCA  138



>gb|KCW77749.1| hypothetical protein EUGRSUZ_D02043, partial [Eucalyptus grandis]
Length=147

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CP+DT+KL VCAN+L +L+HLVVG+P K  CC LI+GL DL+AAVCLCTAIKANVLG
Sbjct  61   KATCPRDTIKLGVCANVLKNLLHLVVGTPPKTPCCSLINGLADLEAAVCLCTAIKANVLG  120

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            +NLNVP+SLSL+LN CGKKVP GF+CA
Sbjct  121  LNLNVPVSLSLLLNYCGKKVPSGFQCA  147



>ref|XP_010053451.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=131

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CP+DT+KL VCAN+L +L+HLVVG+P K  CC LI+GL DL+AAVCLCTAIKANVLG
Sbjct  45   KATCPRDTIKLGVCANVLKNLLHLVVGTPPKTPCCSLINGLADLEAAVCLCTAIKANVLG  104

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            +NLNVP+SLSL+LN CGKKVP GF+CA
Sbjct  105  LNLNVPVSLSLLLNYCGKKVPSGFQCA  131



>ref|XP_010053929.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW78308.1| hypothetical protein EUGRSUZ_D02488 [Eucalyptus grandis]
Length=133

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            A CP+DTLKL VCANLLNDL+HLVVG+P K  CC LI+GL DL+AAVCLCTAIKAN+LG 
Sbjct  48   ATCPRDTLKLGVCANLLNDLLHLVVGTPPKTPCCSLIEGLADLEAAVCLCTAIKANILGN  107

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLN+P+SLSL+LN CG+ VP+GF+CA
Sbjct  108  NLNIPISLSLLLNYCGQGVPKGFQCA  133



>ref|XP_004306948.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=135

 Score =   109 bits (272),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 74/82 (90%), Gaps = 0/82 (0%)
 Frame = +1

Query  250  KDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInlnv  429
            KDTLKL VCANLLNDLVHLVVG+P K  CC LI+GLVDL+AAVCLCTA+KANVLGINLNV
Sbjct  54   KDTLKLGVCANLLNDLVHLVVGTPPKTPCCSLIEGLVDLEAAVCLCTALKANVLGINLNV  113

Query  430  plslslvlnnCGKKVPEGFKCA  495
            P+SLSL+LN CGK VP GF+CA
Sbjct  114  PISLSLLLNYCGKGVPAGFQCA  135



>ref|XP_002271461.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
Length=132

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CPKDTLKL VCA+LLNDL+H VVG+P K+ CC LI GL DL+AAVCLCTAIKANVLG
Sbjct  46   KAVCPKDTLKLGVCADLLNDLLHAVVGTPPKSPCCSLIGGLADLEAAVCLCTAIKANVLG  105

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            I LNVP+SLSL+LN CGKKVP G++CA
Sbjct  106  IKLNVPVSLSLLLNYCGKKVPTGYQCA  132



>ref|XP_009798523.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=137

 Score =   109 bits (272),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGS-PAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
             KCP DTLKL VCANLLNDLVHLV+GS PAK  CC LI GL DLDAAVCLCTAIKANVLG
Sbjct  51   GKCPNDTLKLNVCANLLNDLVHLVIGSSPAKTECCSLIQGLADLDAAVCLCTAIKANVLG  110

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVPLSLSL+LNNCGK  P+ F+CA
Sbjct  111  INLNVPLSLSLLLNNCGKYAPKDFQCA  137



>emb|CBI31906.3| unnamed protein product [Vitis vinifera]
Length=113

 Score =   108 bits (269),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
             A CPKDTLKL VCA+LLNDL+H VVG+P K+ CC LI GL DL+AAVCLCTAIKANVLG
Sbjct  27   SAVCPKDTLKLGVCADLLNDLLHAVVGTPPKSPCCSLIGGLADLEAAVCLCTAIKANVLG  86

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            I LNVP+SLSL+LN CGKKVP G++CA
Sbjct  87   IKLNVPVSLSLLLNYCGKKVPTGYQCA  113



>ref|XP_004245728.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=138

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGS-PAKAHCCPLIDGLVDLDAAVCLCTAIKANVL  411
            K KCPKDTLKL  CANLL DL+HLVVGS PAK  CC LI+GLVDLDAAVCLCTA+KANVL
Sbjct  51   KGKCPKDTLKLNACANLLGDLLHLVVGSSPAKTQCCSLIEGLVDLDAAVCLCTALKANVL  110

Query  412  GInlnvplslslvlnnCGKKVPEGFKC  492
            GINLN+PLSLSL+LNNCGK  P+ F+C
Sbjct  111  GINLNIPLSLSLLLNNCGKYAPKNFQC  137



>ref|XP_007218576.1| hypothetical protein PRUPE_ppa013120mg [Prunus persica]
 gb|EMJ19775.1| hypothetical protein PRUPE_ppa013120mg [Prunus persica]
Length=139

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CPKDTLKL VC  LLN LVHLVVG+P K  CC LI GL D++AAVCLCTAIKANVLG
Sbjct  53   KASCPKDTLKLGVCGALLNGLVHLVVGTPPKTPCCSLIGGLADVEAAVCLCTAIKANVLG  112

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLSL+LN CGK VP GF+CA
Sbjct  113  INLNVPVSLSLLLNYCGKSVPTGFQCA  139



>ref|XP_008362163.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=145

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CPKDTLKL VC +LLNDLV +VVG+P K  CC LI GL DL+AAVCLCTAIKANVLG
Sbjct  59   KASCPKDTLKLGVCGDLLNDLVTIVVGTPPKTPCCSLIGGLADLEAAVCLCTAIKANVLG  118

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INL+VP+SLSL+LN CGK VP GF+C+
Sbjct  119  INLDVPVSLSLLLNYCGKSVPNGFQCS  145



>dbj|BAB16428.1| P-rich protein EIG-I30 [Nicotiana tabacum]
Length=148

 Score =   108 bits (269),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/87 (83%), Positives = 77/87 (89%), Gaps = 1/87 (1%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGS-PAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
             KC KDTLKLKVCANLLNDLVHLV+GS PAK  CC LI GL DLDAAVCLCTAIKAN+LG
Sbjct  62   GKCSKDTLKLKVCANLLNDLVHLVIGSDPAKTPCCSLIHGLADLDAAVCLCTAIKANLLG  121

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVPLSLSL+LNNCGK VP+ F+CA
Sbjct  122  INLNVPLSLSLLLNNCGKYVPKDFQCA  148



>ref|XP_008232632.1| PREDICTED: lipid transfer protein EARLI 1-like [Prunus mume]
Length=175

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            A CPKDTLKL VC NLLNDLVHLVVG+P+K  CC LI GL D+DA VCLCTAIKANVLGI
Sbjct  90   ASCPKDTLKLGVCGNLLNDLVHLVVGTPSKTPCCSLIAGLSDVDATVCLCTAIKANVLGI  149

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLNVP+SLSL+LN CGK VP  F+CA
Sbjct  150  NLNVPVSLSLLLNYCGKSVPTDFQCA  175



>ref|XP_009375766.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=142

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CPKDTLKL VC +LLNDLV +VVG+P K  CC LI GL DL+AAVCLCTAIKANVLG
Sbjct  56   KASCPKDTLKLGVCGDLLNDLVTIVVGTPPKTPCCSLIGGLTDLEAAVCLCTAIKANVLG  115

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INL+VP+SLSL+LN CGK VP+GF+C+
Sbjct  116  INLDVPVSLSLLLNYCGKSVPKGFQCS  142



>ref|XP_008232586.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=139

 Score =   107 bits (266),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            +A CPKDTLKL VC +LLN+LVHLVVG+P K  CC LI GL DLDAA+CLCTAIKANVLG
Sbjct  53   QASCPKDTLKLGVCGDLLNELVHLVVGTPRKTPCCSLIAGLGDLDAAICLCTAIKANVLG  112

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            +NLNVP+SLSL+LN CGK VP  F+CA
Sbjct  113  VNLNVPVSLSLLLNYCGKSVPTDFQCA  139



>ref|XP_008232588.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=139

 Score =   107 bits (266),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CPKDTLKL VC +LLN LVHLV+G+P K  CC LI GL D++AAVCLCTAIKANVLG
Sbjct  53   KASCPKDTLKLGVCGDLLNGLVHLVMGTPPKTPCCSLIGGLADVEAAVCLCTAIKANVLG  112

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVP+SLSL+LN CGK VP GF+C
Sbjct  113  INLNVPVSLSLLLNYCGKSVPTGFQC  138



>ref|XP_002511665.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF50334.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=139

 Score =   106 bits (265),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
              CPK+ LKL VCA+LLNDLVHLVVG+P K  CCPLI GL DL+AAVCLCTA+KAN+LGI
Sbjct  54   GSCPKNALKLGVCADLLNDLVHLVVGTPPKEPCCPLIQGLADLEAAVCLCTALKANILGI  113

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLNVP+SLSL+LN CGK VP GF+CA
Sbjct  114  NLNVPVSLSLLLNYCGKGVPAGFQCA  139



>ref|XP_004245749.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=140

 Score =   106 bits (265),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 68/86 (79%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGS-PAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
             KCPKDTLKL  CANLL DL+HLVVGS PAK  CC LI+GLVDLDAAVCLCTA+KANVLG
Sbjct  54   GKCPKDTLKLNACANLLGDLLHLVVGSSPAKTQCCSLIEGLVDLDAAVCLCTALKANVLG  113

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLN+PLSLSL+LNNCGK  P+ F+C
Sbjct  114  INLNIPLSLSLLLNNCGKYAPKNFQC  139



>ref|XP_004245729.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=135

 Score =   106 bits (264),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 77/88 (88%), Gaps = 1/88 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGS-PAKAHCCPLIDGLVDLDAAVCLCTAIKANVL  411
            K +CPKDTLKL  CANLL DL+HL++GS P+K  CC LI+GLVDLDAAVCLCTA+KAN+L
Sbjct  48   KGECPKDTLKLNACANLLGDLLHLIIGSSPSKTQCCSLIEGLVDLDAAVCLCTALKANLL  107

Query  412  GInlnvplslslvlnnCGKKVPEGFKCA  495
            GINLN+PLSLSL+LNNCGK  P+ F+CA
Sbjct  108  GINLNLPLSLSLLLNNCGKYAPKDFQCA  135



>ref|XP_009602607.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=148

 Score =   106 bits (265),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 76/87 (87%), Gaps = 1/87 (1%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGS-PAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
             KC KDTLKLK CANLLNDLVHLV+GS PAK  CC LI GL DLDAAVCLCTAIKAN+LG
Sbjct  62   GKCSKDTLKLKACANLLNDLVHLVIGSDPAKTPCCSLIHGLADLDAAVCLCTAIKANLLG  121

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVPLSLSL+LNNCGK VP+ F+CA
Sbjct  122  INLNVPLSLSLLLNNCGKYVPKDFQCA  148



>ref|XP_004298648.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=138

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CPKDTLKL  CA++LN LVHLVVG P K  CC LI GLVDLDAAVCLCTAIKANVLG
Sbjct  53   KAVCPKDTLKLGACADVLNGLVHLVVGPP-KFPCCSLIQGLVDLDAAVCLCTAIKANVLG  111

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLSL+LN CGKKVP G++CA
Sbjct  112  INLNVPVSLSLLLNYCGKKVPSGYECA  138



>ref|XP_004245752.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=146

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/86 (80%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGS-PAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
             KCPKDTLKL  CANLLNDLVHLV+GS PAK  CC LI GL DLDAAVCLCTA+KAN+LG
Sbjct  61   GKCPKDTLKLNACANLLNDLVHLVIGSSPAKTKCCSLIHGLADLDAAVCLCTALKANLLG  120

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVPLSLSL+LNNCGK VP+ F+C
Sbjct  121  INLNVPLSLSLLLNNCGKYVPKDFQC  146



>ref|XP_007209690.1| hypothetical protein PRUPE_ppa012402mg [Prunus persica]
 gb|EMJ10889.1| hypothetical protein PRUPE_ppa012402mg [Prunus persica]
Length=171

 Score =   106 bits (264),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            A CPKDTLKL  CA+LLN LVHLVVG P K  CC LI+GLVDLDAAVCLCTAIKANVLGI
Sbjct  87   ATCPKDTLKLGACADLLNGLVHLVVG-PPKFPCCSLIEGLVDLDAAVCLCTAIKANVLGI  145

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            +LN+P+SLSL+LN CGK+VP G++CA
Sbjct  146  HLNIPVSLSLLLNYCGKQVPSGYECA  171



>gb|KDP28790.1| hypothetical protein JCGZ_14561 [Jatropha curcas]
Length=135

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP DTLKL VCANLLNDLVHLV+G+P K  CCPL+ GL DL+AAVCLCTA+KA+VLG+N
Sbjct  51   SCPIDTLKLGVCANLLNDLVHLVLGTPPKTPCCPLLQGLADLEAAVCLCTALKASVLGLN  110

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNVP+SLSL+LN CG+ VP GF+CA
Sbjct  111  LNVPISLSLLLNYCGQGVPAGFQCA  135



>ref|XP_006355499.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=139

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGS-PAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            KCPKDTLKL  CANLL DL+ LV+GS PAK  CC LI+GLVDLDAAVCLCTA+KANVLGI
Sbjct  54   KCPKDTLKLNACANLLGDLLQLVIGSSPAKTECCSLIEGLVDLDAAVCLCTALKANVLGI  113

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLN+PLSLSL+LNNCGK  P+ F+CA
Sbjct  114  NLNIPLSLSLLLNNCGKYAPKNFQCA  139



>gb|EYU31726.1| hypothetical protein MIMGU_mgv1a019851mg, partial [Erythranthe 
guttata]
Length=116

 Score =   104 bits (259),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -1

Query  497  YAHLKPSGTFFPQLLRTKLRERGTLRLIPNTLALMAVQRQTAASRSTRPSIRGQQWAF-A  321
            YAHLKP GTF  Q  R KL E GT RL+PNTLAL AVQRQTAASRS +P +R Q   F +
Sbjct  31   YAHLKPDGTFLSQAFRIKLSEMGTFRLMPNTLALTAVQRQTAASRSVKPPMRVQHGFFES  90

Query  320  GLPTTRWTKSFKRLAHTFNLSVSLGH  243
            G+PTT  TKSF + A   NL VSLGH
Sbjct  91   GVPTTMPTKSFSKFAQAPNLRVSLGH  116



>dbj|BAF46299.1| extensin like protein [Ipomoea nil]
Length=133

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K KCPKD LKL VCAN+L +L+ LVVG+P K  CC LI+GLVDL+AAVCLCTAIKAN+LG
Sbjct  47   KGKCPKDALKLGVCANVLGNLLGLVVGNPPKKPCCSLIEGLVDLEAAVCLCTAIKANILG  106

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVPLSLSL+LN CGKKVP GF+C
Sbjct  107  INLNVPLSLSLLLNVCGKKVPSGFQC  132



>ref|XP_006355500.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=140

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 75/89 (84%), Gaps = 2/89 (2%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVG--SPAKAHCCPLIDGLVDLDAAVCLCTAIKANV  408
            K KCP DTLKL  CANLL DL+HLV+G  SPAK  CC LI+GLVDLDAAVCLCTA+KAN+
Sbjct  52   KGKCPNDTLKLNACANLLGDLLHLVIGISSPAKTECCSLIEGLVDLDAAVCLCTALKANL  111

Query  409  LGInlnvplslslvlnnCGKKVPEGFKCA  495
            LGINLN+PLSL+L+LNNC K  P+ F+CA
Sbjct  112  LGINLNIPLSLNLLLNNCDKYAPKNFQCA  140



>ref|XP_008238562.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=142

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            A CPKDTLKL  CA+LLN LVHLVVG P K  CC LI+GLVDLDAAVCLCTAIKANVLGI
Sbjct  58   ATCPKDTLKLGACADLLNGLVHLVVGPP-KFPCCSLIEGLVDLDAAVCLCTAIKANVLGI  116

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            +LN+P+SLSL+LN CGK+VP G++CA
Sbjct  117  HLNIPVSLSLLLNYCGKQVPSGYECA  142



>ref|XP_008344389.1| PREDICTED: lipid transfer protein EARLI 1-like, partial [Malus 
domestica]
Length=136

 Score =   103 bits (258),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            +A CPKD LKL VC NLLNDLV++VVG+P K  CC L+ GL DL+AAVCLCTAIKANVLG
Sbjct  50   EASCPKDVLKLGVCGNLLNDLVNIVVGTPPKTPCCSLVGGLADLEAAVCLCTAIKANVLG  109

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INL+VP+SL L+LN CGK +P+GF C
Sbjct  110  INLDVPVSLGLLLNYCGKSIPKGFHC  135



>ref|XP_006847372.1| hypothetical protein AMTR_s01045p00008470 [Amborella trichopoda]
 gb|ERN08953.1| hypothetical protein AMTR_s01045p00008470 [Amborella trichopoda]
Length=134

 Score =   103 bits (257),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            CPKDTLKL VCA++L+ + HLV+G P+   CC L+DGLVDLD+AVCLCTA+KAN+LGI  
Sbjct  51   CPKDTLKLAVCADVLDGVAHLVIGGPSWKKCCSLLDGLVDLDSAVCLCTALKANILGIKH  110

Query  424  nvplslslvlnnCGKKVPEGFKCA  495
             + ++LSL++N CGKK+P+GFKCA
Sbjct  111  AIDVALSLLVNTCGKKLPKGFKCA  134



>gb|ABP35529.1| proline-rich protein [Ipomoea batatas]
Length=132

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K KCPKD LKL VCAN+L +L+ LVVG+P K  CC  I+GLVDL+AAVCLCTAIKANVLG
Sbjct  46   KGKCPKDALKLGVCANVLGNLLGLVVGNPPKKPCCSFIEGLVDLEAAVCLCTAIKANVLG  105

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVPLSLSL LN CGKKVP GF+C
Sbjct  106  INLNVPLSLSLFLNVCGKKVPFGFQC  131



>ref|XP_009373377.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009373378.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009346904.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=140

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 1/86 (1%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            A CP+DTLKL  CA++LN LVHLVVG P K  CC LI+GLVDLDAAVCLCTAIKANV+GI
Sbjct  56   ATCPRDTLKLGACADVLNGLVHLVVGPP-KFPCCSLIEGLVDLDAAVCLCTAIKANVMGI  114

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLN+P+SLSL+LN CGK+VP G++CA
Sbjct  115  NLNIPISLSLLLNYCGKQVPTGYECA  140



>ref|XP_002270769.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
 emb|CAN65287.1| hypothetical protein VITISV_042739 [Vitis vinifera]
Length=135

 Score =   102 bits (255),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CPKDTLKL VCANLL  L+  VVG+P K  CC LI GL DL+AAVCLCTAIKANVLG
Sbjct  49   KATCPKDTLKLGVCANLLGGLIGAVVGTPPKTPCCSLIQGLADLEAAVCLCTAIKANVLG  108

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLN+PLSLSL+LN C KKVP GF+CA
Sbjct  109  INLNIPLSLSLLLNVCSKKVPPGFQCA  135



>ref|XP_009338026.1| PREDICTED: vegetative cell wall protein gp1-like [Pyrus x bretschneideri]
Length=334

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            +A CPKD LKL VC NLLNDLV++VVG+P K  CC L+ GL DL+AAVCLCTAIKANVLG
Sbjct  248  EASCPKDVLKLGVCGNLLNDLVNIVVGTPPKTPCCSLVGGLADLEAAVCLCTAIKANVLG  307

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INL+VP+SL L+LN CGK VP+GF+C
Sbjct  308  INLDVPVSLGLLLNYCGKSVPKGFQC  333



>ref|XP_008232631.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=146

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            CPKDTLKL VC +LLNDLVH+VVG+  K  CC LI GL D+DAAVCLCTAIKANVLG+NL
Sbjct  63   CPKDTLKLGVCGDLLNDLVHVVVGTSQKTPCCSLITGLADVDAAVCLCTAIKANVLGVNL  122

Query  424  nvplslslvlnnCGKKVPEGFKCA  495
            NVP+SLSL+LN CGK VP  F+CA
Sbjct  123  NVPVSLSLLLNYCGKSVPTNFQCA  146



>ref|XP_009346905.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Pyrus x bretschneideri]
Length=142

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            +A CP DTLKL VCA++LN LVHLVVG P K  CC LI+GLVDLDAAVCLCTAIKANVLG
Sbjct  57   RATCPIDTLKLGVCADVLNGLVHLVVGPP-KFPCCSLIEGLVDLDAAVCLCTAIKANVLG  115

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            I+LNVP+SLSL+LN CGK+ P G++CA
Sbjct  116  IHLNVPVSLSLLLNYCGKQAPTGYECA  142



>ref|XP_009346906.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Pyrus x bretschneideri]
Length=140

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            +A CP DTLKL VCA++LN LVHLVVG P K  CC LI+GLVDLDAAVCLCTAIKANVLG
Sbjct  55   RATCPIDTLKLGVCADVLNGLVHLVVGPP-KFPCCSLIEGLVDLDAAVCLCTAIKANVLG  113

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            I+LNVP+SLSL+LN CGK+ P G++CA
Sbjct  114  IHLNVPVSLSLLLNYCGKQAPTGYECA  140



>ref|XP_009333675.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=153

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            +CP+DTLKL VCAN+LN L+++ VG+P    CC LI GLVDL+AAVCLCTAI+AN+LGIN
Sbjct  69   RCPRDTLKLGVCANVLNGLLNITVGNPPVQPCCSLIQGLVDLEAAVCLCTAIRANILGIN  128

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+PLSLSL+LN CG KVP GF+CA
Sbjct  129  LNIPLSLSLLLNVCGNKVPRGFQCA  153



>ref|XP_002533292.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29086.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=137

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            AKCP+DTLKL VC +LL DL+ + VG+P K  CC LI  LVDL+AAVCLCT IKA++LGI
Sbjct  52   AKCPRDTLKLGVCVDLLKDLLSVTVGTPPKTPCCSLIADLVDLEAAVCLCTTIKASLLGI  111

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NL+VP+ LSL+LN CGKKVPEGFKCA
Sbjct  112  NLSVPVDLSLLLNYCGKKVPEGFKCA  137



>ref|XP_009333597.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=145

 Score =   101 bits (251),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            +CP+DTLKL VCAN+LN L+++ VG+P    CC LI GLVDL+AAVCLCTAI+AN+LGIN
Sbjct  61   RCPRDTLKLGVCANVLNGLLNITVGNPPVQPCCSLIQGLVDLEAAVCLCTAIRANILGIN  120

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+PLSLSL+LN CG KVP+GF+CA
Sbjct  121  LNIPLSLSLLLNVCGNKVPKGFQCA  145



>ref|XP_009795308.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=132

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCP DTLKL VCAN+L +L+ LV+G+P K  CC LI G+ DL+AAVCLCTAIKAN+LGI
Sbjct  47   GKCPIDTLKLGVCANVLGNLLGLVIGNPPKKPCCTLIQGVADLEAAVCLCTAIKANILGI  106

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLNVPLSLSL+LN CGKKVP GF+CA
Sbjct  107  NLNVPLSLSLLLNVCGKKVPSGFQCA  132



>gb|KFK31985.1| hypothetical protein AALP_AA6G185200 [Arabis alpina]
Length=133

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCPKDT++L VCAN+L DL+ + +G+P    CC LIDGLVDL+AA CLCTA+KANVLGI
Sbjct  48   GKCPKDTIRLGVCANVLKDLLKIKLGTPPVKPCCSLIDGLVDLEAAACLCTALKANVLGI  107

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
             LN+P+SL+L+LN CGKKVP GFKCA
Sbjct  108  KLNIPISLNLLLNVCGKKVPSGFKCA  133



>ref|XP_010053452.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 gb|KCW77751.1| hypothetical protein EUGRSUZ_D02045 [Eucalyptus grandis]
Length=134

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K  CP+D LKL VCA+LLN LV++VVG+P K  CC L++GL DL+AAVCLCTAIKA+VLG
Sbjct  48   KPSCPRDALKLGVCADLLNGLVNIVVGTPPKTPCCSLLEGLADLEAAVCLCTAIKASVLG  107

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLSL+LN CGK VP GF+CA
Sbjct  108  INLNVPVSLSLLLNYCGKDVPYGFQCA  134



>emb|CAA81526.1| 14 kDa polypeptide [Catharanthus roseus]
Length=138

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CP+D LKL VCA+LL  L+  V+G+P K  CC LI+GL DL+AAVCLCTAIKANVLG
Sbjct  52   KATCPRDALKLGVCADLLGGLISAVIGAPPKTPCCSLIEGLADLEAAVCLCTAIKANVLG  111

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SL+L+LN C KKVPEGF CA
Sbjct  112  INLNVPVSLTLLLNVCSKKVPEGFICA  138



>ref|XP_011081227.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Sesamum indicum]
Length=139

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CP+D LKL VCANLL  L+ L +G+P K  CC LI+GL D++AAVCLCTAIKANVLG
Sbjct  53   KATCPRDALKLGVCANLLGGLIDLTIGTPPKTPCCTLIEGLADVEAAVCLCTAIKANVLG  112

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVPLSLSL+LN C KKVP GF+CA
Sbjct  113  INLNVPLSLSLLLNVCSKKVPPGFQCA  139



>emb|CAA59472.1| hybrid proline-rich protein [Catharanthus roseus]
Length=138

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CP+D LKL VCA+LL  L+  V+G+P K  CC LI+GL DL+AAVCLCTAIKANVLG
Sbjct  52   KATCPRDALKLGVCADLLGGLISAVIGAPPKTPCCSLIEGLADLEAAVCLCTAIKANVLG  111

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLSL+LN C KKVPEGF CA
Sbjct  112  INLNVPVSLSLLLNVCSKKVPEGFICA  138



>ref|XP_010676148.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Beta vulgaris 
subsp. vulgaris]
Length=161

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
               CP D LK  VCAN+L DL++L +G+P K  CCPLI GLVDL+AAVCLCTAIKAN+LG
Sbjct  75   SGACPIDALKFGVCANVLTDLLNLNLGTPPKTPCCPLIAGLVDLEAAVCLCTAIKANILG  134

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLN+PLSLSL++N CG KVP GF+CA
Sbjct  135  INLNIPLSLSLLVNYCGTKVPRGFQCA  161



>ref|XP_006841163.1| hypothetical protein AMTR_s00086p00157840 [Amborella trichopoda]
 gb|ERN02838.1| hypothetical protein AMTR_s00086p00157840 [Amborella trichopoda]
Length=140

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP+D LKL VCA+LL  LVHLVVGS A++ CC L+ GL DLD AVCLC AI+AN+LGIN
Sbjct  56   TCPRDALKLDVCADLLGGLVHLVVGSGARSRCCTLLSGLADLDVAVCLCIAIRANILGIN  115

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSL++N CG+ +P GF+CA
Sbjct  116  LNIPVALSLLVNQCGRTLPNGFQCA  140



>ref|XP_006289141.1| hypothetical protein CARUB_v10002564mg [Capsella rubella]
 gb|EOA22039.1| hypothetical protein CARUB_v10002564mg [Capsella rubella]
Length=135

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
              CPKDTLKL VCAN+L DL+ + +G+P    CC LI GLVDL+AA CLCTAIKANVLGI
Sbjct  50   GSCPKDTLKLGVCANVLKDLLKIELGTPPVKPCCSLIKGLVDLEAAACLCTAIKANVLGI  109

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLNVP+SLSL+LN CGKKVP GFKCA
Sbjct  110  NLNVPVSLSLLLNVCGKKVPSGFKCA  135



>ref|XP_002533293.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29087.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=136

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCPKDTLKL VC +LL DL+ + +G P K+ CC LI  LVDL+AAVCLCT IKA++LGI
Sbjct  51   TKCPKDTLKLGVCVDLLKDLLSVTIGKPPKSPCCSLIGDLVDLEAAVCLCTTIKASLLGI  110

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLNVP+ LSL+LN CGKKVPEGFKCA
Sbjct  111  NLNVPVDLSLLLNYCGKKVPEGFKCA  136



>ref|XP_008786990.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=127

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K KCP DTLKL VCAN+LN L++L +G P K  CC LI GL DL+AAVCLCTA+KAN+LG
Sbjct  41   KGKCPIDTLKLGVCANVLNGLINLNLGKPPKKPCCSLIKGLADLEAAVCLCTALKANILG  100

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            I LN+P+ LSL++N CGKKVP GF+C
Sbjct  101  IKLNIPVDLSLLINYCGKKVPTGFQC  126



>ref|XP_010093708.1| hypothetical protein L484_019049 [Morus notabilis]
 gb|EXB54488.1| hypothetical protein L484_019049 [Morus notabilis]
Length=129

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 67/88 (76%), Gaps = 1/88 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K  CP +TLKL VCAN+L+DLVHLVVG P K  CC LI+GL DL+AAVCLCTA+KANVLG
Sbjct  42   KESCPINTLKLGVCANVLDDLVHLVVGVPPKEPCCSLINGLADLEAAVCLCTALKANVLG  101

Query  415  Inlnvp-lslslvlnnCGKKVPEGFKCA  495
            +      + LSL+LN CG  VP GF+CA
Sbjct  102  VVNLNIPIQLSLLLNYCGTGVPSGFQCA  129



>ref|XP_006445312.1| hypothetical protein CICLE_v10022835mg [Citrus clementina]
 ref|XP_006490869.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
 gb|ESR58552.1| hypothetical protein CICLE_v10022835mg [Citrus clementina]
Length=130

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +1

Query  250  KDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInlnv  429
            +DTLKL VCA+LLNDLVHLVVG+P    CC L+ GL DL+AAVCLCTAIKAN+LGINLN+
Sbjct  48   RDTLKLGVCADLLNDLVHLVVGTPPVTPCCALLKGLADLEAAVCLCTAIKANILGINLNL  107

Query  430  plslslvlnnCGKKVPEGFKCA  495
            P+SLSL+LN CG  VP GF+CA
Sbjct  108  PISLSLLLNYCGNGVPSGFQCA  129



>ref|XP_007218581.1| hypothetical protein PRUPE_ppa013196mg [Prunus persica]
 gb|EMJ19780.1| hypothetical protein PRUPE_ppa013196mg [Prunus persica]
Length=135

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CPKDTLKL VC +LLNDL+H V+G+  K  CC LI GL D+DAAVCLCTAIKANVLG
Sbjct  49   KASCPKDTLKLGVCGDLLNDLLHPVLGTLPKTPCCSLIVGLADVDAAVCLCTAIKANVLG  108

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVP+SL+L+L  CGK VP+ F+C
Sbjct  109  INLNVPVSLNLLLKYCGKSVPKDFQC  134



>ref|XP_008392581.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=137

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP+DTLKL VCAN+LN L+++ +G P    CC LI GL DL+AAVCLCTAIKAN+LGIN
Sbjct  53   SCPRDTLKLGVCANVLNGLLNITIGKPPVEPCCSLIQGLADLEAAVCLCTAIKANILGIN  112

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P+SLSL+LN CG KVP+GF+CA
Sbjct  113  LNIPISLSLLLNVCGNKVPKGFQCA  137



>ref|XP_004147199.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 ref|XP_004166720.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN55878.1| proline-rich protein DC2.15 [Cucumis sativus]
Length=136

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCPKDTLKL VCA+LL+ LVH+V+G+P K  CC LI  LVDL+AA+CLCTA+KA  LG+ 
Sbjct  51   KCPKDTLKLGVCADLLDGLVHVVIGAPPKTPCCTLIQDLVDLEAALCLCTAVKAKALGLK  110

Query  421  lnvplslslvlnnCGKKVPEGFKC  492
            +++ +SLSL+LN CGKKVP GFKC
Sbjct  111  IDLSVSLSLLLNYCGKKVPNGFKC  134



>ref|XP_010695115.1| PREDICTED: putative lipid-binding protein AIR1B [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            A CP DTLKLKVCAN+LN L+ L +G+P +  CC LI GL DLDAAVCLCTA++ANVLGI
Sbjct  31   ATCPFDTLKLKVCANVLNGLLGLTIGTPPRHSCCSLIQGLADLDAAVCLCTALRANVLGI  90

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
             LNVP+SLSL+LN CG   P+GF C
Sbjct  91   RLNVPISLSLLLNACGCNYPDGFTC  115



>gb|EYU30301.1| hypothetical protein MIMGU_mgv1a018370mg [Erythranthe guttata]
Length=119

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            CPKDTLKL VCA+LLN L+++ VG+P K  CC LI+GLVDL+AAVCLCTAIKANVLGIN+
Sbjct  36   CPKDTLKLGVCADLLNGLLNVTVGTPPKTPCCSLIEGLVDLEAAVCLCTAIKANVLGINI  95

Query  424  nvplslslvlnnCGKKVPEGFKCA  495
            +VP+SL+L+LN C K VP+ F CA
Sbjct  96   DVPISLTLLLNVCTKSVPKDFVCA  119



>ref|XP_003588783.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
 gb|AES59034.1| Lipid transfer protein [Medicago truncatula]
Length=154

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 72/85 (85%), Gaps = 1/85 (1%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCP DTLKL VCA++L  LV+++VGSPA + CC LI GL DLDAAVCLCTAIKANVLGIN
Sbjct  71   KCPSDTLKLGVCADVLG-LVNVIVGSPASSKCCTLIQGLADLDAAVCLCTAIKANVLGIN  129

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNVP++LSL+L+ C K VP GF+C+
Sbjct  130  LNVPVTLSLLLSACEKSVPNGFQCS  154



>ref|XP_003588785.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
 gb|AES59036.1| protease inhibitor/seed storage/LTP family protein [Medicago 
truncatula]
 gb|AFK36514.1| unknown [Medicago truncatula]
 gb|AFK45094.1| unknown [Medicago truncatula]
Length=151

 Score = 98.2 bits (243),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 73/85 (86%), Gaps = 1/85 (1%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCP DTLKL VCA++L  LV+++VGSPA + CC L+ GLVDLDAA+CLCTAIKANVLGIN
Sbjct  68   KCPSDTLKLGVCADVLG-LVNVIVGSPASSKCCALLQGLVDLDAAICLCTAIKANVLGIN  126

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNVP++LSL+L+ C K VP GF+C+
Sbjct  127  LNVPITLSLLLSACEKSVPSGFQCS  151



>ref|NP_001233824.1| arachidonic acid-induced DEA1 precursor [Solanum lycopersicum]
 gb|AAS80139.1| arachidonic acid-induced DEA1 [Solanum lycopersicum]
Length=138

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCP DTLKL VCAN+L +L+ +V+G+P K  CC LI+GLVDL+AA+CLCTAIKAN+LGI
Sbjct  52   GKCPIDTLKLGVCANVLGNLLGVVLGNPPKKPCCSLIEGLVDLEAALCLCTAIKANILGI  111

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLNVPLSLSL+LN CGKK P GF+C
Sbjct  112  NLNVPLSLSLLLNVCGKKAPSGFQC  136



>emb|CAN80712.1| hypothetical protein VITISV_033379 [Vitis vinifera]
Length=149

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CPKDTLKL VCA+LLNDL+H VVG+P K+ CC LI GL DL+AAVCLCTAIKANVLG
Sbjct  46   KAVCPKDTLKLGVCADLLNDLLHAVVGTPPKSPCCSLIGGLADLEAAVCLCTAIKANVLG  105

Query  415  InlnvplslslvlnnCGKK  471
            I LNVP+SLSL+LN CGKK
Sbjct  106  IKLNVPVSLSLLLNYCGKK  124



>ref|XP_009589966.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
 dbj|BAB16431.1| P-rich protein NtEIG-C29 [Nicotiana tabacum]
Length=130

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCP DTLKL VCAN+L +L+ LV+G+P K  CC LI G+ DL+AA+CLCTAIKAN+LGI
Sbjct  45   GKCPIDTLKLGVCANVLGNLLGLVIGNPPKKPCCTLIQGVADLEAAICLCTAIKANILGI  104

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLNVPLSLSL+LN CGK+VP GF+C
Sbjct  105  NLNVPLSLSLLLNVCGKQVPSGFQC  129



>ref|XP_010088890.1| hypothetical protein L484_020878 [Morus notabilis]
 gb|EXB37087.1| hypothetical protein L484_020878 [Morus notabilis]
Length=135

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            A CPKDTLK  VCA+LLN L H++VG+P    CC L+ GL D++AAVCLCTAIKANVLGI
Sbjct  50   ATCPKDTLKFGVCADLLNGLEHVIVGTPPVTPCCSLLKGLADVEAAVCLCTAIKANVLGI  109

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLN+P+SLSL+LN CGKK P+GF+C
Sbjct  110  NLNIPVSLSLLLNYCGKKAPKGFQC  134



>ref|XP_002533291.1| lipid binding protein, putative [Ricinus communis]
 gb|EEF29085.1| lipid binding protein, putative [Ricinus communis]
Length=114

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            CPKDT+KL VC NLL DL+ + VG+P K  CC LI GLVDL+AA CLCT IKA+V GI L
Sbjct  30   CPKDTVKLGVCVNLLKDLLSVTVGTPPKTPCCSLIAGLVDLEAAACLCTTIKADVAGIKL  89

Query  424  nvplslslvlnnCGKKVPEGFKCA  495
            N+P+ LSL+LN CGKKVP+GFKC+
Sbjct  90   NLPIHLSLLLNYCGKKVPQGFKCS  113



>gb|EYU30296.1| hypothetical protein MIMGU_mgv1a015783mg [Erythranthe guttata]
Length=146

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K  CP+D LKL VCA+LL  L+ L +GSP K  CC LI+GL DL+AAVCLCTAIKANVLG
Sbjct  60   KTTCPRDALKLGVCADLLGGLIGLTIGSPPKTPCCSLIEGLADLEAAVCLCTAIKANVLG  119

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLSL+LN C K +P GF+CA
Sbjct  120  INLNVPISLSLLLNVCSKNIPPGFQCA  146



>emb|CAI51313.1| arachidonic acid-induced DEA1 [Capsicum chinense]
Length=142

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K KCP D LKL +CAN+L +L+ +V+G+P K  CC LI GLVDL+AA+CLCTA+KAN+LG
Sbjct  55   KGKCPIDALKLGICANVLGNLLGVVLGNPPKKPCCSLIQGLVDLEAALCLCTALKANILG  114

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVP+SLSL+LN CGKKVP GF+C
Sbjct  115  INLNVPISLSLLLNVCGKKVPSGFQC  140



>gb|ABQ88334.1| lipid transfer protein [Capsicum annuum]
Length=142

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K KCP D LKL +CAN+L +L+ +V+G+P K  CC LI GLVDL+AA+CLCTA+KAN+LG
Sbjct  55   KGKCPVDALKLGICANVLGNLLGVVLGNPPKKPCCSLIQGLVDLEAALCLCTALKANILG  114

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVP+SLSL+LN CGKKVP GF+C
Sbjct  115  INLNVPISLSLLLNVCGKKVPSGFQC  140



>ref|XP_004235151.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=109

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
             A C  D LK   CAN+LNDLV +++G+   + CC LIDGLVDLDAAVCLCTA+KA+VLG
Sbjct  24   SADCSTDILKFGACANILNDLVGVIIGTTPTSSCCSLIDGLVDLDAAVCLCTALKADVLG  83

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INL++ LSL+++LN CGKK P G+ C
Sbjct  84   INLDISLSLNILLNVCGKKYPTGYTC  109



>ref|XP_009388030.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=143

 Score = 97.1 bits (240),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            AKCP+D LKL +CAN+L  L+++ +G+P K  CC L++GLVDL+AAVCLCTA+K NVLG+
Sbjct  58   AKCPRDALKLGICANVLRGLLNVTLGTPPKQPCCSLLEGLVDLEAAVCLCTALKGNVLGL  117

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
             LN+P+SLSL++N CGKKVP+GF C
Sbjct  118  KLNIPVSLSLLINYCGKKVPKGFLC  142



>ref|XP_002533299.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29093.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=133

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCP+D LKL VCAN+L  L++L +G P    CC LI GLVDL+AAVCLCTAIKAN+LGI
Sbjct  48   GKCPRDALKLGVCANVLGSLLNLNIGKPPVEPCCSLIQGLVDLEAAVCLCTAIKANILGI  107

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLN+PLSLSL+LN CGKK P GF+CA
Sbjct  108  NLNIPLSLSLLLNVCGKKTPSGFQCA  133



>ref|XP_008338137.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
 ref|XP_008389722.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=139

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP+DTLKL VCAN+LN L+++ VG P    CC LI GL DL+AAVCLCTA+KAN+LGIN
Sbjct  55   SCPRDTLKLGVCANVLNGLLNISVGKPPVEPCCSLIQGLADLEAAVCLCTALKANILGIN  114

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P+SLSL+LN CG KVP+GF+CA
Sbjct  115  LNIPVSLSLLLNVCGNKVPKGFQCA  139



>ref|XP_006289733.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
 gb|EOA22631.1| hypothetical protein CARUB_v10003301mg [Capsella rubella]
Length=135

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
              CPKDTLKL VCAN+L DL+ + +G+P    CC LI GLVDL+AA CLCTAIKANVLGI
Sbjct  50   GSCPKDTLKLGVCANVLKDLLKIELGTPPVKPCCSLIKGLVDLEAAACLCTAIKANVLGI  109

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLNVP+SLSL+LN CGKKVP GF CA
Sbjct  110  NLNVPISLSLLLNVCGKKVPSGFVCA  135



>ref|XP_006355477.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=138

 Score = 96.7 bits (239),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCP DTLKL VCAN+L +++ +V+G+P K  CC LI+GLVDL+AA+CLCTAIKAN+LGI
Sbjct  52   GKCPIDTLKLGVCANVLGNVLGVVLGNPPKKPCCSLIEGLVDLEAALCLCTAIKANILGI  111

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLNVPLSLSL+LN CGKK P GF+C
Sbjct  112  NLNVPLSLSLLLNACGKKAPSGFQC  136



>ref|XP_006366743.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum tuberosum]
Length=134

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPL---IDGLVDLDAAVCLCTAIKANVL  411
            KCPKDTLKLKVCANLLNDLVH+V+GSP  +        I+ L D+DAAVCLCTAIKANVL
Sbjct  47   KCPKDTLKLKVCANLLNDLVHVVIGSPLLSSKSSCCSLIENLADVDAAVCLCTAIKANVL  106

Query  412  GInlnvplslslvlnnCGKKVPEGFKCA  495
            G +LN  LSLSL+LNNCGK  P+GFKCA
Sbjct  107  GAHLNAALSLSLLLNNCGKTAPKGFKCA  134



>ref|XP_011070106.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Sesamum indicum]
Length=127

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            CPKDTLKL VCA+LL  L+ + +G+P K  CC LI+GL DL+AAVCLCTAIKAN+LGINL
Sbjct  44   CPKDTLKLGVCADLLGGLLGITIGTPPKTPCCTLIEGLADLEAAVCLCTAIKANILGINL  103

Query  424  nvplslslvlnnCGKKVPEGFKCA  495
            NVPLSLSL+LN C KKVP+GF CA
Sbjct  104  NVPLSLSLLLNVCSKKVPKGFVCA  127



>gb|EPS71802.1| hypothetical protein M569_02964 [Genlisea aurea]
Length=146

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            A CP DTLKL VCANLL DL+ +V+G+P K  CC +I GLVDL+AAVCLCTAIKA++LGI
Sbjct  61   ATCPIDTLKLGVCANLLGDLLGVVIGTPPKEPCCSVIQGLVDLEAAVCLCTAIKADILGI  120

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLN+P+SLS++LN C KKVP GF C
Sbjct  121  NLNIPVSLSVLLNVCSKKVPPGFIC  145



>ref|XP_003588779.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
 gb|AES59030.1| Lipid transfer protein [Medicago truncatula]
Length=210

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 1/85 (1%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCP DTLKL VCA++L  LV+++VGSPA ++CC LI GL DLDAAVCLCTAIKANVLGIN
Sbjct  127  KCPSDTLKLGVCADVLG-LVNVIVGSPASSNCCTLIQGLADLDAAVCLCTAIKANVLGIN  185

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNVP++LSL+L+ C K VP GF+C+
Sbjct  186  LNVPVTLSLLLSACQKSVPNGFQCS  210



>ref|XP_008238564.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=147

 Score = 96.3 bits (238),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCP+DTLKL VCAN+LN L+++ +G P  A CC LI GL D++AAVCLCTAIKAN+LGIN
Sbjct  63   KCPRDTLKLGVCANVLNGLLNITIGKPPVAPCCSLIQGLADVEAAVCLCTAIKANILGIN  122

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P+SLSL+LN CG KVP+ F+CA
Sbjct  123  LNIPISLSLLLNVCGNKVPKDFQCA  147



>ref|XP_008232587.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Prunus mume]
Length=191

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CP+DTLKL VC NLLNDLVH V+ +  K  CC LI GL D+DA VCLCTAIKAN+LG
Sbjct  105  KASCPEDTLKLGVCGNLLNDLVHPVLETLPKTPCCKLIVGLADVDAVVCLCTAIKANILG  164

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SL+L+LN CGK +P  F+C+
Sbjct  165  INLNVPVSLNLLLNLCGKSIPTDFQCS  191



>ref|XP_011001498.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=132

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCPKD LKL VCA LL  L+++ VG+P    CC +I GL+DL+AAVCLCTAIKAN+LGI
Sbjct  47   GKCPKDALKLGVCAGLLGSLLNVTVGTPPVQPCCSVIQGLLDLEAAVCLCTAIKANILGI  106

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLN+P+SLSL+LN CGKKVP+GF+C
Sbjct  107  NLNIPVSLSLLLNVCGKKVPKGFQC  131



>ref|XP_006369032.1| HyPRP family protein [Populus trichocarpa]
 gb|ERP65601.1| HyPRP family protein [Populus trichocarpa]
Length=132

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCPKD LKL VCA+LL  L+++ VG+P    CC LI GL+DL+AAVCLCTAIKAN+LGI
Sbjct  47   GKCPKDALKLGVCADLLGSLLNVTVGTPPVEPCCSLIQGLLDLEAAVCLCTAIKANILGI  106

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLN+P+SLSL+LN CGKKVP+ F+CA
Sbjct  107  NLNIPVSLSLLLNVCGKKVPKDFQCA  132



>ref|XP_006440347.1| hypothetical protein CICLE_v10022825mg [Citrus clementina]
 ref|XP_006477232.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Citrus sinensis]
 gb|ESR53587.1| hypothetical protein CICLE_v10022825mg [Citrus clementina]
 gb|KDO61486.1| hypothetical protein CISIN_1g044385mg [Citrus sinensis]
Length=132

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            A CP+D LKL VCAN+LN L+++ +G+P    CC LI GL DL+AAVCLCTAIKAN+LGI
Sbjct  47   ASCPRDALKLGVCANVLNGLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIKANILGI  106

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLN+PLSLSL+LN C K VP GF+CA
Sbjct  107  NLNIPLSLSLLLNVCSKSVPRGFQCA  132



>ref|XP_004299468.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 1 
[Fragaria vesca subsp. vesca]
Length=166

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
             A CP+D LKL +CAN+LN+L+++ +G+P    CC LI GL DL+AAVCLCTAI+A++LG
Sbjct  80   TATCPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILG  139

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLN+P++LSL+LN CG +VP GF+C+
Sbjct  140  INLNIPIALSLLLNACGNQVPRGFQCS  166



>ref|XP_003588784.1| 14 kDa proline-rich protein DC2.15 [Medicago truncatula]
Length=164

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 1/85 (1%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCP DTLKL VCA++L  LV+++VG+PA + CC LI GL DLDAAVCLCTAIKANVLGIN
Sbjct  81   KCPSDTLKLGVCADVLG-LVNVIVGNPASSKCCTLIQGLADLDAAVCLCTAIKANVLGIN  139

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNVP++LSL+L+ C K VP GF+C+
Sbjct  140  LNVPVTLSLLLSACQKSVPNGFQCS  164



>gb|AFK43955.1| unknown [Lotus japonicus]
Length=128

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 1/86 (1%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCPKDTLKL  CA+LL  LV++V+GSPA + CC L++GL DL+AAVCLCTA+KANVLGI
Sbjct  44   GKCPKDTLKLGACADLLG-LVNVVLGSPASSKCCALLEGLADLEAAVCLCTAVKANVLGI  102

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLNVP++LS++L+ C K VP GF+CA
Sbjct  103  NLNVPVTLSVLLSACQKTVPSGFQCA  128



>gb|AAD01800.1| HyPRP [Fragaria x ananassa]
 gb|AAS76505.1| HyPRP [Fragaria x ananassa]
Length=156

 Score = 96.3 bits (238),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
             A CP+D LKL +CAN+LN+L+++ +G+P    CC LI GL DL+AAVCLCTAI+A++LG
Sbjct  70   TATCPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILG  129

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLN+P++LSL+LN CG +VP GF+C+
Sbjct  130  INLNIPIALSLLLNACGNQVPRGFQCS  156



>ref|XP_009333630.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=135

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP+DTLKL VCAN+LN L+++ VG P    CC LI GL D++AAVCLCTA+KAN+LGIN
Sbjct  51   SCPRDTLKLGVCANVLNGLLNISVGKPPVEPCCSLIQGLADIEAAVCLCTALKANILGIN  110

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P+SLSL+LN CG KVP+GF+CA
Sbjct  111  LNIPISLSLLLNVCGNKVPKGFQCA  135



>ref|XP_007209745.1| hypothetical protein PRUPE_ppa013010mg [Prunus persica]
 gb|EMJ10944.1| hypothetical protein PRUPE_ppa013010mg [Prunus persica]
Length=144

 Score = 95.9 bits (237),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            +CP+DTLKL VCAN+LN L+++ +G P  A CC LI GL D++AAVCLCTAIKAN+LGIN
Sbjct  60   RCPRDTLKLGVCANVLNGLLNITIGKPPVAPCCSLIQGLADVEAAVCLCTAIKANILGIN  119

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P+SLSL+LN CG KVP+ F+CA
Sbjct  120  LNIPISLSLLLNVCGNKVPKDFQCA  144



>gb|AES59035.2| Lipid transfer protein [Medicago truncatula]
Length=164

 Score = 96.7 bits (239),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 72/85 (85%), Gaps = 1/85 (1%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCP DTLKL VCA++L  LV+++VG PA ++CC LI GL DLDAAVCLCTAIKANVLGIN
Sbjct  81   KCPSDTLKLGVCADVLG-LVNVIVGIPASSNCCTLIQGLADLDAAVCLCTAIKANVLGIN  139

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNVP++LSL+L+ C K VP GF+C+
Sbjct  140  LNVPVTLSLLLSACQKSVPNGFQCS  164



>ref|XP_002533294.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
 gb|EEF29088.1| 14 kDa proline-rich protein DC2.15 precursor, putative [Ricinus 
communis]
Length=140

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCPKDTLKL VC +LL DL+ + +G P K  CC LI  LVDL+AAVCLCT+IKA++LGI
Sbjct  55   TKCPKDTLKLGVCVDLLKDLLSVTIGKPPKTPCCSLIGDLVDLEAAVCLCTSIKASLLGI  114

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLN+P+ LSLVLN CGKKVPEGF+C
Sbjct  115  NLNLPVDLSLVLNYCGKKVPEGFQC  139



>ref|XP_004299469.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=152

 Score = 95.9 bits (237),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
             A CP+D LKL +CAN+LN+L+++ +G+P    CC LI GL DL+AAVCLCTAI+A++LG
Sbjct  66   TATCPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILG  125

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLN+P++LSL+LN CG +VP GF+C+
Sbjct  126  INLNIPIALSLLLNACGNQVPRGFQCS  152



>ref|XP_010906608.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=129

 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCP D LKL VCA++L+ L+++ +G+P K  CC L+ GLVDL+AAVCLCTAIKAN+LGI
Sbjct  44   GKCPIDALKLGVCADVLSGLLNVTIGTPPKEPCCSLLSGLVDLEAAVCLCTAIKANILGI  103

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLN+P+ LSL+LN CGKKVP GF+CA
Sbjct  104  NLNIPVDLSLLLNYCGKKVPSGFQCA  129



>ref|XP_008448867.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=136

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCPKDTLKL VCA+LL+ LV +V+G+P K  CC LI  LVDL+AA+CLCTA+KA  LG+N
Sbjct  51   KCPKDTLKLGVCADLLDGLVRVVIGTPPKTPCCTLIKDLVDLEAALCLCTAVKAKALGLN  110

Query  421  lnvplslslvlnnCGKKVPEGFKC  492
            +++ +SLSL+LN CGKKVP GFKC
Sbjct  111  IDLSVSLSLLLNYCGKKVPNGFKC  134



>ref|XP_008808738.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=131

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCP + LKL VCAN+LN L+++ +G P K  CC L++GLVDL+AAVCLCTA+KAN+LGI
Sbjct  46   GKCPMNALKLGVCANVLNGLINVSLGKPPKKPCCTLLEGLVDLEAAVCLCTALKANILGI  105

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
             LN+P+ LSL+LN CGKKVP G+KCA
Sbjct  106  KLNLPVDLSLLLNYCGKKVPAGWKCA  131



>ref|XP_004299470.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform 3 
[Fragaria vesca subsp. vesca]
Length=144

 Score = 95.5 bits (236),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
             A CP+D LKL +CAN+LN+L+++ +G+P    CC LI GL DL+AAVCLCTAI+A++LG
Sbjct  58   TATCPRDALKLGICANVLNNLLNVTIGTPPVQPCCTLIQGLADLEAAVCLCTAIRASILG  117

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLN+P++LSL+LN CG +VP GF+C+
Sbjct  118  INLNIPIALSLLLNACGNQVPRGFQCS  144



>ref|XP_010422222.1| PREDICTED: lipid transfer protein EARLI 1-like isoform X1 [Camelina 
sativa]
Length=135

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
              CP+DTLKL VCAN+L DL+ + +G+P    CC L++GLVDL+AA CLCTA+KANVLGI
Sbjct  50   GSCPRDTLKLGVCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGI  109

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLNVP+SLSL+LN CGKKVP GF CA
Sbjct  110  NLNVPISLSLLLNVCGKKVPSGFVCA  135



>ref|XP_004242005.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=134

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPL---IDGLVDLDAAVCLCTAIKANVL  411
            KCPK+TLKLKVCANLLNDLVH+VVGSP  +        I+ L D+DAAVCLCTAIKANVL
Sbjct  47   KCPKNTLKLKVCANLLNDLVHVVVGSPLLSSKSSCCSLIENLADVDAAVCLCTAIKANVL  106

Query  412  GInlnvplslslvlnnCGKKVPEGFKCA  495
            G +LN  LSLSL+LNNCGK  P+GFKCA
Sbjct  107  GAHLNAALSLSLLLNNCGKTAPKGFKCA  134



>ref|XP_010433403.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Camelina sativa]
Length=162

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
              KCP DTLKL  CAN+L+ L+++ +G P+   CC LI+GLVD+DAA+CLCTA+KAN+LG
Sbjct  76   SGKCPIDTLKLGACANVLSSLLNIQLGQPSSQSCCSLIEGLVDVDAAICLCTALKANILG  135

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLS++LN C KK+P GF+CA
Sbjct  136  INLNVPISLSVLLNVCEKKLPSGFECA  162



>ref|XP_010422224.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
              CP+DTLKL VCAN+L DL+ + +G+P    CC L++GLVDL+AA CLCTA+KANVLGI
Sbjct  50   GSCPRDTLKLGVCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGI  109

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLNVP+SLSL+LN CGKKVP GF CA
Sbjct  110  NLNVPISLSLLLNVCGKKVPSGFVCA  135



>gb|ABQ01426.1| bimodular protein [Medicago falcata]
Length=166

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 72/85 (85%), Gaps = 1/85 (1%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCP DTLKL VCA++L  LV+++VGSPA + CC LI GL DLDAAVCLCTAIKAN+LGIN
Sbjct  83   KCPTDTLKLGVCADVLG-LVNVIVGSPASSKCCTLIQGLADLDAAVCLCTAIKANILGIN  141

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNVP++LSL+L+ C K +P GF+C+
Sbjct  142  LNVPITLSLLLSACEKSIPNGFQCS  166



>ref|XP_010919519.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=143

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCP DTLKL VCAN+LN L++L +G P K  CC LI GL DL+AAVCLCTA+KAN+LG 
Sbjct  58   GKCPIDTLKLGVCANVLNGLINLTLGKPPKKPCCSLIKGLADLEAAVCLCTALKANILGA  117

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLN+P+ LSL++N CGKKVP GF+C+
Sbjct  118  NLNIPIDLSLLINYCGKKVPTGFQCS  143



>ref|XP_010455699.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
 ref|XP_010455700.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
              CP+DTLKL VCAN+L DL+ + +G+P    CC L++GLVDL+AA CLCTA+KANVLGI
Sbjct  50   GSCPRDTLKLGVCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGI  109

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLNVP+SLSL+LN CGKKVP GF CA
Sbjct  110  NLNVPISLSLLLNVCGKKVPSGFVCA  135



>ref|XP_010455698.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
              CP+DTLKL VCAN+L DL+ + +G+P    CC L++GLVDL+AA CLCTA+KANVLGI
Sbjct  50   GSCPRDTLKLGVCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGI  109

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLNVP+SLSL+LN CGKKVP GF CA
Sbjct  110  NLNVPISLSLLLNVCGKKVPSGFVCA  135



>ref|XP_010099842.1| hypothetical protein L484_008499 [Morus notabilis]
 gb|EXB80719.1| hypothetical protein L484_008499 [Morus notabilis]
Length=124

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CPKDTLK  VCA+LL  LV+LVVGSP  + CC L+ GL DL+AAVCLCTAIKANVLGIN
Sbjct  41   SCPKDTLKFGVCADLLG-LVNLVVGSPPSSKCCALLSGLADLEAAVCLCTAIKANVLGIN  99

Query  421  lnvplslslvlnnCGKKVPEGFKC  492
            LNVPL+LS++++ C K VP GFKC
Sbjct  100  LNVPLTLSVLISACQKTVPSGFKC  123



>gb|AAA32650.1| bimodular protein [Medicago sativa]
Length=166

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 72/85 (85%), Gaps = 1/85 (1%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCP DTLKL VCA++L  LV+++VGSPA + CC LI GL DLDAAVCLCTAIKAN+LGIN
Sbjct  83   KCPTDTLKLGVCADVLG-LVNVIVGSPASSKCCTLIQGLADLDAAVCLCTAIKANILGIN  141

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNVP++LSL+L+ C K +P GF+C+
Sbjct  142  LNVPITLSLLLSACEKSIPNGFQCS  166



>ref|XP_009411010.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=137

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
               CP D LKL  CAN+L+ L+H  VG P K  CC LIDGLVDL+AAVCLCTAIKANVLG
Sbjct  51   SGACPVDALKLGGCANVLDGLIHAKVGEPPKEPCCSLIDGLVDLEAAVCLCTAIKANVLG  110

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            I+LN+P++LSL+LN CGK+ P GFKCA
Sbjct  111  IHLNLPINLSLLLNYCGKQSPTGFKCA  137



>ref|XP_010422221.1| PREDICTED: lipid transfer protein EARLI 1 [Camelina sativa]
Length=149

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
              KCP D L+L VCAN+L+ L+++ +G P+   CC LI GLVDLDAA+CLCTA++ANVLG
Sbjct  63   SGKCPIDALRLGVCANVLSSLLNVQLGQPSSQSCCSLIQGLVDLDAAICLCTALRANVLG  122

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLS++LN C +K+P GF+CA
Sbjct  123  INLNVPISLSVLLNVCNRKLPSGFQCA  149



>ref|XP_010433379.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
              CP+DTLKL VCANLL DL+ + +G+P    CC L++GLVDL+AA CLCTA+KANV+GI
Sbjct  50   GSCPRDTLKLGVCANLLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVIGI  109

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
             LNVP+SLSL+LN CG+KVP GF CA
Sbjct  110  KLNVPVSLSLLLNVCGRKVPSGFVCA  135



>ref|XP_010933689.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=134

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCP D LKL VCAN+LN L+++ +G P K  CC L+DGLVDL+AAVCLCTA+KANVLGI 
Sbjct  50   KCPMDALKLGVCANVLNGLINVHLGRPPKKPCCSLLDGLVDLEAAVCLCTALKANVLGIK  109

Query  421  lnvplslslvlnnCGKKVPEGFKC  492
            LN+P+ LSL+LN CGK  P+GF+C
Sbjct  110  LNLPIHLSLLLNYCGKNTPKGFQC  133



>emb|CAN77080.1| hypothetical protein VITISV_025477 [Vitis vinifera]
Length=120

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            CP+DTLK  VCA+LL  LV LV GSP  + CC +++GL DL+AA CLCTAIKA+VLGIN+
Sbjct  37   CPRDTLKFGVCADLLGGLVSLVAGSPPSSKCCAVLEGLADLEAAACLCTAIKASVLGINV  96

Query  424  nvplslslvlnnCGKKVPEGFKC  492
             VP+++SL+++ CGK +P GFKC
Sbjct  97   KVPVAISLLISACGKSIPXGFKC  119



>ref|XP_004498751.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum]
Length=126

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K KCP DTLKL VCA++L  LV+++VG+P+ + CC L+ GL DL+AA+CLCTAIKANVLG
Sbjct  41   KGKCPSDTLKLGVCADVLG-LVNIIVGTPSSSKCCALLQGLADLEAAICLCTAIKANVLG  99

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP++LSL+L+ C K +P GFKC+
Sbjct  100  INLNVPITLSLLLSACQKSIPSGFKCS  126



>ref|XP_010041843.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 ref|XP_010042382.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
Length=121

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            A CP++ LKL VC +LL  LV++ VG+P K  CC LI GLVDL+AAVCLCTAI+ANVLG+
Sbjct  36   ASCPENALKLGVCLDLLGSLVNVTVGTPPKEPCCSLIQGLVDLEAAVCLCTAIRANVLGL  95

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            +L+VPLSLSL+LN C KKVP GF+CA
Sbjct  96   HLDVPLSLSLLLNVCSKKVPPGFQCA  121



>ref|XP_009376589.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
 ref|XP_009376590.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP+D+LKL VCA LLN  V  VVG+P    CC L++GLVDL+ AVCLCTAIKAN+LGIN
Sbjct  52   SCPRDSLKLGVCAKLLNGAVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGIN  111

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSLV++ C K VPEGFKCA
Sbjct  112  LNIPIALSLVIDGCAKNVPEGFKCA  136



>ref|XP_002436327.1| hypothetical protein SORBIDRAFT_10g000510 [Sorghum bicolor]
 gb|EER87694.1| hypothetical protein SORBIDRAFT_10g000510 [Sorghum bicolor]
Length=133

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCP + +KL VCA++L+ L+H VVG P K  CC LI GLVDLDAAVC+C AI ANVLGI
Sbjct  48   GKCPVNAVKLGVCADVLDGLIHAVVGGPPKEPCCSLISGLVDLDAAVCVCLAINANVLGI  107

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NL+V + LSL++N CG++VP GFKCA
Sbjct  108  NLDVAVDLSLLVNYCGRRVPAGFKCA  133



>ref|XP_008669243.1| PREDICTED: uncharacterized protein LOC103646289 [Zea mays]
Length=201

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             +CP D LKL VCANLLN L++  +G+P +  CC LI GL DL+AAVCLCT ++ANVLGI
Sbjct  116  GRCPVDALKLGVCANLLNGLINATLGTPPRTPCCTLIQGLADLEAAVCLCTVLRANVLGI  175

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLN+P++LSL++N CG++VP GF+C
Sbjct  176  NLNLPINLSLLVNYCGRRVPSGFQC  200



>ref|XP_008381149.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
 ref|XP_008365739.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Malus domestica]
Length=136

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP+D+LKL VCA LLN  V  VVG+P    CC L++GLVDL+ AVCLCTAIKAN+LGIN
Sbjct  52   SCPRDSLKLGVCAKLLNGAVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGIN  111

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSLV++ C K VPEGFKCA
Sbjct  112  LNIPIALSLVIDGCAKNVPEGFKCA  136



>ref|XP_002285197.1| PREDICTED: putative lipid-binding protein At4g00165 [Vitis vinifera]
Length=128

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            CP+DTLK  VCA+LL  LV LV GSP  + CC +++GL DL+AA CLCTAIKA+VLGIN+
Sbjct  45   CPRDTLKFGVCADLLGGLVSLVAGSPPSSKCCAVLEGLADLEAAACLCTAIKASVLGINV  104

Query  424  nvplslslvlnnCGKKVPEGFKC  492
             VP+++SL+++ CGK +P GFKC
Sbjct  105  KVPVAISLLISACGKSIPPGFKC  127



>ref|XP_009333632.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP+D+LKL VCA LLN  V  VVG+P    CC L++GLVDL+ AVCLCTAIKAN+LGIN
Sbjct  52   SCPRDSLKLGVCAKLLNGAVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGIN  111

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSLV++ C K VPEGFKCA
Sbjct  112  LNIPIALSLVIDGCAKNVPEGFKCA  136



>ref|XP_010676150.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Beta vulgaris 
subsp. vulgaris]
Length=150

 Score = 94.7 bits (234),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            CP D LKL VCAN+LN L+ L +G+P K+ CCPLI GL+D +AAVCLCTAIKANVLGINL
Sbjct  67   CPIDALKLGVCANVLNGLLDLTIGTPPKSPCCPLIQGLIDAEAAVCLCTAIKANVLGINL  126

Query  424  nvplslslvlnnCGKKVPEGFKC  492
             +PLS+SL++N CG ++P GF+C
Sbjct  127  EIPLSISLLVNYCGCQLPHGFQC  149



>ref|XP_010433369.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=135

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
               CP+DTLKL VCAN+L DL+ + +G P    CC L++GLVDL+AA CLCTA+KANVLG
Sbjct  49   SGSCPRDTLKLGVCANVLKDLLKIELGKPPVKPCCSLLNGLVDLEAAACLCTALKANVLG  108

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            I LNVP+SLSL+LN CGKKVP GF CA
Sbjct  109  IKLNVPVSLSLLLNVCGKKVPSGFVCA  135



>ref|NP_566036.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
 gb|AAL11562.1|AF424568_1 At2g45180/T14P1.1 [Arabidopsis thaliana]
 gb|AAB82643.1| expressed protein [Arabidopsis thaliana]
 gb|AAM62919.1| unknown [Arabidopsis thaliana]
 gb|AAV84511.1| At2g45180 [Arabidopsis thaliana]
 dbj|BAF01874.1| putative proline-rich protein [Arabidopsis thaliana]
 dbj|BAF02133.1| putative proline-rich protein [Arabidopsis thaliana]
 dbj|BAE99283.1| putative proline-rich protein [Arabidopsis thaliana]
 gb|ABI93898.1| At2g45180 [Arabidopsis thaliana]
 gb|AEC10522.1| protease inhibitor/seed storage/lipid transfer protein (LTP) 
family protein [Arabidopsis thaliana]
Length=134

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K  CP DTLKL VCA+LL  LV++VVGSP K  CC L+ GL +L+AAVCLCTA+KANVLG
Sbjct  49   KPTCPTDTLKLGVCADLLG-LVNVVVGSPPKTPCCTLLQGLANLEAAVCLCTALKANVLG  107

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+ L+L+LN CGKKVP GF+C+
Sbjct  108  INLNVPIDLTLLLNYCGKKVPHGFQCS  134



>gb|EAY88189.1| hypothetical protein OsI_09636 [Oryza sativa Indica Group]
 dbj|BAJ08376.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08377.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08378.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08380.1| qLTG3-1 [Oryza sativa Indica Group]
Length=178

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            +CP DTLKL VCAN+LN L+++ +G+P +  CC LI GL DL+AAVCLCTA++AN+LGIN
Sbjct  93   RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  152

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSL++N CG+ VP GF+C+
Sbjct  153  LNLPINLSLLVNYCGRSVPSGFQCS  177



>gb|KDP25650.1| hypothetical protein JCGZ_20806 [Jatropha curcas]
Length=130

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            CP+DTLKL VCA++L  L+++ VG+P K  CC L+  LVDL+AAVCLCT IKA++LGINL
Sbjct  47   CPRDTLKLGVCADVLKGLLNVTVGTPPKTPCCSLLGDLVDLEAAVCLCTTIKASLLGINL  106

Query  424  nvplslslvlnnCGKKVPEGFKCA  495
            N+P+ LSL+LN CGKKVPEGFKCA
Sbjct  107  NLPIDLSLLLNYCGKKVPEGFKCA  130



>ref|XP_010455695.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Camelina sativa]
Length=160

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
              KCP D LKL +C N+L+ L+++ +G P+   CC LI+GLVDLDAA+CLCTA+KAN+LG
Sbjct  74   SGKCPIDALKLALCGNVLSSLLNIQLGQPSSQSCCSLIEGLVDLDAAICLCTALKANILG  133

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SL+++LN C KK+P GF+CA
Sbjct  134  INLNVPISLTVLLNVCEKKLPSGFECA  160



>dbj|BAG50511.1| qLTG-3-1 [Oryza sativa Japonica Group]
 dbj|BAJ08371.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08372.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAJ08373.1| qLTG3-1 [Oryza sativa Japonica Group]
 dbj|BAJ08374.1| qLTG3-1 [Oryza sativa Indica Group]
 dbj|BAN84541.1| QTL for low-temperature germinability 3-1 [Oryza sativa Japonica 
Group]
Length=184

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            +CP DTLKL VCAN+LN L+++ +G+P +  CC LI GL DL+AAVCLCTA++AN+LGIN
Sbjct  99   RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  158

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSL++N CG+ VP GF+C+
Sbjct  159  LNLPINLSLLVNYCGRSVPSGFQCS  183



>ref|XP_010093705.1| hypothetical protein L484_019046 [Morus notabilis]
 gb|EXB54485.1| hypothetical protein L484_019046 [Morus notabilis]
Length=114

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K KCP+D LKL VCA++L   V +VVGSP    CC L++GL+DL+AAVCLCTAIKAN+LG
Sbjct  28   KLKCPRDALKLGVCADVLKGPVGVVVGSPPDVPCCSLLEGLIDLEAAVCLCTAIKANILG  87

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLN+P+SLSL+++ C K +P GF+CA
Sbjct  88   INLNIPISLSLLISTCRKDIPSGFQCA  114



>ref|NP_001048668.1| Os03g0103300 [Oryza sativa Japonica Group]
 gb|ABF93504.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF10582.1| Os03g0103300 [Oryza sativa Japonica Group]
 gb|EAZ25261.1| hypothetical protein OsJ_09069 [Oryza sativa Japonica Group]
 dbj|BAI60003.1| Low-temperature germinability 3-1 [Oryza sativa Japonica Group]
 dbj|BAJ08375.1| qLTG3-1 [Oryza sativa Japonica Group]
Length=184

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            +CP DTLKL VCAN+LN L+++ +G+P +  CC LI GL DL+AAVCLCTA++AN+LGIN
Sbjct  99   RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  158

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSL++N CG+ VP GF+C+
Sbjct  159  LNLPINLSLLVNYCGRSVPSGFQCS  183



>ref|XP_002874775.1| hypothetical protein ARALYDRAFT_490053 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51034.1| hypothetical protein ARALYDRAFT_490053 [Arabidopsis lyrata subsp. 
lyrata]
Length=168

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
               CP D LKL VCAN+L+ L+++ +G P+   CC LI GLVDLDAA+CLCTA++ANVLG
Sbjct  82   SGNCPIDALKLGVCANVLSSLLNIQLGQPSAQPCCSLIQGLVDLDAAICLCTALRANVLG  141

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLS++LN C +KVP GF+CA
Sbjct  142  INLNVPISLSVLLNVCNRKVPSGFQCA  168



>ref|XP_010422223.1| PREDICTED: lipid transfer protein EARLI 1-like isoform X2 [Camelina 
sativa]
Length=135

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
              CP+DTLKL VCAN+L DL+ + +G+P    CC L++GLVDL+AA CLCTA+KANVLGI
Sbjct  50   GSCPRDTLKLGVCANVLKDLLKIELGTPPVKPCCSLLNGLVDLEAAACLCTALKANVLGI  109

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLNVP+SLSL+LN CGKK P GF CA
Sbjct  110  NLNVPISLSLLLNVCGKKFPSGFVCA  135



>gb|ABF93505.1| retrotransposon protein, putative, Ty1-copia subclass, expressed 
[Oryza sativa Japonica Group]
Length=179

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            +CP DTLKL VCAN+LN L+++ +G+P +  CC LI GL DL+AAVCLCTA++AN+LGIN
Sbjct  94   RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  153

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSL++N CG+ VP GF+C+
Sbjct  154  LNLPINLSLLVNYCGRSVPSGFQCS  178



>dbj|BAJ08379.1| qLTG3-1 [Oryza sativa Indica Group]
Length=190

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            +CP DTLKL VCAN+LN L+++ +G+P +  CC LI GL DL+AAVCLCTA++AN+LGIN
Sbjct  105  RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  164

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSL++N CG+ VP GF+C+
Sbjct  165  LNLPINLSLLVNYCGRSVPSGFQCS  189



>ref|XP_010422216.1| PREDICTED: pEARLI1-like lipid transfer protein 1 [Camelina sativa]
Length=160

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
              KCP D LKL +C N+L+ L+++ +G P+   CC LI+GLVDLDAA+CLCTA+KAN+LG
Sbjct  74   SGKCPIDALKLGLCGNVLSSLLNIQLGQPSSQSCCSLIEGLVDLDAAICLCTALKANILG  133

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLS++LN C KK+P GF+CA
Sbjct  134  INLNVPISLSVLLNVCEKKLPSGFECA  160



>ref|XP_009598876.1| PREDICTED: lipid transfer protein EARLI 1-like, partial [Nicotiana 
tomentosiformis]
Length=93

 Score = 92.4 bits (228),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K KCPK+TLKL VCAN+L +L+ L +G+  K  CC LI GL D++AA+CLCTAIKANVLG
Sbjct  7    KGKCPKNTLKLGVCANVLGNLLGLKIGNIPKKPCCTLIKGLADVEAALCLCTAIKANVLG  66

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVPLSLSL+LN CGKKVP GF C
Sbjct  67   INLNVPLSLSLLLNVCGKKVPSGFIC  92



>ref|XP_010433390.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=154

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
               CP D L+L VCAN+L+ L+++ +G P+   CC LI GLVDLDAA+CLCTA++ANVLG
Sbjct  68   SGNCPIDALRLGVCANVLSSLLNVQLGQPSSQSCCSLIQGLVDLDAAICLCTALRANVLG  127

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLS++LN C +K+P GF+CA
Sbjct  128  INLNVPISLSVLLNVCNRKLPSGFQCA  154



>dbj|BAJ08384.1| qLTG3-1 [Oryza longistaminata]
Length=194

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            +CP DTLKL VCAN+LN L+++ +G+P +  CC LI GL DL+AAVCLCTA++AN+LGIN
Sbjct  109  RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  168

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSL++N CG+ VP GF+C+
Sbjct  169  LNLPINLSLLVNYCGRSVPSGFQCS  193



>dbj|BAJ08383.1| qLTG3-1 [Oryza glumipatula]
Length=194

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            +CP DTLKL VCAN+LN L+++ +G+P +  CC LI GL DL+AAVCLCTA++AN+LGIN
Sbjct  109  RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  168

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSL++N CG+ VP GF+C+
Sbjct  169  LNLPINLSLLVNYCGRSVPSGFQCS  193



>dbj|BAJ08381.1| qLTG3-1 [Oryza rufipogon]
Length=194

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            +CP DTLKL VCAN+LN L+++ +G+P +  CC LI GL DL+AAVCLCTA++AN+LGIN
Sbjct  109  RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  168

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSL++N CG+ VP GF+C+
Sbjct  169  LNLPINLSLLVNYCGRSVPSGFQCS  193



>ref|XP_009796139.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=158

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            +A+CP+D LKL VCANLL  LV  V+G+P    CC LI GL DL+AAVCLCTAI+ANVLG
Sbjct  73   QARCPRDALKLGVCANLLGGLVGAVIGTPPTMPCCSLIAGLADLEAAVCLCTAIRANVLG  132

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVPLSLSLVLNNCG+  P GF C
Sbjct  133  INLNVPLSLSLVLNNCGRNPPTGFTC  158



>ref|XP_009616484.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=134

 Score = 93.6 bits (231),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCPKDTLKLKVCANLLNDLVH+V+GS +K+ CC LI+ L D+DAAVCLCTAIKA +LG N
Sbjct  50   KCPKDTLKLKVCANLLNDLVHVVIGSSSKSSCCSLIENLADVDAAVCLCTAIKAKLLGTN  109

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            L+  LSLSL+LNNCGK VP+ F+CA
Sbjct  110  LDTALSLSLLLNNCGKTVPKDFQCA  134



>dbj|BAJ08382.1| qLTG3-1 [Oryza barthii]
Length=198

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            +CP DTLKL VCAN+LN L+++ +G+P +  CC LI GL DL+AAVCLCTA++AN+LGIN
Sbjct  113  RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  172

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSL++N CG+ VP GF+C+
Sbjct  173  LNLPINLSLLVNYCGRSVPSGFQCS  197



>dbj|BAJ08386.1| qLTG3-1 [Oryza meridionalis]
Length=199

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            +CP DTLKL VCAN+LN L+++ +G+P +  CC LI GL DL+AAVCLCTA++AN+LGIN
Sbjct  114  RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  173

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSL++N CG+ VP GF+C+
Sbjct  174  LNLPINLSLLVNYCGRSVPSGFQCS  198



>ref|XP_009388037.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=129

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            CP+D LKL +CAN+L  L+++ +G+P K  CC L++GLVDL+AAVCLCTA+K NVLG+ L
Sbjct  46   CPRDALKLGICANVLRGLLNVTLGTPPKQPCCSLLEGLVDLEAAVCLCTALKGNVLGLKL  105

Query  424  nvplslslvlnnCGKKVPEGFKC  492
            N+P+SLSL++N CGKKVP+GF C
Sbjct  106  NIPVSLSLLINYCGKKVPKGFLC  128



>dbj|BAJ08385.1| qLTG3-1 [Oryza longistaminata]
Length=204

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            +CP DTLKL VCAN+LN L+++ +G+P +  CC LI GL DL+AAVCLCTA++AN+LGIN
Sbjct  119  RCPIDTLKLGVCANVLNGLINVQLGTPPRQPCCSLIQGLADLEAAVCLCTALRANILGIN  178

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSL++N CG+ VP GF+C+
Sbjct  179  LNLPINLSLLVNYCGRSVPSGFQCS  203



>ref|XP_004298650.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Fragaria 
vesca subsp. vesca]
Length=135

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP+DTLKL VCA LLN  V  VVGSP    CC +++GLVDL+ AVCLCTAIKAN+LGIN
Sbjct  51   SCPRDTLKLGVCAKLLNGAVGAVVGSPPDTPCCAVLEGLVDLEVAVCLCTAIKANILGIN  110

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P+SLSL+L+ C KK P GF+CA
Sbjct  111  LNIPVSLSLLLDGCAKKFPSGFQCA  135



>dbj|BAK05563.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=193

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            A+CP D LKL VCAN+LN L++L +G+P K  CC LI GL DL+AAVCLCTA+KAN+LGI
Sbjct  107  ARCPIDALKLGVCANVLNGLINLQLGTPPKKPCCTLIQGLADLEAAVCLCTALKANILGI  166

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLNVP+ LSL++N CGK VP GF+C
Sbjct  167  NLNVPIDLSLLVNYCGKNVPAGFQC  191



>tpg|DAA37198.1| TPA: hypothetical protein ZEAMMB73_187029 [Zea mays]
 tpg|DAA42811.1| TPA: hypothetical protein ZEAMMB73_664289 [Zea mays]
Length=142

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            +CP D LKL VCANLLN L++  +G+P +  CC LI GL DL+AAVCLCT ++ANVLGIN
Sbjct  58   RCPVDALKLGVCANLLNGLINATLGTPPRTPCCTLIQGLADLEAAVCLCTVLRANVLGIN  117

Query  421  lnvplslslvlnnCGKKVPEGFKC  492
            LN+P++LSL++N CG++VP GF+C
Sbjct  118  LNLPINLSLLVNYCGRRVPSGFQC  141



>ref|XP_008796819.1| PREDICTED: lipid transfer protein EARLI 1-like [Phoenix dactylifera]
Length=125

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
              CP + LKL VCAN+LN L++L +G+P+K  CC L+ GL DLD A+CLCTA+KAN+LGI
Sbjct  40   GYCPMNALKLGVCANVLNGLINLNLGNPSKKPCCTLLQGLADLDVALCLCTALKANILGI  99

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLN+P+ LSL++N CGK VP GF+CA
Sbjct  100  NLNIPIDLSLLINYCGKNVPTGFQCA  125



>ref|XP_008786992.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=143

 Score = 93.6 bits (231),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCP D LKL VCA++LN L+HL +G P K  CC L+DGLVDL+AAVCLCT +KAN+LGI 
Sbjct  59   KCPVDALKLGVCADVLNGLIHLKLGKPPKLPCCSLLDGLVDLEAAVCLCTVLKANILGIK  118

Query  421  lnvplslslvlnnCGKKVPEGFKC  492
            LN+P+ LSL+LN CGK  P+GF+C
Sbjct  119  LNLPIHLSLLLNYCGKNTPKGFQC  142



>ref|NP_567391.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 ref|NP_567392.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 emb|CAB41721.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB41722.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78294.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78295.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AAO23622.1| At4g12520 [Arabidopsis thaliana]
 dbj|BAE99415.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AEE83141.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
 gb|AEE83142.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Arabidopsis thaliana]
Length=129

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
              CPKDTLKL VCAN+L DL+ + +G+P    CC L++GLVDL+AA CLCTA+KA VLGI
Sbjct  44   GSCPKDTLKLGVCANVLKDLLKIQLGTPPVKPCCSLLNGLVDLEAAACLCTALKAKVLGI  103

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLNVP+SLSL+LN CGKKVP GF CA
Sbjct  104  NLNVPVSLSLLLNVCGKKVPSGFVCA  129



>ref|NP_192984.1| azelaic acid induced 1 [Arabidopsis thaliana]
 sp|Q9SU35.1|ERLL1_ARATH RecName: Full=pEARLI1-like lipid transfer protein 1; AltName: 
Full=Protein AZELAIC ACID INDUCED 1; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB41717.1| pEARLI 1-like protein [Arabidopsis thaliana]
 emb|CAB78290.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AAM13031.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AAN15723.1| pEARLI 1-like protein [Arabidopsis thaliana]
 gb|AEE83137.1| azelaic acid induced 1 [Arabidopsis thaliana]
Length=161

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP D LKL VCAN+L+ L+++ +G P+   CC LI GLVD+DAA+CLCTA++ANVLGIN
Sbjct  77   SCPIDALKLGVCANVLSSLLNIQLGQPSSQQCCSLIQGLVDVDAAICLCTALRANVLGIN  136

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNVP+SLS++LN C +K+P GF+CA
Sbjct  137  LNVPISLSVLLNVCNRKLPSGFQCA  161



>ref|XP_008786988.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=136

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP+D L+L VCAN+L  L++L +G+P K  CC L++ LVDL+AAVCLCTAIKAN+LGIN
Sbjct  52   SCPRDALELGVCANVLQGLINLQLGNPPKKPCCSLLEDLVDLEAAVCLCTAIKANILGIN  111

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNVP+ LSL+LN CGKKVP G+ CA
Sbjct  112  LNVPVDLSLLLNYCGKKVPAGYACA  136



>emb|CDY31240.1| BnaC08g15350D [Brassica napus]
Length=137

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K KCPKDTLKL VCAN+LN L+ L +G P    CC LI GL D++AAVCLCTA+KANVLG
Sbjct  52   KGKCPKDTLKLGVCANVLNGLLDLTLGKPPVKPCCSLIQGLADVEAAVCLCTALKANVLG  111

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLN+P+SLSL+LN C K+VP GF+C
Sbjct  112  INLNLPISLSLLLNVCSKQVPPGFQC  137



>ref|XP_010695114.1| PREDICTED: lipid transfer protein EARLI 1-like [Beta vulgaris 
subsp. vulgaris]
Length=172

 Score = 94.0 bits (232),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            +  CP D LKL  CAN+L +L+ LV+G+P ++ CC L+ GL DL+AAVCLCTAIKANVLG
Sbjct  86   QGNCPIDVLKLGACANVLGNLLGLVIGTPPQSSCCSLLQGLTDLNAAVCLCTAIKANVLG  145

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLSL+LNNCGK  P GF+C+
Sbjct  146  INLNVPVSLSLLLNNCGKGAPSGFQCS  172



>ref|XP_009333674.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP+D+LKL VCA LLN +V  VVG+P    CC L++GLVDL+ AVCLCTAIKAN+LGIN
Sbjct  52   SCPRDSLKLGVCAKLLNGVVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGIN  111

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSLV++ C K VP GFKCA
Sbjct  112  LNIPIALSLVIDGCAKNVPAGFKCA  136



>ref|XP_007161198.1| hypothetical protein PHAVU_001G050300g [Phaseolus vulgaris]
 gb|ESW33192.1| hypothetical protein PHAVU_001G050300g [Phaseolus vulgaris]
Length=121

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
              KCPKDTLKL  CA++L  LV++VVGSP  + CC L+ GL DL+AA+CLCTAIKANVLG
Sbjct  36   SGKCPKDTLKLGACADILG-LVNIVVGSPVSSKCCALLSGLADLEAALCLCTAIKANVLG  94

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVP++LS++L+ C K VP GF+C
Sbjct  95   INLNVPITLSVLLSACQKTVPSGFQC  120



>ref|XP_010919520.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=140

 Score = 93.2 bits (230),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP+D LK  VCAN+L  L+++ +G+P K  CC L++GL DL+AAVCLCTAIKAN+LG N
Sbjct  56   SCPRDALKFGVCANVLQGLINVQLGNPPKKPCCSLLEGLADLEAAVCLCTAIKANILGTN  115

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNVP+ LSL+LN CGKKVP G+KCA
Sbjct  116  LNVPVDLSLLLNYCGKKVPAGYKCA  140



>ref|XP_009623719.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=135

 Score = 93.2 bits (230),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K KCPK+TLKL VCAN+L +L+ L +G+  K  CC LI GL D++AA+CLCTAIKANVLG
Sbjct  49   KGKCPKNTLKLGVCANVLGNLLGLKIGNIPKKPCCTLIKGLADVEAALCLCTAIKANVLG  108

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVPLSLSL+LN CGKKVP GF C
Sbjct  109  INLNVPLSLSLLLNVCGKKVPSGFIC  134



>ref|XP_004235150.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=109

 Score = 92.4 bits (228),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
             A C  D LK   CAN+L DLV +++G+   + CC LIDGLVDLDAAVCLCTA+KA+VLG
Sbjct  24   SADCSTDILKFGACANILTDLVGVIIGTTPTSSCCSLIDGLVDLDAAVCLCTALKADVLG  83

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INL++PLSL+++LN CGKK P G+ C
Sbjct  84   INLDIPLSLNILLNVCGKKYPTGYTC  109



>ref|XP_011036580.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Populus euphratica]
Length=126

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 71/83 (86%), Gaps = 1/83 (1%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            CP+DTLKL  CA++L  LV++VVG+P  + CCPL++GL DL+ A+CLCTAIKANVLGINL
Sbjct  44   CPRDTLKLGACADILG-LVNVVVGTPPYSKCCPLLEGLADLEVALCLCTAIKANVLGINL  102

Query  424  nvplslslvlnnCGKKVPEGFKC  492
            NVP++LS++++ CGK +P GFKC
Sbjct  103  NVPVALSVLVSACGKSIPPGFKC  125



>ref|XP_008796820.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=124

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCP D LKL VCAN+L  L++L +G P K  CC L++GLVDL+AAVCLCTA++AN+LGI 
Sbjct  40   KCPMDALKLGVCANVLKGLINLNLGKPPKKPCCSLLEGLVDLEAAVCLCTALRANILGIK  99

Query  421  lnvplslslvlnnCGKKVPEGFKC  492
            LN+P+ LSL+LN CGKK P+GF+C
Sbjct  100  LNLPIHLSLLLNYCGKKTPKGFQC  123



>gb|KHG02760.1| 14 kDa proline-rich DC2 [Gossypium arboreum]
Length=132

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 71/86 (83%), Gaps = 1/86 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            + +CP+D LKL VCAN+LN LV++ VGSP    CC L++GLVDL+AA CLCTAI+AN+LG
Sbjct  48   RGRCPRDALKLGVCANVLN-LVNVTVGSPPVMPCCSLLNGLVDLEAAACLCTAIRANILG  106

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLN+P+SLSL+LN C + VP GF+C
Sbjct  107  INLNIPVSLSLLLNVCSRNVPTGFQC  132



>ref|XP_009600481.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=170

 Score = 93.6 bits (231),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            + +CP+D LKL VCANLL  LV ++VGSP    CC LI GL DL+AAVCLCTAI+ANVLG
Sbjct  85   QGRCPRDALKLGVCANLLGGLVGVIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLG  144

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVPLSLSLVLNNCG+  P GF C
Sbjct  145  INLNVPLSLSLVLNNCGRNPPTGFTC  170



>dbj|BAA13150.1| NT16 polypeptide [Nicotiana tabacum]
Length=170

 Score = 93.6 bits (231),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            + +CP+D LKL VCANLL  LV ++VGSP    CC LI GL DL+AAVCLCTAI+ANVLG
Sbjct  85   QGRCPRDALKLGVCANLLGGLVGVIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLG  144

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVPLSLSLVLNNCG+  P GF C
Sbjct  145  INLNVPLSLSLVLNNCGRNPPTGFTC  170



>gb|AFK41425.1| unknown [Lotus japonicus]
Length=142

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            CP+D LKL VCAN+LN L+++ +G P    CC L+DGLVDL+AAVCLCTA+KAN+LGINL
Sbjct  59   CPRDALKLGVCANVLNGLLNVTLGQPPVTPCCTLLDGLVDLEAAVCLCTALKANILGINL  118

Query  424  nvplslslvlnnCGKKVPEGFKCA  495
            N+P+SLSL+LN C KKVP  F+CA
Sbjct  119  NLPISLSLLLNVCSKKVPRDFQCA  142



>dbj|BAA05471.1| tumor-related protein [Nicotiana glauca x Nicotiana langsdorffii]
Length=87

 Score = 91.3 bits (225),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            + +CP+D LKL VCANL+  LV  +VGSP    CC LI GL DL+AAVCLCTAI+ANVLG
Sbjct  2    QGRCPRDALKLGVCANLVGGLVGAIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLG  61

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVPLSLSLVLNNCG+  P GF C
Sbjct  62   INLNVPLSLSLVLNNCGRNPPTGFTC  87



>ref|XP_009333598.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Pyrus x bretschneideri]
Length=136

 Score = 92.8 bits (229),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP+D+LKL VCA LLN +V  VVG+P    CC L++GLVDL+ AVCLCTAIKAN+LGIN
Sbjct  52   SCPRDSLKLGVCAKLLNGVVGAVVGNPPDHPCCALLEGLVDLEVAVCLCTAIKANILGIN  111

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LN+P++LSLV++ C K VP GFKCA
Sbjct  112  LNIPIALSLVIDGCAKNVPAGFKCA  136



>ref|XP_002324869.2| hypothetical protein POPTR_0018s01890g [Populus trichocarpa]
 gb|ABK95939.1| unknown [Populus trichocarpa]
 gb|EEF03434.2| hypothetical protein POPTR_0018s01890g [Populus trichocarpa]
Length=121

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 71/83 (86%), Gaps = 1/83 (1%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            CP+DTLKL  CA++L  LV++VVGSP  + CCPL++GL DL+ A+CLCTAIKA+VLGINL
Sbjct  39   CPRDTLKLGACADILG-LVNVVVGSPPYSKCCPLLEGLADLEVALCLCTAIKASVLGINL  97

Query  424  nvplslslvlnnCGKKVPEGFKC  492
            NVP++LS++++ CGK +P GFKC
Sbjct  98   NVPVALSVLVSACGKSIPPGFKC  120



>ref|XP_003559027.1| PREDICTED: putative glycine-rich cell wall structural protein 
1 [Brachypodium distachyon]
 gb|ACF22748.1| proline-rich protein [Brachypodium distachyon]
Length=186

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             +CP D LKL VCAN+LN L++L +G+P K  CC LI GL DL+AAVCLCTA++AN+LGI
Sbjct  101  GRCPIDALKLGVCANVLNGLINLELGTPPKKPCCTLIQGLADLEAAVCLCTALRANILGI  160

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLNVP+ LSL++N CGK+VP GF+C
Sbjct  161  NLNVPIDLSLLVNYCGKRVPTGFQC  185



>ref|NP_192985.1| putative lipid transfer protein [Arabidopsis thaliana]
 sp|Q39176.1|ERLI1_ARATH RecName: Full=Lipid transfer protein EARLI 1; AltName: Full=Protein 
EARLY ARABIDOPSIS ALUMINUM INDUCED 1; Short=pEARLI1; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL06564.1|AF412111_1 AT4g12480/T1P17_70 [Arabidopsis thaliana]
 gb|AAC37471.1| pEARLI 1 [Arabidopsis thaliana]
 emb|CAB41718.1| pEARLI 1 [Arabidopsis thaliana]
 emb|CAB78291.1| pEARLI 1 [Arabidopsis thaliana]
 gb|AAM91484.1| AT4g12480/T1P17_70 [Arabidopsis thaliana]
 dbj|BAF02055.1| pEARLI 1 [Arabidopsis thaliana]
 gb|AEE83138.1| putative lipid transfer protein [Arabidopsis thaliana]
Length=168

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
               CP D L+L VCAN+L+ L+++ +G P+   CC LI GLVDLDAA+CLCTA++ANVLG
Sbjct  82   SGNCPIDALRLGVCANVLSSLLNIQLGQPSAQPCCSLIQGLVDLDAAICLCTALRANVLG  141

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLS++LN C +KVP GF+CA
Sbjct  142  INLNVPISLSVLLNVCNRKVPSGFQCA  168



>gb|ABG91752.1| HyPRP2 [Gossypium hirsutum]
Length=137

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCP+D LKL VCA+LL  L+++ +G+P    CC LI GL DL+AAVCLCTAIKAN+LGI
Sbjct  52   GKCPRDALKLGVCADLLGGLLNVTIGTPPVQPCCSLIQGLADLEAAVCLCTAIKANILGI  111

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLNVPLSLSL+LN C KKVP GF+C
Sbjct  112  NLNVPLSLSLLLNVCSKKVPSGFQC  136



>ref|XP_006295216.1| hypothetical protein CARUB_v10024298mg [Capsella rubella]
 gb|EOA28114.1| hypothetical protein CARUB_v10024298mg [Capsella rubella]
Length=134

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K  CP DTLKL VCA+LL  LV++++GSP K  CC L+ GL +L+AAVCLCTA+KANVLG
Sbjct  49   KPTCPTDTLKLGVCADLLG-LVNVLIGSPPKTPCCSLLQGLANLEAAVCLCTALKANVLG  107

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+ LSL+LN CGKK+P GF+CA
Sbjct  108  INLNVPVDLSLLLNYCGKKLPYGFQCA  134



>ref|XP_007052128.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOX96285.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=135

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 65/87 (75%), Gaps = 2/87 (2%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            AKCPKDTLK  VC + L  LVH VVG+P    CC LI GL DL+AA+CLCTAIKANVLG+
Sbjct  50   AKCPKDTLKFGVCGSWLG-LVHEVVGTPPSKECCTLIAGLADLEAALCLCTAIKANVLGV  108

Query  418  nlnvp-lslslvlnnCGKKVPEGFKCA  495
                  ++L+L++N CGKKVPEGF CA
Sbjct  109  IKVKTPVALTLLINACGKKVPEGFVCA  135



>gb|KDP25651.1| hypothetical protein JCGZ_20807 [Jatropha curcas]
Length=244

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            +  CP+DTLKL VC +LL DL+ + +G+P K  CC L+  LVDL+AAVCLCT IKA++LG
Sbjct  158  QGACPRDTLKLGVCVDLLKDLLSVTIGTPPKTPCCSLLGDLVDLEAAVCLCTTIKASLLG  217

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLN+P+ LSL+LN CGKKVP+GF+CA
Sbjct  218  INLNLPIDLSLLLNYCGKKVPQGFQCA  244



>ref|XP_010695112.1| PREDICTED: lipid transfer protein EARLI 1-like [Beta vulgaris 
subsp. vulgaris]
Length=224

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            +  CP D LKL  CAN+L +L+ LV+G+P ++ CC L+ GL DL+AAVCLCTAIKANVLG
Sbjct  138  QGNCPIDVLKLGACANVLGNLLGLVIGTPPQSSCCSLLQGLTDLNAAVCLCTAIKANVLG  197

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLSL+LNNCGK  P GF+C+
Sbjct  198  INLNVPVSLSLLLNNCGKGAPSGFQCS  224



>ref|XP_010422218.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=148

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
               CP D L+L VCAN+L+ L+++ +G P+   CC LI GLVD+DAAVCLCTA++AN+LG
Sbjct  62   SGNCPIDALRLGVCANVLSSLLNVQLGQPSSQSCCSLIQGLVDVDAAVCLCTALRANILG  121

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLS++LN C +K+P GF+CA
Sbjct  122  INLNVPISLSVLLNVCNRKLPSGFQCA  148



>emb|CDP19512.1| unnamed protein product [Coffea canephora]
Length=133

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 68/87 (78%), Gaps = 2/87 (2%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG-  414
            AKCPKD LK  VC + L  LVH V+G+     CC LI GL DL+AAVCLCTAIKAN+LG 
Sbjct  48   AKCPKDALKFGVCGDWLG-LVHEVIGAKPSGECCALIKGLADLEAAVCLCTAIKANILGA  106

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            I + +P+++S+++N+CGKKVPEGFKCA
Sbjct  107  IEVKIPVAISMLINSCGKKVPEGFKCA  133



>ref|XP_002271619.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
Length=133

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/87 (61%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
               CP D LKL VCAN+L+ LV +V+G+P    CC L+DGL+DL+AA+CLCTAIKAN+LG
Sbjct  47   SGSCPIDALKLGVCANVLSGLVGVVIGTPPDTPCCALLDGLLDLEAAICLCTAIKANILG  106

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INL++ LSLSL++N CGK +P+ F+CA
Sbjct  107  INLDIHLSLSLLINTCGKTLPKDFQCA  133



>ref|XP_009801606.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=134

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCPKDTLKL VCANLLNDLVH+V+GS +K+ CC LI+ L D+DAAVCLCTAIKA +LG N
Sbjct  50   KCPKDTLKLNVCANLLNDLVHVVIGSSSKSSCCSLIENLADVDAAVCLCTAIKAKLLGTN  109

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            L+  LSLSL+LNNCGK VP+ F+CA
Sbjct  110  LDTALSLSLLLNNCGKTVPKDFQCA  134



>tpg|DAA42812.1| TPA: hypothetical protein ZEAMMB73_664289 [Zea mays]
Length=189

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
              +CP D LKL VCANLLN L++  +G+P +  CC LI GL DL+AAVCLCT ++ANVLG
Sbjct  103  SGRCPVDALKLGVCANLLNGLINATLGTPPRTPCCTLIQGLADLEAAVCLCTVLRANVLG  162

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLN+P++LSL++N CG++VP GF+C
Sbjct  163  INLNLPINLSLLVNYCGRRVPSGFQC  188



>ref|XP_010695113.1| PREDICTED: lipid transfer protein EARLI 1-like [Beta vulgaris 
subsp. vulgaris]
Length=185

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            +  CP D LKL  CAN+L +L+ LV+G+P ++ CC L+ GL DL+AAVCLCTAIKANVLG
Sbjct  99   QGNCPIDVLKLGACANVLGNLLGLVIGTPPQSSCCSLLQGLTDLNAAVCLCTAIKANVLG  158

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLSL+LNNCGK  P GF+C+
Sbjct  159  INLNVPISLSLLLNNCGKGAPSGFQCS  185



>ref|XP_009133710.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Brassica rapa]
 emb|CDX83396.1| BnaA03g21100D [Brassica napus]
Length=131

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K  CP DTLKL VCA+LL  LV+++VGSP K  CC L++GL +++AAVCLCTA+KANVLG
Sbjct  46   KPTCPTDTLKLGVCADLLG-LVNVLVGSPPKTPCCALLNGLANVEAAVCLCTALKANVLG  104

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+ LSL+LN CGKK+P GF+CA
Sbjct  105  INLNVPVDLSLLLNYCGKKLPYGFQCA  131



>ref|XP_010055514.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Eucalyptus 
grandis]
 gb|KCW71995.1| hypothetical protein EUGRSUZ_E00448 [Eucalyptus grandis]
Length=135

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            CP+D LKL VCA++L +L+++ VG P    CC L++GLVDL+AAVCLCTAIKAN+LGINL
Sbjct  52   CPRDALKLGVCADVLGNLLNVTVGKPPVTPCCSLLNGLVDLEAAVCLCTAIKANILGINL  111

Query  424  nvplslslvlnnCGKKVPEGFKCA  495
            N+P+SLSL+LN C K+VP GFKCA
Sbjct  112  NIPISLSLLLNVCSKQVPPGFKCA  135



>ref|XP_007137003.1| hypothetical protein PHAVU_009G092000g [Phaseolus vulgaris]
 gb|ESW08997.1| hypothetical protein PHAVU_009G092000g [Phaseolus vulgaris]
Length=162

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 69/87 (79%), Gaps = 1/87 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K  CPKD LKL VCAN+L  LVH++VG+P  + CC LI  L DL+AA+CLCTAIKANVLG
Sbjct  77   KGSCPKDILKLGVCANVLG-LVHVIVGTPPSSDCCALIKDLADLEAALCLCTAIKANVLG  135

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP++LS +L+ C K VP GFKC+
Sbjct  136  INLNVPVALSAILSACQKTVPSGFKCS  162



>emb|CDP09932.1| unnamed protein product [Coffea canephora]
Length=147

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            +  CP+D LKL VCANLLN ++ + +GSP    CC L+ GL DL+AA+CLCTAIKAN+LG
Sbjct  62   QKSCPRDALKLGVCANLLN-IIGISIGSPPTEPCCSLLQGLADLEAALCLCTAIKANILG  120

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLS++LN+CGKKVP GF+CA
Sbjct  121  INLNVPVSLSVILNDCGKKVPNGFQCA  147



>ref|XP_010430305.1| PREDICTED: lipid transfer protein EARLI 1 [Camelina sativa]
Length=149

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            AKCPKD LKL VCAN+LN L+++ +G P    CC LI GL DL+AA CLCTA+KAN+LGI
Sbjct  65   AKCPKDALKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGI  124

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLN+P+SLSL+LN C KKVP GF+C
Sbjct  125  NLNIPISLSLLLNVCSKKVPPGFQC  149



>ref|XP_006302912.1| hypothetical protein CARUB_v10021046mg [Capsella rubella]
 gb|EOA35810.1| hypothetical protein CARUB_v10021046mg [Capsella rubella]
Length=170

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            AKCPKD LKL VCAN+LN L+++ +G P    CC LI GL DL+AA CLCTA+KAN+LGI
Sbjct  86   AKCPKDALKLGVCANVLNGLLNITLGKPPVEPCCTLIKGLADLEAAACLCTALKANILGI  145

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLN+P+SLSL+LN C KKVP GF+C
Sbjct  146  NLNIPVSLSLLLNVCSKKVPPGFQC  170



>ref|XP_010906606.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=132

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCP +TLKL VCA +LN L+++ +G P K  CC L++GLVDL+AAVCLCTA+KA++LGI 
Sbjct  48   KCPINTLKLGVCAKVLNGLINVSLGKPPKKPCCTLLEGLVDLEAAVCLCTALKASILGIK  107

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNVP+ LSL+LN CGKKVP G+KCA
Sbjct  108  LNVPVDLSLLLNYCGKKVPAGWKCA  132



>ref|XP_006304906.1| hypothetical protein CARUB_v10011959mg [Capsella rubella]
 gb|EOA37804.1| hypothetical protein CARUB_v10011959mg [Capsella rubella]
Length=138

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCPKDTLKL VCAN+LN L+ L +G P    CC LI GL D++AAVCLCTA+KANVLGIN
Sbjct  55   KCPKDTLKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGIN  114

Query  421  lnvplslslvlnnCGKKVPEGFKC  492
            LNVP+SLSL+LN C K++P GF+C
Sbjct  115  LNVPISLSLLLNVCSKQLPSGFQC  138



>ref|XP_009382414.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=145

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            A+CP+D LKL VCAN+L  L+++ +G+P K  CC L+ GLVDL+AAVCLCTA+K NVLG+
Sbjct  60   ARCPRDALKLGVCANVLGGLLNITLGTPPKEPCCTLLQGLVDLEAAVCLCTALKGNVLGL  119

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
             LN+P+SLSL+LN CGK+VP GF C
Sbjct  120  VLNLPISLSLLLNYCGKEVPTGFLC  144



>ref|XP_008648736.1| PREDICTED: pEARLI1-like lipid transfer protein 2 [Zea mays]
 gb|AFW75218.1| hypothetical protein ZEAMMB73_070531 [Zea mays]
Length=133

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCP + +KL VCA++L+ L+H VVG P K  CC LI GL DLDAAVC+C AI AN+LG+
Sbjct  48   GKCPVNAVKLGVCADVLDGLIHAVVGGPPKEPCCSLISGLADLDAAVCVCLAINANILGV  107

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NL+V + LSL++N CG++VP GFKCA
Sbjct  108  NLDVAVDLSLLVNYCGRRVPAGFKCA  133



>ref|XP_011018292.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Populus euphratica]
Length=140

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             +CPKD LKL VCA+LL  L+++ +GSP    CC +I GL+DL+AAVCLCTAIKAN+LGI
Sbjct  55   GRCPKDALKLGVCADLLGSLLNVTIGSPPVKPCCSVIQGLLDLEAAVCLCTAIKANILGI  114

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLN+PLSLSL++N CGKKVP+ F+C
Sbjct  115  NLNIPLSLSLLVNVCGKKVPKDFQC  139



>ref|XP_010473467.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=157

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            AKCPKD LKL VCAN+LN L+++ +G P    CC LI GL DL+AA CLCTA+KAN+LGI
Sbjct  73   AKCPKDALKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGI  132

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLN+P+SLSL+LN C KKVP GF+C
Sbjct  133  NLNIPISLSLLLNVCSKKVPPGFQC  157



>ref|XP_010418243.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=157

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            AKCPKD LKL VCAN+LN L+++ +G P    CC LI GL DL+AA CLCTA+KAN+LGI
Sbjct  73   AKCPKDALKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGI  132

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLN+P+SLSL+LN C KKVP GF+C
Sbjct  133  NLNIPISLSLLLNVCSKKVPPGFQC  157



>ref|NP_176440.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
 gb|AAD43608.1|AC005698_7 T3P18.7 [Arabidopsis thaliana]
 gb|AAQ65111.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAD95067.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAD93991.1| similar to 14KD proline-rich protein DC2.15 precursor [Arabidopsis 
thaliana]
 dbj|BAD94286.1| At1g62510 [Arabidopsis thaliana]
 dbj|BAF01655.1| similar to 14KD proline-rich protein DC2.15 precursor sp|P14009 
[Arabidopsis thaliana]
 dbj|BAF02193.1| similar to 14KD proline-rich protein DC2.15 precursor sp|P14009 
[Arabidopsis thaliana]
 gb|AEE33973.1| bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin-like protein [Arabidopsis thaliana]
Length=149

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            AKCP+D LKL VCAN+LN L+++ +G P    CC LI GL DL+AA CLCTA+KAN+LGI
Sbjct  65   AKCPRDALKLGVCANVLNGLLNVTLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGI  124

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLN+PLSLSL+LN C KKVP GF+C
Sbjct  125  NLNIPLSLSLLLNVCSKKVPRGFQC  149



>ref|XP_007039884.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
 gb|EOY24385.1| Bifunctional inhibitor/lipid-transfer protein/seed storage 2S 
albumin superfamily protein [Theobroma cacao]
Length=134

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 1/86 (1%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            A CPKDTLKL VCA+LLN L+H VVG+PAK  CC L+ GL D +A VCLCT IKA+VLG 
Sbjct  50   ASCPKDTLKLGVCADLLN-LMHAVVGNPAKTPCCSLLAGLADAEATVCLCTTIKASVLGA  108

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLN+P+SLSL+LN CGK +P G++CA
Sbjct  109  NLNIPVSLSLLLNYCGKNIPAGYQCA  134



>emb|CDX95635.1| BnaC03g25160D [Brassica napus]
Length=131

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K  CP DTLKL VCA+LL  L++++VGSP K  CC L++GL +++AAVCLCTA+KANVLG
Sbjct  46   KPTCPTDTLKLGVCADLLG-LINVLVGSPPKTPCCALLNGLANVEAAVCLCTALKANVLG  104

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+ LSL+LN CGKK+P GF+CA
Sbjct  105  INLNVPVDLSLLLNYCGKKLPYGFQCA  131



>ref|XP_010695178.1| PREDICTED: pEARLI1-like lipid transfer protein 2 [Beta vulgaris 
subsp. vulgaris]
Length=224

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            +  CP D LKL  CAN+L +L+ LV+G+P ++ CC L+ GL DL+AAVCLCTAIKAN+LG
Sbjct  138  QGNCPIDVLKLGACANVLGNLLGLVIGTPPQSSCCSLLQGLTDLNAAVCLCTAIKANILG  197

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLSL+LNNCGK  P GF+C+
Sbjct  198  INLNVPVSLSLLLNNCGKGAPSGFQCS  224



>ref|XP_008448871.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis melo]
Length=134

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP+D LKL VC  LLN  V  +VGS     CC L+DGL+DL+AAVCLCTAIKANVLGIN
Sbjct  50   SCPRDALKLGVCTKLLNGPVSALVGSLPNTQCCSLLDGLIDLEAAVCLCTAIKANVLGIN  109

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            +N+P+SLSL++N CGKKVP  F+CA
Sbjct  110  INIPISLSLLVNVCGKKVPSEFQCA  134



>gb|KFK25909.1| hypothetical protein AALP_AA8G178400 [Arabis alpina]
Length=157

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            AKCP+D LKL VCAN+LN L+++ +G P    CC LI GL DL+AA CLCTA+KAN+LGI
Sbjct  73   AKCPRDALKLGVCANVLNGLLNITLGKPPVEPCCTLIQGLADLEAAACLCTALKANILGI  132

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLN+P+SLSL+LN C KKVP GF+C
Sbjct  133  NLNIPISLSLLLNVCSKKVPPGFQC  157



>ref|XP_004150818.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 ref|XP_004163648.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cucumis sativus]
 gb|KGN55887.1| hypothetical protein Csa_3G027210 [Cucumis sativus]
Length=136

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP+D LKL VC  LLN  V  +VGS     CC L+DGL+DL+AAVCLCTAIKANVLGIN
Sbjct  52   SCPRDALKLGVCTKLLNGPVSALVGSLPNTQCCSLLDGLIDLEAAVCLCTAIKANVLGIN  111

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            +N+P+SLSL++N CGKKVP  F+CA
Sbjct  112  INIPISLSLLVNVCGKKVPSEFQCA  136



>ref|XP_006417266.1| hypothetical protein EUTSA_v10009061mg [Eutrema salsugineum]
 gb|ESQ35619.1| hypothetical protein EUTSA_v10009061mg [Eutrema salsugineum]
Length=139

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCPKDTLKL VCAN+LN L+ L +G P    CC LI GL D++AAVCLCTA+KANVLGIN
Sbjct  56   KCPKDTLKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGIN  115

Query  421  lnvplslslvlnnCGKKVPEGFKC  492
            LN+P+SLSL+LN C K+VP GF+C
Sbjct  116  LNLPISLSLLLNVCSKQVPPGFQC  139



>ref|XP_006368194.1| HyPRP family protein [Populus trichocarpa]
 gb|ABK92650.1| unknown [Populus trichocarpa]
 gb|ERP64763.1| HyPRP family protein [Populus trichocarpa]
Length=140

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCPKD LKL VCA+LL  L+++ +GSP    CC +I GL+DL+AA+CLCTAIKAN+LGI
Sbjct  55   GKCPKDALKLGVCADLLGSLLNVTIGSPPVKPCCSVIQGLLDLEAAICLCTAIKANILGI  114

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLN+P+SLSL++N CGKKVP+ F+C
Sbjct  115  NLNIPISLSLLINVCGKKVPKDFQC  139



>ref|XP_004251936.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Solanum lycopersicum]
Length=123

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCPKD LKL VCAN+LN LV++ VGSP    CC LI GL DL+AAVCLCTAI+ANVLGIN
Sbjct  41   KCPKDALKLGVCANVLN-LVNVTVGSPPPLPCCSLIQGLTDLEAAVCLCTAIRANVLGIN  99

Query  421  lnvplslslvlnnCGKKVPEGFKC  492
            LN+PLSLSLVLNNCG+  P GF C
Sbjct  100  LNIPLSLSLVLNNCGRNPPTGFTC  123



>ref|XP_006396753.1| hypothetical protein EUTSA_v10029038mg [Eutrema salsugineum]
 gb|ESQ38206.1| hypothetical protein EUTSA_v10029038mg [Eutrema salsugineum]
Length=153

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP D LKL VCAN+L+ L+++ +G P+   CC L+ GLVDL+AAVCLCTA++ANVLGIN
Sbjct  69   NCPIDVLKLGVCANVLSGLLNIQLGQPSTQECCSLVQGLVDLEAAVCLCTALRANVLGIN  128

Query  421  lnvplslslvlnnCGKKVPEGFKC  492
            LNVP+SLS++LN C KKVP GF+C
Sbjct  129  LNVPISLSVLLNKCNKKVPSGFEC  152



>gb|KHN04347.1| 14 kDa proline-rich protein DC2.15 [Glycine soja]
Length=134

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            A CP+D LKL VCAN+L  L+++ +G P    CC L+DGLVDL+AAVCLCTA+KAN+LGI
Sbjct  49   ASCPRDALKLGVCANVLKGLLNVTLGQPPVTPCCSLLDGLVDLEAAVCLCTALKANILGI  108

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLN+PLSLSL+LN C +KVP  F+CA
Sbjct  109  NLNLPLSLSLLLNVCSRKVPRDFQCA  134



>ref|XP_010476166.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Camelina 
sativa]
Length=143

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            KCPKDTLKL VCAN+LN L+ L +G P    CC LI GL +L+AAVCLCTA+KANVLGIN
Sbjct  59   KCPKDTLKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLANLEAAVCLCTALKANVLGIN  118

Query  421  lnvplslslvlnnCGKKVPEGFKC  492
            LN+P+SLSL+LN C K++P GF+C
Sbjct  119  LNLPISLSLLLNVCSKQLPSGFQC  142



>ref|XP_006289038.1| hypothetical protein CARUB_v10002422mg [Capsella rubella]
 gb|EOA21936.1| hypothetical protein CARUB_v10002422mg [Capsella rubella]
Length=156

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
               CP + L+L VCAN+L++L++L +G P+   CC LI GLVD+DAA+CLCTA+KANVLG
Sbjct  70   SGNCPINALRLGVCANVLSNLLNLQLGQPSSQPCCSLIQGLVDVDAAICLCTALKANVLG  129

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
             N+++P+SLS++LN C KKVP GF+CA
Sbjct  130  FNVDIPVSLSVLLNVCNKKVPSGFQCA  156



>ref|XP_002874777.1| hypothetical protein ARALYDRAFT_911650 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51036.1| hypothetical protein ARALYDRAFT_911650 [Arabidopsis lyrata subsp. 
lyrata]
Length=150

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP D L+L VCAN+L+ L+++ +G P+   CC LI GLVDLDAA+CLCTA++ANVLGIN
Sbjct  66   NCPIDALRLGVCANVLSGLLNVQLGQPSAQPCCSLIQGLVDLDAAICLCTALRANVLGIN  125

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNVP+SLS++LN C +++P GF+CA
Sbjct  126  LNVPISLSVLLNVCNRRLPSGFQCA  150



>ref|XP_009110671.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Brassica rapa]
 emb|CDY21033.1| BnaA08g24920D [Brassica napus]
Length=137

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K KCPKDTLKL VCAN+L+ L+ L +G P    CC LI GL D++AAVCLCTA+KANVLG
Sbjct  52   KGKCPKDTLKLGVCANVLSGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLG  111

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLN+P+SLSL+LN C K+VP GF+C
Sbjct  112  INLNLPISLSLLLNVCSKQVPPGFQC  137



>ref|XP_006396754.1| hypothetical protein EUTSA_v10029528mg [Eutrema salsugineum]
 gb|ESQ38207.1| hypothetical protein EUTSA_v10029528mg [Eutrema salsugineum]
Length=161

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP D LKL VCAN+L+ L+++ +G P+   CC L+ GLVDL+AAVCLCTA++ANVLGIN
Sbjct  77   NCPIDVLKLGVCANVLSGLLNIQLGQPSTQECCSLVQGLVDLEAAVCLCTALRANVLGIN  136

Query  421  lnvplslslvlnnCGKKVPEGFKC  492
            LNVP+SLS++LN C KKVP GF+C
Sbjct  137  LNVPISLSVLLNKCNKKVPSGFEC  160



>ref|XP_011018291.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Populus euphratica]
Length=131

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            + +CP+D LKL VCA LLN  +  VVGSP    CC ++ GLVDL+AAVCLCTAIKAN+LG
Sbjct  45   RNRCPRDALKLGVCAKLLNGAIGGVVGSPPDTPCCTVLQGLVDLEAAVCLCTAIKANILG  104

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            IN+++P+SLSL++N CGKK+P  F CA
Sbjct  105  INIDIPISLSLLINTCGKKLPSDFICA  131



>gb|KDP25647.1| hypothetical protein JCGZ_20803 [Jatropha curcas]
Length=130

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            CP+DTLKL VC ++L  L+++ VG P K  CC L+  LVDL+AAVCLCT IKA++LGINL
Sbjct  47   CPRDTLKLGVCVDVLKGLLNVTVGKPPKTPCCSLLGDLVDLEAAVCLCTTIKASLLGINL  106

Query  424  nvplslslvlnnCGKKVPEGFKCA  495
            N+P+ LSL+LN CGKKVPEGFKCA
Sbjct  107  NLPIDLSLLLNYCGKKVPEGFKCA  130



>dbj|BAA11854.1| extensin like protein [Populus nigra]
 dbj|BAA11855.1| extensin like protein [Populus nigra]
Length=141

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCPKD LKL VCA+LL  L+++ VG+P    CC +I GL+DL+AAVCLCTAIKAN+LGI
Sbjct  56   GKCPKDALKLGVCADLLGSLLNVTVGTPPVKPCCSVIQGLLDLEAAVCLCTAIKANILGI  115

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLN+PLSLSL+LN CGKKVP+ F+C+
Sbjct  116  NLNIPLSLSLLLNVCGKKVPKDFQCS  141



>ref|XP_009783445.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=158

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            + +CP+D LKL VCANL+  LV  V+GSP    CC LI GL DL+AAVCLCTAI+ANVLG
Sbjct  73   QGRCPRDALKLGVCANLVGGLVGAVIGSPPTMPCCSLIAGLADLEAAVCLCTAIRANVLG  132

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVPLSLSLVLNNCG+  P GF C
Sbjct  133  INLNVPLSLSLVLNNCGRNPPTGFTC  158



>ref|XP_010553463.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Tarenaya 
hassleriana]
Length=143

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            +AKCPKD LKL VCAN+LN L+++ +G P    CC LI GL D++AA CLCTA+KAN+LG
Sbjct  57   QAKCPKDALKLGVCANVLNGLLNVTLGQPPVEPCCTLIQGLADVEAAACLCTALKANILG  116

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLN+P+SLSL+LN C KKVP GF+C
Sbjct  117  INLNLPISLSLLLNVCSKKVPPGFQC  142



>ref|XP_010422217.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=172

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
               CP D LKL VC N+L+ L+++ +G P+   CC LI GLVD+DAAVCLCTA++AN+LG
Sbjct  86   SGNCPIDALKLGVCGNVLSRLLNIQLGQPSAQQCCSLIQGLVDVDAAVCLCTALRANILG  145

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLNVP+SLS++LN C +K+P GF+CA
Sbjct  146  INLNVPISLSVLLNACNRKLPSGFQCA  172



>ref|XP_002880164.1| hypothetical protein ARALYDRAFT_483654 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56423.1| hypothetical protein ARALYDRAFT_483654 [Arabidopsis lyrata subsp. 
lyrata]
Length=132

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K  CP DTLKL VCA LL  LV+LVVGSP K  CC L+ GL +L+AAVCLCTA+KANVLG
Sbjct  49   KPTCPTDTLKLGVCAELL-GLVNLVVGSPPKTPCCTLLQGLANLEAAVCLCTALKANVLG  107

Query  415  InlnvplslslvlnnCGKKVPEGFK  489
            INLNVP+ LSL+LN CGKK+P GF+
Sbjct  108  INLNVPVDLSLLLNYCGKKLPYGFQ  132



>ref|XP_009619251.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
Length=158

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            + +CP+D LKL VCANL+  LV  +VGSP    CC LI GL DL+AAVCLCTAI+ANVLG
Sbjct  73   QGRCPRDALKLGVCANLVGGLVGAIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLG  132

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVPLSLSLVLNNCG+  P GF C
Sbjct  133  INLNVPLSLSLVLNNCGRNPPTGFTC  158



>ref|XP_009782706.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=158

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            + +CP+D LKL VCANL+  LV  V+G+P    CC LI GL DL+AAVCLCTAI+ANVLG
Sbjct  73   RGRCPRDALKLGVCANLVGGLVGAVIGTPPTMPCCSLIAGLADLEAAVCLCTAIRANVLG  132

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVPLSLSLVLNNCG+  P GF C
Sbjct  133  INLNVPLSLSLVLNNCGRNPPTGFTC  158



>ref|XP_009397884.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Musa acuminata 
subsp. malaccensis]
Length=132

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP DT+KL  CAN+L  L++L +G+P K  CC LI+GL D +AA+CLCTAIKAN+LGI+
Sbjct  48   SCPIDTVKLGACANVLGGLINLQIGTPPKKPCCSLIEGLADFEAALCLCTAIKANILGIS  107

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNV + L+L+LN CGKKVP G+ CA
Sbjct  108  LNVDVDLTLLLNYCGKKVPYGYLCA  132



>ref|XP_004986077.1| PREDICTED: putative glycine-rich cell wall structural protein 
1-like [Setaria italica]
Length=203

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
            +CP D LKL VCAN+L  L+++ +G+P +  CC LI GL DL+AAVCLCTA++ANVLGI 
Sbjct  119  RCPIDALKLGVCANVLQGLINVTLGTPPRTPCCTLIQGLADLEAAVCLCTALRANVLGIT  178

Query  421  lnvplslslvlnnCGKKVPEGFKC  492
            +N+P++LSL++N CG++VP GF+C
Sbjct  179  INLPINLSLLVNYCGRRVPNGFQC  202



>ref|XP_010264240.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nelumbo nucifera]
Length=132

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            K  CP+D LKL VCA LLN  V   VG+P    CC L++GLVDL+ A CLCTAIKAN+LG
Sbjct  46   KGSCPRDALKLGVCAKLLNGAVGAEVGNPPDHPCCTLLEGLVDLEVAACLCTAIKANILG  105

Query  415  InlnvplslslvlnnCGKKVPEGFKCA  495
            INLN+P+SLSL++N CGKK+P GF+CA
Sbjct  106  INLNIPVSLSLLVNTCGKKLPSGFQCA  132



>ref|XP_007039886.1| 14 kDa proline-rich protein DC2.15, putative [Theobroma cacao]
 gb|EOY24387.1| 14 kDa proline-rich protein DC2.15, putative [Theobroma cacao]
Length=140

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCP+D LKL +CA+LL  L+++ VG P    CC LI GL DL+AAVCLCTAIKAN+LGI
Sbjct  55   GKCPRDALKLGICADLLGGLLNVTVGKPPVQPCCSLIQGLADLEAAVCLCTAIKANILGI  114

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLN+P+SLSL+LN C K VP GF+C+
Sbjct  115  NLNIPVSLSLLLNVCSKNVPSGFQCS  140



>gb|KDP25648.1| hypothetical protein JCGZ_20804 [Jatropha curcas]
Length=251

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            CP+DTLKL VC +LL DL+ + +G+P K  CC L+  LVDL+AAVCLCT IKA++LGINL
Sbjct  168  CPRDTLKLGVCVDLLKDLLSVTIGTPPKTPCCSLLGDLVDLEAAVCLCTTIKASLLGINL  227

Query  424  nvplslslvlnnCGKKVPEGFKCA  495
            N+P+ LSL+LN CGKKVP+GF+CA
Sbjct  228  NLPIDLSLLLNYCGKKVPQGFQCA  251



>ref|XP_010433400.1| PREDICTED: lipid transfer protein EARLI 1-like [Camelina sativa]
Length=164

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  241  KCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGIn  420
             CP D LKL VC N+L+ L+++ +G P+   CC LI GLVD+DAAVCLCTA++AN+LGIN
Sbjct  80   NCPIDALKLGVCGNVLSRLLNIQLGQPSAQQCCSLIQGLVDVDAAVCLCTALRANILGIN  139

Query  421  lnvplslslvlnnCGKKVPEGFKCA  495
            LNVP+SLS++LN C +K+P GF+CA
Sbjct  140  LNVPISLSVLLNVCNRKLPSGFQCA  164



>ref|XP_009148613.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Brassica 
rapa]
 emb|CDY53347.1| BnaA06g38220D [Brassica napus]
Length=137

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCPKDTL+L VCAN+LN L+ L +G P    CC LI GL D++AAVCLCTA+KANVLGI
Sbjct  53   GKCPKDTLQLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGI  112

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLN+P+SLSL+LN C K+VP GF+C
Sbjct  113  NLNLPISLSLLLNVCSKQVPPGFQC  137



>ref|XP_009796138.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
 ref|XP_009796140.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
sylvestris]
Length=152

 Score = 91.7 bits (226),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            + +CP+D LKL VCANL+  LV  V+GSP    CC LI GL DL+AAVCLCTAI+ANVLG
Sbjct  67   QGRCPRDALKLGVCANLVGGLVGAVIGSPPTMPCCSLIAGLADLEAAVCLCTAIRANVLG  126

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVPLSLSLVLNNCG+  P GF C
Sbjct  127  INLNVPLSLSLVLNNCGRNPPTGFTC  152



>gb|KHN08148.1| Putative lipid-binding protein [Glycine soja]
Length=177

 Score = 92.0 bits (227),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 71/86 (83%), Gaps = 1/86 (1%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            KA CPKDTLKL  CA+LL  LV+++VG+P  + CC LI GL DL+AA+CLCTAIK+NVLG
Sbjct  91   KASCPKDTLKLGACADLLG-LVNIIVGTPPSSQCCALIKGLADLEAALCLCTAIKSNVLG  149

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVP++LS++L+ C K VP GF+C
Sbjct  150  INLNVPVTLSVILSACQKTVPPGFQC  175



>gb|KFK43474.1| hypothetical protein AALP_AA1G129700 [Arabis alpina]
Length=140

 Score = 91.3 bits (225),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCPKDTLKL VCAN+LN L+ L +G P    CC LI GL D++AAVCLCTA+KANVLGI
Sbjct  56   GKCPKDTLKLGVCANVLNGLLDLTLGKPPVEPCCSLIQGLADVEAAVCLCTALKANVLGI  115

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
            NLN+P+SLSL+LN C KKVP  F+C
Sbjct  116  NLNLPISLSLLLNVCSKKVPSDFQC  140



>ref|XP_010657904.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Vitis vinifera]
Length=218

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +1

Query  244  CPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGInl  423
            C  DTLKL VCA LLN LVHL VG+ A   CC L+D LVDL+AAVCLC  IKAN+LGINL
Sbjct  135  CSVDTLKLGVCAGLLNGLVHLGVGTLANTPCCSLLDNLVDLEAAVCLCMIIKANILGINL  194

Query  424  nvplslslvlnnCGKKVPEGFKCA  495
            + P++LSL+LN C K VP GF+CA
Sbjct  195  SDPVALSLLLNYCRKNVPSGFQCA  218



>ref|XP_008808739.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Phoenix dactylifera]
Length=126

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
             KCP D LKL VCA++L  L+++ +G+P K  CC L+ GLVDL+ AVCLC AIKA++LGI
Sbjct  41   GKCPIDALKLGVCADVLGGLLNITIGTPPKEPCCSLLSGLVDLEVAVCLCIAIKASILGI  100

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            NLN+P+ LSL++N CGKKVP GF+CA
Sbjct  101  NLNIPVDLSLLVNYCGKKVPSGFQCA  126



>ref|XP_009619252.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Nicotiana 
tomentosiformis]
 dbj|BAA95941.1| glycine-rich protein [Nicotiana tabacum]
Length=158

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +1

Query  235  KAKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLG  414
            + +CP+D LKL VCANL+  LV  +VGSP    CC LI GL DL+AAVCLCTAI+ANVLG
Sbjct  73   QGRCPRDALKLGVCANLVGGLVGAIVGSPPTLPCCSLIAGLADLEAAVCLCTAIRANVLG  132

Query  415  InlnvplslslvlnnCGKKVPEGFKC  492
            INLNVPLSLSLVLNNCG+  P GF C
Sbjct  133  INLNVPLSLSLVLNNCGRNPPTGFTC  158



>ref|XP_010053450.1| PREDICTED: 14 kDa proline-rich protein DC2.15 [Eucalyptus grandis]
 gb|KCW77748.1| hypothetical protein EUGRSUZ_D02042 [Eucalyptus grandis]
Length=121

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
            A CP++ LKL VC +LL  LV++ VG+P K  CC LI GL DL+AAVCLCTAI+A+VLG+
Sbjct  36   ASCPENALKLGVCLDLLGSLVNVTVGTPPKEPCCSLIQGLADLEAAVCLCTAIRADVLGL  95

Query  418  nlnvplslslvlnnCGKKVPEGFKCA  495
            +L+VPLSLSL+LN C KKVP GF+CA
Sbjct  96   HLDVPLSLSLLLNVCSKKVPPGFQCA  121



>ref|XP_010919517.1| PREDICTED: 14 kDa proline-rich protein DC2.15-like [Elaeis guineensis]
Length=157

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  238  AKCPKDTLKLKVCANLLNDLVHLVVGSPAKAHCCPLIDGLVDLDAAVCLCTAIKANVLGI  417
              CP D LKL VCAN+LN L++L  G P K  CC L+DGLVDL+AAVCLCT +KAN+LGI
Sbjct  72   GTCPVDALKLGVCANVLNGLINLKAGKPPKLPCCSLLDGLVDLEAAVCLCTVLKANILGI  131

Query  418  nlnvplslslvlnnCGKKVPEGFKC  492
             LN+P+ LSL+LN CGK  P GF+C
Sbjct  132  KLNLPIHLSLLLNYCGKNTPRGFQC  156



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1272215339102