BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16426_g2_i1 len=289 path=[267:0-288]

Length=289
                                                                      Score     E

tpg|DAA41830.1|  TPA: hypothetical protein ZEAMMB73_407541              194   3e-59   
ref|XP_008670686.1|  PREDICTED: 26S protease regulatory subunit 4...    194   1e-58   
ref|XP_009591299.1|  PREDICTED: 26S protease regulatory subunit 4...    192   2e-58   
gb|EEE67865.1|  hypothetical protein OsJ_25676                          194   3e-58   Oryza sativa Japonica Group [Japonica rice]
gb|KHN02432.1|  26S protease regulatory subunit 4 like                  192   4e-58   
gb|KCW58093.1|  hypothetical protein EUGRSUZ_H00817                     194   6e-58   
gb|KHN05911.1|  26S proteasome regulatory subunit 4 like A              192   9e-58   
gb|KEH42401.1|  regulatory particle triple-A ATPase                     193   1e-57   
ref|XP_010069676.1|  PREDICTED: 26S proteasome regulatory subunit...    194   1e-57   
ref|XP_001754191.1|  predicted protein                                  194   1e-57   
emb|CDP03836.1|  unnamed protein product                                194   2e-57   
ref|XP_009395473.1|  PREDICTED: 26S protease regulatory subunit 4...    194   2e-57   
ref|XP_010913635.1|  PREDICTED: 26S proteasome regulatory subunit...    194   2e-57   
ref|XP_009395470.1|  PREDICTED: 26S protease regulatory subunit 4...    194   2e-57   
ref|XP_008653527.1|  PREDICTED: 26S protease regulatory subunit 4...    194   2e-57   
ref|XP_010928641.1|  PREDICTED: 26S proteasome regulatory subunit...    194   2e-57   
ref|XP_007048402.1|  Regulatory particle AAA-ATPase 2A isoform 2        192   2e-57   
ref|XP_004958786.1|  PREDICTED: 26S protease regulatory subunit 4...    194   2e-57   
ref|XP_001752421.1|  predicted protein                                  194   2e-57   
dbj|BAA04615.1|  rice homologue of Tat binding protein                  194   2e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002463440.1|  hypothetical protein SORBIDRAFT_02g043840          194   2e-57   Sorghum bicolor [broomcorn]
gb|KEH42402.1|  regulatory particle triple-A ATPase                     194   2e-57   
ref|NP_001060719.1|  Os07g0691800                                       194   2e-57   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK03283.1|  predicted protein                                      194   2e-57   
ref|XP_010233630.1|  PREDICTED: 26S protease regulatory subunit 4...    194   3e-57   
ref|XP_001769084.1|  predicted protein                                  193   3e-57   
gb|KDP43828.1|  hypothetical protein JCGZ_23036                         193   3e-57   
emb|CBI37252.3|  unnamed protein product                                192   3e-57   
ref|XP_008372431.1|  PREDICTED: 26S proteasome regulatory subunit...    193   3e-57   
gb|EMT30939.1|  26S protease regulatory subunit 4-like protein          191   3e-57   
ref|XP_002526219.1|  26S protease regulatory subunit, putative          193   3e-57   Ricinus communis
ref|XP_009371109.1|  PREDICTED: 26S proteasome regulatory subunit...    193   3e-57   
gb|AAL73395.1|AF432345_1  26S proteasome regulatory subunit IV          193   4e-57   Syntrichia ruralis
ref|XP_006408928.1|  hypothetical protein EUTSA_v10001985mg             193   4e-57   
ref|XP_006283684.1|  hypothetical protein CARUB_v10004747mg             193   4e-57   
gb|EYU17968.1|  hypothetical protein MIMGU_mgv1a006475mg                193   4e-57   
ref|XP_001690446.1|  26S proteasome regulatory subunit                  193   4e-57   Chlamydomonas reinhardtii
ref|XP_004242383.1|  PREDICTED: 26S proteasome regulatory subunit...    193   4e-57   
gb|ABR16267.1|  unknown                                                 193   5e-57   Picea sitchensis
ref|XP_002966632.1|  hypothetical protein SELMODRAFT_267030             193   5e-57   
ref|XP_010526468.1|  PREDICTED: 26S proteasome regulatory subunit...    193   5e-57   
ref|XP_011080157.1|  PREDICTED: 26S proteasome regulatory subunit...    193   5e-57   
ref|XP_003537160.1|  PREDICTED: 26S proteasome regulatory subunit...    193   5e-57   
ref|XP_002301829.1|  26S protease regulatory complex subunit 4 fa...    193   5e-57   Populus trichocarpa [western balsam poplar]
ref|XP_004152012.1|  PREDICTED: 26S proteasome regulatory subunit...    193   5e-57   
gb|AAF22522.1|AF123391_1  26S proteasome AAA-ATPase subunit RPT2a       192   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010099046.1|  26S proteasome regulatory subunit 4-A-like p...    192   5e-57   
gb|KDP26427.1|  hypothetical protein JCGZ_17585                         192   5e-57   
ref|XP_007144443.1|  hypothetical protein PHAVU_007G156500g             192   5e-57   
ref|XP_003542453.1|  PREDICTED: 26S proteasome regulatory subunit...    192   5e-57   
ref|XP_006352708.1|  PREDICTED: 26S proteasome regulatory subunit...    192   5e-57   
ref|XP_011024543.1|  PREDICTED: 26S proteasome regulatory subunit...    192   5e-57   
ref|NP_194633.1|  regulatory particle AAA-ATPase 2A                     192   5e-57   Arabidopsis thaliana [mouse-ear cress]
gb|ACG31403.1|  26S protease regulatory subunit 4                       192   5e-57   Zea mays [maize]
ref|XP_010540956.1|  PREDICTED: 26S proteasome regulatory subunit...    192   5e-57   
ref|XP_007048401.1|  Regulatory particle AAA-ATPase 2A isoform 1        192   5e-57   
ref|XP_009802140.1|  PREDICTED: 26S proteasome regulatory subunit...    192   5e-57   
ref|XP_010684990.1|  PREDICTED: 26S proteasome regulatory subunit...    192   5e-57   
gb|KEH23989.1|  regulatory particle triple-A ATPase                     192   5e-57   
ref|XP_002320617.2|  hypothetical protein POPTR_0014s18530g             192   6e-57   Populus trichocarpa [western balsam poplar]
ref|XP_002263334.1|  PREDICTED: 26S proteasome regulatory subunit...    192   6e-57   Vitis vinifera
ref|XP_009601763.1|  PREDICTED: 26S proteasome regulatory subunit...    192   6e-57   
ref|NP_001146268.1|  uncharacterized protein LOC100279843               192   6e-57   Zea mays [maize]
gb|KHG28065.1|  26S proteasome regulatory subunit 4 B -like protein     192   6e-57   
gb|KHG18015.1|  26S proteasome regulatory subunit 4 A -like protein     192   6e-57   
gb|EPS64118.1|  hypothetical protein M569_10659                         192   6e-57   
ref|XP_010433142.1|  PREDICTED: 26S proteasome regulatory subunit...    192   6e-57   
ref|XP_006845594.1|  hypothetical protein AMTR_s00019p00202640          192   6e-57   
dbj|BAJ79010.1|  regulatory particle triple-A ATPase 2                  192   6e-57   
ref|XP_004495023.1|  PREDICTED: 26S proteasome regulatory subunit...    192   6e-57   
ref|XP_007049878.1|  Regulatory particle AAA-ATPase 2A                  192   6e-57   
ref|XP_003554317.1|  PREDICTED: 26S proteasome regulatory subunit...    192   6e-57   
ref|XP_003521331.1|  PREDICTED: 26S proteasome regulatory subunit...    192   6e-57   
ref|XP_008235533.1|  PREDICTED: 26S proteasome regulatory subunit...    192   6e-57   
ref|XP_004163169.1|  PREDICTED: LOW QUALITY PROTEIN: 26S proteaso...    192   6e-57   
ref|XP_004290031.1|  PREDICTED: 26S proteasome regulatory subunit...    192   6e-57   
ref|XP_010245668.1|  PREDICTED: 26S proteasome regulatory subunit...    192   6e-57   
ref|XP_010264024.1|  PREDICTED: 26S proteasome regulatory subunit...    192   6e-57   
ref|XP_008789682.1|  PREDICTED: 26S proteasome regulatory subunit...    192   6e-57   
ref|XP_003625484.1|  26S proteasome regulatory subunit-like protein     192   7e-57   
ref|XP_004984889.1|  PREDICTED: 26S protease regulatory subunit 4...    192   7e-57   
ref|XP_010109676.1|  26S proteasome regulatory subunit 4-B-like p...    192   7e-57   
ref|XP_004149071.1|  PREDICTED: 26S proteasome regulatory subunit...    192   7e-57   
ref|XP_007162652.1|  hypothetical protein PHAVU_001G168800g             192   7e-57   
ref|XP_004493865.1|  PREDICTED: 26S proteasome regulatory subunit...    192   7e-57   
gb|KHG23423.1|  26S proteasome regulatory subunit 4 A -like protein     192   7e-57   
ref|XP_008382660.1|  PREDICTED: 26S proteasome regulatory subunit...    192   7e-57   
ref|XP_006443671.1|  hypothetical protein CICLE_v10020143mg             192   7e-57   
ref|XP_002869455.1|  regulatory particle triple-a 2A                    192   7e-57   
gb|EMS67713.1|  26S protease regulatory subunit 4-like protein          192   7e-57   
gb|KHN09416.1|  26S proteasome regulatory subunit 4 like A              192   8e-57   
ref|XP_003558120.1|  PREDICTED: 26S protease regulatory subunit 4...    192   8e-57   
ref|NP_001049843.1|  Os03g0298400                                       192   9e-57   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011011091.1|  PREDICTED: 26S proteasome regulatory subunit...    192   9e-57   
ref|XP_008800188.1|  PREDICTED: 26S proteasome regulatory subunit...    192   1e-56   
gb|EEC75058.1|  hypothetical protein OsI_11173                          192   1e-56   Oryza sativa Indica Group [Indian rice]
gb|KFK40382.1|  hypothetical protein AALP_AA3G366200                    190   1e-56   
gb|EEE58887.1|  hypothetical protein OsJ_10505                          192   1e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005847625.1|  26S proteasome AAA-ATPase subunit RPT2a            191   1e-56   
gb|EMT04844.1|  26S protease regulatory subunit 4-like protein          194   3e-56   
ref|NP_179604.1|  26S proteasome subunit RPT2B                          190   5e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CAC14432.1|  26S proteasome subunit 4-like protein                  190   5e-56   Brassica napus [oilseed rape]
ref|XP_009129033.1|  PREDICTED: 26S proteasome regulatory subunit...    190   6e-56   
ref|XP_010489089.1|  PREDICTED: 26S proteasome regulatory subunit...    190   6e-56   
ref|XP_010416236.1|  PREDICTED: 26S proteasome regulatory subunit...    190   6e-56   
emb|CDX97472.1|  BnaC08g13370D                                          190   6e-56   
ref|XP_002885999.1|  hypothetical protein ARALYDRAFT_480455             190   6e-56   
gb|AAK50114.1|AF372977_1  At2g20140/T2G17.6                             190   6e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109057.1|  PREDICTED: 26S proteasome regulatory subunit...    190   6e-56   
gb|KFK29443.1|  hypothetical protein AALP_AA7G135000                    189   7e-56   
ref|XP_006297610.1|  hypothetical protein CARUB_v10013630mg             190   8e-56   
ref|NP_001275024.1|  26S proteasome subunit 4-like                      189   8e-56   
ref|XP_010438356.1|  PREDICTED: 26S proteasome regulatory subunit...    189   9e-56   
ref|XP_002959240.1|  26S proteasome regulatory complex                  189   9e-56   
emb|CDY06847.1|  BnaC01g09460D                                          189   9e-56   
gb|KDD76237.1|  AAA+ ATPase                                             189   2e-55   
ref|XP_010548707.1|  PREDICTED: 26S proteasome regulatory subunit...    187   8e-55   
gb|AAP80726.1|  26S proteasome subunit                                  182   1e-54   Griffithsia japonica
gb|AAM65126.1|  26S proteasome subunit 4                                187   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_646726.1|  26S proteasome ATPase 1 subunit                       186   1e-54   Dictyostelium discoideum AX4
dbj|GAM28912.1|  hypothetical protein SAMD00019534_120880               186   1e-54   
gb|EFA82511.1|  26S proteasome ATPase 1 subunit                         186   1e-54   Heterostelium album PN500
ref|XP_006163911.1|  PREDICTED: 26S protease regulatory subunit 4...    178   2e-54   
dbj|BAE88023.1|  unnamed protein product                                180   2e-54   
ref|XP_002186016.1|  predicted protein                                  181   3e-54   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_005645317.1|  26S proteasome subunit P45                         183   4e-54   
ref|XP_004357511.1|  26S proteasome ATPase 1 subunit                    185   4e-54   
emb|CEF97142.1|  26S proteasome subunit P45                             185   5e-54   
ref|XP_004335995.1|  26S proteasome AAAATPase subunit RPT2a, puta...    185   6e-54   
gb|KFM27289.1|  26S proteasome regulatory subunit 4-like protein B      184   6e-54   
ref|XP_003290859.1|  26S proteasome ATPase 1 subunit                    184   6e-54   
gb|EYU46362.1|  hypothetical protein MIMGU_mgv1a023433mg                184   6e-54   
gb|AAS47025.1|  proteasome 26S ATPase subunit 1                         179   7e-54   Oreochromis mossambicus [Hawaiian perch]
ref|XP_001416670.1|  predicted protein                                  184   7e-54   Ostreococcus lucimarinus CCE9901
gb|KHJ76446.1|  ATPase, AAA family                                      179   7e-54   
ref|XP_002165829.1|  PREDICTED: 26S protease regulatory subunit 4...    184   8e-54   
gb|AET43959.1|  proteasome 26S subunit ATPase 4                         178   1e-53   
ref|XP_007510866.1|  26S protease regulatory subunit 4                  184   1e-53   
gb|ERL96126.1|  hypothetical protein D910_01116                         181   1e-53   
gb|ERL96197.1|  hypothetical protein D910_01383                         181   1e-53   
gb|EHJ72875.1|  26S protease regulatory subunit                         181   2e-53   
ref|XP_004294291.1|  PREDICTED: 26S proteasome regulatory subunit...    183   2e-53   
gb|KFM73632.1|  26S protease regulatory subunit 4                       181   2e-53   
ref|XP_007942719.1|  PREDICTED: 26S protease regulatory subunit 4       181   2e-53   
gb|EWM27689.1|  26s proteasome subunit 4                                183   2e-53   
emb|CDQ82789.1|  unnamed protein product                                179   3e-53   
ref|XP_004313184.1|  PREDICTED: 26S protease regulatory subunit 4       179   3e-53   
ref|XP_001431072.1|  hypothetical protein                               183   4e-53   Paramecium tetraurelia strain d4-2
ref|XP_009477136.1|  PREDICTED: 26S protease regulatory subunit 4       180   4e-53   
ref|XP_002734612.2|  PREDICTED: 26S protease regulatory subunit 4...    177   4e-53   Saccoglossus kowalevskii
dbj|BAM11111.1|  proteasome (prosome, macropain) 26S subunit, ATP...    181   4e-53   
gb|ACC68862.1|  proteasome 26S ATPase subunit 1 (predicted)             180   4e-53   Rhinolophus ferrumequinum
dbj|BAK63819.1|  26S protease regulatory subunit 4                      180   4e-53   
ref|XP_004698814.1|  PREDICTED: 26S protease regulatory subunit 4...    181   4e-53   
ref|XP_007055518.1|  PREDICTED: 26S protease regulatory subunit 4       181   4e-53   
ref|XP_004055613.1|  PREDICTED: 26S protease regulatory subunit 4...    181   5e-53   
ref|XP_003260921.1|  PREDICTED: 26S protease regulatory subunit 4...    181   5e-53   
ref|XP_002141206.1|  26S proteasome subunit 4                           182   5e-53   Cryptosporidium muris RN66
gb|EPY78557.1|  26S protease regulatory subunit 4 isoform 2             180   5e-53   
emb|CBJ33278.1|  conserved unknown protein                              182   6e-53   
dbj|BAJ99744.1|  predicted protein                                      179   6e-53   
ref|XP_004924561.1|  PREDICTED: 26S protease regulatory subunit 4...    181   6e-53   
gb|EJW79473.1|  26S protease regulatory subunit 4                       179   6e-53   
ref|XP_005705264.1|  AAA-type ATPase                                    181   6e-53   
gb|KDE06590.1|  26S protease regulatory subunit 4                       182   7e-53   
gb|ETE70436.1|  26S protease regulatory subunit 4                       181   7e-53   
gb|EFX87779.1|  hypothetical protein DAPPUDRAFT_306388                  182   8e-53   
gb|EZG56152.1|  26S proteasome ATPase regulatory subunit 4              182   8e-53   
ref|XP_002013487.1|  GL24166                                            181   8e-53   Drosophila persimilis
gb|EAW81420.1|  proteasome (prosome, macropain) 26S subunit, ATPa...    181   9e-53   
dbj|BAN20514.1|  proteasome 26S subunit subunit 4 ATPase                181   9e-53   
ref|XP_005686275.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    181   9e-53   
gb|ERE73673.1|  26S protease regulatory subunit 4-like protein          181   1e-52   
gb|KFB53206.1|  AGAP003215-PA-like protein                              181   1e-52   
ref|XP_003746341.1|  PREDICTED: 26S protease regulatory subunit 4...    181   1e-52   
gb|KDR19574.1|  26S protease regulatory subunit 4                       181   1e-52   
ref|XP_005179926.1|  PREDICTED: 26S protease regulatory subunit 4...    181   1e-52   
ref|XP_005809990.1|  PREDICTED: 26S protease regulatory subunit 4...    181   1e-52   
gb|EOA93815.1|  26S protease regulatory subunit 4                       181   1e-52   
ref|XP_001861875.1|  26S protease regulatory subunit 4                  181   1e-52   Culex quinquefasciatus
ref|XP_001655853.1|  26S protease regulatory subunit                    181   1e-52   Aedes aegypti
ref|NP_524469.2|  regulatory particle triple-A ATPase 2, isoform A      181   1e-52   Drosophila melanogaster
gb|AAB34134.1|  P26s4                                                   181   1e-52   Drosophila melanogaster
ref|XP_001993700.1|  GH19692                                            181   1e-52   Drosophila grimshawi
ref|XP_001982075.1|  GG12390                                            181   1e-52   Drosophila erecta
gb|AEE62840.1|  unknown                                                 181   1e-52   
ref|XP_003384484.1|  PREDICTED: 26S protease regulatory subunit 4...    180   1e-52   
ref|XP_003696714.1|  PREDICTED: 26S protease regulatory subunit 4...    181   1e-52   
ref|XP_004523315.1|  PREDICTED: 26S protease regulatory subunit 4...    181   1e-52   
ref|XP_001948523.1|  PREDICTED: 26S protease regulatory subunit 4       181   1e-52   Acyrthosiphon pisum
gb|EFN65701.1|  26S protease regulatory subunit 4                       181   1e-52   
ref|XP_312923.4|  AGAP003215-PA                                         181   1e-52   Anopheles gambiae str. PEST
ref|XP_974859.1|  PREDICTED: 26S protease regulatory subunit 4          181   1e-52   Tribolium castaneum [rust-red flour beetle]
ref|XP_001953861.1|  GF17023                                            181   1e-52   Drosophila ananassae
ref|XP_001358781.1|  GA18789                                            181   1e-52   Drosophila pseudoobscura pseudoobscura
ref|XP_002431748.1|  26S protease regulatory subunit, putative          181   1e-52   Pediculus humanus corporis [human body lice]
ref|XP_003395819.1|  PREDICTED: 26S protease regulatory subunit 4...    181   1e-52   
gb|AII16487.1|  26S protease regulatory subunit 4                       181   1e-52   
ref|XP_002000888.1|  GI22277                                            181   1e-52   Drosophila mojavensis
ref|XP_003707462.1|  PREDICTED: 26S protease regulatory subunit 4...    181   1e-52   
gb|KFB53205.1|  hypothetical protein ZHAS_00021511                      181   1e-52   
gb|ETN59541.1|  26S protease regulatory subunit 4                       181   1e-52   
gb|ACO12018.1|  26S protease regulatory subunit 4                       181   2e-52   Lepeophtheirus salmonis
ref|XP_011051171.1|  PREDICTED: 26S protease regulatory subunit 4       181   2e-52   
ref|XP_008550534.1|  PREDICTED: 26S protease regulatory subunit 4       181   2e-52   
ref|XP_005285442.1|  PREDICTED: 26S protease regulatory subunit 4       181   2e-52   
ref|XP_004055612.1|  PREDICTED: 26S protease regulatory subunit 4...    181   2e-52   
dbj|BAM19425.1|  proteasome 26S subunit subunit 4 ATPase                181   2e-52   
ref|XP_002053771.1|  GJ24070                                            181   2e-52   Drosophila virilis
gb|AAA35484.1|  26S protease (S4) regulatory subunit                    181   2e-52   Homo sapiens [man]
ref|XP_623527.1|  PREDICTED: 26S protease regulatory subunit 4 is...    181   2e-52   Apis mellifera [bee]
ref|XP_007526891.1|  PREDICTED: 26S protease regulatory subunit 4       181   2e-52   
ref|NP_032973.1|  26S protease regulatory subunit 4                     181   2e-52   Mus musculus [mouse]
ref|XP_010780333.1|  PREDICTED: 26S protease regulatory subunit 4...    181   2e-52   
gb|EGI70823.1|  26S protease regulatory subunit 4                       181   2e-52   
ref|XP_004083702.1|  PREDICTED: 26S protease regulatory subunit 4...    181   2e-52   
ref|XP_007253845.1|  PREDICTED: 26S protease regulatory subunit 4...    181   2e-52   
dbj|BAD96388.1|  proteasome 26S ATPase subunit 1 variant                181   2e-52   Homo sapiens [man]
ref|XP_005992765.1|  PREDICTED: 26S protease regulatory subunit 4       181   2e-52   
gb|AAH16368.1|  Proteasome (prosome, macropain) 26S subunit, ATPa...    181   2e-52   Homo sapiens [man]
gb|EZA51286.1|  26S protease regulatory subunit                         181   2e-52   
ref|XP_006042318.1|  PREDICTED: 26S protease regulatory subunit 4       181   2e-52   
ref|XP_003987959.1|  PREDICTED: 26S protease regulatory subunit 4       181   2e-52   
ref|NP_001271694.1|  uncharacterized protein LOC101925039               181   2e-52   
ref|XP_010876963.1|  PREDICTED: 26S protease regulatory subunit 4       181   2e-52   
gb|EHB02601.1|  26S protease regulatory subunit 4                       181   2e-52   
ref|XP_009951400.1|  PREDICTED: 26S protease regulatory subunit 4       181   2e-52   
ref|XP_010880812.1|  PREDICTED: 26S protease regulatory subunit 4...    181   2e-52   
gb|AAI54337.1|  Proteasome (prosome, macropain) 26S subunit, ATPa...    181   2e-52   Danio rerio [leopard danio]
ref|NP_001014855.1|  26S protease regulatory subunit 4                  181   2e-52   Bos taurus [bovine]
ref|XP_001103312.1|  PREDICTED: 26S protease regulatory subunit 4...    181   2e-52   Macaca mulatta [rhesus macaque]
ref|NP_956327.1|  proteasome (prosome, macropain) 26S subunit, AT...    181   2e-52   Danio rerio [leopard danio]
ref|XP_004363832.1|  proteasome 26S subunit                             181   2e-52   
emb|CAG00116.1|  unnamed protein product                                181   2e-52   Tetraodon nigroviridis
ref|XP_010348883.1|  PREDICTED: 26S protease regulatory subunit 4       181   2e-52   
ref|XP_007180940.1|  PREDICTED: 26S protease regulatory subunit 4...    181   2e-52   
ref|XP_003440735.1|  PREDICTED: 26S protease regulatory subunit 4...    181   2e-52   
ref|NP_001002091.1|  proteasome (prosome, macropain) 26S subunit,...    181   2e-52   Danio rerio [leopard danio]
gb|AAH67741.1|  Proteasome (prosome, macropain) 26S subunit, ATPa...    181   2e-52   Homo sapiens [man]
gb|ELW48702.1|  26S protease regulatory subunit 4                       180   2e-52   
gb|EFN79932.1|  26S protease regulatory subunit 4                       181   2e-52   
gb|EPQ10744.1|  26S protease regulatory subunit 4                       181   2e-52   
emb|CCA21636.1|  26S proteasome AAAATPase subunit RPT2a putative        181   2e-52   
emb|CCI47533.1|  unnamed protein product                                180   2e-52   
ref|XP_006028418.1|  PREDICTED: 26S protease regulatory subunit 4       181   3e-52   
gb|ERG79797.1|  putative 26s protease regulatory subunit 4              180   3e-52   
ref|XP_009688138.1|  PREDICTED: 26S protease regulatory subunit 4       181   3e-52   
ref|XP_001604655.1|  PREDICTED: 26S protease regulatory subunit 4       181   3e-52   Nasonia vitripennis
ref|XP_003214402.1|  PREDICTED: 26S protease regulatory subunit 4       180   3e-52   
ref|XP_008049593.1|  PREDICTED: 26S protease regulatory subunit 4       180   3e-52   
ref|XP_007253016.1|  PREDICTED: 26S protease regulatory subunit 4...    180   3e-52   
ref|XP_001944737.2|  PREDICTED: 26S protease regulatory subunit 4...    180   3e-52   Acyrthosiphon pisum
ref|XP_010392357.1|  PREDICTED: 26S protease regulatory subunit 4...    180   3e-52   
ref|XP_009100602.1|  PREDICTED: 26S protease regulatory subunit 4       180   3e-52   
ref|XP_007908313.1|  PREDICTED: 26S protease regulatory subunit 4       180   3e-52   
ref|XP_005725123.1|  PREDICTED: 26S protease regulatory subunit 4...    181   3e-52   
ref|XP_002920836.1|  PREDICTED: 26S protease regulatory subunit 4...    180   3e-52   
ref|XP_002286831.1|  26S proteasome ATPase regulatory subunit 4         180   3e-52   Thalassiosira pseudonana CCMP1335
ref|XP_005030326.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    180   3e-52   
ref|XP_006632337.1|  PREDICTED: 26S protease regulatory subunit 4...    181   3e-52   
ref|XP_005438976.1|  PREDICTED: 26S protease regulatory subunit 4       180   3e-52   
ref|XP_009065811.1|  hypothetical protein LOTGIDRAFT_197242             180   3e-52   
emb|CDJ61255.1|  26S proteasome subunit 4, putative                     175   3e-52   
dbj|GAC71901.1|  26S proteasome regulatory complex, ATPase RPT2         180   3e-52   
ref|XP_004884174.1|  PREDICTED: 26S protease regulatory subunit 4...    181   3e-52   
ref|XP_758709.1|  hypothetical protein UM02562.1                        180   4e-52   Ustilago maydis 521
emb|CCF52771.1|  probable RPT2-26S proteasome regulatory subunit        180   4e-52   
dbj|GAC94094.1|  hypothetical protein PHSY_001663                       180   4e-52   
gb|EST05622.1|  26S proteasome regulatory complex, ATPase RPT2          180   4e-52   
emb|CBQ72941.1|  probable RPT2-26S proteasome regulatory subunit        180   4e-52   
ref|XP_005710517.1|  26S proteasome ATP-dependent regulatory subunit    180   4e-52   
ref|XP_006158084.1|  PREDICTED: 26S protease regulatory subunit 4       180   4e-52   
gb|ELK36973.1|  26S protease regulatory subunit 4                       181   4e-52   
ref|XP_005773763.1|  hypothetical protein EMIHUDRAFT_444500             180   4e-52   
emb|CDJ93151.1|  ATPase domain containing protein                       179   4e-52   
ref|XP_002501620.1|  predicted protein                                  180   4e-52   Micromonas commoda
ref|XP_005769175.1|  hypothetical protein EMIHUDRAFT_355962             180   4e-52   
emb|CDI53416.1|  probable RPT2-26S proteasome regulatory subunit        180   4e-52   
emb|CDJ05993.1|  proteasome 26s subunit subunit 4 atpase                179   4e-52   
gb|EYC28353.1|  hypothetical protein Y032_0007g3178                     179   4e-52   
ref|XP_007877676.1|  hypothetical protein PFL1_01974                    179   4e-52   
gb|KDN53131.1|  putative RPT2-26S proteasome regulatory subunit         179   4e-52   
ref|NP_990289.1|  26S protease regulatory subunit 4                     179   5e-52   
ref|XP_009279221.1|  PREDICTED: 26S protease regulatory subunit 4       181   5e-52   
emb|CDS33761.1|  proteasome 26s subunit subunit 4 atpase                179   5e-52   
ref|XP_006122416.1|  PREDICTED: 26S protease regulatory subunit 4       181   5e-52   
ref|XP_003062555.1|  predicted protein                                  179   5e-52   
emb|CEG65806.1|  Putative 26S protease regulatory subunit 4             178   5e-52   
ref|XP_010002048.1|  PREDICTED: 26S protease regulatory subunit 4       181   5e-52   
gb|EIE84800.1|  26S protease regulatory subunit 4                       178   5e-52   
ref|XP_005106466.1|  PREDICTED: 26S protease regulatory subunit 4...    179   6e-52   
ref|XP_741761.1|  26S proteasome regulatory subunit 4                   176   6e-52   
ref|XP_009914241.1|  PREDICTED: 26S protease regulatory subunit 4       180   6e-52   
ref|XP_005149701.1|  PREDICTED: 26S protease regulatory subunit 4       180   6e-52   
emb|CEG65805.1|  Putative 26s protease regulatory subunit 4             178   6e-52   
ref|XP_002781356.1|  26S protease regulatory subunit, putative          178   6e-52   
emb|CEJ02486.1|  Putative Proteasome regulatory particle subunit ...    178   6e-52   
dbj|GAK64532.1|  RPT2-26S proteasome regulatory subunit                 180   6e-52   
gb|ELK01127.1|  26S protease regulatory subunit 4                       180   7e-52   
gb|KHJ79755.1|  26S proteasome subunit P45 family protein               179   7e-52   
emb|CDP96417.1|  Protein BM-RPT-2, isoform b                            179   7e-52   
gb|KFO18267.1|  26S protease regulatory subunit 4                       180   7e-52   
ref|XP_003135955.1|  RPT-2 protein                                      179   7e-52   
ref|XP_003206722.2|  PREDICTED: 26S protease regulatory subunit 4       181   7e-52   
gb|ACH85269.1|  proteasome (prosome, macropain) 26S subunit, ATPa...    179   7e-52   
gb|EYC28352.1|  hypothetical protein Y032_0007g3178                     179   7e-52   
emb|CDH57868.1|  26s proteasome subunit p45                             179   7e-52   
gb|ACI68908.1|  26S protease regulatory subunit 4                       179   7e-52   
emb|CDH57869.1|  26s proteasome subunit p45                             179   7e-52   
emb|CDJ66546.1|  26S proteasome subunit 4, putative                     174   8e-52   
emb|CDW53193.1|  26S proteasome regulatory complex ATPase RPT2          179   8e-52   
ref|XP_008875734.1|  26S protease regulatory subunit 4                  179   8e-52   
ref|XP_008605817.1|  26S proteasome regulatory subunit 4 like A         179   8e-52   
gb|KDO27797.1|  26S proteasome regulatory subunit 4 A                   179   8e-52   
ref|XP_002613460.1|  hypothetical protein BRAFLDRAFT_119863             179   8e-52   
gb|ACN10996.1|  26S protease regulatory subunit 4                       179   8e-52   
ref|XP_009018363.1|  hypothetical protein HELRODRAFT_185636             179   8e-52   
emb|CEF61023.1|  26S protease regulatory subunit 4                      179   9e-52   
ref|XP_005417623.1|  PREDICTED: 26S protease regulatory subunit 4       180   9e-52   
gb|KHJ90255.1|  26S proteasome subunit P45 family protein               179   9e-52   
emb|CDS23259.1|  proteasome 26s subunit subunit 4 atpase                179   9e-52   
ref|XP_010220759.1|  PREDICTED: 26S protease regulatory subunit 4       177   9e-52   
ref|XP_003322501.1|  26S protease regulatory subunit 4                  179   1e-51   
gb|ESA02536.1|  hypothetical protein GLOINDRAFT_337332                  179   1e-51   
ref|XP_007005697.1|  hypothetical protein TREMEDRAFT_44632              179   1e-51   
gb|EUB61439.1|  26S protease regulatory subunit 4                       179   1e-51   
ref|XP_010582318.1|  PREDICTED: 26S protease regulatory subunit 4       180   1e-51   
ref|XP_006960777.1|  26S proteasome subunit P45                         179   1e-51   
ref|XP_010392347.1|  PREDICTED: 26S protease regulatory subunit 4...    180   1e-51   
ref|XP_009584690.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    179   1e-51   
ref|XP_003756221.1|  PREDICTED: 26S protease regulatory subunit 4       180   1e-51   
ref|XP_653833.1|  26S protease regulatory subunit                       178   1e-51   
ref|XP_007414749.1|  ATP-dependent 26S proteasome regulatory subunit    179   1e-51   
ref|XP_010392353.1|  PREDICTED: 26S protease regulatory subunit 4...    180   1e-51   
ref|XP_010307096.1|  PREDICTED: 26S protease regulatory subunit 4       179   1e-51   
ref|XP_009829202.1|  26S protease regulatory subunit 4                  179   1e-51   
ref|XP_002636822.1|  C. briggsae CBR-RPT-2 protein                      179   1e-51   
ref|XP_003112636.1|  CRE-RPT-2 protein                                  179   1e-51   
dbj|BAN38397.1|  26S protease regulatory subunit, putative              177   1e-51   
ref|NP_001229616.1|  proteasome 26S subunit subunit 4 ATPase-like       178   1e-51   
ref|XP_005983102.1|  PREDICTED: 26S protease regulatory subunit 4       178   1e-51   
ref|XP_001739671.1|  26S protease regulatory subunit                    177   1e-51   
ref|XP_002778080.1|  26S protease regulatory subunit, putative          178   1e-51   
gb|ELU12421.1|  hypothetical protein CAPTEDRAFT_160726                  178   1e-51   
ref|XP_008039737.1|  26S proteasome subunit P45                         179   1e-51   
ref|XP_001880695.1|  predicted protein                                  178   1e-51   
gb|EGT47046.1|  hypothetical protein CAEBREN_12205                      178   1e-51   
gb|EPB87829.1|  26S protease regulatory subunit 4                       178   1e-51   
gb|KDQ19257.1|  hypothetical protein BOTBODRAFT_170378                  178   1e-51   
ref|NP_504558.1|  Protein RPT-2                                         178   1e-51   
ref|XP_007318478.1|  hypothetical protein SERLADRAFT_348772             178   1e-51   
gb|EHH62123.1|  hypothetical protein EGM_20328                          178   1e-51   
emb|CCO30814.1|  26S protease regulatory subunit 4 Short=P26s4          178   1e-51   
gb|EMD34033.1|  hypothetical protein CERSUDRAFT_117543                  178   1e-51   
ref|XP_004088749.1|  PREDICTED: 26S protease regulatory subunit 4...    176   2e-51   
ref|NP_001232241.1|  putative 26S ATPase complex subunit 4              178   2e-51   
gb|KHN89100.1|  26S protease regulatory subunit 4                       181   2e-51   
ref|XP_002765620.1|  26S protease regulatory subunit, putative          178   2e-51   
emb|CDO70660.1|  hypothetical protein BN946_scf184756.g27               178   2e-51   
gb|KDR79003.1|  hypothetical protein GALMADRAFT_137968                  178   2e-51   
gb|EJU04754.1|  26S proteasome subunit P45                              178   2e-51   
ref|XP_002677130.1|  predicted protein                                  178   2e-51   
gb|KDQ57318.1|  hypothetical protein JAAARDRAFT_157515                  178   2e-51   
gb|KFO76440.1|  26S protease regulatory subunit 4                       178   2e-51   
emb|CCA75216.1|  probable RPT2-26S proteasome regulatory subunit        177   2e-51   
emb|CEG65804.1|  Putative 26s protease regulatory subunit 4             178   2e-51   
ref|XP_010151155.1|  PREDICTED: 26S protease regulatory subunit 4       178   2e-51   
gb|ABB71588.1|  26S proteasome subunit ATPase 4                         177   2e-51   
ref|XP_003027303.1|  hypothetical protein SCHCODRAFT_238082             178   2e-51   
ref|XP_008310982.1|  PREDICTED: 26S protease regulatory subunit 4...    178   2e-51   
ref|XP_002127866.1|  PREDICTED: 26S protease regulatory subunit 4       178   2e-51   
ref|XP_008491049.1|  PREDICTED: 26S protease regulatory subunit 4       179   2e-51   
ref|XP_007299755.1|  26S proteasome subunit P45                         178   2e-51   
ref|XP_007383110.1|  26S proteasome subunit P45                         178   2e-51   
gb|EQB49393.1|  hypothetical protein CGLO_11282                         172   2e-51   
ref|XP_007362693.1|  26S proteasome subunit P45                         178   2e-51   
ref|XP_007846015.1|  putative rpt2-26s proteasome regulatory subunit    178   2e-51   
ref|XP_625714.1|  26S proteasome regulatory subunit S4 like AAA A...    178   2e-51   
gb|ETP34278.1|  26S protease regulatory subunit 4                       178   2e-51   
ref|XP_007869061.1|  26S proteasome subunit P45                         178   2e-51   
ref|XP_008896011.1|  26S protease regulatory subunit 4                  178   2e-51   
emb|CCU99189.1|  unnamed protein product                                177   2e-51   
ref|XP_007342133.1|  26S proteasome subunit P45                         178   2e-51   
gb|EPZ33147.1|  26S protease regulatory subunit 4                       177   2e-51   
gb|EJK59304.1|  hypothetical protein THAOC_20491                        178   2e-51   
emb|CCF75004.1|  unnamed protein product                                178   2e-51   
emb|CAX73881.1|  Proteasome 26S subunit subunit 4 ATPase                177   2e-51   
ref|XP_009521651.1|  hypothetical protein PHYSODRAFT_354148             178   2e-51   
ref|XP_002900803.1|  26S protease regulatory subunit 4                  177   3e-51   
dbj|BAN64160.1|  26S protease regulatory subunit 4, putative            175   3e-51   
ref|NP_001080548.1|  proteasome (prosome, macropain) 26S subunit,...    177   3e-51   
gb|KDQ24457.1|  hypothetical protein PLEOSDRAFT_170485                  178   3e-51   
emb|CAZ36600.1|  26S protease regulatory subunit, putative              177   3e-51   
ref|XP_010132796.1|  PREDICTED: 26S protease regulatory subunit 4       177   3e-51   
gb|KGB38635.1|  26S protease regulatory subunit 4                       177   3e-51   
ref|XP_005534916.1|  26S proteasome ATP-dependent regulatory subunit    177   3e-51   
ref|XP_005047560.1|  PREDICTED: 26S protease regulatory subunit 4       180   3e-51   
ref|XP_009545449.1|  26S proteasome regulatory complex, ATPase RPT2     177   3e-51   
ref|XP_007765789.1|  26S proteasome subunit P45                         177   3e-51   
gb|KFH72195.1|  26S protease regulatory subunit 4                       177   3e-51   
emb|CCG80742.1|  26S protease regulatory subunit 4                      177   3e-51   
gb|ACO10548.1|  26S protease regulatory subunit 4                       177   3e-51   
ref|XP_007393654.1|  hypothetical protein PHACADRAFT_252589             178   4e-51   
gb|EPT01431.1|  hypothetical protein FOMPIDRAFT_1023309                 177   4e-51   
gb|EMS22541.1|  26S proteasome regulatory subunit T2                    177   4e-51   
ref|XP_009270441.1|  26S protease regulatory subunit 4                  177   4e-51   
gb|ACO07810.1|  26S protease regulatory subunit 4                       177   4e-51   
ref|XP_004649731.1|  PREDICTED: 26S protease regulatory subunit 4       181   4e-51   
gb|KGL73273.1|  26S protease regulatory subunit 4                       177   4e-51   
ref|XP_006681706.1|  hypothetical protein BATDEDRAFT_32324              177   5e-51   
ref|XP_003668126.1|  hypothetical protein NDAI_0A07290                  175   5e-51   
gb|EUC64951.1|  26S proteasome regulatory complex, ATPase RPT2          177   6e-51   
ref|XP_001347366.2|  26S proteasome regulatory subunit 4, putative      177   6e-51   
ref|XP_001730706.1|  hypothetical protein MGL_2160                      178   6e-51   
ref|XP_005068342.1|  PREDICTED: 26S protease regulatory subunit 4       177   7e-51   
emb|CDO64515.1|  26S proteasome regulatory subunit 4, putative          177   7e-51   
gb|ETW56499.1|  26S protease regulatory subunit 4                       177   7e-51   
gb|ETW18248.1|  26S protease regulatory subunit 4                       176   8e-51   
ref|XP_001836399.1|  endopeptidase                                      177   8e-51   
gb|EWC88460.1|  26S protease regulatory subunit 4                       177   8e-51   
gb|EKC29780.1|  26S protease regulatory subunit 4                       181   8e-51   
gb|KDN50658.1|  26S protease regulatory subunit 4                       177   9e-51   
ref|XP_007330473.1|  hypothetical protein AGABI1DRAFT_114231            176   9e-51   
ref|XP_006459243.1|  hypothetical protein AGABI2DRAFT_191249            176   9e-51   
ref|XP_009559613.1|  PREDICTED: 26S protease regulatory subunit 4       177   1e-50   
ref|XP_007262774.1|  26S proteasome subunit P45                         176   1e-50   
gb|ETO09518.1|  putative 26S ATPase complex subunit 4                   175   1e-50   
gb|AEQ35008.1|  proteasome 26S subunit, atpase 1                        172   1e-50   
gb|KFG29822.1|  putative 26S protease regulatory subunit 4              176   1e-50   
gb|KFG43050.1|  putative 26S protease regulatory subunit 4              176   1e-50   
ref|XP_003194541.1|  26S proteasome regulatory subunit 4                176   1e-50   
ref|XP_009903131.1|  PREDICTED: 26S protease regulatory subunit 4       176   1e-50   
ref|XP_002117269.1|  26S proteasome regulatory chain 4                  175   1e-50   
gb|KFV70634.1|  26S protease regulatory subunit 4                       176   1e-50   
gb|AFR95579.2|  26S protease regulatory subunit 4                       176   1e-50   
emb|CBY14503.1|  unnamed protein product                                176   1e-50   
gb|EUD72611.1|  26S proteasome regulatory subunit 4 like B              176   1e-50   
ref|XP_008550368.1|  PREDICTED: 26S protease regulatory subunit 4...    176   1e-50   
gb|KFD63631.1|  hypothetical protein M514_09682                         179   2e-50   
gb|KGB79542.1|  endopeptidase                                           176   2e-50   
ref|XP_008623308.1|  26S proteasome regulatory subunit 4 like B         175   2e-50   
gb|KFD49415.1|  hypothetical protein M513_09682                         179   2e-50   
ref|XP_001610851.1|  26S protease regulatory subunit 4                  175   2e-50   
dbj|GAA99225.1|  hypothetical protein E5Q_05918                         176   2e-50   
ref|XP_008146672.1|  PREDICTED: 26S protease regulatory subunit 4       170   2e-50   
ref|XP_002368787.1|  26S proteasome subunit 4, putative                 175   2e-50   
gb|EPR57151.1|  putative 26S protease regulatory subunit 4              175   2e-50   
ref|XP_570849.1|  endopeptidase                                         175   2e-50   
ref|XP_003880859.1|  probable 26S protease regulatory subunit 6B,...    175   2e-50   
ref|XP_001614391.1|  26S proteasome regulatory subunit 4                175   2e-50   
gb|EKC99535.1|  endopeptidase                                           177   2e-50   
ref|XP_002258715.1|  26S proteasome regulatory subunit 4                175   2e-50   
ref|XP_004221963.1|  26S proteasome regulatory subunit 4                175   2e-50   
emb|CDW71228.1|  26s protease regulatory subunit 4                      175   2e-50   
ref|XP_726782.1|  26S proteasome subunit 4 protein                      175   2e-50   
ref|XP_008888467.1|  26S protease regulatory subunit 4, putative        175   2e-50   
ref|XP_008816013.1|  26S proteasome regulatory subunit 4 like B         175   2e-50   
ref|XP_004184754.1|  26S protease regulatory subunit, putative          174   3e-50   
emb|CDW54678.1|  AAA domain containing protein                          175   3e-50   
gb|EJT48081.1|  endopeptidase                                           177   3e-50   
gb|KFO56091.1|  26S protease regulatory subunit 4                       175   3e-50   
ref|XP_002835560.1|  hypothetical protein                               171   3e-50   
emb|CDR94373.1|  26S protease regulatory subunit 4, putative            175   3e-50   
emb|CDJ39342.1|  26S proteasome subunit 4, putative                     175   4e-50   
ref|XP_003381185.1|  26S protease regulatory subunit 4                  177   4e-50   
ref|XP_766366.1|  26S proteasome regulatory subunit 4                   174   4e-50   
gb|ACN10104.1|  26S protease regulatory subunit 4                       174   4e-50   
gb|KFD62602.1|  hypothetical protein M514_01119                         175   4e-50   
dbj|GAA49174.1|  26S proteasome regulatory subunit T2                   174   5e-50   
gb|KHJ45135.1|  26S proteasome subunit P45 family protein               179   5e-50   
gb|KHJ45755.1|  26S proteasome subunit P45 family protein               175   6e-50   
gb|KGG51566.1|  hypothetical protein DI09_31p170                        175   6e-50   
emb|CDI80922.1|  26S proteasome subunit 4, putative                     175   6e-50   
ref|XP_004181133.1|  hypothetical protein TBLA_0F00690                  174   7e-50   
ref|XP_953936.1|  26S proteasome subunit 4                              174   7e-50   
emb|CDF89089.1|  ZYBA0S03-08900g1_1                                     174   8e-50   
ref|XP_004833397.1|  26S proteasome subunit 4, putative                 174   8e-50   
ref|XP_009689636.1|  26S proteasome subunit 4                           174   8e-50   
ref|NP_595480.1|  19S proteasome regulatory subunit Rpt2                174   8e-50   
emb|CDH10320.1|  26S protease regulatory subunit 4 homolog              174   8e-50   
gb|EHN03248.1|  Rpt2p                                                   172   1e-49   
gb|AAG38539.1|AF309805_4  putative 26S protease regulatory subunit 4    173   1e-49   
gb|KEQ61812.1|  26S protease regulatory subunit 4                       174   1e-49   
gb|EJY88541.1|  26S protease regulatory subunit 4                       174   1e-49   
ref|XP_003804139.1|  PREDICTED: LOW QUALITY PROTEIN: 26S protease...    172   1e-49   
gb|EKG10355.1|  ATPase AAA+ type core                                   174   1e-49   
ref|XP_002616542.1|  hypothetical protein CLUG_03783                    173   1e-49   
gb|KFQ92146.1|  26S protease regulatory subunit 4                       173   1e-49   
ref|XP_007582817.1|  putative 26s protease regulatory subunit 4 p...    173   2e-49   
ref|XP_003000320.1|  26S protease regulatory subunit 4                  173   2e-49   
ref|XP_002171981.1|  19S proteasome regulatory subunit Rpt2             173   2e-49   
ref|XP_961590.2|  26S protease regulatory subunit 4                     173   2e-49   
ref|XP_007837651.1|  26S protease regulatory subunit 4                  173   2e-49   
ref|XP_007875076.1|  hypothetical protein PNEG_03025                    173   2e-49   
ref|XP_003646865.1|  hypothetical protein Ecym_5286                     172   2e-49   
ref|XP_003957976.1|  hypothetical protein KAFR_0F02440                  172   2e-49   
ref|XP_009848041.1|  hypothetical protein NEUTE1DRAFT_115902            173   2e-49   
ref|NP_984850.1|  AEL011Wp                                              172   2e-49   
ref|XP_009474195.1|  PREDICTED: 26S protease regulatory subunit 4       173   2e-49   
ref|XP_004649113.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    174   2e-49   



>tpg|DAA41830.1| TPA: hypothetical protein ZEAMMB73_407541 [Zea mays]
Length=289

 Score =   194 bits (493),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  73   LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  132

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  133  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  168



>ref|XP_008670686.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Zea mays]
 gb|ACN26938.1| unknown [Zea mays]
Length=334

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  118  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  177

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  178  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  213



>ref|XP_009591299.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Nicotiana 
tomentosiformis]
Length=291

 Score =   192 bits (489),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  75   LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  134

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  135  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  170



>gb|EEE67865.1| hypothetical protein OsJ_25676 [Oryza sativa Japonica Group]
Length=367

 Score =   194 bits (493),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  151  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  210

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  211  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  246



>gb|KHN02432.1| 26S protease regulatory subunit 4 like [Glycine soja]
Length=334

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  118  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  177

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  178  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  213



>gb|KCW58093.1| hypothetical protein EUGRSUZ_H00817 [Eucalyptus grandis]
Length=402

 Score =   194 bits (493),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  228  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  323



>gb|KHN05911.1| 26S proteasome regulatory subunit 4 like A [Glycine soja]
 gb|KHN48977.1| 26S proteasome regulatory subunit 4 like A [Glycine soja]
Length=367

 Score =   192 bits (489),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  151  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  210

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  211  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  246



>gb|KEH42401.1| regulatory particle triple-A ATPase [Medicago truncatula]
Length=398

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPAIVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPAIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_010069676.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Eucalyptus 
grandis]
 gb|KCW58092.1| hypothetical protein EUGRSUZ_H00817 [Eucalyptus grandis]
Length=444

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  228  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  323



>ref|XP_001754191.1| predicted protein [Physcomitrella patens]
 gb|EDQ81092.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   194 bits (493),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>emb|CDP03836.1| unnamed protein product [Coffea canephora]
Length=444

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  228  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  323



>ref|XP_009395473.1| PREDICTED: 26S protease regulatory subunit 4 homolog isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009395474.1| PREDICTED: 26S protease regulatory subunit 4 homolog isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=445

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  324



>ref|XP_010913635.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
isoform X1 [Elaeis guineensis]
 ref|XP_010913636.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
isoform X2 [Elaeis guineensis]
Length=445

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  324



>ref|XP_009395470.1| PREDICTED: 26S protease regulatory subunit 4 homolog isoform 
X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009395472.1| PREDICTED: 26S protease regulatory subunit 4 homolog isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=445

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  324



>ref|XP_008653527.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Zea mays]
 tpg|DAA64239.1| TPA: hypothetical protein ZEAMMB73_409330 [Zea mays]
Length=447

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  231  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  290

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  291  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  326



>ref|XP_010928641.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Elaeis 
guineensis]
 ref|XP_010928642.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Elaeis 
guineensis]
Length=445

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  324



>ref|XP_007048402.1| Regulatory particle AAA-ATPase 2A isoform 2 [Theobroma cacao]
 gb|EOX92559.1| Regulatory particle AAA-ATPase 2A isoform 2 [Theobroma cacao]
Length=382

 Score =   192 bits (488),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_004958786.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Setaria 
italica]
Length=447

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  231  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  290

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  291  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  326



>ref|XP_001752421.1| predicted protein [Physcomitrella patens]
 gb|EDQ82660.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPTIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>dbj|BAA04615.1| rice homologue of Tat binding protein [Oryza sativa Japonica 
Group]
Length=448

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  232  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  291

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  292  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  327



>ref|XP_002463440.1| hypothetical protein SORBIDRAFT_02g043840 [Sorghum bicolor]
 gb|EER99961.1| hypothetical protein SORBIDRAFT_02g043840 [Sorghum bicolor]
Length=447

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  231  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  290

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  291  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  326



>gb|KEH42402.1| regulatory particle triple-A ATPase [Medicago truncatula]
Length=446

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPAIVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPAIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|NP_001060719.1| Os07g0691800 [Oryza sativa Japonica Group]
 ref|XP_006658170.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Oryza brachyantha]
 sp|P46466.2|PRS4_ORYSJ RecName: Full=26S protease regulatory subunit 4 homolog; AltName: 
Full=Tat-binding protein homolog 2 [Oryza sativa Japonica 
Group]
 dbj|BAC75555.1| 26S proteasome regulatory subunit 4 homolog [Oryza sativa Japonica 
Group]
 dbj|BAF22633.1| Os07g0691800 [Oryza sativa Japonica Group]
 gb|EAY95233.1| hypothetical protein OsI_17051 [Oryza sativa Indica Group]
 dbj|BAG94028.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97398.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86657.1| unnamed protein product [Oryza sativa Japonica Group]
Length=448

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  232  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  291

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  292  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  327



>dbj|BAK03283.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=449

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  233  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  292

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  293  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  328



>ref|XP_010233630.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Brachypodium 
distachyon]
Length=450

 Score =   194 bits (492),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  234  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  293

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  294  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  329



>ref|XP_001769084.1| predicted protein [Physcomitrella patens]
 gb|EDQ66162.1| predicted protein [Physcomitrella patens]
Length=446

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPTIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>gb|KDP43828.1| hypothetical protein JCGZ_23036 [Jatropha curcas]
Length=436

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  220  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  279

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  280  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  315



>emb|CBI37252.3| unnamed protein product [Vitis vinifera]
Length=418

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  202  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  261

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  262  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  297



>ref|XP_008372431.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Malus domestica]
Length=446

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPAIVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPAIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAIGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>gb|EMT30939.1| 26S protease regulatory subunit 4-like protein [Aegilops tauschii]
Length=370

 Score =   191 bits (486),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP+IVF
Sbjct  154  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPSIVF  213

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELL QLDGF
Sbjct  214  IDEIDAVGTKRYDAHSGGEREIQRTMLELLKQLDGF  249



>ref|XP_002526219.1| 26S protease regulatory subunit, putative [Ricinus communis]
 gb|EEF36160.1| 26S protease regulatory subunit, putative [Ricinus communis]
Length=443

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  322



>ref|XP_009371109.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Pyrus 
x bretschneideri]
Length=446

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSPAIVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPAIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAIGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>gb|AAL73395.1|AF432345_1 26S proteasome regulatory subunit IV [Syntrichia ruralis]
Length=446

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSP IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPTIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAIGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_006408928.1| hypothetical protein EUTSA_v10001985mg [Eutrema salsugineum]
 gb|ESQ50381.1| hypothetical protein EUTSA_v10001985mg [Eutrema salsugineum]
Length=443

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  322



>ref|XP_006283684.1| hypothetical protein CARUB_v10004747mg, partial [Capsella rubella]
 gb|EOA16582.1| hypothetical protein CARUB_v10004747mg, partial [Capsella rubella]
Length=466

 Score =   193 bits (491),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  250  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  309

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  310  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  345



>gb|EYU17968.1| hypothetical protein MIMGU_mgv1a006475mg [Erythranthe guttata]
Length=443

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  322



>ref|XP_001690446.1| 26S proteasome regulatory subunit [Chlamydomonas reinhardtii]
 gb|EDP05705.1| 26S proteasome regulatory subunit [Chlamydomonas reinhardtii]
Length=443

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADEL+P+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELAPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAIGTKRYDAHSGGEREIQRTMLELLNQLDGF  322



>ref|XP_004242383.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Solanum 
lycopersicum]
Length=444

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  228  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  323



>gb|ABR16267.1| unknown [Picea sitchensis]
Length=444

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  228  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  323



>ref|XP_002966632.1| hypothetical protein SELMODRAFT_267030 [Selaginella moellendorffii]
 ref|XP_002978110.1| hypothetical protein SELMODRAFT_271301 [Selaginella moellendorffii]
 gb|EFJ20767.1| hypothetical protein SELMODRAFT_271301 [Selaginella moellendorffii]
 gb|EFJ32659.1| hypothetical protein SELMODRAFT_267030 [Selaginella moellendorffii]
Length=444

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  228  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  323



>ref|XP_010526468.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Tarenaya hassleriana]
Length=443

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  322



>ref|XP_011080157.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Sesamum 
indicum]
 ref|XP_011083104.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Sesamum 
indicum]
Length=444

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  228  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  323



>ref|XP_003537160.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Glycine 
max]
Length=443

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  322



>ref|XP_002301829.1| 26S protease regulatory complex subunit 4 family protein [Populus 
trichocarpa]
 gb|EEE81102.1| 26S protease regulatory complex subunit 4 family protein [Populus 
trichocarpa]
Length=446

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_004152012.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
[Cucumis sativus]
 ref|XP_004164937.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
[Cucumis sativus]
 ref|XP_008447342.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
[Cucumis melo]
 gb|KGN58327.1| hypothetical protein Csa_3G623950 [Cucumis sativus]
Length=445

 Score =   193 bits (490),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  324



>gb|AAF22522.1|AF123391_1 26S proteasome AAA-ATPase subunit RPT2a [Arabidopsis thaliana]
Length=443

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  322



>ref|XP_010099046.1| 26S proteasome regulatory subunit 4-A-like protein [Morus notabilis]
 gb|EXB76506.1| 26S proteasome regulatory subunit 4-A-like protein [Morus notabilis]
Length=446

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>gb|KDP26427.1| hypothetical protein JCGZ_17585 [Jatropha curcas]
Length=444

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  228  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  323



>ref|XP_007144443.1| hypothetical protein PHAVU_007G156500g [Phaseolus vulgaris]
 gb|ESW16437.1| hypothetical protein PHAVU_007G156500g [Phaseolus vulgaris]
Length=443

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  322



>ref|XP_003542453.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Glycine 
max]
Length=443

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  322



>ref|XP_006352708.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Solanum tuberosum]
Length=444

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  228  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  323



>ref|XP_011024543.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Populus 
euphratica]
Length=446

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|NP_194633.1| regulatory particle AAA-ATPase 2A [Arabidopsis thaliana]
 sp|Q9SZD4.1|PRS4A_ARATH RecName: Full=26S proteasome regulatory subunit 4 homolog A; 
AltName: Full=26S proteasome AAA-ATPase subunit RPT2a; AltName: 
Full=26S proteasome subunit 4 homolog A; AltName: Full=Protein 
HALTED ROOT; AltName: Full=Regulatory particle triple-A 
ATPase subunit 2a [Arabidopsis thaliana]
 emb|CAB43918.1| 26S proteasome subunit 4-like protein [Arabidopsis thaliana]
 emb|CAB79662.1| 26S proteasome subunit 4-like protein [Arabidopsis thaliana]
 gb|AAK59480.1| putative 26S proteasome subunit 4 [Arabidopsis thaliana]
 dbj|BAD18016.1| 26S proteasome subunit AtRPT2a [Arabidopsis thaliana]
 gb|AEE85578.1| regulatory particle AAA-ATPase 2A [Arabidopsis thaliana]
Length=443

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  322



>gb|ACG31403.1| 26S protease regulatory subunit 4 [Zea mays]
Length=446

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_010540956.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Tarenaya 
hassleriana]
Length=443

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  322



>ref|XP_007048401.1| Regulatory particle AAA-ATPase 2A isoform 1 [Theobroma cacao]
 gb|EOX92558.1| Regulatory particle AAA-ATPase 2A isoform 1 [Theobroma cacao]
Length=446

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_009802140.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Nicotiana sylvestris]
Length=444

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  228  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  323



>ref|XP_010684990.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Beta 
vulgaris subsp. vulgaris]
Length=445

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  324



>gb|KEH23989.1| regulatory particle triple-A ATPase [Medicago truncatula]
Length=425

 Score =   192 bits (488),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  324



>ref|XP_002320617.2| hypothetical protein POPTR_0014s18530g [Populus trichocarpa]
 gb|EEE98932.2| hypothetical protein POPTR_0014s18530g [Populus trichocarpa]
Length=423

 Score =   192 bits (488),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAIGTKRYDAHSGGEREIQRTMLELLNQLDGF  324



>ref|XP_002263334.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Vitis 
vinifera]
 emb|CAN78907.1| hypothetical protein VITISV_029788 [Vitis vinifera]
Length=445

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  324



>ref|XP_009601763.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Nicotiana 
tomentosiformis]
 ref|XP_009769924.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Nicotiana 
sylvestris]
Length=444

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  228  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  323



>ref|NP_001146268.1| uncharacterized protein LOC100279843 [Zea mays]
 gb|ACL53605.1| unknown [Zea mays]
 tpg|DAA44915.1| TPA: 26S protease regulatory subunit 4 [Zea mays]
Length=446

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>gb|KHG28065.1| 26S proteasome regulatory subunit 4 B -like protein [Gossypium 
arboreum]
Length=446

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>gb|KHG18015.1| 26S proteasome regulatory subunit 4 A -like protein [Gossypium 
arboreum]
Length=446

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>gb|EPS64118.1| hypothetical protein M569_10659 [Genlisea aurea]
Length=444

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  228  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  323



>ref|XP_010433142.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Camelina 
sativa]
 ref|XP_010447896.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Camelina 
sativa]
Length=444

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  228  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  323



>ref|XP_006845594.1| hypothetical protein AMTR_s00019p00202640 [Amborella trichopoda]
 gb|ERN07269.1| hypothetical protein AMTR_s00019p00202640 [Amborella trichopoda]
Length=444

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  228  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  323



>dbj|BAJ79010.1| regulatory particle triple-A ATPase 2 [Sophora flavescens]
Length=446

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_004495023.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Cicer arietinum]
Length=446

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_007049878.1| Regulatory particle AAA-ATPase 2A [Theobroma cacao]
 gb|EOX94035.1| Regulatory particle AAA-ATPase 2A [Theobroma cacao]
Length=446

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_003554317.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Glycine 
max]
Length=446

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_003521331.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Glycine 
max]
Length=446

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_008235533.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Prunus 
mume]
Length=446

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_004163169.1| PREDICTED: LOW QUALITY PROTEIN: 26S proteasome regulatory subunit 
4 homolog A-like [Cucumis sativus]
Length=447

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  231  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  290

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  291  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  326



>ref|XP_004290031.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Fragaria vesca subsp. vesca]
Length=446

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_010245668.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Nelumbo 
nucifera]
Length=445

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  324



>ref|XP_010264024.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Nelumbo 
nucifera]
Length=445

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  324



>ref|XP_008789682.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A isoform 
X1 [Phoenix dactylifera]
 ref|XP_008789683.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A isoform 
X2 [Phoenix dactylifera]
Length=445

 Score =   192 bits (489),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  324



>ref|XP_003625484.1| 26S proteasome regulatory subunit-like protein [Medicago truncatula]
 gb|ABD32889.1| AAA ATPase; 26S proteasome subunit P45 [Medicago truncatula]
 gb|ABN08912.1| AAA ATPase; 26S proteasome subunit P45 [Medicago truncatula]
 gb|AES81702.1| regulatory particle triple-A ATPase [Medicago truncatula]
Length=445

 Score =   192 bits (489),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  324



>ref|XP_004984889.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Setaria 
italica]
Length=447

 Score =   192 bits (489),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  231  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  290

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  291  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  326



>ref|XP_010109676.1| 26S proteasome regulatory subunit 4-B-like protein [Morus notabilis]
 gb|EXC24146.1| 26S proteasome regulatory subunit 4-B-like protein [Morus notabilis]
Length=446

 Score =   192 bits (489),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_004149071.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Cucumis sativus]
 ref|XP_008452203.1| PREDICTED: LOW QUALITY PROTEIN: 26S proteasome regulatory subunit 
4 homolog B-like [Cucumis melo]
 gb|KGN61098.1| hypothetical protein Csa_2G049870 [Cucumis sativus]
Length=447

 Score =   192 bits (489),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  231  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  290

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  291  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  326



>ref|XP_007162652.1| hypothetical protein PHAVU_001G168800g [Phaseolus vulgaris]
 gb|ESW34646.1| hypothetical protein PHAVU_001G168800g [Phaseolus vulgaris]
Length=446

 Score =   192 bits (489),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_004493865.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Cicer arietinum]
Length=446

 Score =   192 bits (489),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>gb|KHG23423.1| 26S proteasome regulatory subunit 4 A -like protein [Gossypium 
arboreum]
Length=446

 Score =   192 bits (488),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_008382660.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Malus 
domestica]
Length=446

 Score =   192 bits (488),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_006443671.1| hypothetical protein CICLE_v10020143mg [Citrus clementina]
 ref|XP_006480183.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Citrus sinensis]
 gb|ESR56911.1| hypothetical protein CICLE_v10020143mg [Citrus clementina]
Length=446

 Score =   192 bits (488),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>ref|XP_002869455.1| regulatory particle triple-a 2A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45714.1| regulatory particle triple-a 2A [Arabidopsis lyrata subsp. lyrata]
Length=443

 Score =   192 bits (488),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAIGTKRYDAHSGGEREIQRTMLELLNQLDGF  322



>gb|EMS67713.1| 26S protease regulatory subunit 4-like protein [Triticum urartu]
Length=450

 Score =   192 bits (489),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  234  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  293

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  294  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  329



>gb|KHN09416.1| 26S proteasome regulatory subunit 4 like A [Glycine soja]
Length=447

 Score =   192 bits (488),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  231  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  290

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  291  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  326



>ref|XP_003558120.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Brachypodium 
distachyon]
Length=450

 Score =   192 bits (488),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  234  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  293

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  294  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  329



>ref|NP_001049843.1| Os03g0298400 [Oryza sativa Japonica Group]
 ref|XP_006649937.1| PREDICTED: 26S protease regulatory subunit 4 homolog [Oryza brachyantha]
 dbj|BAB78491.1| 26S proteasome regulatory particle triple-A ATPase subunit2b 
[Oryza sativa Japonica Group]
 gb|ABF95461.1| 26S protease regulatory subunit 4, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11757.1| Os03g0298400 [Oryza sativa Japonica Group]
 dbj|BAG91617.1| unnamed protein product [Oryza sativa Japonica Group]
Length=450

 Score =   192 bits (488),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  234  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  293

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  294  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  329



>ref|XP_011011091.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Populus euphratica]
Length=445

 Score =   192 bits (488),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAIGTKRYDAHSGGEREIQRTMLELLNQLDGF  324



>ref|XP_008800188.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Phoenix dactylifera]
Length=445

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAIGTKRYDAHSGGEREIQRTMLELLNQLDGF  324



>gb|EEC75058.1| hypothetical protein OsI_11173 [Oryza sativa Indica Group]
Length=460

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  244  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  303

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  304  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  339



>gb|KFK40382.1| hypothetical protein AALP_AA3G366200 [Arabis alpina]
Length=376

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  160  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  219

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDA+SGGEREIQRTMLELLNQLDGF
Sbjct  220  IDEIDAVGTKRYDANSGGEREIQRTMLELLNQLDGF  255



>gb|EEE58887.1| hypothetical protein OsJ_10505 [Oryza sativa Japonica Group]
Length=460

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  244  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  303

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  304  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  339



>ref|XP_005847625.1| 26S proteasome AAA-ATPase subunit RPT2a [Chlorella variabilis]
 gb|EFN55523.1| 26S proteasome AAA-ATPase subunit RPT2a [Chlorella variabilis]
Length=443

 Score =   191 bits (486),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADE +P+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADEQAPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  322



>gb|EMT04844.1| 26S protease regulatory subunit 4-like protein [Aegilops tauschii]
Length=655

 Score =   194 bits (494),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  264  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  323

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  324  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  359



>ref|NP_179604.1| 26S proteasome subunit RPT2B [Arabidopsis thaliana]
 sp|Q9SL67.1|PRS4B_ARATH RecName: Full=26S proteasome regulatory subunit 4 homolog B; 
AltName: Full=26S proteasome AAA-ATPase subunit RPT2b; AltName: 
Full=26S proteasome subunit 4 homolog B; AltName: Full=Regulatory 
particle triple-A ATPase subunit 2b [Arabidopsis thaliana]
 gb|AAD24384.1| 26S proteasome subunit 4 [Arabidopsis thaliana]
 gb|AAK59577.1| putative 26S proteasome subunit 4 [Arabidopsis thaliana]
 gb|AAL07184.1| putative 26S proteasome subunit 4 [Arabidopsis thaliana]
 gb|AEC06970.1| 26S proteasome subunit RPT2B [Arabidopsis thaliana]
Length=443

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDA+SGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDANSGGEREIQRTMLELLNQLDGF  322



>emb|CAC14432.1| 26S proteasome subunit 4-like protein [Brassica napus]
 emb|CDX92914.1| BnaC07g41720D [Brassica napus]
Length=443

 Score =   190 bits (482),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDA+SGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDANSGGEREIQRTMLELLNQLDGF  322



>ref|XP_009129033.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A [Brassica 
rapa]
 emb|CDY35245.1| BnaA01g07860D [Brassica napus]
Length=443

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDA+SGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDANSGGEREIQRTMLELLNQLDGF  322



>ref|XP_010489089.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
isoform X1 [Camelina sativa]
 ref|XP_010489090.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B-like 
isoform X2 [Camelina sativa]
Length=443

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDA+SGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDANSGGEREIQRTMLELLNQLDGF  322



>ref|XP_010416236.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B [Camelina 
sativa]
 ref|XP_010467933.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B isoform 
X1 [Camelina sativa]
 ref|XP_010467934.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog B isoform 
X2 [Camelina sativa]
Length=443

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDA+SGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDANSGGEREIQRTMLELLNQLDGF  322



>emb|CDX97472.1| BnaC08g13370D [Brassica napus]
Length=445

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDA+SGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAVGTKRYDANSGGEREIQRTMLELLNQLDGF  324



>ref|XP_002885999.1| hypothetical protein ARALYDRAFT_480455 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62258.1| hypothetical protein ARALYDRAFT_480455 [Arabidopsis lyrata subsp. 
lyrata]
Length=443

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDA+SGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDANSGGEREIQRTMLELLNQLDGF  322



>gb|AAK50114.1|AF372977_1 At2g20140/T2G17.6 [Arabidopsis thaliana]
Length=443

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDA+SGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDANSGGEREIQRTMLELLNQLDGF  322



>ref|XP_009109057.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Brassica rapa]
 emb|CDY14224.1| BnaA08g13550D [Brassica napus]
Length=445

 Score =   190 bits (482),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDA+SGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAVGTKRYDANSGGEREIQRTMLELLNQLDGF  324



>gb|KFK29443.1| hypothetical protein AALP_AA7G135000 [Arabis alpina]
Length=443

 Score =   189 bits (481),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDA+SGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDANSGGEREIQRTMLELLNQLDGF  322



>ref|XP_006297610.1| hypothetical protein CARUB_v10013630mg, partial [Capsella rubella]
 gb|EOA30508.1| hypothetical protein CARUB_v10013630mg, partial [Capsella rubella]
Length=468

 Score =   190 bits (483),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  252  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  311

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDA+SGGEREIQRTMLELLNQLDGF
Sbjct  312  IDEIDAVGTKRYDANSGGEREIQRTMLELLNQLDGF  347



>ref|NP_001275024.1| 26S proteasome subunit 4-like [Solanum tuberosum]
 gb|ABB02638.1| 26S proteasome subunit 4-like [Solanum tuberosum]
Length=444

 Score =   189 bits (481),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  228  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAV TKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVRTKRYDAHSGGEREIQRTMLELLNQLDGF  323



>ref|XP_010438356.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Camelina sativa]
Length=444

 Score =   189 bits (481),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  228  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDA SGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVGTKRYDAQSGGEREIQRTMLELLNQLDGF  323



>ref|XP_002959240.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
 gb|EFJ39700.1| 26S proteasome regulatory complex [Volvox carteri f. nagariensis]
Length=444

 Score =   189 bits (481),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG+PGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADEL+P+IVF
Sbjct  228  LYGDPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELAPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRY+AHSGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAIGTKRYEAHSGGEREIQRTMLELLNQLDGF  323



>emb|CDY06847.1| BnaC01g09460D [Brassica napus]
Length=443

 Score =   189 bits (481),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYDA+SGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAIGTKRYDANSGGEREIQRTMLELLNQLDGF  322



>gb|KDD76237.1| AAA+ ATPase [Helicosporidium sp. ATCC 50920]
Length=445

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSA+FLRVVGSELIQKYLGDGPKLVRELFR ADELSP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSASFLRVVGSELIQKYLGDGPKLVRELFRTADELSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDA SGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAVGTKRYDAQSGGEREIQRTMLELLNQLDGF  324



>ref|XP_010548707.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Tarenaya hassleriana]
 ref|XP_010548708.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Tarenaya hassleriana]
Length=436

 Score =   187 bits (474),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATF RVVGSELIQK+ GDGPKLVRELFRVAD+LSP+IVF
Sbjct  220  LYGEPGTGKTLLAKAVANSTSATFFRVVGSELIQKHSGDGPKLVRELFRVADDLSPSIVF  279

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  280  IDEIDAIGTKRYDAHSGGEREIQRTMLELLNQLDGF  315



>gb|AAP80726.1| 26S proteasome subunit [Griffithsia japonica]
Length=284

 Score =   182 bits (463),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVA++++P+IVF
Sbjct  68   LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEDMAPSIVF  127

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD  SGGEREIQRTMLELLNQLDGF
Sbjct  128  IDEIDAVGTKRYDTTSGGEREIQRTMLELLNQLDGF  163



>gb|AAM65126.1| 26S proteasome subunit 4 [Arabidopsis thaliana]
Length=443

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+I F
Sbjct  227  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIGF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDA+SGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDANSGGEREIQRTMLELLNQLDGF  322



>ref|XP_646726.1| 26S proteasome ATPase 1 subunit [Dictyostelium discoideum AX4]
 sp|Q55BV5.1|PRS4_DICDI RecName: Full=26S protease regulatory subunit 4 homolog; AltName: 
Full=Tat-binding protein alpha; Short=DdTBPalpha [Dictyostelium 
discoideum]
 gb|EAL72742.1| 26S proteasome ATPase 1 subunit [Dictyostelium discoideum AX4]
Length=439

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVADE +P+IVF
Sbjct  223  LYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVADECAPSIVF  282

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD+ SGGEREIQRTMLELLNQLDGF
Sbjct  283  IDEIDAVGTKRYDSQSGGEREIQRTMLELLNQLDGF  318



>dbj|GAM28912.1| hypothetical protein SAMD00019534_120880 [Acytostelium subglobosum 
LB1]
Length=441

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+EL+P+IVF
Sbjct  225  LYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEELAPSIVF  284

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD+ SGGEREIQRTMLELLNQLDGF
Sbjct  285  IDEIDAVGTKRYDSQSGGEREIQRTMLELLNQLDGF  320



>gb|EFA82511.1| 26S proteasome ATPase 1 subunit [Polysphondylium pallidum PN500]
Length=442

 Score =   186 bits (473),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+EL+P+IVF
Sbjct  226  LYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEELAPSIVF  285

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  286  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  321



>ref|XP_006163911.1| PREDICTED: 26S protease regulatory subunit 4-like [Tupaia chinensis]
Length=166

 Score =   178 bits (451),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  14   LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  73

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELL+QLDGF
Sbjct  74   IDEIDAIGTKRYDSNSGGEREIQRTMLELLDQLDGF  109



>dbj|BAE88023.1| unnamed protein product [Macaca fascicularis]
Length=227

 Score =   180 bits (456),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  11   LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  70

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  71   IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  106



>ref|XP_002186016.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65486.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=284

 Score =   181 bits (460),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP IVF
Sbjct  68   LYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPTIVF  127

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVG+KRYD+ SGG REIQRTMLELLNQLDGF
Sbjct  128  IDEIDAVGSKRYDSGSGGTREIQRTMLELLNQLDGF  163



>ref|XP_005645317.1| 26S proteasome subunit P45 [Coccomyxa subellipsoidea C-169]
 gb|EIE20773.1| 26S proteasome subunit P45 [Coccomyxa subellipsoidea C-169]
Length=367

 Score =   183 bits (465),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADEL+P+IVF
Sbjct  151  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELAPSIVF  210

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDE+DA+G KRY++ SGGEREIQRTMLELLNQ+DGF
Sbjct  211  IDEVDAIGAKRYESQSGGEREIQRTMLELLNQMDGF  246



>ref|XP_004357511.1| 26S proteasome ATPase 1 subunit [Dictyostelium fasciculatum]
 gb|EGG19240.1| 26S proteasome ATPase 1 subunit [Dictyostelium fasciculatum]
Length=440

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+EL+P+IVF
Sbjct  224  LYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEELAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD+ SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAVGTKRYDSTSGGEREIQRTMLELLNQLDGF  319



>emb|CEF97142.1| 26S proteasome subunit P45 [Ostreococcus tauri]
Length=446

 Score =   185 bits (469),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVANSTSATFLR+VGSELIQKYLGDGPKLVRELFRVADE+SP+IVF
Sbjct  230  LYGAPGTGKTLLAKAVANSTSATFLRIVGSELIQKYLGDGPKLVRELFRVADEMSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            +DEIDAVGTKRYD+ SGGEREIQRTMLELLNQ+DGF
Sbjct  290  MDEIDAVGTKRYDSQSGGEREIQRTMLELLNQMDGF  325



>ref|XP_004335995.1| 26S proteasome AAAATPase subunit RPT2a, putative [Acanthamoeba 
castellanii str. Neff]
 gb|ELR13982.1| 26S proteasome AAAATPase subunit RPT2a, putative [Acanthamoeba 
castellanii str. Neff]
Length=445

 Score =   185 bits (469),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E SP+IVF
Sbjct  229  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHSPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYDA SGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAIGTKRYDATSGGEREIQRTMLELLNQLDGF  324



>gb|KFM27289.1| 26S proteasome regulatory subunit 4-like protein B [Auxenochlorella 
protothecoides]
Length=420

 Score =   184 bits (467),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVA+STSA+FLRVVGSELIQKYLGDGPKLVRELFR ADELSP+IVF
Sbjct  204  LYGEPGTGKTLLAKAVAHSTSASFLRVVGSELIQKYLGDGPKLVRELFRTADELSPSIVF  263

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRY+A+SGGEREIQRTMLELLNQLDGF
Sbjct  264  IDEIDAVGTKRYEANSGGEREIQRTMLELLNQLDGF  299



>ref|XP_003290859.1| 26S proteasome ATPase 1 subunit [Dictyostelium purpureum]
 gb|EGC32607.1| 26S proteasome ATPase 1 subunit [Dictyostelium purpureum]
Length=440

 Score =   184 bits (468),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  223  LYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEECAPSIVF  282

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD+ SGGEREIQRTMLELLNQLDGF
Sbjct  283  IDEIDAVGTKRYDSQSGGEREIQRTMLELLNQLDGF  318



>gb|EYU46362.1| hypothetical protein MIMGU_mgv1a023433mg [Erythranthe guttata]
Length=440

 Score =   184 bits (468),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLG+GPKLVRE+FRVAD+LSP+IVF
Sbjct  224  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGEGPKLVREIFRVADDLSPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYDA SG EREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAVGTKRYDARSGAEREIQRTMLELLNQLDGF  319



>gb|AAS47025.1| proteasome 26S ATPase subunit 1 [Oreochromis mossambicus]
Length=256

 Score =   179 bits (455),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  63   LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  122

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  123  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  158



>ref|XP_001416670.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO94963.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=443

 Score =   184 bits (468),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVANSTSATFLR+VGSELIQKYLGDGPKLVRELFRVADE+SP+IVF
Sbjct  227  LYGAPGTGKTLLAKAVANSTSATFLRIVGSELIQKYLGDGPKLVRELFRVADEMSPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            +DEIDAVGTKRYD+ SGGEREIQRTMLELLNQ+DGF
Sbjct  287  MDEIDAVGTKRYDSQSGGEREIQRTMLELLNQMDGF  322



>gb|KHJ76446.1| ATPase, AAA family [Oesophagostomum dentatum]
 gb|KHJ79636.1| ATPase, AAA family [Oesophagostomum dentatum]
Length=227

 Score =   179 bits (453),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLR+VGSELIQKYLGDGPK+VRELFRVA+E +P+IVF
Sbjct  11   LYGCPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPKMVRELFRVAEENAPSIVF  70

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  71   IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  106



>ref|XP_002165829.1| PREDICTED: 26S protease regulatory subunit 4-like [Hydra vulgaris]
Length=441

 Score =   184 bits (467),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/96 (94%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E SP+IVF
Sbjct  225  LYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHSPSIVF  284

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  285  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  320



>gb|AET43959.1| proteasome 26S subunit ATPase 4, partial [Reishia clavigera]
Length=223

 Score =   178 bits (451),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  37   LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  96

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRY+++SGGEREIQRTMLELLNQLDGF
Sbjct  97   IDEIDAVGTKRYESNSGGEREIQRTMLELLNQLDGF  132



>ref|XP_007510866.1| 26S protease regulatory subunit 4 [Bathycoccus prasinos]
 emb|CCO66426.1| 26S protease regulatory subunit 4 [Bathycoccus prasinos]
Length=448

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSA+FLRVVGSELIQKYLGDGPKLVRELFRVAD++SP+IVF
Sbjct  232  LYGEPGTGKTLLAKAVANSTSASFLRVVGSELIQKYLGDGPKLVRELFRVADDMSPSIVF  291

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            +DEIDAVGTKRYD+ SGGE+EIQRTMLELLNQLDGF
Sbjct  292  LDEIDAVGTKRYDSQSGGEKEIQRTMLELLNQLDGF  327



>gb|ERL96126.1| hypothetical protein D910_01116, partial [Dendroctonus ponderosae]
Length=324

 Score =   181 bits (458),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  222  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  281

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  282  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  317



>gb|ERL96197.1| hypothetical protein D910_01383, partial [Dendroctonus ponderosae]
Length=334

 Score =   181 bits (459),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  232  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  291

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  292  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  327



>gb|EHJ72875.1| 26S protease regulatory subunit [Danaus plexippus]
Length=334

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  118  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  177

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  178  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  213



>ref|XP_004294291.1| PREDICTED: 26S proteasome regulatory subunit 4 homolog A-like 
[Fragaria vesca subsp. vesca]
Length=446

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKY G+G KLVRE+FRVADE SP+IVF
Sbjct  230  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYSGEGQKLVREIFRVADECSPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDE+DAVGTKRYDAHSGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEVDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  325



>gb|KFM73632.1| 26S protease regulatory subunit 4, partial [Stegodyphus mimosarum]
Length=359

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  151  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  210

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  211  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  246



>ref|XP_007942719.1| PREDICTED: 26S protease regulatory subunit 4 [Orycteropus afer 
afer]
Length=335

 Score =   181 bits (458),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  151  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  210

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  211  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  246



>gb|EWM27689.1| 26s proteasome subunit 4 [Nannochloropsis gaditana]
Length=447

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVAD+LSP+IVF
Sbjct  231  LYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVADDLSPSIVF  290

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVG+KRYD++SGG REIQRTMLELLNQLDGF
Sbjct  291  IDEIDAVGSKRYDSNSGGTREIQRTMLELLNQLDGF  326



>emb|CDQ82789.1| unnamed protein product [Oncorhynchus mykiss]
Length=287

 Score =   179 bits (453),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  61   LYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  120

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRT+LELLNQLDGF
Sbjct  121  IDEIDAIGTKRYDSNSGGEREIQRTLLELLNQLDGF  156



>ref|XP_004313184.1| PREDICTED: 26S protease regulatory subunit 4 [Tursiops truncatus]
Length=315

 Score =   179 bits (455),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  99   LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  158

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  159  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  194



>ref|XP_001431072.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 ref|XP_001441362.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK63674.1| unnamed protein product [Paramecium tetraurelia]
 emb|CAK73965.1| unnamed protein product [Paramecium tetraurelia]
Length=452

 Score =   183 bits (464),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKY GDGPKLVRELFRVA+E +P+IVF
Sbjct  236  LYGEPGTGKTLLAKAVANETSATFLRVVGSELIQKYQGDGPKLVRELFRVAEEHAPSIVF  295

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD+HSGGE+EIQRTMLELLNQLDGF
Sbjct  296  IDEIDAVGTKRYDSHSGGEKEIQRTMLELLNQLDGF  331



>ref|XP_009477136.1| PREDICTED: 26S protease regulatory subunit 4, partial [Pelecanus 
crispus]
 gb|KFQ59296.1| 26S protease regulatory subunit 4, partial [Pelecanus crispus]
Length=349

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  133  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  192

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  193  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  228



>ref|XP_002734612.2| PREDICTED: 26S protease regulatory subunit 4-like, partial [Saccoglossus 
kowalevskii]
Length=241

 Score =   177 bits (449),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  69   LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  128

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            +DEIDA+GTKRY+++SGGEREIQRTMLELLNQLDGF
Sbjct  129  VDEIDAIGTKRYESNSGGEREIQRTMLELLNQLDGF  164



>dbj|BAM11111.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1, partial 
[Siebenrockiella crassicollis]
Length=363

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  182  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  241

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  242  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  277



>gb|ACC68862.1| proteasome 26S ATPase subunit 1 (predicted) [Rhinolophus ferrumequinum]
Length=356

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  140  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  199

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  200  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  235



>dbj|BAK63819.1| 26S protease regulatory subunit 4 [Pan troglodytes]
Length=349

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_004698814.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Echinops 
telfairi]
 ref|XP_004698815.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Echinops 
telfairi]
Length=367

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  151  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  210

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  211  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  246



>ref|XP_007055518.1| PREDICTED: 26S protease regulatory subunit 4 [Chelonia mydas]
 gb|EMP39883.1| 26S protease regulatory subunit 4 [Chelonia mydas]
Length=367

 Score =   181 bits (458),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  151  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  210

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  211  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  246



>ref|XP_004055613.1| PREDICTED: 26S protease regulatory subunit 4 isoform 2 [Gorilla 
gorilla gorilla]
Length=367

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  151  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  210

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  211  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  246



>ref|XP_003260921.1| PREDICTED: 26S protease regulatory subunit 4 isoform 2 [Nomascus 
leucogenys]
 ref|XP_004010887.1| PREDICTED: 26S protease regulatory subunit 4 [Ovis aries]
 ref|XP_004262380.1| PREDICTED: 26S protease regulatory subunit 4 isoform 2 [Orcinus 
orca]
 ref|XP_004394524.1| PREDICTED: 26S protease regulatory subunit 4 isoform 2 [Odobenus 
rosmarus divergens]
 ref|XP_004434252.1| PREDICTED: 26S protease regulatory subunit 4 isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004610311.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Sorex 
araneus]
 ref|XP_004681687.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Condylura 
cristata]
 ref|XP_005343506.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Microtus 
ochrogaster]
 ref|XP_006187993.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Camelus 
ferus]
 ref|XP_006187994.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Camelus 
ferus]
 ref|XP_006208253.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Vicugna 
pacos]
 ref|XP_006754785.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Myotis 
davidii]
 ref|XP_006748119.1| PREDICTED: 26S protease regulatory subunit 4-like isoform X2 
[Leptonychotes weddellii]
 ref|XP_006879186.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Elephantulus 
edwardii]
 ref|XP_007102740.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Physeter 
catodon]
 ref|XP_007102741.1| PREDICTED: 26S protease regulatory subunit 4 isoform X3 [Physeter 
catodon]
 ref|XP_007471953.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Lipotes 
vexillifer]
 ref|XP_001517805.2| PREDICTED: 26S protease regulatory subunit 4 [Ornithorhynchus 
anatinus]
 ref|XP_008561839.1| PREDICTED: 26S protease regulatory subunit 4 [Galeopterus variegatus]
 ref|XP_009426560.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Pan 
troglodytes]
 dbj|BAG61175.1| unnamed protein product [Homo sapiens]
Length=367

 Score =   181 bits (458),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  151  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  210

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  211  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  246



>ref|XP_002141206.1| 26S proteasome subunit 4 [Cryptosporidium muris RN66]
 gb|EEA06857.1| 26S proteasome subunit 4, putative [Cryptosporidium muris RN66]
Length=447

 Score =   182 bits (463),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  231  LYGPPGTGKTLLAKAVANETSATFLRVVGSELIQKYLGDGPKLVRELFRVAEENAPSIVF  290

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKR+DAHSGGER+IQRTMLELLNQLDGF
Sbjct  291  IDEIDAVGTKRHDAHSGGERDIQRTMLELLNQLDGF  326



>gb|EPY78557.1| 26S protease regulatory subunit 4 isoform 2, partial [Camelus 
ferus]
Length=369

 Score =   180 bits (457),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  149  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  208

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  209  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  244



>emb|CBJ33278.1| conserved unknown protein [Ectocarpus siliculosus]
Length=446

 Score =   182 bits (462),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVADE+SP +VF
Sbjct  230  LYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVADEMSPTLVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVG+KRYD++SGG REIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGSKRYDSNSGGTREIQRTMLELLNQLDGF  325



>dbj|BAJ99744.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=329

 Score =   179 bits (454),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELF+ A E SPAI+F
Sbjct  118  LYGEPGTGKTLLAKAVANETSATFLRVVGSELIQKYLGDGPKLVRELFKTAQEHSPAIIF  177

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGE+E+QRTMLELLNQLDGF
Sbjct  178  IDEIDAIGTKRYDSNSGGEKEVQRTMLELLNQLDGF  213



>ref|XP_004924561.1| PREDICTED: 26S protease regulatory subunit 4-like, partial [Bombyx 
mori]
Length=392

 Score =   181 bits (459),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  176  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  235

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  236  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  271



>gb|EJW79473.1| 26S protease regulatory subunit 4, partial [Wuchereria bancrofti]
Length=333

 Score =   179 bits (454),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPK+VRELFRVA+E +P+IVF
Sbjct  235  LYGCPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKMVRELFRVAEEHAPSIVF  294

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  295  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  330



>ref|XP_005705264.1| AAA-type ATPase [Galdieria sulphuraria]
 gb|EME28744.1| AAA-type ATPase [Galdieria sulphuraria]
Length=413

 Score =   181 bits (460),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLA+AVANSTSATFLRVVGSELIQKYLGDGPKLVRELFR A+E++P+IVF
Sbjct  232  LYGEPGTGKTLLARAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRAAEEMAPSIVF  291

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRY+A SGGEREIQRTMLELLNQLDGF
Sbjct  292  IDEIDAIGTKRYEATSGGEREIQRTMLELLNQLDGF  327



>gb|KDE06590.1| 26S protease regulatory subunit 4 [Microbotryum violaceum p1A1 
Lamole]
Length=445

 Score =   182 bits (461),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLR+VGSELIQKYLGDGPKLVRELFRVA+EL+P+IVF
Sbjct  229  LYGVPGTGKTLLAKAVANQTSATFLRIVGSELIQKYLGDGPKLVRELFRVAEELAPSIVF  288

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  289  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  324



>gb|ETE70436.1| 26S protease regulatory subunit 4 [Ophiophagus hannah]
Length=389

 Score =   181 bits (458),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>gb|EFX87779.1| hypothetical protein DAPPUDRAFT_306388 [Daphnia pulex]
Length=442

 Score =   182 bits (461),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E SP+IVF
Sbjct  226  LYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHSPSIVF  285

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  286  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  321



>gb|EZG56152.1| 26S proteasome ATPase regulatory subunit 4 [Gregarina niphandrodes]
Length=442

 Score =   182 bits (461),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRE+FRVA+E +P+IVF
Sbjct  226  LYGPPGTGKTLLAKAVANETSATFLRVVGSELIQKYLGDGPKLVREMFRVAEEHAPSIVF  285

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVG+KRY+AHSGGEREIQRTMLELLNQLDGF
Sbjct  286  IDEIDAVGSKRYEAHSGGEREIQRTMLELLNQLDGF  321



>ref|XP_002013487.1| GL24166 [Drosophila persimilis]
 gb|EDW24473.1| GL24166 [Drosophila persimilis]
Length=417

 Score =   181 bits (459),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  201  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  260

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  261  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  296



>gb|EAW81420.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1, isoform 
CRA_b [Homo sapiens]
Length=397

 Score =   181 bits (458),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  181  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  240

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  241  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  276



>dbj|BAN20514.1| proteasome 26S subunit subunit 4 ATPase [Riptortus pedestris]
Length=440

 Score =   181 bits (460),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_005686275.1| PREDICTED: LOW QUALITY PROTEIN: 26S protease regulatory subunit 
4 [Capra hircus]
Length=403

 Score =   181 bits (458),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  187  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  246

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  247  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  282



>gb|ERE73673.1| 26S protease regulatory subunit 4-like protein [Cricetulus griseus]
Length=403

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  187  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  246

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  247  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  282



>gb|KFB53206.1| AGAP003215-PA-like protein [Anopheles sinensis]
Length=430

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  214  LYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  273

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  274  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  309



>ref|XP_003746341.1| PREDICTED: 26S protease regulatory subunit 4-like [Metaseiulus 
occidentalis]
Length=438

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  222  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  281

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  282  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  317



>gb|KDR19574.1| 26S protease regulatory subunit 4 [Zootermopsis nevadensis]
Length=440

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_005179926.1| PREDICTED: 26S protease regulatory subunit 4-like [Musca domestica]
Length=439

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  223  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  282

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  283  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  318



>ref|XP_005809990.1| PREDICTED: 26S protease regulatory subunit 4-like [Xiphophorus 
maculatus]
Length=408

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>gb|EOA93815.1| 26S protease regulatory subunit 4, partial [Anas platyrhynchos]
Length=407

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  191  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  250

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  251  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  286



>ref|XP_001861875.1| 26S protease regulatory subunit 4 [Culex quinquefasciatus]
 gb|EDS36214.1| 26S protease regulatory subunit 4 [Culex quinquefasciatus]
Length=438

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  222  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  281

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  282  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  317



>ref|XP_001655853.1| 26S protease regulatory subunit [Aedes aegypti]
 gb|ABF18346.1| 26S proteasome regulatory chain 4 [Aedes aegypti]
 gb|EAT35749.1| AAEL012095-PA [Aedes aegypti]
Length=438

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  222  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  281

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  282  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  317



>ref|NP_524469.2| regulatory particle triple-A ATPase 2, isoform A [Drosophila 
melanogaster]
 ref|NP_001287493.1| regulatory particle triple-A ATPase 2, isoform B [Drosophila 
melanogaster]
 ref|XP_002032413.1| GM23527 [Drosophila sechellia]
 ref|XP_002104626.1| GD18337 [Drosophila simulans]
 sp|P48601.2|PRS4_DROME RecName: Full=26S protease regulatory subunit 4; Short=P26s4 
[Drosophila melanogaster]
 gb|AAF56205.1| regulatory particle triple-A ATPase 2, isoform A [Drosophila 
melanogaster]
 gb|AAL13988.1| SD02658p [Drosophila melanogaster]
 gb|EDW43399.1| GM23527 [Drosophila sechellia]
 gb|EDX14129.1| GD18337 [Drosophila simulans]
 gb|ACL90655.1| Pros26.4-PA [synthetic construct]
 gb|AHN57492.1| regulatory particle triple-A ATPase 2, isoform B [Drosophila 
melanogaster]
Length=439

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  223  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  282

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  283  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  318



>gb|AAB34134.1| P26s4 [Drosophila melanogaster]
Length=439

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  223  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  282

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  283  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  318



>ref|XP_001993700.1| GH19692 [Drosophila grimshawi]
 gb|EDV94436.1| GH19692 [Drosophila grimshawi]
Length=439

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  223  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  282

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  283  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  318



>ref|XP_001982075.1| GG12390 [Drosophila erecta]
 ref|XP_002070237.1| GK11948 [Drosophila willistoni]
 ref|XP_002099325.1| GE10845 [Drosophila yakuba]
 gb|EDV53945.1| GG12390 [Drosophila erecta]
 gb|EDW81223.1| GK11948 [Drosophila willistoni]
 gb|EDW99037.1| GE10845 [Drosophila yakuba]
Length=439

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  223  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  282

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  283  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  318



>gb|AEE62840.1| unknown [Dendroctonus ponderosae]
 gb|ENN73080.1| hypothetical protein YQE_10284, partial [Dendroctonus ponderosae]
Length=438

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  222  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  281

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  282  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  317



>ref|XP_003384484.1| PREDICTED: 26S protease regulatory subunit 4-like [Amphimedon 
queenslandica]
Length=395

 Score =   180 bits (456),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRV GSELIQKYLG+GPKLVRELFRVA+E SP+IVF
Sbjct  218  LYGAPGTGKTLLAKAVANQTSATFLRVCGSELIQKYLGEGPKLVRELFRVAEEHSPSIVF  277

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRY++HSGGEREIQRTMLELLNQLDGF
Sbjct  278  IDEIDAIGTKRYESHSGGEREIQRTMLELLNQLDGF  313



>ref|XP_003696714.1| PREDICTED: 26S protease regulatory subunit 4-like [Apis florea]
 ref|XP_006623398.1| PREDICTED: 26S protease regulatory subunit 4-like [Apis dorsata]
Length=440

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_004523315.1| PREDICTED: 26S protease regulatory subunit 4-like [Ceratitis 
capitata]
Length=439

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  223  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  282

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  283  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  318



>ref|XP_001948523.1| PREDICTED: 26S protease regulatory subunit 4 [Acyrthosiphon pisum]
Length=440

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>gb|EFN65701.1| 26S protease regulatory subunit 4 [Camponotus floridanus]
Length=440

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_312923.4| AGAP003215-PA [Anopheles gambiae str. PEST]
 ref|XP_312924.4| AGAP003216-PA [Anopheles gambiae str. PEST]
 gb|EAA08386.4| AGAP003215-PA [Anopheles gambiae str. PEST]
 gb|EAA08387.4| AGAP003216-PA [Anopheles gambiae str. PEST]
Length=438

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  222  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  281

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  282  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  317



>ref|XP_974859.1| PREDICTED: 26S protease regulatory subunit 4 [Tribolium castaneum]
 gb|EFA06741.1| hypothetical protein TcasGA2_TC009675 [Tribolium castaneum]
Length=438

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  222  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  281

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  282  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  317



>ref|XP_001953861.1| GF17023 [Drosophila ananassae]
 gb|EDV42422.1| GF17023 [Drosophila ananassae]
Length=446

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  230  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  289

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  290  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  325



>ref|XP_001358781.1| GA18789 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL27924.1| GA18789 [Drosophila pseudoobscura pseudoobscura]
Length=439

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  223  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  282

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  283  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  318



>ref|XP_002431748.1| 26S protease regulatory subunit, putative [Pediculus humanus 
corporis]
 gb|EEB19010.1| 26S protease regulatory subunit, putative [Pediculus humanus 
corporis]
Length=440

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_003395819.1| PREDICTED: 26S protease regulatory subunit 4-like [Bombus terrestris]
 ref|XP_003489177.1| PREDICTED: 26S protease regulatory subunit 4-like [Bombus impatiens]
Length=440

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>gb|AII16487.1| 26S protease regulatory subunit 4, partial [Paracyclopina nana]
Length=439

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  223  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  282

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  283  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  318



>ref|XP_002000888.1| GI22277 [Drosophila mojavensis]
 gb|EDW16349.1| GI22277 [Drosophila mojavensis]
Length=439

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  223  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  282

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  283  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  318



>ref|XP_003707462.1| PREDICTED: 26S protease regulatory subunit 4-like [Megachile 
rotundata]
Length=466

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  250  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  309

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  310  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  345



>gb|KFB53205.1| hypothetical protein ZHAS_00021511 [Anopheles sinensis]
Length=438

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  222  LYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  281

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  282  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  317



>gb|ETN59541.1| 26S protease regulatory subunit 4 [Anopheles darlingi]
 gb|ETN59542.1| 26S protease regulatory subunit 4 [Anopheles darlingi]
Length=438

 Score =   181 bits (459),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  222  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  281

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  282  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  317



>gb|ACO12018.1| 26S protease regulatory subunit 4 [Lepeophtheirus salmonis]
Length=438

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E SP+IVF
Sbjct  222  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHSPSIVF  281

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++ GGEREIQRTMLELLNQLDGF
Sbjct  282  IDEIDAVGTKRYDSNCGGEREIQRTMLELLNQLDGF  317



>ref|XP_011051171.1| PREDICTED: 26S protease regulatory subunit 4 [Acromyrmex echinatior]
Length=440

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_008550534.1| PREDICTED: 26S protease regulatory subunit 4 [Microplitis demolitor]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_005285442.1| PREDICTED: 26S protease regulatory subunit 4 [Chrysemys picta 
bellii]
 ref|XP_006270442.1| PREDICTED: 26S protease regulatory subunit 4 [Alligator mississippiensis]
 ref|XP_007437056.1| PREDICTED: 26S protease regulatory subunit 4 [Python bivittatus]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_004055612.1| PREDICTED: 26S protease regulatory subunit 4 isoform 1 [Gorilla 
gorilla gorilla]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>dbj|BAM19425.1| proteasome 26S subunit subunit 4 ATPase, partial [Papilio xuthus]
Length=441

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  225  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  284

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  285  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  320



>ref|XP_002053771.1| GJ24070 [Drosophila virilis]
 gb|EDW67291.1| GJ24070 [Drosophila virilis]
Length=444

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  228  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  287

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  288  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  323



>gb|AAA35484.1| 26S protease (S4) regulatory subunit [Homo sapiens]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_623527.1| PREDICTED: 26S protease regulatory subunit 4 isoform 1 [Apis 
mellifera]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_007526891.1| PREDICTED: 26S protease regulatory subunit 4 [Erinaceus europaeus]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|NP_032973.1| 26S protease regulatory subunit 4 [Mus musculus]
 ref|NP_476464.1| 26S protease regulatory subunit 4 [Rattus norvegicus]
 ref|NP_002793.2| 26S protease regulatory subunit 4 [Homo sapiens]
 ref|NP_001039154.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Xenopus 
(Silurana) tropicalis]
 ref|NP_001231080.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Sus scrofa]
 ref|NP_001238880.1| 26S protease regulatory subunit 4 [Canis lupus familiaris]
 ref|NP_001253262.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Macaca 
mulatta]
 ref|XP_510114.2| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Pan 
troglodytes]
 ref|XP_001494140.2| PREDICTED: 26S protease regulatory subunit 4 isoform 1 [Equus 
caballus]
 ref|XP_002754239.1| PREDICTED: 26S protease regulatory subunit 4 [Callithrix jacchus]
 ref|XP_003260920.1| PREDICTED: 26S protease regulatory subunit 4 isoform 1 [Nomascus 
leucogenys]
 ref|XP_001371702.2| PREDICTED: 26S protease regulatory subunit 4-like isoform X1 
[Monodelphis domestica]
 ref|XP_003501438.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Cricetulus 
griseus]
 ref|XP_004262379.1| PREDICTED: 26S protease regulatory subunit 4 isoform 1 [Orcinus 
orca]
 ref|XP_004394523.1| PREDICTED: 26S protease regulatory subunit 4 isoform 1 [Odobenus 
rosmarus divergens]
 ref|XP_004434253.1| PREDICTED: 26S protease regulatory subunit 4 isoform 2 [Ceratotherium 
simum simum]
 ref|XP_004476117.1| PREDICTED: 26S protease regulatory subunit 4 [Dasypus novemcinctus]
 ref|XP_004584401.1| PREDICTED: 26S protease regulatory subunit 4 [Ochotona princeps]
 ref|XP_004610310.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Sorex 
araneus]
 ref|XP_004681686.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Condylura 
cristata]
 ref|XP_004739122.1| PREDICTED: 26S protease regulatory subunit 4 [Mustela putorius 
furo]
 ref|XP_004797160.1| PREDICTED: 26S protease regulatory subunit 4 [Mustela putorius 
furo]
 ref|XP_004884175.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Heterocephalus 
glaber]
 ref|XP_004884176.1| PREDICTED: 26S protease regulatory subunit 4 isoform X3 [Heterocephalus 
glaber]
 ref|XP_004884177.1| PREDICTED: 26S protease regulatory subunit 4 isoform X4 [Heterocephalus 
glaber]
 ref|XP_003472392.2| PREDICTED: 26S protease regulatory subunit 4 [Cavia porcellus]
 ref|XP_005343505.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Microtus 
ochrogaster]
 ref|XP_005321372.1| PREDICTED: 26S protease regulatory subunit 4 [Ictidomys tridecemlineatus]
 ref|XP_005390338.1| PREDICTED: 26S protease regulatory subunit 4 [Chinchilla lanigera]
 ref|XP_005562068.1| PREDICTED: 26S protease regulatory subunit 4 [Macaca fascicularis]
 ref|XP_005871251.1| PREDICTED: 26S protease regulatory subunit 4 [Myotis brandtii]
 ref|XP_006101737.1| PREDICTED: 26S protease regulatory subunit 4 [Myotis lucifugus]
 ref|XP_006208252.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Vicugna 
pacos]
 ref|XP_006754784.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Myotis 
davidii]
 ref|XP_006748118.1| PREDICTED: 26S protease regulatory subunit 4-like isoform X1 
[Leptonychotes weddellii]
 ref|XP_006879185.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Elephantulus 
edwardii]
 ref|XP_006839641.1| PREDICTED: 26S protease regulatory subunit 4 [Chrysochloris asiatica]
 ref|XP_006925586.1| PREDICTED: 26S protease regulatory subunit 4 [Pteropus alecto]
 ref|XP_006991870.1| PREDICTED: 26S protease regulatory subunit 4 [Peromyscus maniculatus 
bairdii]
 ref|XP_007102739.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Physeter 
catodon]
 ref|XP_007180941.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007471952.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Lipotes 
vexillifer]
 ref|XP_007472663.1| PREDICTED: 26S protease regulatory subunit 4-like isoform X2 
[Monodelphis domestica]
 ref|XP_007985761.1| PREDICTED: 26S protease regulatory subunit 4 [Chlorocebus sabaeus]
 ref|XP_008270148.1| PREDICTED: 26S protease regulatory subunit 4 [Oryctolagus cuniculus]
 ref|XP_008516748.1| PREDICTED: 26S protease regulatory subunit 4 [Equus przewalskii]
 ref|XP_008819971.1| PREDICTED: 26S protease regulatory subunit 4 [Nannospalax galili]
 ref|XP_008956433.1| PREDICTED: 26S protease regulatory subunit 4 [Pan paniscus]
 ref|XP_009210390.1| PREDICTED: 26S protease regulatory subunit 4 [Papio anubis]
 ref|XP_009234479.1| PREDICTED: 26S protease regulatory subunit 4 [Pongo abelii]
 ref|XP_010361221.1| PREDICTED: 26S protease regulatory subunit 4 [Rhinopithecus roxellana]
 ref|XP_010372145.1| PREDICTED: 26S protease regulatory subunit 4 [Rhinopithecus roxellana]
 ref|XP_010387196.1| PREDICTED: 26S protease regulatory subunit 4 [Rhinopithecus roxellana]
 ref|XP_010357338.1| PREDICTED: 26S protease regulatory subunit 4 [Rhinopithecus roxellana]
 ref|XP_010614594.1| PREDICTED: 26S protease regulatory subunit 4 [Fukomys damarensis]
 ref|XP_010587104.1| PREDICTED: 26S protease regulatory subunit 4 [Loxodonta africana]
 ref|XP_010843484.1| PREDICTED: 26S protease regulatory subunit 4 [Bison bison bison]
 ref|XP_010966985.1| PREDICTED: 26S protease regulatory subunit 4 [Camelus bactrianus]
 ref|XP_010986547.1| PREDICTED: 26S protease regulatory subunit 4 [Camelus dromedarius]
 sp|P62193.1|PRS4_RAT RecName: Full=26S protease regulatory subunit 4; Short=P26s4; 
AltName: Full=26S proteasome AAA-ATPase subunit RPT2; AltName: 
Full=Proteasome 26S subunit ATPase 1 [Rattus norvegicus]
 sp|P62191.1|PRS4_HUMAN RecName: Full=26S protease regulatory subunit 4; Short=P26s4; 
AltName: Full=26S proteasome AAA-ATPase subunit RPT2; AltName: 
Full=Proteasome 26S subunit ATPase 1 [Homo sapiens]
 sp|P62192.1|PRS4_MOUSE RecName: Full=26S protease regulatory subunit 4; Short=P26s4; 
AltName: Full=26S proteasome AAA-ATPase subunit RPT2; AltName: 
Full=Proteasome 26S subunit ATPase 1 [Mus musculus]
 gb|AAB34137.1| P26s4 [Mus musculus]
 dbj|BAA09341.1| proteasomal ATPase (S4) [Rattus norvegicus]
 gb|AAH00512.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Homo 
sapiens]
 gb|AAH03860.1| Protease (prosome, macropain) 26S subunit, ATPase 1 [Mus musculus]
 dbj|BAC40339.1| unnamed protein product [Mus musculus]
 gb|AAP88828.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Homo 
sapiens]
 gb|AAH63157.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Rattus 
norvegicus]
 emb|CAG33325.1| PSMC1 [Homo sapiens]
 gb|AAH73818.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Homo 
sapiens]
 gb|AAX41701.1| proteasome 26S subunit 1 [synthetic construct]
 gb|AAX41702.1| proteasome 26S subunit 1 [synthetic construct]
 gb|AAX41703.1| proteasome 26S subunit 1 [synthetic construct]
 dbj|BAE40812.1| unnamed protein product [Mus musculus]
 dbj|BAE39016.1| unnamed protein product [Mus musculus]
 dbj|BAE36506.1| unnamed protein product [Mus musculus]
 dbj|BAE28695.1| unnamed protein product [Mus musculus]
 dbj|BAE21929.1| unnamed protein product [Mus musculus]
 emb|CAJ83548.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Xenopus 
(Silurana) tropicalis]
 gb|EAW81419.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1, isoform 
CRA_a [Homo sapiens]
 gb|ABM82629.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [synthetic 
construct]
 gb|ABM85807.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [synthetic 
construct]
 gb|AAI23488.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Bos taurus]
 gb|EDL18904.1| mCG122657 [Mus musculus]
 gb|EDL81712.1| peptidase (prosome, macropain) 26S subunit, ATPase 1 [Rattus 
norvegicus]
 dbj|BAG36130.1| unnamed protein product [Homo sapiens]
 dbj|BAG70125.1| proteasome 26S ATPase subunit 1 [Homo sapiens]
 dbj|BAG70255.1| proteasome 26S ATPase subunit 1 [Homo sapiens]
 dbj|BAG72708.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [synthetic 
construct]
 tpg|DAA25005.1| TPA: proteasome 26S ATPase subunit 1 [Bos taurus]
 gb|AIC54978.1| PSMC1, partial [synthetic construct]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_010780333.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Notothenia 
coriiceps]
 ref|XP_010780334.1| PREDICTED: 26S protease regulatory subunit 4 isoform X2 [Notothenia 
coriiceps]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>gb|EGI70823.1| 26S protease regulatory subunit 4 [Acromyrmex echinatior]
Length=439

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  223  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  282

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  283  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  318



>ref|XP_004083702.1| PREDICTED: 26S protease regulatory subunit 4-like [Oryzias latipes]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_007253845.1| PREDICTED: 26S protease regulatory subunit 4-like isoform X1 
[Astyanax mexicanus]
 ref|XP_007253846.1| PREDICTED: 26S protease regulatory subunit 4-like isoform X2 
[Astyanax mexicanus]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>dbj|BAD96388.1| proteasome 26S ATPase subunit 1 variant [Homo sapiens]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_005992765.1| PREDICTED: 26S protease regulatory subunit 4 [Latimeria chalumnae]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>gb|AAH16368.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Homo 
sapiens]
 gb|AIC54977.1| PSMC1, partial [synthetic construct]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>gb|EZA51286.1| 26S protease regulatory subunit [Cerapachys biroi]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_006042318.1| PREDICTED: 26S protease regulatory subunit 4 [Bubalus bubalis]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_003987959.1| PREDICTED: 26S protease regulatory subunit 4 [Felis catus]
 ref|XP_007095030.1| PREDICTED: 26S protease regulatory subunit 4 [Panthera tigris 
altaica]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|NP_001271694.1| uncharacterized protein LOC101925039 [Macaca fascicularis]
 dbj|BAE01644.1| unnamed protein product [Macaca fascicularis]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_010876963.1| PREDICTED: 26S protease regulatory subunit 4 [Esox lucius]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>gb|EHB02601.1| 26S protease regulatory subunit 4, partial [Heterocephalus glaber]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_009951400.1| PREDICTED: 26S protease regulatory subunit 4, partial [Leptosomus 
discolor]
 ref|XP_010172100.1| PREDICTED: 26S protease regulatory subunit 4, partial [Caprimulgus 
carolinensis]
 gb|KFM08568.1| 26S protease regulatory subunit 4, partial [Aptenodytes forsteri]
 gb|KFP53065.1| 26S protease regulatory subunit 4, partial [Cathartes aura]
 gb|KFP99330.1| 26S protease regulatory subunit 4, partial [Leptosomus discolor]
 gb|KFQ01595.1| 26S protease regulatory subunit 4, partial [Haliaeetus albicilla]
 gb|KFU94221.1| 26S protease regulatory subunit 4, partial [Chaetura pelagica]
 gb|KFV74889.1| 26S protease regulatory subunit 4, partial [Struthio camelus 
australis]
 gb|KFZ48252.1| 26S protease regulatory subunit 4, partial [Caprimulgus carolinensis]
Length=439

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  223  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  282

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  283  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  318



>ref|XP_010880812.1| PREDICTED: 26S protease regulatory subunit 4-like [Esox lucius]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>gb|AAI54337.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 1a [Danio 
rerio]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|NP_001014855.1| 26S protease regulatory subunit 4 [Bos taurus]
 gb|AAX09000.1| proteasome 26S ATPase subunit 1 [Bos taurus]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_001103312.1| PREDICTED: 26S protease regulatory subunit 4-like [Macaca mulatta]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|NP_956327.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Danio 
rerio]
 gb|AAH49471.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 1a [Danio 
rerio]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_004363832.1| proteasome 26S subunit [Capsaspora owczarzaki ATCC 30864]
 gb|EFW44987.1| proteasome 26S subunit [Capsaspora owczarzaki ATCC 30864]
Length=449

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  233  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  292

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  293  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  328



>emb|CAG00116.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_010348883.1| PREDICTED: 26S protease regulatory subunit 4 [Saimiri boliviensis 
boliviensis]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_007180940.1| PREDICTED: 26S protease regulatory subunit 4 isoform X1 [Balaenoptera 
acutorostrata scammoni]
Length=442

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  226  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  285

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  286  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  321



>ref|XP_003440735.1| PREDICTED: 26S protease regulatory subunit 4-like [Oreochromis 
niloticus]
 ref|XP_003971504.1| PREDICTED: 26S protease regulatory subunit 4-like [Takifugu rubripes]
 ref|XP_004542305.1| PREDICTED: 26S protease regulatory subunit 4-like [Maylandia 
zebra]
 ref|XP_005917148.1| PREDICTED: 26S protease regulatory subunit 4-like [Haplochromis 
burtoni]
 ref|XP_007568997.1| PREDICTED: 26S protease regulatory subunit 4 [Poecilia formosa]
 ref|XP_008282305.1| PREDICTED: 26S protease regulatory subunit 4 [Stegastes partitus]
 ref|XP_008396443.1| PREDICTED: 26S protease regulatory subunit 4 [Poecilia reticulata]
 ref|XP_010755249.1| PREDICTED: 26S protease regulatory subunit 4 [Larimichthys crocea]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|NP_001002091.1| proteasome (prosome, macropain) 26S subunit, ATPase, 1b [Danio 
rerio]
 gb|AAH71538.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 1b [Danio 
rerio]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGAPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>gb|AAH67741.1| Proteasome (prosome, macropain) 26S subunit, ATPase, 1 [Homo 
sapiens]
 gb|AIC63128.1| PSMC1, partial [synthetic construct]
Length=440

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>gb|ELW48702.1| 26S protease regulatory subunit 4 [Tupaia chinensis]
Length=426

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  210  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  269

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  270  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  305



>gb|EFN79932.1| 26S protease regulatory subunit 4 [Harpegnathos saltator]
Length=486

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  270  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  329

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  330  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  365



>gb|EPQ10744.1| 26S protease regulatory subunit 4 [Myotis brandtii]
Length=456

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  240  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  299

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  300  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  335



>emb|CCA21636.1| 26S proteasome AAAATPase subunit RPT2a putative [Albugo laibachii 
Nc14]
Length=442

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRE+FRVA++L+P+IVF
Sbjct  226  LYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVREMFRVAEDLAPSIVF  285

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVG+KRYD++SGG REIQRTMLELLNQLDGF
Sbjct  286  IDEIDAVGSKRYDSNSGGTREIQRTMLELLNQLDGF  321



>emb|CCI47533.1| unnamed protein product [Albugo candida]
Length=442

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/96 (90%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYGEPGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRE+FRVA++L+P+IVF
Sbjct  226  LYGEPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVREMFRVAEDLAPSIVF  285

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVG+KRYD++SGG REIQRTMLELLNQLDGF
Sbjct  286  IDEIDAVGSKRYDSNSGGTREIQRTMLELLNQLDGF  321



>ref|XP_006028418.1| PREDICTED: 26S protease regulatory subunit 4 [Alligator sinensis]
Length=454

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  238  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  297

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  298  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  333



>gb|ERG79797.1| putative 26s protease regulatory subunit 4 [Ascaris suum]
Length=443

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPK+VRELFRVA+E +P+IVF
Sbjct  227  LYGSPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKMVRELFRVAEEHAPSIVF  286

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  287  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  322



>ref|XP_009688138.1| PREDICTED: 26S protease regulatory subunit 4 [Struthio camelus 
australis]
Length=454

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  238  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  297

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  298  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  333



>ref|XP_001604655.1| PREDICTED: 26S protease regulatory subunit 4 [Nasonia vitripennis]
Length=464

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDAVGTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_003214402.1| PREDICTED: 26S protease regulatory subunit 4 [Anolis carolinensis]
 ref|XP_005483210.1| PREDICTED: 26S protease regulatory subunit 4 [Zonotrichia albicollis]
 ref|XP_005520253.1| PREDICTED: 26S protease regulatory subunit 4 [Pseudopodoces humilis]
Length=440

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



>ref|XP_008049593.1| PREDICTED: 26S protease regulatory subunit 4 [Tarsius syrichta]
Length=440

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/96 (91%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = -2

Query  288  LYGEPGTGKTLLAKAVANSTSATFLRVVGSELIQKYLGDGPKLVRELFRVADELSPAIVF  109
            LYG PGTGKTLLAKAVAN TSATFLRVVGSELIQKYLGDGPKLVRELFRVA+E +P+IVF
Sbjct  224  LYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVF  283

Query  108  IDEIDAVGTKRYDAHSGGEREIQRTMLELLNQLDGF  1
            IDEIDA+GTKRYD++SGGEREIQRTMLELLNQLDGF
Sbjct  284  IDEIDAIGTKRYDSNSGGEREIQRTMLELLNQLDGF  319



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 507655145520