BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16407_g1_i2 len=506 path=[1858:0-162 2021:163-505]

Length=506
                                                                      Score     E

ref|XP_009621350.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    239   1e-73   
ref|XP_009792964.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    228   2e-69   
emb|CDP07485.1|  unnamed protein product                                219   9e-66   
ref|XP_011048791.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    218   1e-65   
ref|XP_011083655.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    219   1e-65   
ref|XP_011083654.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    219   3e-65   
ref|XP_002306883.1|  hypothetical protein POPTR_0005s25180g             212   2e-63   Populus trichocarpa [western balsam poplar]
ref|XP_010664715.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    211   1e-62   
emb|CBI19737.3|  unnamed protein product                                211   2e-62   
ref|XP_004238270.2|  PREDICTED: inositol-pentakisphosphate 2-kinase     210   2e-62   
ref|XP_008359763.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    212   2e-62   
gb|KDP38543.1|  hypothetical protein JCGZ_04468                         208   9e-62   
ref|XP_009365515.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    208   1e-61   
ref|XP_009365516.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    208   1e-61   
tpg|DAA64567.1|  TPA: inositol-pentakisphosphate 2-kinase 450           207   4e-61   
tpg|DAA64568.1|  TPA: inositol-pentakisphosphate 2-kinase 452           207   4e-61   
ref|XP_010254763.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    206   5e-61   
emb|CAN76214.1|  hypothetical protein VITISV_009512                     211   6e-61   Vitis vinifera
ref|XP_004160062.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    202   1e-60   
ref|XP_010254762.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    206   1e-60   
ref|XP_010254756.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    206   2e-60   
tpg|DAA64569.1|  TPA: inositol-pentakisphosphate 2-kinase 555           207   2e-60   
ref|XP_009365518.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    207   2e-60   
ref|XP_006341967.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    202   2e-60   
ref|XP_010110041.1|  Inositol-pentakisphosphate 2-kinase                207   5e-60   
ref|XP_008220840.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    204   5e-60   
ref|XP_008347365.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    202   8e-60   
ref|XP_010540332.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    202   9e-60   
ref|XP_008347364.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    202   1e-59   
ref|XP_006341966.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    202   1e-59   
ref|XP_008377206.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    202   2e-59   
ref|XP_008444741.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    202   2e-59   
ref|XP_002510425.1|  Inositol-pentakisphosphate 2-kinase, putative      207   2e-59   Ricinus communis
ref|XP_004154853.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    202   3e-59   
ref|XP_010540330.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    202   3e-59   
ref|XP_004152686.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    202   3e-59   
ref|XP_004291851.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    201   5e-59   
ref|XP_008220842.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    203   5e-59   
gb|EYU32907.1|  hypothetical protein MIMGU_mgv1a006028mg                201   6e-59   
ref|XP_007223293.1|  hypothetical protein PRUPE_ppa005582mg             201   8e-59   
ref|XP_008466533.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    201   8e-59   
gb|KHG28547.1|  Inositol-pentakisphosphate 2-kinase -like protein       202   8e-59   
ref|XP_003528009.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    201   1e-58   
ref|XP_002302020.2|  hypothetical protein POPTR_0002s03430g             200   1e-58   Populus trichocarpa [western balsam poplar]
gb|KHN22235.1|  Inositol-pentakisphosphate 2-kinase                     200   1e-58   
ref|XP_004147852.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    200   1e-58   
gb|KHG30015.1|  Inositol-pentakisphosphate 2-kinase -like protein       201   2e-58   
ref|XP_008377208.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    202   2e-58   
gb|KHN45871.1|  Inositol-pentakisphosphate 2-kinase                     199   3e-58   
ref|XP_003523790.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    199   3e-58   
gb|EYU45129.1|  hypothetical protein MIMGU_mgv1a006036mg                199   4e-58   
ref|XP_002865479.1|  inositol-pentakisphosphate 2-kinase 1              197   1e-57   
gb|KDO84622.1|  hypothetical protein CISIN_1g0134841mg                  194   2e-57   
emb|CDY38844.1|  BnaC08g20180D                                          193   4e-57   
ref|XP_004500991.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    196   5e-57   
ref|XP_004500990.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    196   6e-57   
ref|XP_006403344.1|  hypothetical protein EUTSA_v10003206mg             196   6e-57   
ref|XP_006416232.1|  hypothetical protein EUTSA_v10007647mg             195   9e-57   
emb|CDY52373.1|  BnaA09g15720D                                          195   1e-56   
ref|XP_011029078.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    197   2e-56   
ref|XP_006473539.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    194   2e-56   
gb|KEH36181.1|  inositol-pentakisphosphate 2-kinase-like protein        194   2e-56   
ref|XP_009114034.1|  PREDICTED: inositol-pentakisphosphate 2-kinase     194   2e-56   
ref|XP_009110150.1|  PREDICTED: inositol-pentakisphosphate 2-kinase     194   2e-56   
gb|KEH36180.1|  inositol-pentakisphosphate 2-kinase-like protein        194   2e-56   
emb|CDY41494.1|  BnaA08g20960D                                          194   2e-56   
ref|XP_008219053.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    194   2e-56   
ref|XP_010459951.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    193   5e-56   
ref|XP_006435038.1|  hypothetical protein CICLE_v10001170mg             192   1e-55   
ref|XP_007136627.1|  hypothetical protein PHAVU_009G060100g             192   1e-55   
ref|XP_006280454.1|  hypothetical protein CARUB_v10026386mg             191   4e-55   
gb|KFK31811.1|  hypothetical protein AALP_AA6G161800                    191   4e-55   
emb|CDX95152.1|  BnaC09g17180D                                          191   5e-55   
ref|XP_010477465.1|  PREDICTED: inositol-pentakisphosphate 2-kinase     191   6e-55   
ref|XP_010445901.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    189   1e-54   
ref|XP_010673136.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    190   1e-54   
ref|XP_010494238.1|  PREDICTED: inositol-pentakisphosphate 2-kinase     190   1e-54   
ref|XP_010498671.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    188   3e-54   
ref|XP_006306470.1|  hypothetical protein CARUB_v10012434mg             187   8e-54   
ref|XP_002893210.1|  hypothetical protein ARALYDRAFT_313098             187   1e-53   
dbj|BAB10637.1|  unnamed protein product                                184   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009389920.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    186   3e-53   
gb|ABK28408.1|  unknown                                                 185   5e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173629.2|  Inositol-pentakisphosphate 2-kinase family protein    185   5e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AHZ62755.1|  inositol 1,3,4,5,6-pentakisphosphate 2-kinase           185   6e-53   
gb|AAF86558.1|AC069252_17  F2E2.17                                      185   9e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006827390.1|  hypothetical protein AMTR_s00011p00177280          184   1e-52   
ref|NP_568613.1|  inositol-pentakisphosphate 2-kinase 1                 184   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009390179.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    183   4e-52   
ref|XP_009390180.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    183   4e-52   
ref|XP_010481940.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    183   5e-52   
pdb|4AXC|A  Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinas...    182   6e-52   
pdb|2XAL|A  Chain A, Lead Derivative Of Inositol 1,3,4,5,6-Pentak...    182   7e-52   
pdb|4AXE|A  Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinas...    182   8e-52   
gb|EPS63025.1|  hypothetical protein M569_11760                         182   8e-52   
ref|XP_010940105.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    182   1e-51   
pdb|4AXD|A  Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinas...    182   1e-51   
ref|XP_010940107.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    182   1e-51   
pdb|3UDZ|A  Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinas...    182   1e-51   
pdb|3UDS|A  Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinas...    182   1e-51   
pdb|4LV7|A  Chain A, Crystal Structure Of Inositol 1,3,4,5,6-pent...    182   2e-51   
pdb|4AQK|A  Chain A, Inositol 1,3,4,5,6-pentakisphosphate 2-kinas...    181   2e-51   
ref|XP_004499186.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    181   5e-51   
ref|XP_004499187.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    180   5e-51   
ref|XP_004499185.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    181   5e-51   
ref|XP_007227480.1|  hypothetical protein PRUPE_ppa006527mg             178   1e-50   
ref|XP_008795958.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    176   6e-50   
ref|XP_008795955.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    176   2e-49   
ref|XP_008795949.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    176   3e-49   
gb|KEH40178.1|  inositol-pentakisphosphate 2-kinase-like protein        174   9e-49   
ref|XP_010061286.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    174   1e-48   
ref|XP_010240557.1|  PREDICTED: inositol-pentakisphosphate 2-kinase     174   1e-48   
gb|KEH40179.1|  inositol-pentakisphosphate 2-kinase-like protein        174   1e-48   
ref|XP_010539889.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    172   2e-48   
gb|AGZ03654.1|  inositol pentakisphosphate 2-kinase                     174   2e-48   
ref|NP_001237433.1|  inositol pentakisphosphate 2-kinase                173   2e-48   
ref|NP_001054147.1|  Os04g0661200                                       173   2e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007160728.1|  hypothetical protein PHAVU_001G012200g             173   2e-48   
emb|CAH67064.1|  H0112G12.9                                             173   2e-48   Oryza sativa [red rice]
ref|XP_010539888.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    172   3e-48   
ref|XP_007160729.1|  hypothetical protein PHAVU_001G012200g             173   4e-48   
ref|NP_564736.1|  Inositol-pentakisphosphate 2-kinase-like protein      173   5e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010539886.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    172   6e-48   
gb|AEM36353.1|  At1g59312                                               172   7e-48   
dbj|BAG68917.1|  hypothetical protein                                   171   2e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CAM33431.1|  Ins5P-2kinase                                          167   7e-47   Phaseolus vulgaris [French bean]
ref|XP_002888206.1|  hypothetical protein ARALYDRAFT_475379             168   3e-46   
ref|XP_006302305.1|  hypothetical protein CARUB_v10020353mg             165   1e-45   
ref|XP_004960165.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    164   1e-44   
ref|XP_010511060.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    163   1e-44   
ref|XP_010414720.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    163   2e-44   
ref|XP_006652958.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    161   6e-44   
dbj|BAJ91392.1|  predicted protein                                      161   6e-44   
ref|XP_010474037.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    159   5e-43   
ref|NP_001183320.1|  uncharacterized protein LOC100501721               160   5e-43   
tpg|DAA35552.1|  TPA: hypothetical protein ZEAMMB73_927289              160   5e-43   
gb|AFW59738.1|  inositol 1,3,4,5,6-pentakisphosphate 2-kinase           157   6e-43   
ref|XP_010414722.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    158   8e-43   
gb|EMT22168.1|  Inositol-pentakisphosphate 2-kinase                     158   1e-42   
ref|NP_001106063.1|  LOC100126363                                       157   1e-42   Zea mays [maize]
gb|AFW59740.1|  inositol 1,3,4,5,6-pentakisphosphate 2-kinase iso...    157   2e-42   
ref|NP_001106053.1|  inositol polyphosphate 2-kinase                    157   2e-42   Zea mays [maize]
gb|ABK24850.1|  unknown                                                 135   3e-34   Picea sitchensis
ref|XP_008795956.1|  PREDICTED: inositol-pentakisphosphate 2-kina...    132   3e-33   
ref|XP_002992945.1|  hypothetical protein SELMODRAFT_136205             115   3e-27   
ref|XP_002980010.1|  hypothetical protein SELMODRAFT_111972             115   4e-27   
ref|XP_001757602.1|  predicted protein                                  112   5e-26   
emb|CDP17915.1|  unnamed protein product                                108   1e-25   
ref|XP_001761338.1|  predicted protein                                  107   3e-24   
gb|AEM36351.1|  At1g58936-like protein                                93.6    2e-20   
tpg|DAA64566.1|  TPA: non-functional inositol-pentakisphosphate 2...  89.4    3e-18   
ref|XP_008795957.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  88.2    1e-17   
ref|XP_004349251.1|  hypothetical protein CAOG_02501                  81.3    7e-15   
ref|XP_005832271.1|  hypothetical protein GUITHDRAFT_108933           76.3    3e-13   
dbj|GAM24665.1|  hypothetical protein SAMD00019534_078400             73.9    2e-12   
ref|XP_007017602.1|  Inositol-pentakisphosphate 2-kinase 1, putat...  68.6    1e-10   
ref|XP_007017601.1|  Inositol-pentakisphosphate 2-kinase family p...  68.2    2e-10   
emb|CCI44944.1|  unnamed protein product                              62.4    3e-08   
gb|EJW78215.1|  hypothetical protein WUBG_10877                       60.1    4e-08   
ref|XP_008199701.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  60.5    8e-08   
ref|XP_003294485.1|  hypothetical protein DICPUDRAFT_43505            60.5    8e-08   
ref|XP_002287547.1|  predicted protein                                60.1    1e-07   Thalassiosira pseudonana CCMP1335
ref|XP_003141648.1|  hypothetical protein LOAG_06064                  58.9    2e-07   
emb|CDQ05695.1|  Protein Bm6305, isoform b                            58.9    3e-07   
emb|CCA21884.1|  conserved hypothetical protein                       58.9    3e-07   
ref|XP_009823933.1|  hypothetical protein H257_02125                  58.2    4e-07   
emb|CBN74385.1|  conserved unknown protein                            57.8    6e-07   
gb|ELU02473.1|  hypothetical protein CAPTEDRAFT_191375                57.8    6e-07   
emb|CDY00419.1|  BnaC07g14070D                                        56.6    8e-07   
ref|XP_002074949.1|  GK23328                                          57.4    9e-07   Drosophila willistoni
ref|XP_008479233.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   57.0    1e-06   
ref|NP_001014346.1|  inositol-pentakisphosphate 2-kinase              57.0    1e-06   Danio rerio [leopard danio]
ref|XP_007322116.1|  hypothetical protein SERLADRAFT_475955           56.6    1e-06   
gb|AAY79345.1|  inositol 1,3,4,5,6-pentakisphosphate 2-kinase         56.6    1e-06   Danio rerio [leopard danio]
sp|Q4JL91.3|IPPK_DANRE  RecName: Full=Inositol-pentakisphosphate ...  56.6    1e-06   Danio rerio [leopard danio]
ref|XP_002631799.1|  Hypothetical protein CBG21018                    55.8    2e-06   Caenorhabditis briggsae
gb|EFA81684.1|  hypothetical protein PPL_05678                        55.8    3e-06   Polysphondylium pallidum PN500
emb|CAP37932.2|  Protein CBG21018                                     55.8    3e-06   Caenorhabditis briggsae
ref|NP_496564.2|  Protein Y17G7B.13                                   55.5    3e-06   Caenorhabditis elegans [roundworm]
ref|XP_004647610.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   54.7    6e-06   
gb|ETN60510.1|  hypothetical protein AND_007864                       54.7    7e-06   
ref|XP_003113660.1|  hypothetical protein CRE_26086                   54.3    8e-06   
gb|KFH73726.1|  hypothetical protein MVEG_00940                       54.3    9e-06   
ref|XP_010834292.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  53.9    1e-05   
ref|XP_006063159.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  53.9    1e-05   
ref|XP_007229670.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.5    1e-05   
gb|EYC08479.1|  hypothetical protein Y032_0065g3576                   53.5    2e-05   
emb|CDJ91583.1|  Inositol-pentakisphosphate 2-kinase domain conta...  53.5    2e-05   
emb|CBK22859.2|  unnamed protein product                              51.2    2e-05   
gb|EYC08478.1|  hypothetical protein Y032_0065g3576                   53.5    2e-05   
ref|XP_010018096.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.1    2e-05   
ref|XP_005141642.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   53.1    2e-05   
ref|XP_008769756.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.8    2e-05   
ref|XP_009905956.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.8    2e-05   
gb|KFV73789.1|  Inositol-pentakisphosphate 2-kinase                   52.8    3e-05   
ref|XP_008318919.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.8    3e-05   
ref|XP_008577572.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.8    3e-05   
gb|EDL98114.1|  inositol 1,3,4,5,6-pentakisphosphate 2-kinase         52.8    3e-05   
ref|NP_001008556.1|  inositol-pentakisphosphate 2-kinase              52.8    3e-05   Rattus norvegicus [brown rat]
ref|XP_005066372.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.8    3e-05   
ref|XP_005408970.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.8    3e-05   
ref|XP_003505388.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.4    3e-05   
ref|XP_007506451.1|  PREDICTED: uncharacterized protein LOC100030309  52.8    4e-05   
ref|XP_005408971.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.4    4e-05   
ref|XP_004209697.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.4    4e-05   
ref|XP_007617413.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.4    4e-05   
gb|ERE78538.1|  inositol-pentakisphosphate 2-kinase                   52.4    4e-05   
ref|XP_006025938.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.4    4e-05   
ref|XP_006261188.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.4    4e-05   
ref|XP_004898275.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.0    4e-05   
ref|XP_003748212.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.0    5e-05   
ref|XP_006992344.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.0    5e-05   
ref|XP_010608886.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.0    5e-05   
ref|XP_004652359.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.0    5e-05   
ref|XP_005355230.1|  PREDICTED: LOW QUALITY PROTEIN: inositol-pen...  52.0    5e-05   
ref|XP_010973179.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.0    5e-05   
ref|XP_007428725.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   52.0    5e-05   
gb|ERG81447.1|  inositol-pentakisphosphate 2-kinase                   52.0    5e-05   
ref|XP_010608887.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  52.0    6e-05   
ref|XP_003468284.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   51.6    6e-05   
ref|XP_006517044.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  51.2    7e-05   
ref|XP_010873347.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  51.6    7e-05   
ref|XP_010873338.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  51.6    7e-05   
ref|XP_003251884.2|  PREDICTED: uncharacterized protein LOC100576733  51.6    7e-05   
ref|XP_007907076.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   51.6    7e-05   
ref|XP_008851096.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   51.6    8e-05   
ref|XP_008865587.1|  hypothetical protein H310_03491                  51.6    8e-05   
ref|NP_001263328.1|  inositol-pentakisphosphate 2-kinase isoform b    51.6    8e-05   
ref|XP_006625233.1|  PREDICTED: uncharacterized protein LOC102678697  51.2    8e-05   
dbj|BAE20447.1|  unnamed protein product                              51.2    8e-05   Mus musculus [mouse]
ref|NP_951011.1|  inositol-pentakisphosphate 2-kinase isoform a       51.2    9e-05   Mus musculus [mouse]
ref|XP_008053337.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   51.2    9e-05   
ref|XP_007529252.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   51.2    9e-05   
ref|XP_001987591.1|  GH22003                                          51.6    9e-05   Drosophila grimshawi
ref|XP_005605221.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   51.2    9e-05   
gb|AAH24630.1|  Ippk protein                                          51.2    9e-05   Mus musculus [mouse]
ref|XP_006717298.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.8    9e-05   
ref|XP_006161538.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   51.2    9e-05   
ref|XP_004351454.1|  hypothetical protein DFA_10812                   51.2    1e-04   
ref|XP_004384280.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   51.2    1e-04   
gb|EDL41077.1|  inositol 1,3,4,5,6-pentakisphosphate 2-kinase, is...  51.2    1e-04   
ref|XP_008689206.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.8    1e-04   
ref|NP_001286649.1|  Ipk1, isoform D                                  51.2    1e-04   
ref|XP_007951203.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   51.2    1e-04   
ref|XP_005469745.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  51.2    1e-04   
ref|XP_004717792.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   51.2    1e-04   
ref|XP_002128315.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.8    1e-04   Ciona intestinalis [sea vase]
ref|NP_001261111.1|  Ipk1, isoform C                                  51.2    1e-04   
ref|XP_002039668.1|  GM15781                                          51.2    1e-04   Drosophila sechellia
ref|XP_006750592.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.8    1e-04   
ref|XP_006876833.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.8    1e-04   
ref|NP_001097387.1|  Ipk1, isoform B                                  51.2    1e-04   Drosophila melanogaster
ref|XP_005469746.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.8    1e-04   
ref|XP_002082390.1|  GD11544                                          51.2    1e-04   Drosophila simulans
ref|XP_010598946.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.8    1e-04   
ref|XP_005320928.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.8    1e-04   
ref|XP_003421137.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.8    1e-04   
ref|XP_002820003.2|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.8    1e-04   
ref|XP_006900784.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.8    1e-04   
ref|NP_073592.1|  inositol-pentakisphosphate 2-kinase                 50.8    1e-04   Homo sapiens [man]
ref|XP_003938248.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.8    1e-04   
ref|XP_004766196.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.8    1e-04   
ref|XP_001146962.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.8    1e-04   Pan troglodytes
ref|XP_009187460.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.8    1e-04   
ref|XP_002004261.1|  GI19706                                          50.8    1e-04   Drosophila mojavensis
ref|XP_002927737.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.8    1e-04   
ref|XP_008991345.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.8    1e-04   
ref|XP_001974968.1|  GG22064                                          50.8    1e-04   Drosophila erecta
ref|XP_002671419.1|  predicted protein                                50.8    1e-04   Naegleria gruberi strain NEG-M
ref|XP_010373400.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.8    1e-04   
ref|XP_005309394.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.8    1e-04   
ref|XP_004442787.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.8    1e-04   
ref|XP_003795089.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.8    1e-04   
gb|ELV14098.1|  Inositol-pentakisphosphate 2-kinase                   50.8    1e-04   
dbj|BAB14866.1|  unnamed protein product                              50.8    1e-04   Homo sapiens [man]
ref|XP_008255083.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.8    1e-04   
ref|XP_003807884.2|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.8    1e-04   
ref|XP_004803040.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.8    1e-04   
ref|XP_003697154.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.8    1e-04   
ref|XP_004393629.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.8    1e-04   
ref|XP_007097410.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.8    1e-04   
ref|XP_002413625.1|  inositol-pentakisphosphate 2-kinase, putative    50.4    1e-04   
ref|XP_004684558.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.8    1e-04   
ref|XP_003260534.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.8    1e-04   
ref|XP_002708272.2|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.4    2e-04   
ref|XP_010347105.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.4    2e-04   
ref|XP_007967932.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.4    2e-04   
ref|XP_005582306.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.4    2e-04   
ref|XP_003912033.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.4    2e-04   
ref|XP_001103030.2|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.4    2e-04   
ref|XP_003481164.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.4    2e-04   
ref|XP_008532633.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.4    2e-04   
ref|XP_010373399.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.4    2e-04   
ref|XP_009187461.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.4    2e-04   
ref|XP_006783025.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.4    2e-04   
ref|NP_611522.1|  Ipk1, isoform A                                     50.4    2e-04   
ref|XP_541331.3|  PREDICTED: inositol-pentakisphosphate 2-kinase      50.4    2e-04   
ref|XP_002059420.1|  GJ17425                                          50.4    2e-04   
gb|KDR21258.1|  Inositol-pentakisphosphate 2-kinase                   50.1    2e-04   
gb|EGN95632.1|  hypothetical protein SERLA73DRAFT_186748              50.1    2e-04   
ref|XP_005917853.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.1    2e-04   
ref|XP_006631161.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.1    2e-04   
ref|XP_004620164.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.1    2e-04   
ref|XP_005749523.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.1    2e-04   
ref|XP_004547453.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  50.1    2e-04   
ref|NP_001072748.1|  inositol-pentakisphosphate 2-kinase              50.1    2e-04   
ref|XP_006127629.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   50.1    3e-04   
ref|XP_003731799.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  49.7    3e-04   
ref|XP_010124478.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.7    3e-04   
gb|KFP37126.1|  Inositol-pentakisphosphate 2-kinase                   49.7    3e-04   
ref|XP_008155090.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.7    3e-04   
ref|XP_005881722.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.7    3e-04   
ref|XP_004598876.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.7    3e-04   
ref|XP_006102265.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.7    3e-04   
ref|XP_010965811.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.7    3e-04   
ref|XP_003124839.3|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.7    3e-04   
ref|XP_010834291.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  49.7    3e-04   
ref|XP_005901898.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.7    3e-04   
ref|XP_009558705.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.7    3e-04   
ref|XP_010196037.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    3e-04   
ref|XP_007182449.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  49.3    3e-04   
gb|ELR51986.1|  Inositol-pentakisphosphate 2-kinase                   49.7    3e-04   
ref|XP_006063158.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  49.7    3e-04   
ref|XP_004284162.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.7    3e-04   
ref|XP_005684285.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.7    3e-04   
ref|XP_599340.3|  PREDICTED: inositol-pentakisphosphate 2-kinase ...  49.7    3e-04   
ref|XP_004322141.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.7    3e-04   
ref|XP_006773371.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.7    3e-04   
ref|XP_004004122.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.7    3e-04   
ref|XP_010834294.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  49.7    3e-04   
ref|XP_007111364.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  49.7    3e-04   
gb|KFQ78994.1|  Inositol-pentakisphosphate 2-kinase                   49.3    3e-04   
gb|KFM04403.1|  Inositol-pentakisphosphate 2-kinase                   49.3    3e-04   
ref|XP_002689884.1|  PREDICTED: LOW QUALITY PROTEIN: inositol-pen...  49.7    3e-04   
ref|XP_007111365.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  49.3    4e-04   
ref|XP_009272892.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_005052966.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  49.3    4e-04   
ref|XP_006209281.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_006190072.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|KFV04424.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_007182450.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  49.3    4e-04   
ref|XP_005971608.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_005522267.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|KFO69300.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
gb|EOA96981.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_010084762.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|ELK03394.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_007468229.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_005444501.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_009089470.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_009327549.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_003995355.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_009995247.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_009986164.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_009864002.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|KFU89078.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_005025686.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_009067909.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|KFP75171.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_010210590.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_009686404.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  49.3    4e-04   
gb|KFW08258.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
gb|KFV19014.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_004526563.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  49.3    4e-04   
ref|XP_009686403.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  49.3    4e-04   
gb|KFW70788.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
gb|KFO14592.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_009482726.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_005229988.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|KFW74720.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_010308274.1|  PREDICTED: LOW QUALITY PROTEIN: inositol-pen...  49.3    4e-04   
gb|KFV88066.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_008922223.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_009808930.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|KFP14189.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_010388612.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_009500521.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|KFQ62017.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_009579832.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_002193083.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|KFQ36280.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_009919472.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_009634947.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|KFP67011.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_008945439.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_005485664.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|KFP85258.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_010172672.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|KFZ64525.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_006822470.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  48.9    4e-04   
ref|XP_009702503.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|KFP47712.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_009475003.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_008634296.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|KEP55489.1|  inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_006922874.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|KFO60949.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
ref|XP_005422535.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|KFQ92752.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
gb|KFQ05855.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
gb|KFZ68400.1|  Inositol-pentakisphosphate 2-kinase                   48.9    4e-04   
ref|XP_005508939.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
ref|XP_009974712.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    4e-04   
gb|KGL86224.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
gb|KFP04825.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
gb|EMC83989.1|  Inositol-pentakisphosphate 2-kinase                   49.3    4e-04   
gb|EGT41347.1|  hypothetical protein CAEBREN_01818                    49.3    4e-04   
gb|KFQ68100.1|  Inositol-pentakisphosphate 2-kinase                   49.3    5e-04   
ref|XP_009944676.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    5e-04   
ref|XP_010143623.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    5e-04   
gb|KFQ39628.1|  Inositol-pentakisphosphate 2-kinase                   49.3    5e-04   
ref|XP_008497244.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   49.3    5e-04   
gb|KHN87952.1|  Inositol-pentakisphosphate 2-kinase                   48.9    5e-04   
ref|XP_005052965.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  48.9    5e-04   
ref|XP_009879656.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   48.9    5e-04   
ref|XP_010188744.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   48.9    5e-04   
gb|EUC66300.1|  inositol-pentakisphosphate 2-kinase                   48.9    5e-04   
ref|XP_010289716.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   48.9    5e-04   
gb|EGT48174.1|  hypothetical protein CAEBREN_03471                    48.9    6e-04   
ref|XP_003217705.2|  PREDICTED: inositol-pentakisphosphate 2-kinase   48.9    6e-04   
ref|XP_007055649.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   48.5    6e-04   
ref|XP_005987157.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   48.5    7e-04   
ref|XP_314805.4|  AGAP008700-PA                                       48.5    7e-04   
ref|XP_005179032.1|  PREDICTED: inositol-pentakisphosphate 2-kina...  48.5    8e-04   
ref|XP_008289491.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   48.1    0.001   
ref|XP_003210077.1|  PREDICTED: inositol-pentakisphosphate 2-kinase   48.1    0.001   
ref|NP_001280251.1|  inositol-pentakisphosphate 2-kinase              48.1    0.001   



>ref|XP_009621350.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
tomentosiformis]
 ref|XP_009621351.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
tomentosiformis]
 ref|XP_009621352.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
tomentosiformis]
 ref|XP_009621353.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
tomentosiformis]
 ref|XP_009621354.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
tomentosiformis]
 ref|XP_009621356.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
tomentosiformis]
Length=449

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 146/169 (86%), Gaps = 1/169 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GKIS +SAYDPLD+FSGS+DR+ KAI +LF TPQNNFRVF++G LIFGGLGGGA+ T+ +
Sbjct  201  GKISEVSAYDPLDLFSGSRDRVHKAINNLFRTPQNNFRVFLDGSLIFGGLGGGADTTSCE  260

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
             G+AFED+LK++I A+EGMRT YFLELIS+ V SS LLNRLLEVQKLDT DIEGAIH YY
Sbjct  261  VGKAFEDSLKHVIQAEEGMRTQYFLELISKTVCSSELLNRLLEVQKLDTTDIEGAIHPYY  320

Query  363  NVISQPCVVCKDLGSGL-SKRFNTLHSISMEESWKILRDYLIAATAKDL  506
            NVISQPC+VC  L     SKR+N+LHS+SMEES KI+RDYLIAATAKDL
Sbjct  321  NVISQPCMVCGQLDKDQSSKRYNSLHSMSMEESLKIVRDYLIAATAKDL  369



>ref|XP_009792964.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
sylvestris]
 ref|XP_009792965.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
sylvestris]
 ref|XP_009792966.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
sylvestris]
 ref|XP_009792967.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
sylvestris]
 ref|XP_009792968.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
sylvestris]
 ref|XP_009792969.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
sylvestris]
 ref|XP_009792970.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Nicotiana 
sylvestris]
Length=449

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/169 (73%), Positives = 145/169 (86%), Gaps = 1/169 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GKIS +SAYDPLD+FSGS+DR+ KAI +LF TPQNNFRVF++G LI GGLGGGA+ T+ +
Sbjct  201  GKISEVSAYDPLDLFSGSRDRVRKAINNLFKTPQNNFRVFLDGSLIIGGLGGGADTTSCE  260

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
             G+AFE++LK++I A+EGMRT YFLELIS+ V SS LLNRLLEVQKLDT DIEGAIH YY
Sbjct  261  VGKAFENSLKHVIQAEEGMRTQYFLELISKTVCSSELLNRLLEVQKLDTTDIEGAIHAYY  320

Query  363  NVISQPCVVCKDLGSGL-SKRFNTLHSISMEESWKILRDYLIAATAKDL  506
            NVISQPC+VC  L     SKR+N+LHS+SMEES KI+RDYLIAATAKDL
Sbjct  321  NVISQPCMVCGQLDKDQSSKRYNSLHSMSMEESLKIVRDYLIAATAKDL  369



>emb|CDP07485.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   219 bits (558),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 111/167 (66%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = +3

Query  9    ISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAG  188
            IS IS YDPLDMFSGS++R+ +AIK L+ TPQNNFRVF+NG LIFGGLGGG + TN   G
Sbjct  203  ISEISEYDPLDMFSGSRERIHRAIKALYNTPQNNFRVFLNGSLIFGGLGGGTKSTNYMVG  262

Query  189  QAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNV  368
            Q FEDALK++I A++GMRT   LELI+EA+F SGLL+RLLEVQKLD  DIEG IH Y+++
Sbjct  263  QDFEDALKHVIMAEDGMRTEKLLELITEALFRSGLLDRLLEVQKLDAIDIEGVIHAYHDI  322

Query  369  ISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKDL  506
            +SQPC+VC+ + +   + R+ TLHS+ MEES KI+RDYLIAATAKDL
Sbjct  323  VSQPCLVCRKMDADEFTNRYATLHSMPMEESLKIVRDYLIAATAKDL  369



>ref|XP_011048791.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Populus 
euphratica]
 ref|XP_011048792.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Populus 
euphratica]
 ref|XP_011048793.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Populus 
euphratica]
Length=435

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 137/167 (82%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS +S YDPLD+FSGSK+R+ KAIKDL+ TPQNNFRVF+NG LIFGG GGG E TN+  
Sbjct  203  EISELSEYDPLDLFSGSKERIHKAIKDLYNTPQNNFRVFLNGSLIFGGSGGGTEKTNAVV  262

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G+AFED L+ II AK+G+RT  F++L+SE V+ S +L+ LLEVQK D FDIEGAIH YYN
Sbjct  263  GKAFEDMLEGIIQAKDGLRTMSFIQLVSETVYCSRVLDELLEVQKFDNFDIEGAIHAYYN  322

Query  366  VISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +ISQPC VC+ L  +GL  R+++LHSI M+ES KI++DYLIAATAKD
Sbjct  323  IISQPCAVCQQLDEAGLPHRYSSLHSIHMDESLKIVKDYLIAATAKD  369



>ref|XP_011083655.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Sesamum indicum]
Length=476

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GKI  IS YDPLDMFSGSKDR+ KAIK LF+TPQNNFRVF+NG L FGG+ G A+  +  
Sbjct  203  GKIRKISKYDPLDMFSGSKDRVQKAIKSLFLTPQNNFRVFLNGSLAFGGMDGSADSASYT  262

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              QAF D LK+II AK+GM   YFLELI+E +F SGLL+RLLEVQKLD  DIEGAIH YY
Sbjct  263  LDQAFLDGLKHIIVAKDGMHIKYFLELIAETIFKSGLLDRLLEVQKLDAIDIEGAIHAYY  322

Query  363  NVISQPCVVCKDL-GSGLSKRFNTLHSISMEESWKILRDYLIAATAKDL  506
            +++SQPC+VC++  G+ LS R+++LHS+  +E  KI+RDYLI++TAKDL
Sbjct  323  DIVSQPCMVCREKDGNKLSGRYSSLHSMPRDEKLKIVRDYLISSTAKDL  371



>ref|XP_011083654.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Sesamum indicum]
Length=508

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 135/169 (80%), Gaps = 1/169 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GKI  IS YDPLDMFSGSKDR+ KAIK LF+TPQNNFRVF+NG L FGG+ G A+  +  
Sbjct  235  GKIRKISKYDPLDMFSGSKDRVQKAIKSLFLTPQNNFRVFLNGSLAFGGMDGSADSASYT  294

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              QAF D LK+II AK+GM   YFLELI+E +F SGLL+RLLEVQKLD  DIEGAIH YY
Sbjct  295  LDQAFLDGLKHIIVAKDGMHIKYFLELIAETIFKSGLLDRLLEVQKLDAIDIEGAIHAYY  354

Query  363  NVISQPCVVCKDL-GSGLSKRFNTLHSISMEESWKILRDYLIAATAKDL  506
            +++SQPC+VC++  G+ LS R+++LHS+  +E  KI+RDYLI++TAKDL
Sbjct  355  DIVSQPCMVCREKDGNKLSGRYSSLHSMPRDEKLKIVRDYLISSTAKDL  403



>ref|XP_002306883.1| hypothetical protein POPTR_0005s25180g [Populus trichocarpa]
 gb|EEE93879.1| hypothetical protein POPTR_0005s25180g [Populus trichocarpa]
Length=435

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS +S YDPLD+FSGSK+R+ KAIKDL+ TPQNNFRVF+NG LIFGG GGG E TN+  
Sbjct  203  EISELSEYDPLDLFSGSKERIHKAIKDLYNTPQNNFRVFLNGSLIFGGSGGGTEKTNAVV  262

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G+AFED L+ II A++G+RT  F++L+ E V+ S +L+ LLEVQK D FDIEGAIH YYN
Sbjct  263  GKAFEDMLEGIIQAEDGLRTMSFIQLVGETVYCSRVLDELLEVQKFDNFDIEGAIHAYYN  322

Query  366  VISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++SQPC VC+ L  +GL  R ++LHSI M+ES KI++DYLIAATAKD
Sbjct  323  IVSQPCAVCQQLDEAGLPHRCSSLHSIHMDESLKIVKDYLIAATAKD  369



>ref|XP_010664715.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Vitis vinifera]
Length=453

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +I+ IS Y+PLD+FSGSK+++ KA+K LF TPQNNFRVF+NG LI+GGLGGG + T+   
Sbjct  202  EIAQISEYEPLDLFSGSKEKMHKAVKALFTTPQNNFRVFLNGSLIYGGLGGGTDSTSFMV  261

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G+AFED LK +I A+ GMR   FL L+SE V  SG+L+RLLEVQKLDTFDIEGAIH YY+
Sbjct  262  GEAFEDVLKCVIQAEVGMRVESFLHLVSETVSKSGVLDRLLEVQKLDTFDIEGAIHAYYD  321

Query  366  VISQPCVVCKDLGSGL-SKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++S+PC VC+DLG  + S R+ +LHSI  +ES KI+RDYLIAATAKD
Sbjct  322  IVSEPCTVCRDLGEDIASHRYTSLHSIPSDESLKIVRDYLIAATAKD  368



>emb|CBI19737.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +I+ IS Y+PLD+FSGSK+++ KA+K LF TPQNNFRVF+NG LI+GGLGGG + T+   
Sbjct  218  EIAQISEYEPLDLFSGSKEKMHKAVKALFTTPQNNFRVFLNGSLIYGGLGGGTDSTSFMV  277

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G+AFED LK +I A+ GMR   FL L+SE V  SG+L+RLLEVQKLDTFDIEGAIH YY+
Sbjct  278  GEAFEDVLKCVIQAEVGMRVESFLHLVSETVSKSGVLDRLLEVQKLDTFDIEGAIHAYYD  337

Query  366  VISQPCVVCKDLGSGL-SKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++S+PC VC+DLG  + S R+ +LHSI  +ES KI+RDYLIAATAKD
Sbjct  338  IVSEPCTVCRDLGEDIASHRYTSLHSIPSDESLKIVRDYLIAATAKD  384



>ref|XP_004238270.2| PREDICTED: inositol-pentakisphosphate 2-kinase [Solanum lycopersicum]
Length=445

 Score =   210 bits (534),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 139/170 (82%), Gaps = 2/170 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GKIS ISAYDPLD+FSGS DR+ KAIK LF TPQNNFRVF+NG LI GGLGG A+ T+ +
Sbjct  201  GKISEISAYDPLDLFSGSSDRVHKAIKGLFETPQNNFRVFLNGSLILGGLGGNADATSCE  260

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
             G+ FE+ALK +I A +G RT  FL+LIS+ +FSSGLLN++LEVQKLD  DIEGAIH YY
Sbjct  261  VGETFENALKCVIQAVDGQRTQCFLDLISKTIFSSGLLNKVLEVQKLDNADIEGAIHAYY  320

Query  363  NVISQPCVVCKDLGS--GLSKRFNTLHSISMEESWKILRDYLIAATAKDL  506
            NVISQPC VC  L +   LS+R+++LHSIS +ES KI+R+YLIAATAKDL
Sbjct  321  NVISQPCAVCNKLSAEDQLSERYSSLHSISNDESMKIVRNYLIAATAKDL  370



>ref|XP_008359763.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Malus domestica]
Length=552

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/168 (64%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S YDPLD+FSGSKDR+ KAIKDLF TPQNNFRVF+NG LIFGGLGGGA  TN  
Sbjct  201  GEISEYSEYDPLDLFSGSKDRIHKAIKDLFSTPQNNFRVFLNGSLIFGGLGGGAHSTNLA  260

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
             G AFEDALK +I   +G+RT  FL+LI+E V  SG+L+RLLEVQKLD  DI+GAIH YY
Sbjct  261  IGGAFEDALKGVIQGGDGLRTKSFLQLIAETVHKSGVLDRLLEVQKLDNLDIDGAIHAYY  320

Query  363  NVISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++IS+PC+VC++LG   +S+++ +LHS+S++ES KI++D+LIA +AKD
Sbjct  321  DIISEPCMVCRELGKEEVSQKYLSLHSMSLDESLKIVKDFLIATSAKD  368



>gb|KDP38543.1| hypothetical protein JCGZ_04468 [Jatropha curcas]
Length=454

 Score =   208 bits (530),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 136/167 (81%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS +S YDPLD+FSGSK+R+ KAI DL+ TPQNNFRVF+NG LIFGGLGGG   T++  
Sbjct  203  EISELSQYDPLDIFSGSKERIHKAINDLYTTPQNNFRVFLNGSLIFGGLGGGTSKTSALI  262

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
             +AFEDALK +I A +G+RT  F+EL++E V+SS +L++LLE QKLD FDIEGA+H YYN
Sbjct  263  EKAFEDALKGVIQADDGLRTRSFIELVAETVYSSRVLDQLLEAQKLDNFDIEGAVHAYYN  322

Query  366  VISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +ISQPC+VC++L    L  R+ +LHSI M++S KI++DYLIAATAKD
Sbjct  323  IISQPCMVCRELDEARLPHRYASLHSIPMDDSLKIVKDYLIAATAKD  369



>ref|XP_009365515.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Pyrus x bretschneideri]
Length=453

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  SAYDPLD+FSGSKDR+ KAIKDLF TPQNNFRVF+NG LIFGGLGGGA  TN  
Sbjct  201  GEVSEYSAYDPLDLFSGSKDRIHKAIKDLFSTPQNNFRVFLNGSLIFGGLGGGAHSTNLA  260

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
             G AFEDALK +I   +G RT  FL+L++E V  SG+L++LLE QKLD  DIEGAIH YY
Sbjct  261  IGGAFEDALKGVIQRGDGKRTMSFLQLVAETVHKSGVLDQLLEAQKLDNLDIEGAIHAYY  320

Query  363  NVISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++IS+PC+VC++LG   +S+++ +LHS+S++ES K+++D+LIA +AKD
Sbjct  321  DIISEPCMVCRELGKEKVSQKYLSLHSMSLDESLKMVKDFLIATSAKD  368



>ref|XP_009365516.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Pyrus x bretschneideri]
Length=468

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  SAYDPLD+FSGSKDR+ KAIKDLF TPQNNFRVF+NG LIFGGLGGGA  TN  
Sbjct  216  GEVSEYSAYDPLDLFSGSKDRIHKAIKDLFSTPQNNFRVFLNGSLIFGGLGGGAHSTNLA  275

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
             G AFEDALK +I   +G RT  FL+L++E V  SG+L++LLE QKLD  DIEGAIH YY
Sbjct  276  IGGAFEDALKGVIQRGDGKRTMSFLQLVAETVHKSGVLDQLLEAQKLDNLDIEGAIHAYY  335

Query  363  NVISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++IS+PC+VC++LG   +S+++ +LHS+S++ES K+++D+LIA +AKD
Sbjct  336  DIISEPCMVCRELGKEKVSQKYLSLHSMSLDESLKMVKDFLIATSAKD  383



>tpg|DAA64567.1| TPA_exp: inositol-pentakisphosphate 2-kinase 450 [Ricinus communis]
Length=450

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            + S +S YDPLD+FSGSK+R+ KAI DL+ TPQNNFRVF+NG LIFGGLGGG   T+   
Sbjct  203  ETSEVSQYDPLDIFSGSKERIQKAISDLYATPQNNFRVFLNGSLIFGGLGGGTNKTSIVI  262

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            GQ FEDALK  I A +G+RT   +EL++EA++SS +L+RLL VQKLD  DIEGAIH YYN
Sbjct  263  GQGFEDALKGFIQADDGLRTTSLIELVAEAIYSSQVLDRLLAVQKLDHLDIEGAIHAYYN  322

Query  366  VISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            VISQPCVVC++L  +GL  ++  LHSI M+ES KI++D+LI+ATAKD
Sbjct  323  VISQPCVVCRELDEAGLPHKYVALHSIPMDESLKIVKDFLISATAKD  369



>tpg|DAA64568.1| TPA_exp: inositol-pentakisphosphate 2-kinase 452 [Ricinus communis]
Length=452

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            + S +S YDPLD+FSGSK+R+ KAI DL+ TPQNNFRVF+NG LIFGGLGGG   T+   
Sbjct  203  ETSEVSQYDPLDIFSGSKERIQKAISDLYATPQNNFRVFLNGSLIFGGLGGGTNKTSIVI  262

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            GQ FEDALK  I A +G+RT   +EL++EA++SS +L+RLL VQKLD  DIEGAIH YYN
Sbjct  263  GQGFEDALKGFIQADDGLRTTSLIELVAEAIYSSQVLDRLLAVQKLDHLDIEGAIHAYYN  322

Query  366  VISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            VISQPCVVC++L  +GL  ++  LHSI M+ES KI++D+LI+ATAKD
Sbjct  323  VISQPCVVCRELDEAGLPHKYVALHSIPMDESLKIVKDFLISATAKD  369



>ref|XP_010254763.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X3 
[Nelumbo nucifera]
 ref|XP_010254764.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X3 
[Nelumbo nucifera]
 ref|XP_010254765.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X3 
[Nelumbo nucifera]
Length=438

 Score =   206 bits (524),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 134/167 (80%), Gaps = 2/167 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS IS YDPLD+FSGS +R+ KAIK LF TPQNNFR+F+N  LIFGGLGGG + T+  
Sbjct  189  GEISQISEYDPLDLFSGSSERIHKAIKALFTTPQNNFRIFLNSSLIFGGLGGGRDSTDFV  248

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
             G++FED ++ II A  G+RT  FL+L++EA+F SG+L+RLLE QKLD  DIEGAIH YY
Sbjct  249  MGESFEDKMEGIIRADYGLRTASFLQLVAEAIFRSGVLDRLLEAQKLDLLDIEGAIHAYY  308

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N++SQPCV C+DL   + +  ++LHSIS+EES KI+RDYL+AATAKD
Sbjct  309  NIVSQPCVACRDL--AVRELSHSLHSISLEESLKIVRDYLVAATAKD  353



>emb|CAN76214.1| hypothetical protein VITISV_009512 [Vitis vinifera]
Length=696

 Score =   211 bits (537),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 107/167 (64%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +I+ IS Y+PLD+FSGSK+++ KA+K LF TPQNNFRVF+NG LI+GGLGGG + T+   
Sbjct  253  QIAQISEYEPLDLFSGSKEKMHKAVKALFTTPQNNFRVFLNGSLIYGGLGGGTDSTSFMV  312

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G+AFED LK +I A+ GMR   FL L+SE V  SG+L+RLLEVQKLDTFDIEGAIH YY+
Sbjct  313  GEAFEDVLKCVIQAEVGMRVESFLHLVSETVSKSGVLDRLLEVQKLDTFDIEGAIHAYYD  372

Query  366  VISQPCVVCKDLGSGL-SKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++S+PC VC+DLG  + S R+ +LHSI  +ES KI+RDYLIAATAKD
Sbjct  373  IVSEPCTVCRDLGEDIASHRYTSLHSIPSDESLKIVRDYLIAATAKD  419



>ref|XP_004160062.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Cucumis 
sativus]
Length=311

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS  S YDPLD+FSGSKDR+ KAIKDLF TPQNNFRVF+NG LIFG LGG AE T+   
Sbjct  60   EISEFSDYDPLDLFSGSKDRILKAIKDLFSTPQNNFRVFLNGSLIFGALGGSAESTDVIV  119

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G+AFEDALK++I A +G+ T   L+L+++ ++ SG+L+RLLEVQKLD+ DIEGAIH YY+
Sbjct  120  GEAFEDALKSVILADDGLCTTSLLQLVTDTLYKSGVLDRLLEVQKLDSLDIEGAIHAYYD  179

Query  366  VISQPCVVCKDLGSGLS-KRFNTLHSISMEESWKILRDYLIAATAKD  503
            VIS+PCVVC  L       R+ +LHS+ +++S KI++++LIAATAKD
Sbjct  180  VISEPCVVCGQLNEDEELHRYASLHSLPLDQSLKIVKNFLIAATAKD  226



>ref|XP_010254762.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Nelumbo nucifera]
Length=461

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 134/167 (80%), Gaps = 2/167 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS IS YDPLD+FSGS +R+ KAIK LF TPQNNFR+F+N  LIFGGLGGG + T+  
Sbjct  212  GEISQISEYDPLDLFSGSSERIHKAIKALFTTPQNNFRIFLNSSLIFGGLGGGRDSTDFV  271

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
             G++FED ++ II A  G+RT  FL+L++EA+F SG+L+RLLE QKLD  DIEGAIH YY
Sbjct  272  MGESFEDKMEGIIRADYGLRTASFLQLVAEAIFRSGVLDRLLEAQKLDLLDIEGAIHAYY  331

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N++SQPCV C+DL   + +  ++LHSIS+EES KI+RDYL+AATAKD
Sbjct  332  NIVSQPCVACRDL--AVRELSHSLHSISLEESLKIVRDYLVAATAKD  376



>ref|XP_010254756.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010254757.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010254760.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010254761.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Nelumbo nucifera]
Length=500

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 134/167 (80%), Gaps = 2/167 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS IS YDPLD+FSGS +R+ KAIK LF TPQNNFR+F+N  LIFGGLGGG + T+  
Sbjct  251  GEISQISEYDPLDLFSGSSERIHKAIKALFTTPQNNFRIFLNSSLIFGGLGGGRDSTDFV  310

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
             G++FED ++ II A  G+RT  FL+L++EA+F SG+L+RLLE QKLD  DIEGAIH YY
Sbjct  311  MGESFEDKMEGIIRADYGLRTASFLQLVAEAIFRSGVLDRLLEAQKLDLLDIEGAIHAYY  370

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N++SQPCV C+DL   + +  ++LHSIS+EES KI+RDYL+AATAKD
Sbjct  371  NIVSQPCVACRDL--AVRELSHSLHSISLEESLKIVRDYLVAATAKD  415



>tpg|DAA64569.1| TPA_exp: inositol-pentakisphosphate 2-kinase 555 [Ricinus communis]
Length=555

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = +3

Query  12   SYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQ  191
            S +S YDPLD+FSGSK+R+ KAI DL+ TPQNNFRVF+NG LIFGGLGGG   T+   GQ
Sbjct  205  SEVSQYDPLDIFSGSKERIQKAISDLYATPQNNFRVFLNGSLIFGGLGGGTNKTSIVIGQ  264

Query  192  AFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVI  371
             FEDALK  I A +G+RT   +EL++EA++SS +L+RLL VQKLD  DIEGAIH YYNVI
Sbjct  265  GFEDALKGFIQADDGLRTTSLIELVAEAIYSSQVLDRLLAVQKLDHLDIEGAIHAYYNVI  324

Query  372  SQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            SQPCVVC++L  +GL  ++  LHSI M+ES KI++D+LI+ATAKD
Sbjct  325  SQPCVVCRELDEAGLPHKYVALHSIPMDESLKIVKDFLISATAKD  369



>ref|XP_009365518.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X3 
[Pyrus x bretschneideri]
Length=559

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 137/168 (82%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  SAYDPLD+FSGSKDR+ KAIKDLF TPQNNFRVF+NG LIFGGLGGGA  TN  
Sbjct  216  GEVSEYSAYDPLDLFSGSKDRIHKAIKDLFSTPQNNFRVFLNGSLIFGGLGGGAHSTNLA  275

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
             G AFEDALK +I   +G RT  FL+L++E V  SG+L++LLE QKLD  DIEGAIH YY
Sbjct  276  IGGAFEDALKGVIQRGDGKRTMSFLQLVAETVHKSGVLDQLLEAQKLDNLDIEGAIHAYY  335

Query  363  NVISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++IS+PC+VC++LG   +S+++ +LHS+S++ES K+++D+LIA +AKD
Sbjct  336  DIISEPCMVCRELGKEKVSQKYLSLHSMSLDESLKMVKDFLIATSAKD  383



>ref|XP_006341967.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Solanum tuberosum]
Length=372

 Score =   202 bits (515),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 137/170 (81%), Gaps = 2/170 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GKIS ISAYDPLD+FSGS DR+ KAIK LF TPQNNFRVF+NG LI GGLGG A+ T+ +
Sbjct  133  GKISEISAYDPLDLFSGSNDRVHKAIKGLFKTPQNNFRVFLNGSLILGGLGGNADATSCE  192

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
             G+ FE+AL+ +I A +G RT  FL+LIS+ + SSGLLN++LEVQKLD  DIEGAIH YY
Sbjct  193  VGETFENALQCVIQAVDGQRTQCFLDLISKTICSSGLLNKVLEVQKLDNADIEGAIHAYY  252

Query  363  NVISQPCVVCKDLGS--GLSKRFNTLHSISMEESWKILRDYLIAATAKDL  506
            NVISQPCVVC    +   LS+R+++LHSI  +ES KI+R+YLIAATAKDL
Sbjct  253  NVISQPCVVCNKQSAEDQLSERYSSLHSILNDESMKIVRNYLIAATAKDL  302



>ref|XP_010110041.1| Inositol-pentakisphosphate 2-kinase [Morus notabilis]
 gb|EXC25059.1| Inositol-pentakisphosphate 2-kinase [Morus notabilis]
Length=618

 Score =   207 bits (527),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/168 (60%), Positives = 138/168 (82%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S YDPLD+FSGSKD++ KAIKDLF +PQNNFRVF++G LIFG LG  A+ TN  
Sbjct  218  GEISAFSDYDPLDLFSGSKDKIHKAIKDLFSSPQNNFRVFLDGSLIFGALGATADSTNFV  277

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +AFE ALK +I+  +G+RT  FL+L+SE +++SG+++RLL+VQ+LD  DIEGAIH YY
Sbjct  278  IQEAFEVALKGVIWGDQGLRTKAFLQLLSETIYTSGVMDRLLKVQELDDIDIEGAIHAYY  337

Query  363  NVISQPCVVCKDL-GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+IS+PC+VC+DL    ++ R+++LHSIS++ES KI++++LIAATAKD
Sbjct  338  NIISEPCMVCRDLEEEKVAHRYSSLHSISLDESLKIVKNFLIAATAKD  385



>ref|XP_008220840.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Prunus 
mume]
 ref|XP_008220841.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Prunus 
mume]
Length=453

 Score =   204 bits (518),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  S Y+PLDMFSGSKDR+ KAI+DLF TPQNNFRVF+NG  IFGGLGGGA+ TN  
Sbjct  201  GEVSEYSEYNPLDMFSGSKDRIHKAIRDLFSTPQNNFRVFLNGSQIFGGLGGGADSTNFV  260

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
                FEDALK +I   +G+RT  FL+L++E V +SG+L+RLLEVQKLD  DI+GAIH YY
Sbjct  261  TRGKFEDALKCVIQGGDGLRTMSFLQLVAETVHNSGVLDRLLEVQKLDNLDIDGAIHAYY  320

Query  363  NVISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +++S+PC+VC+  G   +S+R+ +LHSIS++ES KI++D+LIAATAKD
Sbjct  321  DIVSEPCMVCRAFGKEKMSQRYLSLHSISLDESLKIVKDFLIAATAKD  368



>ref|XP_008347365.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Malus domestica]
Length=415

 Score =   202 bits (515),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  S YDPLD+FSGS DR+ KAIKDLF TPQNNFRVF+NG LIFGGLGGGA  TN  
Sbjct  201  GEVSEYSEYDPLDLFSGSNDRIHKAIKDLFXTPQNNFRVFLNGSLIFGGLGGGAHSTNLA  260

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
               AFEDALK +I   +G RT  FL+L++E V  SG+L+RLLE QKLD  DIEGAIH YY
Sbjct  261  IRGAFEDALKGVIQGGDGKRTKSFLQLVAETVHKSGVLDRLLEAQKLDNLDIEGAIHAYY  320

Query  363  NVISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++IS+PC+VC +LG   +S+++ +LHS+S++ES K+++D+LIA +AKD
Sbjct  321  DIISEPCMVCGELGKEKVSQKYLSLHSMSLDESLKMVKDFLIATSAKD  368



>ref|XP_010540332.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Tarenaya 
hassleriana]
Length=401

 Score =   202 bits (513),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 131/168 (78%), Gaps = 4/168 (2%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
             ++S +S YDPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG L+FGG G     T  +
Sbjct  165  NEVSELSEYDPLDLFSGSKERIHRAIKALYSTPQNNFRVFLNGALLFGGSGESIGRTTPE  224

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
             G AFEDALK  I A +G+RT YFLEL+SE+V+SS +L+ LLEVQKLD  D+EGAIH YY
Sbjct  225  YGDAFEDALKGFIQADDGLRTKYFLELVSESVYSSRVLDMLLEVQKLDNLDVEGAIHCYY  284

Query  363  NVISQPCVVCKDL-GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +VISQPC VCK+L   GL   + +LHS+ ++ES KI++DYLIAATAKD
Sbjct  285  DVISQPCSVCKELEQDGL---YASLHSLPLDESLKIVKDYLIAATAKD  329



>ref|XP_008347364.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Malus domestica]
Length=430

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  S YDPLD+FSGS DR+ KAIKDLF TPQNNFRVF+NG LIFGGLGGGA  TN  
Sbjct  216  GEVSEYSEYDPLDLFSGSNDRIHKAIKDLFXTPQNNFRVFLNGSLIFGGLGGGAHSTNLA  275

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
               AFEDALK +I   +G RT  FL+L++E V  SG+L+RLLE QKLD  DIEGAIH YY
Sbjct  276  IRGAFEDALKGVIQGGDGKRTKSFLQLVAETVHKSGVLDRLLEAQKLDNLDIEGAIHAYY  335

Query  363  NVISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++IS+PC+VC +LG   +S+++ +LHS+S++ES K+++D+LIA +AKD
Sbjct  336  DIISEPCMVCGELGKEKVSQKYLSLHSMSLDESLKMVKDFLIATSAKD  383



>ref|XP_006341966.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Solanum tuberosum]
Length=440

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 137/170 (81%), Gaps = 2/170 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GKIS ISAYDPLD+FSGS DR+ KAIK LF TPQNNFRVF+NG LI GGLGG A+ T+ +
Sbjct  201  GKISEISAYDPLDLFSGSNDRVHKAIKGLFKTPQNNFRVFLNGSLILGGLGGNADATSCE  260

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
             G+ FE+AL+ +I A +G RT  FL+LIS+ + SSGLLN++LEVQKLD  DIEGAIH YY
Sbjct  261  VGETFENALQCVIQAVDGQRTQCFLDLISKTICSSGLLNKVLEVQKLDNADIEGAIHAYY  320

Query  363  NVISQPCVVCKDLGS--GLSKRFNTLHSISMEESWKILRDYLIAATAKDL  506
            NVISQPCVVC    +   LS+R+++LHSI  +ES KI+R+YLIAATAKDL
Sbjct  321  NVISQPCVVCNKQSAEDQLSERYSSLHSILNDESMKIVRNYLIAATAKDL  370



>ref|XP_008377206.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Malus domestica]
Length=453

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  S YDPLD+FSGS DR+ KAIKDLF TPQNNFRVF+NG LIFGGLGGGA  TN  
Sbjct  201  GEVSEYSEYDPLDLFSGSNDRIHKAIKDLFSTPQNNFRVFLNGSLIFGGLGGGAHSTNLA  260

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
               AFEDALK +I   +G RT  FL+L++E V  SG+L+RLLE QKLD  DIEGAIH YY
Sbjct  261  IRGAFEDALKGVIQGGDGKRTKSFLQLVAETVHKSGVLDRLLEAQKLDNLDIEGAIHAYY  320

Query  363  NVISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++IS+PC+VC +LG   +S+++ +LHS+S++ES K+++D+LIA +AKD
Sbjct  321  DIISEPCMVCGELGKEKVSQKYLSLHSMSLDESLKMVKDFLIATSAKD  368



>ref|XP_008444741.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Cucumis 
melo]
Length=453

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS  S YDPLD+FSGSKDR+ KAIKDLF TPQNNFRVF+NG LIFG LGG AE T+   
Sbjct  202  EISEFSDYDPLDLFSGSKDRILKAIKDLFSTPQNNFRVFLNGSLIFGALGGSAENTDVIV  261

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G+AFEDALK++I A +G+ T+  L+L+++ ++ SG+L+RLLEVQKLD+ DIEGAIH YY+
Sbjct  262  GEAFEDALKSVILADDGLCTSSLLQLVTDTLYKSGVLDRLLEVQKLDSLDIEGAIHAYYD  321

Query  366  VISQPCVVCKDLGSGLS-KRFNTLHSISMEESWKILRDYLIAATAKD  503
            VIS+PCVVC  L       RF +LHS+ +++S KI++++LIAATAKD
Sbjct  322  VISEPCVVCGQLNEDEELHRFASLHSLPLDQSLKIVKNFLIAATAKD  368



>ref|XP_002510425.1| Inositol-pentakisphosphate 2-kinase, putative [Ricinus communis]
 gb|EEF52612.1| Inositol-pentakisphosphate 2-kinase, putative [Ricinus communis]
Length=695

 Score =   207 bits (526),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 132/165 (80%), Gaps = 1/165 (1%)
 Frame = +3

Query  12   SYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQ  191
            S +S YDPLD+FSGSK+R+ KAI DL+ TPQNNFRVF+NG LIFGGLGGG   T+   GQ
Sbjct  205  SEVSQYDPLDIFSGSKERIQKAISDLYATPQNNFRVFLNGSLIFGGLGGGTNKTSIVIGQ  264

Query  192  AFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVI  371
             FEDALK  I A +G+RT   +EL++EA++SS +L+RLL VQKLD  DIEGAIH YYNVI
Sbjct  265  GFEDALKGFIQADDGLRTTSLIELVAEAIYSSQVLDRLLAVQKLDHLDIEGAIHAYYNVI  324

Query  372  SQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            SQPCVVC++L  +GL  ++  LHSI M+ES KI++D+LI+ATAKD
Sbjct  325  SQPCVVCRELDEAGLPHKYVALHSIPMDESLKIVKDFLISATAKD  369



>ref|XP_004154853.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Cucumis 
sativus]
Length=444

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 131/168 (78%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S YDPLD+FSGS+DR+ KAIKDLF TPQNNFRVF+NG LI G  GG A  TN +
Sbjct  202  GEISEFSDYDPLDLFSGSQDRIYKAIKDLFSTPQNNFRVFLNGSLILGTEGGYAVDTNLE  261

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +AFEDAL+++I    G RT  FL+L++EAV  SG LNRLL+VQKLD+FDIEGAIH YY
Sbjct  262  IEEAFEDALRSVIQRGNGFRTMSFLQLVAEAVHKSGCLNRLLDVQKLDSFDIEGAIHAYY  321

Query  363  NVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++IS+PC+VC+ +    L KR  TLHS  +++S +I+R+YLIAATAKD
Sbjct  322  DIISEPCLVCRQMNDDELLKRCATLHSAHLDQSLEIVRNYLIAATAKD  369



>ref|XP_010540330.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540331.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Tarenaya 
hassleriana]
Length=439

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 131/167 (78%), Gaps = 4/167 (2%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            ++S +S YDPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG L+FGG G     T  + 
Sbjct  204  EVSELSEYDPLDLFSGSKERIHRAIKALYSTPQNNFRVFLNGALLFGGSGESIGRTTPEY  263

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G AFEDALK  I A +G+RT YFLEL+SE+V+SS +L+ LLEVQKLD  D+EGAIH YY+
Sbjct  264  GDAFEDALKGFIQADDGLRTKYFLELVSESVYSSRVLDMLLEVQKLDNLDVEGAIHCYYD  323

Query  366  VISQPCVVCKDLGS-GLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            VISQPC VCK+L   GL   + +LHS+ ++ES KI++DYLIAATAKD
Sbjct  324  VISQPCSVCKELEQDGL---YASLHSLPLDESLKIVKDYLIAATAKD  367



>ref|XP_004152686.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Cucumis 
sativus]
 gb|KGN62621.1| hypothetical protein Csa_2G361850 [Cucumis sativus]
Length=453

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS  S YDPLD+FSGSKDR+ KAIKDLF TPQNNFRVF+NG LIFG LGG AE T+   
Sbjct  202  EISEFSDYDPLDLFSGSKDRILKAIKDLFSTPQNNFRVFLNGSLIFGALGGSAESTDVIV  261

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G+AFEDALK++I A +G+ T   L+L+++ ++ SG+L+RLLEVQKLD+ DIEGAIH YY+
Sbjct  262  GEAFEDALKSVILADDGLCTTSLLQLVTDTLYKSGVLDRLLEVQKLDSLDIEGAIHAYYD  321

Query  366  VISQPCVVCKDLGSGLS-KRFNTLHSISMEESWKILRDYLIAATAKD  503
            VIS+PCVVC  L       R+ +LHS+ +++S KI++++LIAATAKD
Sbjct  322  VISEPCVVCGQLNEDEELHRYASLHSLPLDQSLKIVKNFLIAATAKD  368



>ref|XP_004291851.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Fragaria 
vesca subsp. vesca]
Length=454

 Score =   201 bits (512),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 135/168 (80%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  S YDPLD+FSGSKDR+ KAIKDLF TPQNNFRVFVNG LIFGGLGGGAE TN  
Sbjct  202  GEVSQYSNYDPLDLFSGSKDRIHKAIKDLFATPQNNFRVFVNGSLIFGGLGGGAESTNLV  261

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
             G  FE ALK++I   +G RT  FL+L++E V+ SG++++LLE+QKLD  DI+GAIH YY
Sbjct  262  IGDKFETALKDVIQGGDGSRTVNFLQLVAETVYRSGVMDQLLEIQKLDYLDIDGAIHAYY  321

Query  363  NVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++IS+PC+VC +LG    S R+++LHS+ ++ES KI++ +LI+A+AKD
Sbjct  322  DIISEPCMVCTELGKDKASNRYSSLHSLPLDESLKIVKQFLISASAKD  369



>ref|XP_008220842.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Prunus 
mume]
Length=548

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  S Y+PLDMFSGSKDR+ KAI+DLF TPQNNFRVF+NG  IFGGLGGGA+ TN  
Sbjct  201  GEVSEYSEYNPLDMFSGSKDRIHKAIRDLFSTPQNNFRVFLNGSQIFGGLGGGADSTNFV  260

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
                FEDALK +I   +G+RT  FL+L++E V +SG+L+RLLEVQKLD  DI+GAIH YY
Sbjct  261  TRGKFEDALKCVIQGGDGLRTMSFLQLVAETVHNSGVLDRLLEVQKLDNLDIDGAIHAYY  320

Query  363  NVISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +++S+PC+VC+  G   +S+R+ +LHSIS++ES KI++D+LIAATAKD
Sbjct  321  DIVSEPCMVCRAFGKEKMSQRYLSLHSISLDESLKIVKDFLIAATAKD  368



>gb|EYU32907.1| hypothetical protein MIMGU_mgv1a006028mg [Erythranthe guttata]
Length=460

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 126/169 (75%), Gaps = 1/169 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G IS IS YDPLD+FSGSKD +  A K LF+TPQNNFRVF+NG LIFGG+ G A+  +  
Sbjct  203  GVISQISKYDPLDLFSGSKDGVQNAFKSLFLTPQNNFRVFLNGSLIFGGMDGAADCVSYT  262

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              QAF+D +K +I AK+GM + YFLEL++E V  SGLLN LLEVQKLD  DIEGAIH YY
Sbjct  263  VDQAFQDGIKRVIVAKDGMHSKYFLELVTETVIKSGLLNLLLEVQKLDAIDIEGAIHAYY  322

Query  363  NVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKDL  506
            +++S PCV+C+  G   LS R++ +H +S  E  K++RDYLI+AT KDL
Sbjct  323  DLVSLPCVICRQKGENKLSGRYSPIHLMSKHEKLKVVRDYLISATGKDL  371



>ref|XP_007223293.1| hypothetical protein PRUPE_ppa005582mg [Prunus persica]
 gb|EMJ24492.1| hypothetical protein PRUPE_ppa005582mg [Prunus persica]
Length=453

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 136/168 (81%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  S Y+PLDMFSGSKDR+ KAI+DLF TPQNNFRVF+NG  IFGGLGGGA+ TN  
Sbjct  201  GEVSEYSDYNPLDMFSGSKDRIHKAIRDLFSTPQNNFRVFLNGSQIFGGLGGGADSTNFV  260

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
                FEDALK +I   +G+RT  FL+L++E V +SG+L++LLEVQKLD  DI+GAIH YY
Sbjct  261  TRGKFEDALKCVIQGGDGLRTMSFLQLVAETVHNSGVLDQLLEVQKLDNLDIDGAIHAYY  320

Query  363  NVISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +++S+PC+VC+  G   LS+++ +LHSIS++ES KI++D+LIAATAKD
Sbjct  321  DIVSEPCMVCRAFGKEKLSQKYLSLHSISLDESLKIVKDFLIAATAKD  368



>ref|XP_008466533.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Cucumis 
melo]
Length=444

 Score =   201 bits (510),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 131/168 (78%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S YDPLD+FSGS+DR+ KAIKDLF TPQNNFRVF+NG LI G  GG A  TN +
Sbjct  202  GEISELSDYDPLDLFSGSQDRIYKAIKDLFSTPQNNFRVFLNGSLILGTEGGYAVDTNLE  261

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +AFEDAL+++I    G RT  FL+L++EAV  SG LNRLL+VQKLD+FDIEGAIH YY
Sbjct  262  IQEAFEDALQSVIQRGNGFRTMSFLQLVAEAVHKSGCLNRLLDVQKLDSFDIEGAIHAYY  321

Query  363  NVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++IS+PC+VC+ +    L KR  TLHS  +++S +I+R+YL AATAKD
Sbjct  322  DIISEPCLVCRQMDDDELLKRCATLHSAHLDQSLEIVRNYLTAATAKD  369



>gb|KHG28547.1| Inositol-pentakisphosphate 2-kinase -like protein [Gossypium 
arboreum]
Length=505

 Score =   202 bits (513),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS  S Y+PLD+FSGS++ + KAI+ L+ TPQNNFRVF+NG ++FGGLGGG   T  + 
Sbjct  235  EISEYSEYNPLDLFSGSREGIQKAIEALYATPQNNFRVFLNGSIVFGGLGGGTNSTTVQV  294

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G+AFED LKN I A  G RT  FL+L++E +++SG L +LLEVQKLDT+DIEGAIH YYN
Sbjct  295  GEAFEDILKNFIQADNGQRTTSFLQLVAETIYTSGALEQLLEVQKLDTYDIEGAIHAYYN  354

Query  366  VISQPCVVCKDLGS-GLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +ISQPC+VC++L    LS R+ +LHSI +++S KI++DYLIAATAKD
Sbjct  355  IISQPCMVCRELSKDKLSCRYTSLHSIPLDQSLKIVKDYLIAATAKD  401



>ref|XP_003528009.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Glycine max]
 ref|XP_006581199.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Glycine max]
 ref|XP_006581200.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X3 
[Glycine max]
Length=457

 Score =   201 bits (510),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSK+R+ KAIKDLF TPQNNFRVF+NG LIFGGLGGGAE TN  
Sbjct  203  GEISLLSKYNPLDLFSGSKERIYKAIKDLFTTPQNNFRVFMNGSLIFGGLGGGAEDTNFG  262

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +AFE+ALK++I A  G+ T   L L++EAV  SG+L+RLL+VQKLD  DIEGAIH YY
Sbjct  263  IAKAFENALKSVIQADNGLCTENLLTLVAEAVKKSGVLDRLLDVQKLDNVDIEGAIHAYY  322

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++  Q C++C++L     KR+ +LHS S++ES +I++DYLIAATAKD
Sbjct  323  DITRQQCIICRELSEEQLKRYTSLHSASLDESLRIVKDYLIAATAKD  369



>ref|XP_002302020.2| hypothetical protein POPTR_0002s03430g [Populus trichocarpa]
 gb|EEE81293.2| hypothetical protein POPTR_0002s03430g [Populus trichocarpa]
Length=453

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 135/167 (81%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS +S YDPLD+FSGSK+R+ KAIKDL+ TPQNNFRVF+NG LIFGGLGGG + TN+ A
Sbjct  204  EISELSEYDPLDLFSGSKERIHKAIKDLYTTPQNNFRVFLNGSLIFGGLGGGIKRTNAVA  263

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G+AFEDAL+ II A+ G+RT  F++L++EAV+ S +L+ LLEVQ+LD FDIEGAIH YYN
Sbjct  264  GKAFEDALEGIILAENGLRTTSFIQLVAEAVYCSRVLDGLLEVQRLDNFDIEGAIHAYYN  323

Query  366  VISQPCVVCKDLGSGL-SKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++ QPC +C+ L       R ++LHSI M+ES KI +DYLIAATAKD
Sbjct  324  IVCQPCAICQQLDEARPPHRCSSLHSIHMDESLKIAKDYLIAATAKD  370



>gb|KHN22235.1| Inositol-pentakisphosphate 2-kinase [Glycine soja]
Length=457

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSK+R+ KAIKDLF TPQNNFRVF+NG LIFGGLGGGAE TN  
Sbjct  203  GEISLLSKYNPLDLFSGSKERIYKAIKDLFTTPQNNFRVFMNGSLIFGGLGGGAEDTNFG  262

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +AFE+ALK++I A  G+ T   L L++EAV  SG+L+RLL+VQKLD  DIEGAIH YY
Sbjct  263  IAKAFENALKSVIQADNGLCTENLLTLVAEAVKKSGVLDRLLDVQKLDNVDIEGAIHAYY  322

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++  Q C++C++L     KR+ +LHS S++ES +I++DYLIAATAKD
Sbjct  323  DITRQQCIICRELSEEQLKRYTSLHSASLDESLRIVKDYLIAATAKD  369



>ref|XP_004147852.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Cucumis 
sativus]
 gb|KGN59987.1| hypothetical protein Csa_3G860230 [Cucumis sativus]
Length=444

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 131/168 (78%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S YDPLD+FSGS+DR+ KAIK+LF TPQNNFRVF+NG LI G  GG A  TN +
Sbjct  202  GEISEFSDYDPLDLFSGSQDRIYKAIKNLFSTPQNNFRVFLNGSLILGTEGGYAVDTNLE  261

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +AFEDAL+++I    G RT  FL+L++EAV  SG LNRLL+VQKLD+FDIEGAIH YY
Sbjct  262  IEEAFEDALRSVIQRGNGFRTMSFLQLVAEAVHKSGCLNRLLDVQKLDSFDIEGAIHAYY  321

Query  363  NVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++IS+PC+VC+ +    L KR  TLHS  +++S +I+R+YLIAATAKD
Sbjct  322  DIISEPCLVCRQMNDDELLKRCATLHSAHLDQSLEIVRNYLIAATAKD  369



>gb|KHG30015.1| Inositol-pentakisphosphate 2-kinase -like protein [Gossypium 
arboreum]
Length=486

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS  S Y+PLD+FSGS DR+ KAI+ L+ TPQNNFRVF+NG ++FGGLGGGA  T    
Sbjct  203  EISEYSEYNPLDLFSGSLDRICKAIEALYATPQNNFRVFLNGSIVFGGLGGGAGSTTVLV  262

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G+AFED+LK++I A +GM    F++L+SE V+SSG+L++LLEVQKLD +DIEGAIH YYN
Sbjct  263  GEAFEDSLKDVIKADDGMCKTSFIQLVSETVYSSGVLDQLLEVQKLDAYDIEGAIHAYYN  322

Query  366  VISQPCVVCKDLGS-GLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +ISQPC+VC++L    LS R  +LHSI +EES KI++DYLI+AT KD
Sbjct  323  IISQPCMVCRELSKDKLSNRHTSLHSIPLEESLKIVKDYLISATVKD  369



>ref|XP_008377208.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Malus domestica]
Length=555

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  S YDPLD+FSGS DR+ KAIKDLF TPQNNFRVF+NG LIFGGLGGGA  TN  
Sbjct  216  GEVSEYSEYDPLDLFSGSNDRIHKAIKDLFSTPQNNFRVFLNGSLIFGGLGGGAHSTNLA  275

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
               AFEDALK +I   +G RT  FL+L++E V  SG+L+RLLE QKLD  DIEGAIH YY
Sbjct  276  IRGAFEDALKGVIQGGDGKRTKSFLQLVAETVHKSGVLDRLLEAQKLDNLDIEGAIHAYY  335

Query  363  NVISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++IS+PC+VC +LG   +S+++ +LHS+S++ES K+++D+LIA +AKD
Sbjct  336  DIISEPCMVCGELGKEKVSQKYLSLHSMSLDESLKMVKDFLIATSAKD  383



>gb|KHN45871.1| Inositol-pentakisphosphate 2-kinase [Glycine soja]
Length=457

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSK+R+ KAIKDLF TPQNNFRVF+NG LIFGGLGGGAE TN  
Sbjct  203  GEISLLSEYNPLDLFSGSKERIYKAIKDLFTTPQNNFRVFMNGSLIFGGLGGGAEDTNFG  262

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +AFEDALK++I A  G+ T   L +++EAV  SG+L+RLL+VQKLD  DIEGAIH YY
Sbjct  263  IAKAFEDALKSVIQADNGLCTENLLTIVAEAVQKSGVLDRLLDVQKLDNVDIEGAIHAYY  322

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++  Q C++C++L     KR+ +LHS +++ES +I++DYLIAATAKD
Sbjct  323  DITHQQCMICRELSEEQLKRYTSLHSATLDESLRIVKDYLIAATAKD  369



>ref|XP_003523790.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Glycine 
max]
Length=457

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 133/167 (80%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSK+R+ KAIKDLF TPQNNFRVF+NG LIFGGLGGGAE TN  
Sbjct  203  GEISLLSEYNPLDLFSGSKERIYKAIKDLFTTPQNNFRVFMNGSLIFGGLGGGAEDTNFG  262

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +AFEDALK++I A  G+ T   L +++EAV  SG+L+RLL+VQKLD  DIEGAIH YY
Sbjct  263  IAKAFEDALKSVIQADNGLCTENLLTIVAEAVQKSGVLDRLLDVQKLDNVDIEGAIHAYY  322

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++  Q C++C++L     KR+ +LHS +++ES +I++DYLIAATAKD
Sbjct  323  DITHQQCMICRELSEEQLKRYTSLHSATLDESLRIVKDYLIAATAKD  369



>gb|EYU45129.1| hypothetical protein MIMGU_mgv1a006036mg [Erythranthe guttata]
Length=460

 Score =   199 bits (506),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 131/170 (77%), Gaps = 2/170 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFggl-gggAEPTNS  179
            G IS IS YDPLD+FSGSKD +  AIK LF+TPQNNFRVF+NG LIFGG+ GG AE  + 
Sbjct  201  GVISKISKYDPLDLFSGSKDGVQNAIKCLFLTPQNNFRVFLNGSLIFGGMDGGAAECVSY  260

Query  180  KAGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVY  359
               QAF+D +K +I AK+GM + YFLEL++E V  SGLLN+LLEVQKLD+ DIEGAIH Y
Sbjct  261  TVDQAFQDGIKRVIVAKDGMHSKYFLELVTETVMKSGLLNQLLEVQKLDSIDIEGAIHAY  320

Query  360  YNVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKDL  506
            Y+ +S PC+VC+  G    S R++++HS+S +E  K++R+YLI+AT KDL
Sbjct  321  YDFVSLPCMVCRKKGENKFSGRYSSIHSMSKDEKLKLVRNYLISATGKDL  370



>ref|XP_002865479.1| inositol-pentakisphosphate 2-kinase 1 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41738.1| inositol-pentakisphosphate 2-kinase 1 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 132/166 (80%), Gaps = 2/166 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS  S YDPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG LI GG G     T+ + 
Sbjct  203  EISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEI  262

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G AFED LK  I +++G RT YFL+L+S+AV+SSG+L+RLLE+QKLD  DIEGAIH YY+
Sbjct  263  GYAFEDTLKGFIQSEDGHRTKYFLQLVSDAVYSSGVLDRLLEIQKLDKLDIEGAIHSYYD  322

Query  366  VISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +I+QPC +CK+  SG  + +++LH++ ++ES KI++DYL+AATAKD
Sbjct  323  IINQPCAICKE--SGPLEAYSSLHTLPLDESLKIVKDYLVAATAKD  366



>gb|KDO84622.1| hypothetical protein CISIN_1g0134841mg, partial [Citrus sinensis]
 gb|KDO84623.1| hypothetical protein CISIN_1g0134841mg, partial [Citrus sinensis]
 gb|KDO84624.1| hypothetical protein CISIN_1g0134841mg, partial [Citrus sinensis]
Length=334

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS  S YDPLD+FSGSK+R+ KAIK L+  PQNN RVF+NG LIFG LGGG    +   
Sbjct  100  EISERSEYDPLDLFSGSKERICKAIKALYTNPQNNLRVFLNGSLIFGSLGGGMCGNSVAV  159

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G+AFEDALK  I A  G+RT+ F++L++E V  +G+L+RLLEVQKLD FDIEGAIH YYN
Sbjct  160  GEAFEDALKCTIKADNGLRTDSFIQLVAETVHQAGILDRLLEVQKLDNFDIEGAIHAYYN  219

Query  366  VISQPCVVCKDLGSGLSKRFNT-LHSISMEESWKILRDYLIAATAKD  503
            +ISQPC VC++L    +    T LHSI M ES KI++DYLIAATAKD
Sbjct  220  IISQPCRVCRELDEEKASHLCTSLHSIPMNESLKIVKDYLIAATAKD  266



>emb|CDY38844.1| BnaC08g20180D [Brassica napus]
Length=349

 Score =   193 bits (491),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 133/170 (78%), Gaps = 3/170 (2%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
             +IS IS YDPLD+FSGSKDR+ KAI+ L+ TPQNNFRVF+NG L+FGGLGGG   T SK
Sbjct  99   NEISEISEYDPLDLFSGSKDRIHKAIRALYATPQNNFRVFLNGSLVFGGLGGGTCKTTSK  158

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              Q FE  LK+II  K+G R N+F+EL++E V++SG+L+ LL+VQKLD ++IEGA+HVYY
Sbjct  159  VEQDFEHLLKDIIKTKDGSRANHFIELVAETVYTSGVLDHLLDVQKLDKYNIEGAVHVYY  218

Query  363  NVISQPCVVCKDL---GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++I+QPC VCK+L    +  + +F+ +HSI M E   +L+++LI+ATAKD
Sbjct  219  DLINQPCRVCKELEKSKTSSTSQFSFMHSIPMAEKVNVLKEFLISATAKD  268



>ref|XP_004500991.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Cicer arietinum]
Length=441

 Score =   196 bits (497),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSK+++ KAIKDLF TPQNNFRVF+NG LIFGGLGGGAE TN  
Sbjct  194  GEISLLSEYNPLDLFSGSKEKIHKAIKDLFTTPQNNFRVFMNGSLIFGGLGGGAEDTNFC  253

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +AFE ALK+II + +G+ T  FL L++EA   SG+L+RLLEVQKLD  DIEGAIH YY
Sbjct  254  IAKAFEVALKSIIQSDDGLCTENFLTLVTEAAHKSGVLDRLLEVQKLDNVDIEGAIHAYY  313

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++  Q C+VC +L     K +  LHS S++ES  I++DYLIAATAKD
Sbjct  314  DITHQQCMVCSELNEDQRKIYTPLHSASLDESLTIVKDYLIAATAKD  360



>ref|XP_004500990.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Cicer arietinum]
Length=450

 Score =   196 bits (497),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 129/167 (77%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSK+++ KAIKDLF TPQNNFRVF+NG LIFGGLGGGAE TN  
Sbjct  203  GEISLLSEYNPLDLFSGSKEKIHKAIKDLFTTPQNNFRVFMNGSLIFGGLGGGAEDTNFC  262

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +AFE ALK+II + +G+ T  FL L++EA   SG+L+RLLEVQKLD  DIEGAIH YY
Sbjct  263  IAKAFEVALKSIIQSDDGLCTENFLTLVTEAAHKSGVLDRLLEVQKLDNVDIEGAIHAYY  322

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++  Q C+VC +L     K +  LHS S++ES  I++DYLIAATAKD
Sbjct  323  DITHQQCMVCSELNEDQRKIYTPLHSASLDESLTIVKDYLIAATAKD  369



>ref|XP_006403344.1| hypothetical protein EUTSA_v10003206mg [Eutrema salsugineum]
 gb|ESQ44797.1| hypothetical protein EUTSA_v10003206mg [Eutrema salsugineum]
Length=453

 Score =   196 bits (497),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 131/166 (79%), Gaps = 2/166 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS +S YDPLD+FSGSKDR+ +AIK L+  PQNNFRVF+NG LI GG G     T+ + 
Sbjct  207  EISEVSGYDPLDLFSGSKDRVSEAIKALYSIPQNNFRVFLNGSLILGGSGESTGRTSPEI  266

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
               FEDALK  I + +G+RT  FLE++S+AV+SSG+L++LLEVQKLD  DIEGAIH YYN
Sbjct  267  AYTFEDALKGFIQSDDGLRTKCFLEIVSDAVYSSGVLDKLLEVQKLDKLDIEGAIHSYYN  326

Query  366  VISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            VI+QPC +CK++G   S+++ +LH++ ++E+ KI+++Y+IAATAKD
Sbjct  327  VINQPCPLCKEIGP--SEKYASLHALPLDENLKIVKEYMIAATAKD  370



>ref|XP_006416232.1| hypothetical protein EUTSA_v10007647mg [Eutrema salsugineum]
 gb|ESQ34585.1| hypothetical protein EUTSA_v10007647mg [Eutrema salsugineum]
Length=442

 Score =   195 bits (496),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 136/168 (81%), Gaps = 2/168 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSGSKDR+ +AI+ L+ TPQNNFRVF+NG L+FGGLGGG   T SK 
Sbjct  205  EISEISEYDPLDLFSGSKDRIHRAIRALYATPQNNFRVFLNGSLVFGGLGGGICKTTSKV  264

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
             Q FE  LK+II  ++G+R ++F+EL++E V++SG+L++LL+VQKLD ++IEGAIHVYY+
Sbjct  265  EQDFEHLLKDIIRTEDGLRADHFIELVAETVYASGVLDQLLDVQKLDKYNIEGAIHVYYD  324

Query  366  VISQPCVVCKDL--GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +I QPC VC++L     LS +F+++HSI ++E   IL+D+L++ATAKD
Sbjct  325  LIDQPCKVCRELEKSETLSDQFSSMHSIPLDEKVNILKDFLVSATAKD  372



>emb|CDY52373.1| BnaA09g15720D [Brassica napus]
Length=450

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 127/166 (77%), Gaps = 1/166 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS +S YDPLD+FSGSKDR+ KA+K L+  PQNNFRVF+NG L+ GG G     T+ + 
Sbjct  202  EISEVSEYDPLDLFSGSKDRVSKAVKALYSIPQNNFRVFLNGSLVLGGSGESTGRTSPET  261

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
             Q FE+AL+  I + +G+RT  FL+L+S+ V+ SG+L++LLEVQKLD  DIEGAIH YYN
Sbjct  262  AQTFEEALRGFIQSNDGLRTKCFLQLVSDTVYDSGVLDKLLEVQKLDKLDIEGAIHCYYN  321

Query  366  VISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +I+QPC +CK+ G+ L +   +LH + ++ES KI+RDYLIAATAKD
Sbjct  322  IINQPCPICKEAGT-LEEEEESLHCLPLDESLKIVRDYLIAATAKD  366



>ref|XP_011029078.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Populus 
euphratica]
Length=570

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS +S YDPLD+FSGSK+R+ KAIKDL+ TPQNNFRVF+NG LIFGGLGGG + TN+ A
Sbjct  204  EISELSEYDPLDLFSGSKERIHKAIKDLYTTPQNNFRVFLNGSLIFGGLGGGIKRTNALA  263

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G+AFEDAL+ II A+ G+RT  F++L++EAV+ S +L+ LLEVQ+LD FDIEGAIH YYN
Sbjct  264  GKAFEDALEGIILAENGLRTTSFIQLVAEAVYCSRVLDGLLEVQRLDNFDIEGAIHAYYN  323

Query  366  VISQPCVVCKDLGSGLSK-RFNTLHSISMEESWKILRDYLIAATAKD  503
            ++ QPC VC+ L       R ++LHSI M++S KI +DYL AATAKD
Sbjct  324  IVGQPCAVCQQLDEARPPHRCSSLHSIHMDDSLKIAKDYLTAATAKD  370



>ref|XP_006473539.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Citrus sinensis]
Length=442

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 128/167 (77%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS  S YDPLD+FSGSK+R+ KAIK L+  PQNN RVF+NG LIFG LGGG    +   
Sbjct  208  EISERSEYDPLDLFSGSKERICKAIKALYTNPQNNLRVFLNGSLIFGSLGGGMCSNSVAV  267

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G+AFED+LK  I A  G+RT+ F++L++E V  +G+L+RLLEVQKLD FDIEGAIH YYN
Sbjct  268  GEAFEDSLKCTIKADNGLRTDSFIQLVAETVHQAGILDRLLEVQKLDNFDIEGAIHAYYN  327

Query  366  VISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +ISQPC VC++L    +S+   +LHSI M ES KI++DYLIAATAKD
Sbjct  328  IISQPCRVCRELDEEKVSRLCTSLHSIPMNESLKIVKDYLIAATAKD  374



>gb|KEH36181.1| inositol-pentakisphosphate 2-kinase-like protein [Medicago truncatula]
Length=447

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSK+R+ KAI DLF TPQNNFRVF+NG LIFGGLGGGAE TN  
Sbjct  203  GEISLLSEYNPLDLFSGSKERIHKAINDLFTTPQNNFRVFMNGSLIFGGLGGGAEDTNLC  262

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +AFE AL +II A +G+ T  FL L++EA   SG+L+RLLEVQKLD  DIEGAIH YY
Sbjct  263  IAKAFEGALMSIIQADDGLCTENFLTLVAEAAHKSGVLDRLLEVQKLDDVDIEGAIHAYY  322

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++  Q C+VC +L     K +  LHS+S++ES ++++DYLIAAT KD
Sbjct  323  DITRQQCMVCTELNEEQMKVYTPLHSVSLDESLRVVKDYLIAATVKD  369



>ref|XP_009114034.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Brassica rapa]
Length=443

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 128/166 (77%), Gaps = 1/166 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS +S YDPLD+FSGSKDR+ KA+K L+  PQNNFRVF+NG L+ GG G     T+ + 
Sbjct  198  EISEVSEYDPLDLFSGSKDRVSKAVKALYSIPQNNFRVFLNGSLVLGGSGESTGRTSPET  257

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
             QAFE+ALK  I + +G+RT  FL+L+S+ V+ SG+L++LLEVQKLD  DIEGAIH YYN
Sbjct  258  AQAFEEALKGFIQSNDGLRTKCFLQLVSDTVYDSGVLDKLLEVQKLDKLDIEGAIHCYYN  317

Query  366  VISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +I+QPC +CK+ G+ L +   +LH + ++ES KI+++YLIAATAKD
Sbjct  318  IINQPCPICKEAGT-LEEEEESLHCLPLDESLKIVKEYLIAATAKD  362



>ref|XP_009110150.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Brassica rapa]
Length=455

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 134/169 (79%), Gaps = 3/169 (2%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSGSKDR+ KAI+ L+ TPQNNFRVF+NG L+FGGLGGG   T SK 
Sbjct  204  EISEISEYDPLDLFSGSKDRIHKAIRALYATPQNNFRVFLNGSLVFGGLGGGTCKTTSKV  263

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
             Q FE  LK+II  K+G R N+F+EL++E V++SG+L+ LL+VQKLD ++IEGA+HVYY+
Sbjct  264  EQDFEQLLKDIIKTKDGSRANHFIELVAETVYTSGVLDHLLDVQKLDKYNIEGAVHVYYD  323

Query  366  VISQPCVVCKDL---GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +I+QPC VCK+L    +  + +F+++HSI M E   +L+++LI+ATAKD
Sbjct  324  LINQPCRVCKELEKSKTSSTSQFSSMHSIPMAEKVNVLKEFLISATAKD  372



>gb|KEH36180.1| inositol-pentakisphosphate 2-kinase-like protein [Medicago truncatula]
Length=440

 Score =   194 bits (493),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 128/167 (77%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSK+R+ KAI DLF TPQNNFRVF+NG LIFGGLGGGAE TN  
Sbjct  203  GEISLLSEYNPLDLFSGSKERIHKAINDLFTTPQNNFRVFMNGSLIFGGLGGGAEDTNLC  262

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +AFE AL +II A +G+ T  FL L++EA   SG+L+RLLEVQKLD  DIEGAIH YY
Sbjct  263  IAKAFEGALMSIIQADDGLCTENFLTLVAEAAHKSGVLDRLLEVQKLDDVDIEGAIHAYY  322

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++  Q C+VC +L     K +  LHS+S++ES ++++DYLIAAT KD
Sbjct  323  DITRQQCMVCTELNEEQMKVYTPLHSVSLDESLRVVKDYLIAATVKD  369



>emb|CDY41494.1| BnaA08g20960D [Brassica napus]
Length=455

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 98/169 (58%), Positives = 134/169 (79%), Gaps = 3/169 (2%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSGSKDR+ KAI+ L+ TPQNNFRVF+NG L+FGGLGGG   T SK 
Sbjct  204  EISEISEYDPLDLFSGSKDRIHKAIRALYATPQNNFRVFLNGSLVFGGLGGGTCKTTSKV  263

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
             Q FE  LK+II  K+G R N+F+EL++E V++SG+L+ LL+VQKLD ++IEGA+HVYY+
Sbjct  264  EQDFEHLLKDIIKTKDGSRANHFIELVAETVYTSGVLDHLLDVQKLDKYNIEGAVHVYYD  323

Query  366  VISQPCVVCKDL---GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +I+QPC VCK+L    +  + +F+++HSI M E   +L+++LI+ATAKD
Sbjct  324  LINQPCRVCKELEKSKTSSTSQFSSMHSIPMAEKVNVLKEFLISATAKD  372



>ref|XP_008219053.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Prunus mume]
 ref|XP_008219054.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Prunus mume]
Length=453

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 133/168 (79%), Gaps = 1/168 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  S Y+PLD+FSGSK+R+ KAI+DLF TPQNNFRVF+NG  IFGGLGGGA+ T+  
Sbjct  201  GEVSEYSEYNPLDLFSGSKERIHKAIRDLFSTPQNNFRVFLNGSQIFGGLGGGADSTDFV  260

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
                FEDALK +I   +G+RT  FL L++E V  SG+L+RLLEVQKLD  DI+GAIH YY
Sbjct  261  TRGKFEDALKCVIQGGDGLRTMSFLLLVAETVHKSGVLDRLLEVQKLDNLDIDGAIHAYY  320

Query  363  NVISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +++S+PC VC+  G   +S+R+ +LHSIS++ES KI++D+LIAATAKD
Sbjct  321  DIVSEPCRVCRASGKEKMSQRYLSLHSISLDESLKIVKDFLIAATAKD  368



>ref|XP_010459951.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
Length=444

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSGSKDR+ +AIK L+ TPQNNFRVF+NG L+FGGLGGG   T SK 
Sbjct  204  EISEISEYDPLDLFSGSKDRIHRAIKALYATPQNNFRVFLNGTLVFGGLGGGISKTTSKV  263

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
              AFE  LK+II   +G+R + F+EL++E V+SS +L++LL+VQKLD ++IEGAIHVYY+
Sbjct  264  EVAFEHILKDIIKTDDGLRADRFIELVAETVYSSEVLDQLLDVQKLDKYNIEGAIHVYYD  323

Query  366  VISQPCVVCKDLGSGLS-KRFNTLHSISMEESWKILRDYLIAATAKD  503
            +I QPC VC+DL    S  +++++HSI ++E  KIL+D+LI+ATAKD
Sbjct  324  LIDQPCKVCRDLEKSKSLNQYSSIHSIPLDEKVKILKDFLISATAKD  370



>ref|XP_006435038.1| hypothetical protein CICLE_v10001170mg [Citrus clementina]
 ref|XP_006435039.1| hypothetical protein CICLE_v10001170mg [Citrus clementina]
 gb|ESR48278.1| hypothetical protein CICLE_v10001170mg [Citrus clementina]
 gb|ESR48279.1| hypothetical protein CICLE_v10001170mg [Citrus clementina]
Length=442

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/167 (62%), Positives = 126/167 (75%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS  S YDPLD+FSGSK+R+ KAIK L+  PQNN RVF+NG LIFG LGGG    +   
Sbjct  208  EISERSEYDPLDLFSGSKERICKAIKALYTNPQNNLRVFLNGSLIFGSLGGGMCGNSFAF  267

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G+AFEDALK  I A  G+RT+ F++L++E V  +G+L+RLLEVQKLD FDIEGAIH YYN
Sbjct  268  GEAFEDALKCTIKADNGLRTDSFIQLVAETVHQAGILDRLLEVQKLDNFDIEGAIHAYYN  327

Query  366  VISQPCVVCKDLGSGLSKRFNT-LHSISMEESWKILRDYLIAATAKD  503
            +ISQPC VC++L    +    T LHSI M ES KI++DYLIAATAKD
Sbjct  328  IISQPCRVCRELDEEKASHLCTSLHSIPMNESLKIVKDYLIAATAKD  374



>ref|XP_007136627.1| hypothetical protein PHAVU_009G060100g [Phaseolus vulgaris]
 gb|ESW08621.1| hypothetical protein PHAVU_009G060100g [Phaseolus vulgaris]
Length=453

 Score =   192 bits (488),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 132/167 (79%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSK++  KAIK+LF +PQNNFRVF+NG LIFGGLGGGA+ TN  
Sbjct  203  GEISLLSEYNPLDLFSGSKEKTFKAIKNLFSSPQNNFRVFMNGSLIFGGLGGGAQNTNIC  262

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +AFEDALK++I + +G+RT   L L++EAV  SG+L++LL+VQKLD  DIEG IH YY
Sbjct  263  IAKAFEDALKSVIRSDDGLRTENLLTLVTEAVQKSGVLDQLLKVQKLDNVDIEGVIHAYY  322

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++  Q C++CK L +   KR+ +LHS S++ES +I++DYLIA TAKD
Sbjct  323  DITHQQCMICKHLSAEQLKRYTSLHSASLDESLRIVKDYLIATTAKD  369



>ref|XP_006280454.1| hypothetical protein CARUB_v10026386mg [Capsella rubella]
 gb|EOA13352.1| hypothetical protein CARUB_v10026386mg [Capsella rubella]
Length=451

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 129/166 (78%), Gaps = 2/166 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS  S YDPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG LI GG G     T+ + 
Sbjct  205  EISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEI  264

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G AFEDALK  I +++G RT  FL+L+S+AV+ SG+LNRLLE+QKLD  DIEGAIH YYN
Sbjct  265  GYAFEDALKGFIQSEDGQRTKCFLQLVSDAVYDSGVLNRLLEIQKLDKLDIEGAIHSYYN  324

Query  366  VISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +I+QPC +CK+     +K  ++LH++ ++ES KI+++YLIAATAKD
Sbjct  325  IINQPCPICKEARPFEAK--SSLHALPLDESLKIVKEYLIAATAKD  368



>gb|KFK31811.1| hypothetical protein AALP_AA6G161800 [Arabis alpina]
Length=470

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 128/166 (77%), Gaps = 2/166 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS +S YDPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG LI GG G     T+ + 
Sbjct  206  EISEVSEYDPLDLFSGSKERVSEAIKGLYSTPQNNFRVFLNGSLILGGSGESTGRTSPEI  265

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G AFEDALK  I + +G R N FL+L+S+AV+ S +L+RLLEVQKLD  D+EGAIH YY+
Sbjct  266  GYAFEDALKGFIQSDDGHRKNSFLQLVSDAVYESKVLDRLLEVQKLDILDVEGAIHCYYD  325

Query  366  VISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            VI+QPC +CK+   G  + +++LH++ ++ES KI++DY+ AATAKD
Sbjct  326  VINQPCPICKE--GGPLEEYSSLHALPLDESLKIVKDYMTAATAKD  369



>emb|CDX95152.1| BnaC09g17180D [Brassica napus]
Length=447

 Score =   191 bits (484),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 126/166 (76%), Gaps = 3/166 (2%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS +S YDPLD+FSGSKDR+ KA+K L+  PQNNFRVF+NG L+ GG G     T+ + 
Sbjct  204  EISEVSEYDPLDLFSGSKDRVSKAVKALYSIPQNNFRVFLNGSLVLGGSGESTGRTSPET  263

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
             Q FE+ALK  I + +G+RT  FL+L+++ V+ SG+L++LLEVQKLD  DIEGAIH YYN
Sbjct  264  AQTFEEALKGFIQSNDGLRTKCFLQLVTDTVYDSGVLDKLLEVQKLDKLDIEGAIHCYYN  323

Query  366  VISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +I+QPC +CK+ G   ++   +LH + ++ES KI+++YLIAATAKD
Sbjct  324  IINQPCPICKEAG---TEEEESLHCLPLDESLKIVKEYLIAATAKD  366



>ref|XP_010477465.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Camelina sativa]
Length=445

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 132/167 (79%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSGSKDR+ +AIK L+ TPQNNFRVF+NG L+FGGLGGG   T SK 
Sbjct  204  EISEISEYDPLDLFSGSKDRIHRAIKALYATPQNNFRVFLNGSLVFGGLGGGTCKTTSKV  263

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
              AFE  LK+II   +G+R + F+EL++E V+SS +L++LL+VQKLD ++IEGAIHVYY+
Sbjct  264  EVAFEQILKDIIKTNDGLRADRFIELVAETVYSSEVLDQLLDVQKLDKYNIEGAIHVYYD  323

Query  366  VISQPCVVCKDLGSGLS-KRFNTLHSISMEESWKILRDYLIAATAKD  503
            +I QPC VC+DL    S  +++++HSI ++E   IL+D+LI+ATAKD
Sbjct  324  LIDQPCKVCRDLEKSKSLNQYSSMHSIPLDEKVNILKDFLISATAKD  370



>ref|XP_010445901.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
Length=423

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 130/166 (78%), Gaps = 2/166 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS  S YDPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG LI GG G     T+ + 
Sbjct  177  EISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEI  236

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G AFEDALK  I +++G RT  FL+L+S+AV  SG+LNRLLE+QKLD  DIEGAIH YY+
Sbjct  237  GYAFEDALKGFIESEDGHRTKSFLQLVSDAVCGSGVLNRLLEIQKLDKLDIEGAIHSYYD  296

Query  366  VISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +I+QPC +CK+ G+ L  + ++LH++ ++ES KI+++YLIAATAKD
Sbjct  297  IINQPCPICKE-GTPLEAK-SSLHALPLDESLKIVKEYLIAATAKD  340



>ref|XP_010673136.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Beta vulgaris 
subsp. vulgaris]
Length=445

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 125/162 (77%), Gaps = 9/162 (6%)
 Frame = +3

Query  21   SAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAFE  200
            S YDPLD++SGS++R+ KA+K LF TPQNN RVF++G LI+G        TN    +AFE
Sbjct  207  SEYDPLDLYSGSRERIHKALKALFATPQNNLRVFLDGSLIYG--------TNLVKAEAFE  258

Query  201  DALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVISQP  380
            D LK+ I  ++G+RT+ F+ L+ EA+   G+L+RLLEVQKLD FD+EGAIH YY+V+S+P
Sbjct  259  DHLKSFIHGEDGLRTSSFVHLVIEAIVKLGVLDRLLEVQKLDKFDVEGAIHAYYDVVSEP  318

Query  381  CVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            C +C+D G SG  ++++ LH+IS+EES KI+RDYLIAATAKD
Sbjct  319  CKICRDSGESGKLEKYSLLHAISLEESVKIVRDYLIAATAKD  360



>ref|XP_010494238.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Camelina sativa]
Length=451

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 131/166 (79%), Gaps = 2/166 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS  S YDPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG LI GG G     T+ ++
Sbjct  205  EISEESEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPES  264

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G AFEDALK  I +++G RT  FL+L+S+AV  SG+LNRLLE+QKLD  DIEGAIH YY+
Sbjct  265  GYAFEDALKGFIESEDGHRTKSFLQLVSDAVCGSGVLNRLLEIQKLDKLDIEGAIHSYYD  324

Query  366  VISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +I+QPC +CK+ G+ +  + ++LH++ ++ES KI+++YLIAATAKD
Sbjct  325  IINQPCPICKE-GTPMEAK-SSLHALPLDESLKIVKEYLIAATAKD  368



>ref|XP_010498671.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
Length=444

 Score =   188 bits (478),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 132/167 (79%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG L+FGGLGGG   T SK 
Sbjct  204  EISEISEYDPLDLFSGSKERIHRAIKALYATPQNNFRVFLNGSLVFGGLGGGTCKTTSKV  263

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
              AFE  LK+II   +G+R + F+EL++E V+SS +L++LL+VQKLD ++IEGAIHVYY+
Sbjct  264  EVAFEHILKDIIKTDDGLRADRFIELVAETVYSSEVLDQLLDVQKLDKYNIEGAIHVYYD  323

Query  366  VISQPCVVCKDLGSGLS-KRFNTLHSISMEESWKILRDYLIAATAKD  503
            +I QPC VC+DL    S  +++++HSI ++E   IL+D+LI+ATAKD
Sbjct  324  LIDQPCKVCRDLEKSKSLNQYSSMHSIPLDEKVNILKDFLISATAKD  370



>ref|XP_006306470.1| hypothetical protein CARUB_v10012434mg [Capsella rubella]
 gb|EOA39368.1| hypothetical protein CARUB_v10012434mg [Capsella rubella]
Length=446

 Score =   187 bits (476),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 134/168 (80%), Gaps = 2/168 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +I+ IS YDPLD+FSGSKDR+ +AIK L+ TPQNNFRVF+NG L+FGGLGGG   T SK 
Sbjct  204  EITEISEYDPLDLFSGSKDRIHRAIKALYTTPQNNFRVFLNGSLVFGGLGGGICKTTSKV  263

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
              AFE  LK+II   +G+R + F+EL++E+V+SSG+L++LL+VQKLD ++IEG IH+YY+
Sbjct  264  ELAFEHMLKDIIKIDDGLRADRFIELVAESVYSSGVLDQLLDVQKLDKYNIEGVIHLYYD  323

Query  366  VISQPCVVCKDLG--SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +I QPC VC++L   S  S +++++HSI ++E   IL+D+LI+ATAKD
Sbjct  324  LIDQPCKVCRELEKISKPSNQYSSMHSIPLDEKVNILKDFLISATAKD  371



>ref|XP_002893210.1| hypothetical protein ARALYDRAFT_313098 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69469.1| hypothetical protein ARALYDRAFT_313098 [Arabidopsis lyrata subsp. 
lyrata]
Length=441

 Score =   187 bits (474),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/166 (58%), Positives = 131/166 (79%), Gaps = 5/166 (3%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSGSKDR+ KAIK L+ TPQNNFRVF+NG L+FGGLGGG   T SK 
Sbjct  204  EISEISEYDPLDLFSGSKDRILKAIKALYATPQNNFRVFLNGSLVFGGLGGGICKTTSKV  263

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
              AFE  LK+II   +G+R + F+EL++E V++SG+L++LL+VQKLD ++IEGAIHVYY+
Sbjct  264  ELAFEHILKDIIKTYDGLRADRFIELVAETVYTSGVLDQLLDVQKLDKYNIEGAIHVYYD  323

Query  366  VISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
             I QPC VC++L      +++++HSI ++E   IL+D+LI+ATAKD
Sbjct  324  FIDQPCKVCRELN-----QYSSMHSIPLDEKVNILKDFLISATAKD  364



>dbj|BAB10637.1| unnamed protein product [Arabidopsis thaliana]
Length=351

 Score =   184 bits (468),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 126/165 (76%), Gaps = 2/165 (1%)
 Frame = +3

Query  9    ISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAG  188
            IS  S YDPLD+FSGSK+ + +AIK L+ TPQNNFRVF+NG LI GG G     T+ + G
Sbjct  106  ISEESEYDPLDLFSGSKESVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIG  165

Query  189  QAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNV  368
             AFEDALK  I +++G RT  FL+L+S+AV+ SG+L+RLLE+QKLD  DIEGAIH YY++
Sbjct  166  YAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHSYYDL  225

Query  369  ISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            I+QPC +CK+ G  L     +LH++ ++ES KI+++YLIAATAKD
Sbjct  226  INQPCPICKE-GKPLEAEL-SLHALPLDESLKIVKEYLIAATAKD  268



>ref|XP_009389920.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Musa acuminata 
subsp. malaccensis]
Length=447

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 132/168 (79%), Gaps = 3/168 (2%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GKIS IS YDPLD+FSG KDR+  AI  LF  PQNNFR+F NG LIFGGLGGG + T  +
Sbjct  198  GKISQISLYDPLDLFSGLKDRIHLAITALFACPQNNFRIFFNGSLIFGGLGGGLDNTVVQ  257

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
            + +A E+A+ ++I +  G++   FLEL++EA+F SG+L++LLE Q+LD  DIEGAIHVYY
Sbjct  258  SHKA-EEAIVDLI-SPSGLQLASFLELVAEAIFRSGILDKLLETQQLDVLDIEGAIHVYY  315

Query  363  NVISQPCVVCKDL-GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ISQPCVVCK+L  + L  +++ LHS+S+EES KI+R YLIAATAKD
Sbjct  316  NIISQPCVVCKNLIDAELLHQYSFLHSLSLEESLKIVRGYLIAATAKD  363



>gb|ABK28408.1| unknown [Arabidopsis thaliana]
Length=442

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 131/166 (79%), Gaps = 5/166 (3%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG L+FGGLGGG   T SK 
Sbjct  204  EISEISEYDPLDLFSGSKERILEAIKALYTTPQNNFRVFLNGSLVFGGLGGGICKTTSKV  263

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
              AFE  LK+II   +G+R + F+EL++E V++SG+L++LL+VQKLD ++IEGAIHVYY+
Sbjct  264  ELAFEHILKDIIKTDDGLRADRFIELVAETVYTSGVLDQLLDVQKLDRYNIEGAIHVYYD  323

Query  366  VISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
             I QPC VC++L      +F+++HSI M+E   IL+++LI+ATAKD
Sbjct  324  FIDQPCKVCRELN-----QFSSMHSIPMDEKVNILKEFLISATAKD  364



>ref|NP_173629.2| Inositol-pentakisphosphate 2-kinase family protein [Arabidopsis 
thaliana]
 gb|ABE65642.1| hypothetical protein At1g22100 [Arabidopsis thaliana]
 gb|AEE30197.1| Inositol-pentakisphosphate 2-kinase family protein [Arabidopsis 
thaliana]
Length=441

 Score =   185 bits (470),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 131/166 (79%), Gaps = 5/166 (3%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG L+FGGLGGG   T SK 
Sbjct  204  EISEISEYDPLDLFSGSKERILEAIKALYTTPQNNFRVFLNGSLVFGGLGGGICKTTSKV  263

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
              AFE  LK+II   +G+R + F+EL++E V++SG+L++LL+VQKLD ++IEGAIHVYY+
Sbjct  264  ELAFEHILKDIIKTDDGLRADRFIELVAETVYTSGVLDQLLDVQKLDRYNIEGAIHVYYD  323

Query  366  VISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
             I QPC VC++L      +F+++HSI M+E   IL+++LI+ATAKD
Sbjct  324  FIDQPCKVCRELN-----QFSSMHSIPMDEKVNILKEFLISATAKD  364



>gb|AHZ62755.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Brassica napus]
Length=447

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 89/166 (54%), Positives = 124/166 (75%), Gaps = 3/166 (2%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS +S YDPL +FSGSKDR+ KA+K L+  PQNNFRVF+NG L+ GG G     T+ + 
Sbjct  204  EISEVSEYDPLHLFSGSKDRVSKAVKALYSIPQNNFRVFLNGSLVLGGSGESTGRTSPET  263

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
             Q F +ALK  I + +G+RT  FL+L+++ V+ SG+L++LLEVQKLD  DIEGAIH YYN
Sbjct  264  AQTFGEALKGFIQSNDGLRTKCFLQLVTDTVYDSGVLDKLLEVQKLDKLDIEGAIHCYYN  323

Query  366  VISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +I+QPC +CK+ G   ++   +LH + ++ES KI+++YLIAATAKD
Sbjct  324  IINQPCPICKEAG---TEEEESLHXLPLDESLKIVKEYLIAATAKD  366



>gb|AAF86558.1|AC069252_17 F2E2.17 [Arabidopsis thaliana]
Length=457

 Score =   185 bits (469),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 131/166 (79%), Gaps = 5/166 (3%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG L+FGGLGGG   T SK 
Sbjct  220  EISEISEYDPLDLFSGSKERILEAIKALYTTPQNNFRVFLNGSLVFGGLGGGICKTTSKV  279

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
              AFE  LK+II   +G+R + F+EL++E V++SG+L++LL+VQKLD ++IEGAIHVYY+
Sbjct  280  ELAFEHILKDIIKTDDGLRADRFIELVAETVYTSGVLDQLLDVQKLDRYNIEGAIHVYYD  339

Query  366  VISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
             I QPC VC++L      +F+++HSI M+E   IL+++LI+ATAKD
Sbjct  340  FIDQPCKVCRELN-----QFSSMHSIPMDEKVNILKEFLISATAKD  380



>ref|XP_006827390.1| hypothetical protein AMTR_s00011p00177280 [Amborella trichopoda]
 gb|ERM94627.1| hypothetical protein AMTR_s00011p00177280 [Amborella trichopoda]
Length=411

 Score =   184 bits (466),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/170 (57%), Positives = 125/170 (74%), Gaps = 3/170 (2%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S YDP D+FSGS+ R+ +AI+ LF+TPQNNFR+F+NG L+FGGLGG    + S 
Sbjct  169  GEISNTSKYDPCDLFSGSRGRIRQAIEALFLTPQNNFRIFLNGTLVFGGLGGYFGGSESD  228

Query  183  AGQAF---EDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIH  353
            A +A    ++AL  +I A  G R N   EL++E +F SG L RLLEVQKLD  DIEG IH
Sbjct  229  AQEALGRLDNALMGLIHAGPGQRINCCHELLAEILFKSGALVRLLEVQKLDKLDIEGVIH  288

Query  354  VYYNVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
             Y+NVISQPC VCKDLG  LS+ +  LHS+S++ES  I+++YL+AATAKD
Sbjct  289  AYFNVISQPCRVCKDLGEELSQIYQVLHSLSLKESMDIMKNYLVAATAKD  338



>ref|NP_568613.1| inositol-pentakisphosphate 2-kinase 1 [Arabidopsis thaliana]
 sp|Q93YN9.1|IPPK_ARATH RecName: Full=Inositol-pentakisphosphate 2-kinase; AltName: Full=Inositol-1,3,4,5,6-pentakisphosphate 
2-kinase; AltName: 
Full=Ins(1,3,4,5,6)P5 2-kinase; Short=AtIPK1; Short=InsP5 2-kinase 
[Arabidopsis thaliana]
 gb|AAL24380.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM13361.1| unknown protein [Arabidopsis thaliana]
 gb|AAZ99216.1| inositol polyphosphate IP4/IP5 2-kinase [Arabidopsis thaliana]
 gb|AED94867.1| inositol-pentakisphosphate 2-kinase 1 [Arabidopsis thaliana]
Length=451

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 127/166 (77%), Gaps = 2/166 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS  S YDPLD+FSGSK+ + +AIK L+ TPQNNFRVF+NG LI GG G     T+ + 
Sbjct  205  EISEESEYDPLDLFSGSKESVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEI  264

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
            G AFEDALK  I +++G RT  FL+L+S+AV+ SG+L+RLLE+QKLD  DIEGAIH YY+
Sbjct  265  GYAFEDALKGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHSYYD  324

Query  366  VISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +I+QPC +CK+ G  L     +LH++ ++ES KI+++YLIAATAKD
Sbjct  325  LINQPCPICKE-GKPLEAEL-SLHALPLDESLKIVKEYLIAATAKD  368



>ref|XP_009390179.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=461

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 132/168 (79%), Gaps = 3/168 (2%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS IS YDPLD+FSG KDR+  AI  LF +PQNNFR+F+NGCLIFGGLGG  + T+ +
Sbjct  207  GEISQISGYDPLDLFSGLKDRIHLAITALFASPQNNFRIFLNGCLIFGGLGGSMDNTDVR  266

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
            + ++ E A+ ++I A  G++   FLEL++EA+F SG+L+RLL  Q+LD  DIEGAIHVYY
Sbjct  267  SHKSGE-AIADLISAC-GLQLGSFLELVAEAIFGSGILDRLLATQQLDVLDIEGAIHVYY  324

Query  363  NVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+IS+PC VCK+     L  ++++LHS+S+++S KI+R+YLIAATAKD
Sbjct  325  NIISRPCAVCKNSSDAELLHQYSSLHSLSLDDSLKIVREYLIAATAKD  372



>ref|XP_009390180.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=452

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 132/168 (79%), Gaps = 3/168 (2%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS IS YDPLD+FSG KDR+  AI  LF +PQNNFR+F+NGCLIFGGLGG  + T+ +
Sbjct  198  GEISQISGYDPLDLFSGLKDRIHLAITALFASPQNNFRIFLNGCLIFGGLGGSMDNTDVR  257

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
            + ++ E A+ ++I A  G++   FLEL++EA+F SG+L+RLL  Q+LD  DIEGAIHVYY
Sbjct  258  SHKSGE-AIADLISAC-GLQLGSFLELVAEAIFGSGILDRLLATQQLDVLDIEGAIHVYY  315

Query  363  NVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+IS+PC VCK+     L  ++++LHS+S+++S KI+R+YLIAATAKD
Sbjct  316  NIISRPCAVCKNSSDAELLHQYSSLHSLSLDDSLKIVREYLIAATAKD  363



>ref|XP_010481940.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
Length=453

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 125/162 (77%), Gaps = 2/162 (1%)
 Frame = +3

Query  18   ISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAF  197
            +  YDPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG LI GG G     T+ + G AF
Sbjct  211  LXEYDPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAF  270

Query  198  EDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVISQ  377
            EDALK  I +++G RT  FL+L+S+AV  SG+LNRLLE+QKLD  DIEGAIH YY++I+Q
Sbjct  271  EDALKGFIESEDGHRTKSFLQLVSDAVCGSGVLNRLLEIQKLDILDIEGAIHSYYDIINQ  330

Query  378  PCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            PC +C + G+ L  + ++LH + ++ES KI+++YLIAATAKD
Sbjct  331  PCPICIE-GTPLEAK-SSLHGLPLDESLKIVKEYLIAATAKD  370



>pdb|4AXC|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase Apo Form
Length=456

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = +3

Query  30   DPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAFEDAL  209
            DPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG LI GG G     T+ + G AFEDAL
Sbjct  218  DPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDAL  277

Query  210  KNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVISQPCVV  389
            K  I +++G RT  FL+L+S+AV+ SG+L+RLLE+QKLD  DIEGAIH YY++I+QPC +
Sbjct  278  KGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPI  337

Query  390  CKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            CK+ G  L     +LH++ ++ES KI+++YLIAATAKD
Sbjct  338  CKE-GRPLEAEL-SLHALPLDESLKIVKEYLIAATAKD  373



>pdb|2XAL|A Chain A, Lead Derivative Of Inositol 1,3,4,5,6-Pentakisphosphate 
2- Kinase From A. Thaliana In Complex With Adp And Ip6.
 pdb|2XAL|B Chain B, Lead Derivative Of Inositol 1,3,4,5,6-Pentakisphosphate 
2- Kinase From A. Thaliana In Complex With Adp And Ip6.
 pdb|2XAM|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Adp And Ip6.
 pdb|2XAM|B Chain B, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Adp And Ip6.
 pdb|2XAN|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Amp Pnp And Ip5
 pdb|2XAN|B Chain B, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Amp Pnp And Ip5
 pdb|2XAO|A Chain A, Inositol 1,3,4,5,6-pentakisphosphate 2-kinase From A. 
Thaliana In Complex With Ip5
 pdb|2XAO|B Chain B, Inositol 1,3,4,5,6-pentakisphosphate 2-kinase From A. 
Thaliana In Complex With Ip5
 pdb|2XAR|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Ip6.
 pdb|2XAR|B Chain B, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Ip6.
Length=451

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = +3

Query  30   DPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAFEDAL  209
            DPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG LI GG G     T+ + G AFEDAL
Sbjct  213  DPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDAL  272

Query  210  KNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVISQPCVV  389
            K  I +++G RT  FL+L+S+AV+ SG+L+RLLE+QKLD  DIEGAIH YY++I+QPC +
Sbjct  273  KGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPI  332

Query  390  CKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            CK+ G  L     +LH++ ++ES KI+++YLIAATAKD
Sbjct  333  CKE-GRPLEAEL-SLHALPLDESLKIVKEYLIAATAKD  368



>pdb|4AXE|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase In Complex 
With Adp
Length=456

 Score =   182 bits (463),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = +3

Query  30   DPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAFEDAL  209
            DPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG LI GG G     T+ + G AFEDAL
Sbjct  218  DPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDAL  277

Query  210  KNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVISQPCVV  389
            K  I +++G RT  FL+L+S+AV+ SG+L+RLLE+QKLD  DIEGAIH YY++I+QPC +
Sbjct  278  KGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPI  337

Query  390  CKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            CK+ G  L     +LH++ ++ES KI+++YLIAATAKD
Sbjct  338  CKE-GRPLEAEL-SLHALPLDESLKIVKEYLIAATAKD  373



>gb|EPS63025.1| hypothetical protein M569_11760, partial [Genlisea aurea]
Length=439

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 123/171 (72%), Gaps = 7/171 (4%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GKIS +S YDPLDMFSGSKDR+  A+  LF TPQNNFRVF+NG LIFGG+    + ++  
Sbjct  206  GKISKLSKYDPLDMFSGSKDRVQNAVTALFETPQNNFRVFLNGSLIFGGM----DGSDFT  261

Query  183  AGQAFEDALKNIIFAKEGMR--TNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHV  356
              + F D LK++   K+  R  T  FLEL++E +F S LLNRLLEVQKLD FDIEGAIH 
Sbjct  262  VDRTFGDGLKHLFRTKDESRSHTKLFLELVAETLFESRLLNRLLEVQKLDAFDIEGAIHH  321

Query  357  YYNVISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKDL  506
            YY+VIS+ C VC   G S  S R++TLHS+  +E  K +RDYLI+ATAKDL
Sbjct  322  YYDVISENCAVCLRKGESRSSGRYSTLHSMPHDEKLKTVRDYLISATAKDL  372



>ref|XP_010940105.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Elaeis guineensis]
Length=465

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 130/170 (76%), Gaps = 7/170 (4%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS IS Y+PLD+FSGSKDR+ +AI  LF TPQNNFR+F+NG LIFGGL       +S 
Sbjct  200  GEISNISEYNPLDLFSGSKDRIYQAITTLFATPQNNFRIFLNGSLIFGGL---GGGMDSA  256

Query  183  AGQAFED--ALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHV  356
            A ++ E+  A+K++I    G++   FLEL++EA+FSSG+L++LL  QKLD  DIEGAIH 
Sbjct  257  AVRSHEENTAIKDLIKV-SGLQLPGFLELVAEAIFSSGVLDKLLATQKLDVLDIEGAIHA  315

Query  357  YYNVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            YYN+ISQPC+VCK+LG   L  +++ LHS  +++S KILRDYLIAATAKD
Sbjct  316  YYNIISQPCMVCKNLGDPELLDQYSLLHSFPLDKSLKILRDYLIAATAKD  365



>pdb|4AXD|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase In Complex 
With Amppnp
Length=456

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = +3

Query  30   DPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAFEDAL  209
            DPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG LI GG G     T+ + G AFEDAL
Sbjct  218  DPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDAL  277

Query  210  KNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVISQPCVV  389
            K  I +++G RT  FL+L+S+AV+ SG+L+RLLE+QKLD  DIEGAIH YY++I+QPC +
Sbjct  278  KGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPI  337

Query  390  CKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            C++ G  L     +LH++ ++ES KI+++YLIAATAKD
Sbjct  338  CRE-GRPLEAEL-SLHALPLDESLKIVKEYLIAATAKD  373



>ref|XP_010940107.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Elaeis guineensis]
Length=445

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 130/170 (76%), Gaps = 7/170 (4%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS IS Y+PLD+FSGSKDR+ +AI  LF TPQNNFR+F+NG LIFGGL       +S 
Sbjct  200  GEISNISEYNPLDLFSGSKDRIYQAITTLFATPQNNFRIFLNGSLIFGGL---GGGMDSA  256

Query  183  AGQAFED--ALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHV  356
            A ++ E+  A+K++I    G++   FLEL++EA+FSSG+L++LL  QKLD  DIEGAIH 
Sbjct  257  AVRSHEENTAIKDLI-KVSGLQLPGFLELVAEAIFSSGVLDKLLATQKLDVLDIEGAIHA  315

Query  357  YYNVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            YYN+ISQPC+VCK+LG   L  +++ LHS  +++S KILRDYLIAATAKD
Sbjct  316  YYNIISQPCMVCKNLGDPELLDQYSLLHSFPLDKSLKILRDYLIAATAKD  365



>pdb|3UDZ|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Adp And Ip6.
 pdb|3UDZ|B Chain B, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Adp And Ip6.
Length=493

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = +3

Query  30   DPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAFEDAL  209
            DPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG LI GG G     T+ + G AFEDAL
Sbjct  247  DPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDAL  306

Query  210  KNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVISQPCVV  389
            K  I +++G RT  FL+L+S+AV+ SG+L+RLLE+QKLD  DIEGAIH YY++I+QPC +
Sbjct  307  KGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPI  366

Query  390  CKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            CK+ G  L     +LH++ ++ES KI+++YLIAATAKD
Sbjct  367  CKE-GRPLEAEL-SLHALPLDESLKIVKEYLIAATAKD  402



>pdb|3UDS|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Adp.
 pdb|3UDS|B Chain B, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Adp.
 pdb|3UDT|A Chain A, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Adp And Ip5.
 pdb|3UDT|B Chain B, Inositol 1,3,4,5,6-Pentakisphosphate 2-Kinase From A. 
Thaliana In Complex With Adp And Ip5.
Length=493

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = +3

Query  30   DPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAFEDAL  209
            DPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG LI GG G     T+ + G AFEDAL
Sbjct  247  DPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDAL  306

Query  210  KNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVISQPCVV  389
            K  I +++G RT  FL+L+S+AV+ SG+L+RLLE+QKLD  DIEGAIH YY++I+QPC +
Sbjct  307  KGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPI  366

Query  390  CKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            CK+ G  L     +LH++ ++ES KI+++YLIAATAKD
Sbjct  367  CKE-GRPLEAEL-SLHALPLDESLKIVKEYLIAATAKD  402



>pdb|4LV7|A Chain A, Crystal Structure Of Inositol 1,3,4,5,6-pentakisphosphate 
2-kinase E82c/s142c
 pdb|4LV7|B Chain B, Crystal Structure Of Inositol 1,3,4,5,6-pentakisphosphate 
2-kinase E82c/s142c
Length=493

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = +3

Query  30   DPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAFEDAL  209
            DPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG LI GG G     T+ + G AFEDAL
Sbjct  247  DPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDAL  306

Query  210  KNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVISQPCVV  389
            K  I +++G RT  FL+L+S+AV+ SG+L+RLLE+QKLD  DIEGAIH YY++I+QPC +
Sbjct  307  KGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPI  366

Query  390  CKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            CK+ G  L     +LH++ ++ES KI+++YLIAATAKD
Sbjct  367  CKE-GRPLEAEL-SLHALPLDESLKIVKEYLIAATAKD  402



>pdb|4AQK|A Chain A, Inositol 1,3,4,5,6-pentakisphosphate 2-kinase In Complex 
With Adp And Ip6
 pdb|4AXF|A Chain A, Insp5 2-k In Complex With Ins(3,4,5,6)p4 Plus Amppnp
Length=456

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = +3

Query  30   DPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAFEDAL  209
            DPLD+FSGSK+R+ +AIK L+ TPQNNFRVF+NG LI GG G     T+ + G AFEDAL
Sbjct  218  DPLDLFSGSKERVLEAIKALYSTPQNNFRVFLNGSLILGGSGESTGRTSPEIGYAFEDAL  277

Query  210  KNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVISQPCVV  389
            K  I +++G RT  FL+L+S+AV+ SG+L+RLLE+QKLD  DIEGAIH YY++I+QPC +
Sbjct  278  KGFIQSEDGHRTECFLQLVSDAVYGSGVLDRLLEIQKLDKLDIEGAIHCYYDIINQPCPI  337

Query  390  CKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            C++ G  L     +LH++ ++ES KI+++YLIAATAKD
Sbjct  338  CRE-GRPLEAEL-SLHALPLDESLKIVKEYLIAATAKD  373



>ref|XP_004499186.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Cicer arietinum]
Length=458

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  SAY+PLD+FSGSK+R+ KAIKDLF TPQNNFR+F+NG LI GGLGGGA+ T+  
Sbjct  207  GEVSQPSAYNPLDLFSGSKERIHKAIKDLFATPQNNFRLFLNGSLILGGLGGGAKTTDVC  266

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +  ED L +II A +G+ T   L LI+EAV  SG+L++LL+VQKLD  DIEGAIH YY
Sbjct  267  IAKVLEDELNSIIQADDGLCTENLLTLITEAVQKSGVLDQLLKVQKLDNVDIEGAIHAYY  326

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++ SQ C VC++L    +KR+ +LHS S++ES +I++DYLIAATAKD
Sbjct  327  DITSQQCRVCRELSEEQAKRYASLHSASLDESLRIVKDYLIAATAKD  373



>ref|XP_004499187.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X3 
[Cicer arietinum]
Length=454

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  SAY+PLD+FSGSK+R+ KAIKDLF TPQNNFR+F+NG LI GGLGGGA+ T+  
Sbjct  203  GEVSQPSAYNPLDLFSGSKERIHKAIKDLFATPQNNFRLFLNGSLILGGLGGGAKTTDVC  262

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +  ED L +II A +G+ T   L LI+EAV  SG+L++LL+VQKLD  DIEGAIH YY
Sbjct  263  IAKVLEDELNSIIQADDGLCTENLLTLITEAVQKSGVLDQLLKVQKLDNVDIEGAIHAYY  322

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++ SQ C VC++L    +KR+ +LHS S++ES +I++DYLIAATAKD
Sbjct  323  DITSQQCRVCRELSEEQAKRYASLHSASLDESLRIVKDYLIAATAKD  369



>ref|XP_004499185.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Cicer arietinum]
Length=466

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 99/167 (59%), Positives = 130/167 (78%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  SAY+PLD+FSGSK+R+ KAIKDLF TPQNNFR+F+NG LI GGLGGGA+ T+  
Sbjct  215  GEVSQPSAYNPLDLFSGSKERIHKAIKDLFATPQNNFRLFLNGSLILGGLGGGAKTTDVC  274

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +  ED L +II A +G+ T   L LI+EAV  SG+L++LL+VQKLD  DIEGAIH YY
Sbjct  275  IAKVLEDELNSIIQADDGLCTENLLTLITEAVQKSGVLDQLLKVQKLDNVDIEGAIHAYY  334

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++ SQ C VC++L    +KR+ +LHS S++ES +I++DYLIAATAKD
Sbjct  335  DITSQQCRVCRELSEEQAKRYASLHSASLDESLRIVKDYLIAATAKD  381



>ref|XP_007227480.1| hypothetical protein PRUPE_ppa006527mg [Prunus persica]
 gb|EMJ28679.1| hypothetical protein PRUPE_ppa006527mg [Prunus persica]
Length=407

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  S Y+PLD+FSGSKDR+ KAI+DLF TPQNNFRVF+NG  IFGGLGGGA+ T+  
Sbjct  201  GEVSEYSEYNPLDLFSGSKDRMHKAIRDLFSTPQNNFRVFLNGSQIFGGLGGGADSTDFV  260

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
                FEDALK +I   +G+RT  FL L++E V  SG+L+RLLEVQKLD  DI+GAIH YY
Sbjct  261  TRGKFEDALKCVIQGGDGLRTMSFLLLVAETVHKSGVLDRLLEVQKLDNLDIDGAIHAYY  320

Query  363  NVISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKIL  470
            +++S+PC VC+  G   +S+R+ +LHSIS++ES KI+
Sbjct  321  DIVSEPCRVCRASGKEKISQRYLSLHSISLDESLKIV  357



>ref|XP_008795958.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X5 [Phoenix 
dactylifera]
 ref|XP_008795959.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X5 [Phoenix 
dactylifera]
Length=373

 Score =   176 bits (445),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 129/171 (75%), Gaps = 9/171 (5%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSKDR+ +A+  LF TPQNNFR+F+NG LIFGGLGGG + +  +
Sbjct  119  GEISKVSEYNPLDLFSGSKDRIYQAMTALFATPQNNFRIFLNGSLIFGGLGGGMDSSAVR  178

Query  183  AGQ---AFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIH  353
            + +   A ED +K       G++   FLEL+SE +FSSG+L++LL  QKLD  DIEGAIH
Sbjct  179  SHETNTAIEDLIK-----VSGLQLPSFLELVSETIFSSGVLDQLLATQKLDVLDIEGAIH  233

Query  354  VYYNVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
             YYN+ISQPC+VCK+ G   L  ++++LHS+ +E+  KI+RDYLIA+TAKD
Sbjct  234  AYYNIISQPCMVCKNSGDPELLDQYSSLHSLPLEKRLKIVRDYLIASTAKD  284



>ref|XP_008795955.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Phoenix 
dactylifera]
Length=432

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 129/171 (75%), Gaps = 9/171 (5%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSKDR+ +A+  LF TPQNNFR+F+NG LIFGGLGGG + +  +
Sbjct  178  GEISKVSEYNPLDLFSGSKDRIYQAMTALFATPQNNFRIFLNGSLIFGGLGGGMDSSAVR  237

Query  183  AGQ---AFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIH  353
            + +   A ED +K       G++   FLEL+SE +FSSG+L++LL  QKLD  DIEGAIH
Sbjct  238  SHETNTAIEDLIK-----VSGLQLPSFLELVSETIFSSGVLDQLLATQKLDVLDIEGAIH  292

Query  354  VYYNVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
             YYN+ISQPC+VCK+ G   L  ++++LHS+ +E+  KI+RDYLIA+TAKD
Sbjct  293  AYYNIISQPCMVCKNSGDPELLDQYSSLHSLPLEKRLKIVRDYLIASTAKD  343



>ref|XP_008795949.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Phoenix 
dactylifera]
 ref|XP_008795950.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Phoenix 
dactylifera]
 ref|XP_008795951.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Phoenix 
dactylifera]
 ref|XP_008795953.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Phoenix 
dactylifera]
 ref|XP_008795954.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Phoenix 
dactylifera]
 ref|XP_008795960.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Phoenix 
dactylifera]
Length=454

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 129/171 (75%), Gaps = 9/171 (5%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSKDR+ +A+  LF TPQNNFR+F+NG LIFGGLGGG + +  +
Sbjct  200  GEISKVSEYNPLDLFSGSKDRIYQAMTALFATPQNNFRIFLNGSLIFGGLGGGMDSSAVR  259

Query  183  AGQ---AFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIH  353
            + +   A ED +K       G++   FLEL+SE +FSSG+L++LL  QKLD  DIEGAIH
Sbjct  260  SHETNTAIEDLIK-----VSGLQLPSFLELVSETIFSSGVLDQLLATQKLDVLDIEGAIH  314

Query  354  VYYNVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
             YYN+ISQPC+VCK+ G   L  ++++LHS+ +E+  KI+RDYLIA+TAKD
Sbjct  315  AYYNIISQPCMVCKNSGDPELLDQYSSLHSLPLEKRLKIVRDYLIASTAKD  365



>gb|KEH40178.1| inositol-pentakisphosphate 2-kinase-like protein [Medicago truncatula]
Length=447

 Score =   174 bits (441),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S Y+PLD+FSGSK+R+ KA+KDLF TPQNNFRVF+NG LI GGLGGGAE T++ 
Sbjct  203  GEISQRSVYNPLDLFSGSKERIHKAVKDLFTTPQNNFRVFLNGSLILGGLGGGAESTDAS  262

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +  ED L+++I A +G  T     L++EAV  SG+L++LLEVQKLD  DIEG IH YY
Sbjct  263  IAKVLEDELQSVIQADDGQCTENLFTLVTEAVQKSGVLDKLLEVQKLDNIDIEGVIHAYY  322

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ SQ  +  K L    +K++ +LHS S+EES +I++DYLIAATAKD
Sbjct  323  NITSQQSMARKALDEEQAKKYASLHSASLEESLRIVKDYLIAATAKD  369



>ref|XP_010061286.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Eucalyptus 
grandis]
 ref|XP_010061287.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Eucalyptus 
grandis]
 ref|XP_010061288.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Eucalyptus 
grandis]
 ref|XP_010061289.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Eucalyptus 
grandis]
 gb|KCW68220.1| hypothetical protein EUGRSUZ_F01873 [Eucalyptus grandis]
Length=448

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 90/167 (54%), Positives = 121/167 (72%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +I  +S YDPLD+FSGSK+R+  A+K L   PQNNFRVF+N  LI GG GG  + + S  
Sbjct  202  QIPNLSEYDPLDLFSGSKERILVALKALCNNPQNNFRVFLNNSLILGGFGGAVDNSTSTT  261

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
             +A ED LK +I   +G++T  FLEL++E V+ SG+L+RLL+VQKLD +DIEGAIH YYN
Sbjct  262  AEALEDVLKYVIKEDDGLQTTSFLELLTETVYKSGVLDRLLDVQKLDNYDIEGAIHAYYN  321

Query  366  VISQPCVVCKDLGSGLSKRFNT-LHSISMEESWKILRDYLIAATAKD  503
             ISQPC VC++LG       +T LH++ + ES +I++ +LIAATAKD
Sbjct  322  FISQPCSVCRELGEDKVSPISTLLHALPLNESLEIVKKFLIAATAKD  368



>ref|XP_010240557.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Brachypodium 
distachyon]
Length=454

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 126/168 (75%), Gaps = 5/168 (3%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G++S  S YDPLD+FSGSK+R+  AIK  F TPQNNFR+FVNG L+FGG+GGGA+  +  
Sbjct  200  GEVSKTSEYDPLDLFSGSKERIHTAIKSFFSTPQNNFRIFVNGSLVFGGMGGGADKVHPN  259

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +   + L  +     G++ + F+EL+SEA++ SG+L++LL  QKLD  DIEGAIH+YY
Sbjct  260  ETEKCLEDLSKV----SGLQLSDFIELLSEAIYKSGVLDKLLATQKLDDHDIEGAIHLYY  315

Query  363  NVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ SQPC+VCK++    L +++  LHS+S+++S KI+RD+LI+ATAKD
Sbjct  316  NITSQPCLVCKNISDAELLRKYAVLHSLSLDKSCKIIRDFLISATAKD  363



>gb|KEH40179.1| inositol-pentakisphosphate 2-kinase-like protein [Medicago truncatula]
Length=478

 Score =   174 bits (442),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S Y+PLD+FSGSK+R+ KA+KDLF TPQNNFRVF+NG LI GGLGGGAE T++ 
Sbjct  234  GEISQRSVYNPLDLFSGSKERIHKAVKDLFTTPQNNFRVFLNGSLILGGLGGGAESTDAS  293

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +  ED L+++I A +G  T     L++EAV  SG+L++LLEVQKLD  DIEG IH YY
Sbjct  294  IAKVLEDELQSVIQADDGQCTENLFTLVTEAVQKSGVLDKLLEVQKLDNIDIEGVIHAYY  353

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ SQ  +  K L    +K++ +LHS S+EES +I++DYLIAATAKD
Sbjct  354  NITSQQSMARKALDEEQAKKYASLHSASLEESLRIVKDYLIAATAKD  400



>ref|XP_010539889.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X3 [Tarenaya 
hassleriana]
Length=408

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSG+KDR+ KAI+ L  TPQNNFRVF+NG L+FG   GG   T  K 
Sbjct  204  EISEISQYDPLDLFSGTKDRIHKAIRALSGTPQNNFRVFLNGSLVFGNFDGGIGKTTVKV  263

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
              AFE  LK II A +G+  + F++L+++ +++SG+L++LL  QKLD FDIEG IH YY+
Sbjct  264  EHAFELLLKGIISAGDGLCADNFIQLVTDTIYTSGVLDQLLGAQKLDKFDIEGVIHAYYD  323

Query  366  VISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +  Q C VC+    S +S +++++HS+ ++ES  I+++YLIAATAKD
Sbjct  324  ITGQACTVCRGSDESKISSQYSSMHSVPLDESLNIVKNYLIAATAKD  370



>gb|AGZ03654.1| inositol pentakisphosphate 2-kinase [Glycine max]
Length=456

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSK+R+ KAIK L  TPQNNFRVF+NG LI GGLGG A+ T+  
Sbjct  205  GEISQLSEYNPLDLFSGSKERILKAIKSLLTTPQNNFRVFLNGSLILGGLGGVAKNTDVC  264

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +AFED LK+II A + + TN    L++EA+  SG+L++LL+VQKLD  D+EG IH YY
Sbjct  265  IAKAFEDELKSIIRADDDLCTNNLSTLVTEALQKSGVLDKLLKVQKLDNIDVEGVIHAYY  324

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ SQ C+VCK+L    +K +  LHS S++ES +I++DYLIA TAKD
Sbjct  325  NITSQQCMVCKELSEEQAKIYTPLHSASLDESLRIVKDYLIATTAKD  371



>ref|NP_001237433.1| inositol pentakisphosphate 2-kinase [Glycine max]
 ref|XP_006595481.1| PREDICTED: inositol pentakisphosphate 2-kinase isoform X1 [Glycine 
max]
 ref|XP_006595482.1| PREDICTED: inositol pentakisphosphate 2-kinase isoform X2 [Glycine 
max]
 gb|ABU93829.1| inositol pentakisphosphate 2-kinase [Glycine max]
 gb|KHN20959.1| Inositol-pentakisphosphate 2-kinase [Glycine soja]
Length=456

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/167 (57%), Positives = 126/167 (75%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSK+R+ KAIK L  TPQNNFRVF+NG LI GGLGG A+ T+  
Sbjct  205  GEISQLSEYNPLDLFSGSKERILKAIKGLLTTPQNNFRVFLNGSLILGGLGGVAKNTDVC  264

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +AFED LK+II A + + TN    L++EA+  SG+L++LL+VQKLD  DIEG IH YY
Sbjct  265  IAKAFEDELKSIIRADDDLCTNNLSTLVTEALQKSGVLDKLLKVQKLDNIDIEGVIHAYY  324

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ SQ C+VCK+L    +K +  LHS S++ES +I++DYLIA TAKD
Sbjct  325  NITSQQCMVCKELSEEQAKIYTPLHSASLDESLRIVKDYLIATTAKD  371



>ref|NP_001054147.1| Os04g0661200 [Oryza sativa Japonica Group]
 emb|CAE02901.1| OSJNBa0015K02.18 [Oryza sativa Japonica Group]
 dbj|BAF16061.1| Os04g0661200 [Oryza sativa Japonica Group]
 dbj|BAG95743.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78180.1| hypothetical protein OsI_17777 [Oryza sativa Indica Group]
 gb|EEE61843.1| hypothetical protein OsJ_16498 [Oryza sativa Japonica Group]
Length=445

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 127/168 (76%), Gaps = 5/168 (3%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S YDPLD+FSGSK+R+  AIK  F TPQNNFR+FV+G L+FGG+GGGA+  +  
Sbjct  200  GEISKTSEYDPLDLFSGSKERIHMAIKSFFSTPQNNFRIFVDGSLVFGGMGGGADSVHPN  259

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +   + L  +     G++ + F+EL+SEA+F SG+L +LL  QKLD  DIEGAIH+YY
Sbjct  260  ETEKCLEDLSKVT----GLQLSDFIELLSEAIFKSGVLGKLLATQKLDDHDIEGAIHLYY  315

Query  363  NVISQPCVVCKDL-GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ISQPC+VCK +  + L ++++TLHS+ +++S KI+RD+LI+ATAKD
Sbjct  316  NIISQPCLVCKSITDTELLRKYSTLHSLPLDKSEKIVRDFLISATAKD  363



>ref|XP_007160728.1| hypothetical protein PHAVU_001G012200g [Phaseolus vulgaris]
 gb|ESW32722.1| hypothetical protein PHAVU_001G012200g [Phaseolus vulgaris]
Length=466

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSK+R+ KAIK L  TPQNNFRVF+NG LI GGLGG A+ T+  
Sbjct  205  GEISRLSEYNPLDLFSGSKERIKKAIKGLLTTPQNNFRVFLNGSLILGGLGGVAKNTDIC  264

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              + FED LK+ I   + +RT     L++EA+  SG+L++LLEVQKLD+ DIEG IH YY
Sbjct  265  IAKEFEDELKSFIQVDDVLRTENLFTLVTEALQKSGVLDKLLEVQKLDSIDIEGVIHAYY  324

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ S+ CVVCK+L    +K + +LHS S +ES +I++DYLIAATAKD
Sbjct  325  NITSEQCVVCKELSEEQAKTYASLHSASFDESLRIVKDYLIAATAKD  371



>emb|CAH67064.1| H0112G12.9 [Oryza sativa Indica Group]
Length=445

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 126/168 (75%), Gaps = 5/168 (3%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S YDPLD+FSGSK+R+  AIK  F TPQNNFR+FV+G L+FGG+GG A+  +  
Sbjct  200  GEISKASEYDPLDLFSGSKERIHMAIKSFFSTPQNNFRIFVDGSLVFGGMGGXADSVHPN  259

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +   + L  +     G++ + F+EL+SEA+F SG+L +LL  QKLD  DIEGAIH+YY
Sbjct  260  ETEKCLEDLSKVT----GLQLSDFIELLSEAIFKSGVLGKLLATQKLDDHDIEGAIHLYY  315

Query  363  NVISQPCVVCKDL-GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ISQPC+VCK +  + L ++++TLHS+ +++S KI+RD+LI+ATAKD
Sbjct  316  NIISQPCLVCKSITDTELLRKYSTLHSLPLDKSEKIVRDFLISATAKD  363



>ref|XP_010539888.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Tarenaya 
hassleriana]
Length=417

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSG+KDR+ KAI+ L  TPQNNFRVF+NG L+FG   GG   T  K 
Sbjct  166  EISEISQYDPLDLFSGTKDRIHKAIRALSGTPQNNFRVFLNGSLVFGNFDGGIGKTTVKV  225

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
              AFE  LK II A +G+  + F++L+++ +++SG+L++LL  QKLD FDIEG IH YY+
Sbjct  226  EHAFELLLKGIISAGDGLCADNFIQLVTDTIYTSGVLDQLLGAQKLDKFDIEGVIHAYYD  285

Query  366  VISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +  Q C VC+    S +S +++++HS+ ++ES  I+++YLIAATAKD
Sbjct  286  ITGQACTVCRGSDESKISSQYSSMHSVPLDESLNIVKNYLIAATAKD  332



>ref|XP_007160729.1| hypothetical protein PHAVU_001G012200g [Phaseolus vulgaris]
 gb|ESW32723.1| hypothetical protein PHAVU_001G012200g [Phaseolus vulgaris]
Length=489

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/167 (57%), Positives = 125/167 (75%), Gaps = 0/167 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSK+R+ KAIK L  TPQNNFRVF+NG LI GGLGG A+ T+  
Sbjct  205  GEISRLSEYNPLDLFSGSKERIKKAIKGLLTTPQNNFRVFLNGSLILGGLGGVAKNTDIC  264

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              + FED LK+ I   + +RT     L++EA+  SG+L++LLEVQKLD+ DIEG IH YY
Sbjct  265  IAKEFEDELKSFIQVDDVLRTENLFTLVTEALQKSGVLDKLLEVQKLDSIDIEGVIHAYY  324

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ S+ CVVCK+L    +K + +LHS S +ES +I++DYLIAATAKD
Sbjct  325  NITSEQCVVCKELSEEQAKTYASLHSASFDESLRIVKDYLIAATAKD  371



>ref|NP_564736.1| Inositol-pentakisphosphate 2-kinase-like protein [Arabidopsis 
thaliana]
 ref|NP_564739.1| Inositol-pentakisphosphate 2-kinase-like protein [Arabidopsis 
thaliana]
 ref|NP_683442.1| Inositol-pentakisphosphate 2-kinase family protein [Arabidopsis 
thaliana]
 gb|AAK62785.1|AC027036_6 hypothetical protein [Arabidopsis thaliana]
 gb|AAK62795.1|AC027036_16 hypothetical protein [Arabidopsis thaliana]
 gb|AEE33558.1| Inositol-pentakisphosphate 2-kinase family protein [Arabidopsis 
thaliana]
 gb|AEE33566.1| Inositol-pentakisphosphate 2-kinase-like protein [Arabidopsis 
thaliana]
 gb|AEE33575.1| Inositol-pentakisphosphate 2-kinase-like protein [Arabidopsis 
thaliana]
Length=486

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 125/169 (74%), Gaps = 3/169 (2%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSGSKDR+ KAIK L+ TPQN+ +VF+NG L+FGG  GG   T SK 
Sbjct  240  QISQISEYDPLDLFSGSKDRIHKAIKALYSTPQNSLQVFLNGSLVFGGFRGGICKTTSKL  299

Query  186  GQAFEDALKNIIFAKE--GMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVY  359
              AFE  LK+    ++  G+R N F+EL++E V++SG L++LLEVQKLD ++IEGAIH Y
Sbjct  300  ELAFEHTLKDFFKTEDDCGLRANAFIELVAETVYASGALDQLLEVQKLDKYNIEGAIHAY  359

Query  360  YNVISQPCVVCKDL-GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            Y+++ QPC  C++L  S LS +F ++HS+  +E   IL+D+LI++TA D
Sbjct  360  YDLVDQPCKACQELESSKLSNQFGSMHSLPQDEKVNILKDFLISSTAID  408



>ref|XP_010539886.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539887.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Tarenaya 
hassleriana]
Length=455

 Score =   172 bits (436),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 122/167 (73%), Gaps = 1/167 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSG+KDR+ KAI+ L  TPQNNFRVF+NG L+FG   GG   T  K 
Sbjct  204  EISEISQYDPLDLFSGTKDRIHKAIRALSGTPQNNFRVFLNGSLVFGNFDGGIGKTTVKV  263

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYN  365
              AFE  LK II A +G+  + F++L+++ +++SG+L++LL  QKLD FDIEG IH YY+
Sbjct  264  EHAFELLLKGIISAGDGLCADNFIQLVTDTIYTSGVLDQLLGAQKLDKFDIEGVIHAYYD  323

Query  366  VISQPCVVCKDLG-SGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            +  Q C VC+    S +S +++++HS+ ++ES  I+++YLIAATAKD
Sbjct  324  ITGQACTVCRGSDESKISSQYSSMHSVPLDESLNIVKNYLIAATAKD  370



>gb|AEM36353.1| At1g59312 [Arabidopsis thaliana]
Length=486

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 125/169 (74%), Gaps = 3/169 (2%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSGSKDR+ KAIK L+ TPQN+ +VF+NG L+FGG  GG   T SK 
Sbjct  240  QISQISEYDPLDLFSGSKDRIHKAIKALYSTPQNSLQVFLNGSLVFGGFRGGICKTTSKL  299

Query  186  GQAFEDALKNIIFAKE--GMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVY  359
              AFE  LK+    ++  G+R N F+EL++E V++SG L++LLEVQKLD ++IEGAIH Y
Sbjct  300  ELAFEHKLKDFFKTEDDCGLRANAFIELVAETVYASGALDQLLEVQKLDKYNIEGAIHAY  359

Query  360  YNVISQPCVVCKDL-GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            Y+++ QPC  C++L  S LS +F ++HS+  +E   IL+D+LI++TA D
Sbjct  360  YDLVDQPCKACQELESSKLSNQFGSMHSLPQDEKVNILKDFLISSTAID  408



>dbj|BAG68917.1| hypothetical protein [Arabidopsis thaliana]
Length=475

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 124/170 (73%), Gaps = 5/170 (3%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSGSKDR+ KAIK L+ TPQN+ +VF+NG L+FGG  GG   T SK 
Sbjct  229  QISQISEYDPLDLFSGSKDRIHKAIKALYSTPQNSLQVFLNGSLVFGGFRGGICKTTSKL  288

Query  186  GQAFEDALKNIIFAKE---GMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHV  356
              AFE  L N  F  E   G+R N F+EL++E V++SG L++LLEVQKLD ++IEGAIH 
Sbjct  289  ELAFEHTL-NDFFKTEDDSGLRANAFIELVAETVYASGALDQLLEVQKLDKYNIEGAIHA  347

Query  357  YYNVISQPCVVCKDL-GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            YY+++ QPC  C++L  S LS +F ++HS+  +E   IL+D+LI++TA D
Sbjct  348  YYDLVDQPCKACQELESSKLSNQFGSMHSLPQDEKVNILKDFLISSTAID  397



>emb|CAM33431.1| Ins5P-2kinase [Phaseolus vulgaris]
 emb|CAX94845.1| inositol 1,3,4,5,6 pentakisphosphate 2-kinase [Phaseolus vulgaris]
 emb|CAX94846.1| inositol 1,3,4,5,6 pentakisphosphate 2-kinase [Phaseolus vulgaris]
Length=352

 Score =   167 bits (423),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSK++  KAIK+LF +PQNNFRVF+NG LIFGGLGGGA+ TN  
Sbjct  203  GEISLLSEYNPLDLFSGSKEKTFKAIKNLFSSPQNNFRVFMNGSLIFGGLGGGAQNTNIC  262

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +AFEDALK++I + +G+RT   L L++EAV  SG+L++LL+VQKLD  DIEG IH YY
Sbjct  263  IAKAFEDALKSVIRSDDGLRTENLLTLVTEAVQKSGVLDQLLKVQKLDNVDIEGVIHAYY  322

Query  363  NVISQPCVVCKDLGSGLSKRFNTLHSIS  446
            ++  Q C++CK L +   KR+ +LHS S
Sbjct  323  DITHQQCMICKHLSAEQLKRYTSLHSAS  350



>ref|XP_002888206.1| hypothetical protein ARALYDRAFT_475379 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64465.1| hypothetical protein ARALYDRAFT_475379 [Arabidopsis lyrata subsp. 
lyrata]
Length=486

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 87/169 (51%), Positives = 124/169 (73%), Gaps = 3/169 (2%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS Y+PLD+FSGSKDR+ KAIK L+ TPQN+ +VF+NG L+FGG  GG   T  K 
Sbjct  240  QISQISEYNPLDLFSGSKDRIHKAIKALYSTPQNSLQVFLNGSLVFGGFRGGICKTTPKL  299

Query  186  GQAFEDALKNIIFAKE--GMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVY  359
              AFE  LK+    ++  G+R N F+EL++E V++SG L++LL+VQKLD ++IEGAIH Y
Sbjct  300  ELAFEHKLKDFFKTEDDSGVRANTFIELVTETVYASGALDQLLDVQKLDKYNIEGAIHAY  359

Query  360  YNVISQPCVVCKDL-GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            Y+++ +PC  C++L  S LS +F ++HSI  +E   IL+D+LI++TA D
Sbjct  360  YDLVDKPCKACQELESSKLSNQFGSMHSIPQDEKVNILKDFLISSTATD  408



>ref|XP_006302305.1| hypothetical protein CARUB_v10020353mg [Capsella rubella]
 gb|EOA35203.1| hypothetical protein CARUB_v10020353mg [Capsella rubella]
Length=422

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 120/169 (71%), Gaps = 3/169 (2%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSGSK R+ +AIK L+ TPQNNF+VF+NG L+FGG   G   T S  
Sbjct  205  EISEISEYDPLDLFSGSKGRIHRAIKALYATPQNNFQVFLNGSLVFGGFRSGICKTTSTV  264

Query  186  GQAFEDALKNIIFAKE--GMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVY  359
              AFE+ LK+ I  ++  G+R N F+EL++E V++SG L++LL VQKLD + IEG IH Y
Sbjct  265  ELAFENILKDFIKTEDEGGIRANSFIELVAETVYASGALDQLLNVQKLDKYSIEGVIHAY  324

Query  360  YNVISQPCVVCKDL-GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            Y++I QPC  C++L  S LS  F ++H++  +E   IL+ +LI++TA D
Sbjct  325  YDLIDQPCKACQELENSKLSNPFGSMHAMPQDEKVNILKGFLISSTAVD  373



>ref|XP_004960165.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Setaria italica]
 ref|XP_004960166.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Setaria italica]
Length=452

 Score =   164 bits (414),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 125/169 (74%), Gaps = 7/169 (4%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTN-S  179
            G+IS  S Y+PLD+FSGSK+R+  AIK  F TPQNNFRVFVNG L+FGG+GGGA+  + +
Sbjct  202  GEISTPSEYNPLDLFSGSKERICIAIKSFFSTPQNNFRVFVNGSLVFGGMGGGADNVHPA  261

Query  180  KAGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVY  359
            +  +  +D  K       G+    F+EL+SEA+F SG+L +LL  QKLD  DIEGAIH+Y
Sbjct  262  ETDKCLQDLSK-----VSGLELPDFIELLSEAIFRSGVLGKLLITQKLDDHDIEGAIHLY  316

Query  360  YNVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            Y++ISQPC+VCK++    L +++  LHS+ +++S KI+RD+L++ATAKD
Sbjct  317  YSIISQPCLVCKNVTDAELLRKYTLLHSLPLDKSLKIVRDFLVSATAKD  365



>ref|XP_010511060.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
 ref|XP_010511061.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
 ref|XP_010511062.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
 ref|XP_010511063.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
Length=444

 Score =   163 bits (413),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 116/164 (71%), Gaps = 2/164 (1%)
 Frame = +3

Query  18   ISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAF  197
            IS YDPLD+FSGSKDR+ KAIK L+ TPQ NFRVF+NG L+FGG  G      SK   AF
Sbjct  210  ISKYDPLDLFSGSKDRIHKAIKALYATPQTNFRVFLNGSLVFGGFRGSKCIATSKDELAF  269

Query  198  EDALKNIIFAK-EGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVIS  374
            E  LK II  + + +R N F+EL++E +++SG L++LLEVQKLD ++IE  IH YY++I 
Sbjct  270  EHILKGIIKTEDDSVRANSFIELVAETIYASGALDQLLEVQKLDRYNIEAVIHAYYDLID  329

Query  375  QPCVVCKDL-GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
             PC  C++L  S LS +F  +H++  +E   IL+++LI++TA D
Sbjct  330  HPCKACQELEKSKLSNQFGAMHAMPQDEKVNILKNFLISSTATD  373



>ref|XP_010414720.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
 ref|XP_010414721.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
Length=448

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 115/164 (70%), Gaps = 2/164 (1%)
 Frame = +3

Query  18   ISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAF  197
            IS YD LD+FSGSKDR+ KAIK L+ TPQ NFRVF+NG L+FG   G    + SK   AF
Sbjct  211  ISEYDSLDLFSGSKDRIHKAIKALYATPQTNFRVFLNGSLVFGSFRGSKCISTSKDELAF  270

Query  198  EDALKNIIFAKEGM-RTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVIS  374
            E  LK II  ++ + R N F+EL++E V++SG L++LLEVQKLD ++IE  IH YY++I 
Sbjct  271  EHILKGIIKTEDDIVRANSFIELVAETVYASGALDQLLEVQKLDKYNIEAVIHAYYDLID  330

Query  375  QPCVVCKDL-GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
             PC  C++L  S LS +F  +H++  +E   IL++YLI++TA D
Sbjct  331  HPCKACQELEKSKLSHQFGAMHAMPQDEKVNILKNYLISSTATD  374



>ref|XP_006652958.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006652959.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X2 
[Oryza brachyantha]
Length=451

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 122/168 (73%), Gaps = 5/168 (3%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S Y+PLD+FSGSK+ +  AIK  F TPQNNFR+FVNG L+FGG+GGG +  +  
Sbjct  200  GEISKTSEYNPLDLFSGSKEGIHMAIKSFFSTPQNNFRIFVNGSLVFGGMGGGVDNVHPN  259

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +   + L  +     G++ + F+EL+SEA+F SG+L +LL  QKLD  DIEGAIH+YY
Sbjct  260  ETEKCIEDLSKVT----GLQLSDFIELLSEAIFKSGVLGKLLATQKLDDHDIEGAIHLYY  315

Query  363  NVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ISQPC+VC+ +    L  +++ LHS+ +++S +I+RD+LI+ATAKD
Sbjct  316  NIISQPCLVCRSISDPELLCKYSILHSLPLDKSERIVRDFLISATAKD  363



>dbj|BAJ91392.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86878.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=454

 Score =   161 bits (408),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 125/168 (74%), Gaps = 5/168 (3%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S YDPLD+FSGSK+R+  AIK  F TPQNNFR+FVNG L FGG+GGGA+   + 
Sbjct  200  GQISKTSEYDPLDLFSGSKERIRTAIKSFFSTPQNNFRIFVNGSLGFGGMGGGADKVLAN  259

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +   + L+ +     G++ + F+EL+SEA+  SG+L++LL  QKLD  DIEGAIH+YY
Sbjct  260  ETEKCLEDLRKV----SGLQLSDFIELLSEAISKSGVLDKLLATQKLDDHDIEGAIHLYY  315

Query  363  NVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ISQPCVVCK++    L  +++ LHS+ +++S KI+R++LI+ATAKD
Sbjct  316  NIISQPCVVCKNITDAELLHKYSVLHSLPLDKSCKIVREFLISATAKD  363



>ref|XP_010474037.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
Length=452

 Score =   159 bits (402),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 117/164 (71%), Gaps = 2/164 (1%)
 Frame = +3

Query  18   ISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAF  197
            +S YDPLD+FSGSKDR+ +AIK L+ TPQ NFRVF+NG L+FG   G    T SK   AF
Sbjct  220  VSEYDPLDLFSGSKDRIHEAIKALYATPQTNFRVFLNGSLVFGDFRGSKCITTSKVELAF  279

Query  198  EDALKNIIFAK-EGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVIS  374
            +  LK I+  + + +  + F+EL+++ +++SG L++LL VQKLD ++IEG IH YY++I 
Sbjct  280  KHILKRILKTEDDDVCASSFIELVADTIYASGALDQLLHVQKLDKYNIEGVIHAYYDLID  339

Query  375  QPCVVCKDL-GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            QPC  C++L  S LS +F  +HS+S +E   IL+++LI++TA D
Sbjct  340  QPCKACQELENSKLSNQFGAMHSMSHDEKVNILKNFLISSTATD  383



>ref|NP_001183320.1| uncharacterized protein LOC100501721 [Zea mays]
 gb|ACR36415.1| unknown [Zea mays]
Length=526

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 118/168 (70%), Gaps = 5/168 (3%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S Y+PLD+FS SK+R+  AIK  F TPQNNFR+FVNG L FGG+GGGA+  +  
Sbjct  288  GEISKTSEYNPLDLFSESKERISMAIKSFFSTPQNNFRIFVNGSLAFGGMGGGADSVHP-  346

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
               A  D     +    G+    F EL+SE +F SG+L +LL  QKLD  DIEGAIH+YY
Sbjct  347  ---ADTDKCIKDLSKVSGLELPDFTELLSETIFKSGVLGKLLTTQKLDDHDIEGAIHLYY  403

Query  363  NVISQPCVVCKDLGS-GLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ISQPC+VCK+L    L +++  LHS+ +++S KI+R++LI+ATAKD
Sbjct  404  NIISQPCLVCKNLTDVELLRKYTLLHSLPLDKSLKIVRNFLISATAKD  451



>tpg|DAA35552.1| TPA: hypothetical protein ZEAMMB73_927289 [Zea mays]
Length=526

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 118/168 (70%), Gaps = 5/168 (3%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S Y+PLD+FS SK+R+  AIK  F TPQNNFR+FVNG L FGG+GGGA+  +  
Sbjct  288  GEISKTSEYNPLDLFSESKERISMAIKSFFSTPQNNFRIFVNGSLAFGGMGGGADSVHP-  346

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
               A  D     +    G+    F EL+SE +F SG+L +LL  QKLD  DIEGAIH+YY
Sbjct  347  ---ADTDKCIKDLSKVSGLELPDFTELLSETIFKSGVLGKLLTTQKLDDHDIEGAIHLYY  403

Query  363  NVISQPCVVCKDLGS-GLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ISQPC+VCK+L    L +++  LHS+ +++S KI+R++LI+ATAKD
Sbjct  404  NIISQPCLVCKNLTDVELLRKYTLLHSLPLDKSLKIVRNFLISATAKD  451



>gb|AFW59738.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Zea mays]
Length=372

 Score =   157 bits (397),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 117/168 (70%), Gaps = 5/168 (3%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S Y+PLD+FSGSK+R+  AIK LF TPQNN R+FVNG L FGG+GGGA+  +  
Sbjct  134  GEISKTSEYNPLDLFSGSKERICMAIKSLFSTPQNNLRIFVNGSLAFGGMGGGADSVHPA  193

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
                  + L  I     G++   F EL+SE +F S +L  LL  QKLD  DIEG IH+YY
Sbjct  194  DTLKCLEDLSKI----SGLKLPDFTELLSETIFRSEVLGNLLATQKLDDHDIEGVIHLYY  249

Query  363  NVISQPCVVCKDLGS-GLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ISQPC+VCK+L    L +++  LHS+ +++S KI+RD+LI+ATAKD
Sbjct  250  NIISQPCLVCKNLTDVELLRKYTFLHSLPLDKSLKIVRDFLISATAKD  297



>ref|XP_010414722.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Camelina 
sativa]
Length=442

 Score =   158 bits (400),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 117/168 (70%), Gaps = 2/168 (1%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +I  +S YDPLD+FSGSKDR+ KAIK L+ TPQ NFRVF+NG L+FGG  G    T SK 
Sbjct  206  EILKVSEYDPLDLFSGSKDRIHKAIKALYATPQTNFRVFLNGSLVFGGFRGSKCITTSKV  265

Query  186  GQAFEDALKNIIFAK-EGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              AF   LK I+  + + +  + F+EL++E +++SG L++LL VQKLD ++IEG +H YY
Sbjct  266  ELAFNHILKGILKTEDDDVCASSFIELVAETIYASGALDQLLHVQKLDKYNIEGVVHAYY  325

Query  363  NVISQPCVVCKDL-GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++I QPC  C++L    LS  F  +HS+S +E   IL+++LI++TA D
Sbjct  326  DLIDQPCKACQELEKRKLSNHFGAMHSMSHDEKVNILKNFLISSTATD  373



>gb|EMT22168.1| Inositol-pentakisphosphate 2-kinase [Aegilops tauschii]
Length=493

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 123/168 (73%), Gaps = 5/168 (3%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S YDPLD+FSGSK+R+  AIK  F TPQNNFR+FVNG L FGG+GGGA+   + 
Sbjct  200  GQISKTSEYDPLDLFSGSKERIRTAIKSFFSTPQNNFRIFVNGSLGFGGMGGGADKILAN  259

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              +   + L+ +     G++ + F+EL+SEA+  SG L++LL  QKLD  DIE AIH+YY
Sbjct  260  ETEKCLEDLRKV----SGLQLSDFIELLSEAISKSGALDKLLATQKLDDHDIEAAIHLYY  315

Query  363  NVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ISQPC+VCK++    L  +++ LHS+ +++S KI+RD+LI+ATAKD
Sbjct  316  NIISQPCLVCKNITDAELLHKYSVLHSLPLDKSCKIVRDFLISATAKD  363



>ref|NP_001106063.1| LOC100126363 [Zea mays]
 gb|ABR92616.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Zea mays]
Length=440

 Score =   157 bits (398),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 117/168 (70%), Gaps = 5/168 (3%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S Y+PLD+FSGSK+R+  AIK LF TPQNN R+FVNG L FGG+GGGA+  +  
Sbjct  202  GEISKTSEYNPLDLFSGSKERICMAIKSLFSTPQNNLRIFVNGSLAFGGMGGGADSVHPA  261

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
                  + L  I     G++   F EL+SE +F S +L  LL  QKLD  DIEG IH+YY
Sbjct  262  DTLKCLEDLSKI----SGLKLPDFTELLSETIFRSEVLGNLLATQKLDDHDIEGVIHLYY  317

Query  363  NVISQPCVVCKDLGS-GLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ISQPC+VCK+L    L +++  LHS+ +++S KI+RD+LI+ATAKD
Sbjct  318  NIISQPCLVCKNLTDVELLRKYTFLHSLPLDKSLKIVRDFLISATAKD  365



>gb|AFW59740.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase isoform 1 [Zea 
mays]
 gb|AFW59741.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase isoform 2 [Zea 
mays]
Length=440

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 117/168 (70%), Gaps = 5/168 (3%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S Y+PLD+FSGSK+R+  AIK LF TPQNN R+FVNG L FGG+GGGA+  +  
Sbjct  202  GEISKTSEYNPLDLFSGSKERICMAIKSLFSTPQNNLRIFVNGSLAFGGMGGGADSVHPA  261

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
                  + L  I     G++   F EL+SE +F S +L  LL  QKLD  DIEG IH+YY
Sbjct  262  DTLKCLEDLSKI----SGLKLPDFTELLSETIFRSEVLGNLLATQKLDDHDIEGVIHLYY  317

Query  363  NVISQPCVVCKDLGS-GLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ISQPC+VCK+L    L +++  LHS+ +++S KI+RD+LI+ATAKD
Sbjct  318  NIISQPCLVCKNLTDVELLRKYTFLHSLPLDKSLKIVRDFLISATAKD  365



>ref|NP_001106053.1| inositol polyphosphate 2-kinase [Zea mays]
 gb|ABE03696.1| inositol polyphosphate 2-kinase [Zea mays]
 gb|ABO33318.1| inositol phosphate kinase 1A [Zea mays]
Length=440

 Score =   157 bits (398),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 117/168 (70%), Gaps = 5/168 (3%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS  S Y+PLD+FSGSK+R+  AIK LF TPQNN R+FVNG L FGG+GGGA+  +  
Sbjct  202  GEISKTSEYNPLDLFSGSKERICMAIKSLFSTPQNNLRIFVNGSLAFGGMGGGADSVHPA  261

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
                  + L  I     G++   F EL+SE +F S +L  LL  QKLD  DIEG IH+YY
Sbjct  262  DTLKCLEDLSKI----SGLKLPDFTELLSETIFRSEVLGNLLATQKLDDHDIEGVIHLYY  317

Query  363  NVISQPCVVCKDLGS-GLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            N+ISQPC+VCK+L    L +++  LHS+ +++S KI+RD+LI+ATAKD
Sbjct  318  NIISQPCLVCKNLTDVELLRKYTFLHSLPLDKSLKIVRDFLISATAKD  365



>gb|ABK24850.1| unknown [Picea sitchensis]
Length=508

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 88/229 (38%), Positives = 120/229 (52%), Gaps = 63/229 (28%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAE------  167
            +IS IS Y PLD+FS S+DR+ +AI+ LF TPQNN R+F NG L+FGGLGG AE      
Sbjct  205  EISCISKYSPLDLFSESRDRIHRAIEGLFETPQNNLRIFWNGSLVFGGLGGYAEQGLCNG  264

Query  168  PTNSKAGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGA  347
            PT +   +  ED LK++I  + G R   F +L++E +  + +L+ LL VQK+D +DIEGA
Sbjct  265  PTINSLARELEDTLKSVILCQSGERVAIFKDLVTETLLRTRILSHLLAVQKMDLYDIEGA  324

Query  348  IHVYYNVISQPCVVC-------------------------KDLGSGLSK-----------  419
            IH Y+NVI  PC +C                         KD+    S            
Sbjct  325  IHAYFNVIQVPCHICPHSVSEAGNLNEAENIEINPDEPIEKDMQENNSDLHFPSSITESL  384

Query  420  -----------RFNTLH----------SISMEESWKILRDYLIAATAKD  503
                        F+ LH          S+S+EES +I+RD+L+A TAKD
Sbjct  385  SEEHMEKHTQGNFSYLHSSKNECSHLHSLSIEESRRIVRDFLLATTAKD  433



>ref|XP_008795956.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X3 [Phoenix 
dactylifera]
Length=425

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 102/138 (74%), Gaps = 9/138 (7%)
 Frame = +3

Query  102  QNNFRVFVNGCLIFgglgggAEPTNSKAGQ---AFEDALKNIIFAKEGMRTNYFLELISE  272
            +NNFR+F+NG LIFGGLGGG + +  ++ +   A ED +K       G++   FLEL+SE
Sbjct  204  KNNFRIFLNGSLIFGGLGGGMDSSAVRSHETNTAIEDLIK-----VSGLQLPSFLELVSE  258

Query  273  AVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVISQPCVVCKDLGSG-LSKRFNTLHSISM  449
             +FSSG+L++LL  QKLD  DIEGAIH YYN+ISQPC+VCK+ G   L  ++++LHS+ +
Sbjct  259  TIFSSGVLDQLLATQKLDVLDIEGAIHAYYNIISQPCMVCKNSGDPELLDQYSSLHSLPL  318

Query  450  EESWKILRDYLIAATAKD  503
            E+  KI+RDYLIA+TAKD
Sbjct  319  EKRLKIVRDYLIASTAKD  336



>ref|XP_002992945.1| hypothetical protein SELMODRAFT_136205 [Selaginella moellendorffii]
 gb|EFJ06034.1| hypothetical protein SELMODRAFT_136205 [Selaginella moellendorffii]
Length=451

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 105/178 (59%), Gaps = 11/178 (6%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAE-PTNS  179
            GKI   S+Y PLD+FSG++D + KA+  LF +PQNN RVF +G  IF G   GA+  T+S
Sbjct  205  GKIRSSSSYCPLDLFSGTRDGIIKALNALFKSPQNNLRVFKDGNRIFTGSVDGAQDSTDS  264

Query  180  KAGQ-AFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHV  356
             A +   E +L +   +  G R +   +LI+E + SS  L +LL+ Q+LD+ DIEG IH+
Sbjct  265  SASRDLLERSLVDFTDSVTGQRLDVLEKLIAEILHSSETLRKLLQTQQLDSLDIEGVIHL  324

Query  357  YYNVISQPCVVCKDLGSGLS------KR---FNTLHSISMEESWKILRDYLIAATAKD  503
            YY+ +   C  C    +G S      KR   F + HS+  +E  + L  +LIAATAKD
Sbjct  325  YYSFVGLHCPECGSDKTGCSIDSDVDKRSVLFASPHSMPADEQRRNLCKFLIAATAKD  382



>ref|XP_002980010.1| hypothetical protein SELMODRAFT_111972 [Selaginella moellendorffii]
 gb|EFJ18880.1| hypothetical protein SELMODRAFT_111972 [Selaginella moellendorffii]
Length=451

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 105/178 (59%), Gaps = 11/178 (6%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAE-PTNS  179
            GKI   S+Y PLD+FSG++D + KA+  LF +PQNN RVF +G  IF G   GA+  T+S
Sbjct  205  GKIRSSSSYCPLDLFSGTRDGIIKALNALFKSPQNNLRVFKDGNRIFTGSVDGAQDSTDS  264

Query  180  KAGQ-AFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHV  356
             A +   E +L +   +  G R +   +LI+E + SS  L +LL+ Q+LD+ DIEG IH+
Sbjct  265  SASRDLLERSLVDFTDSVTGQRLDVLEKLIAEILHSSETLRKLLQTQQLDSLDIEGVIHL  324

Query  357  YYNVISQPCVVCKDLGSGLS------KR---FNTLHSISMEESWKILRDYLIAATAKD  503
            YY+ +   C  C    +G S      KR   F + HS+  +E  + L  +LIAATAKD
Sbjct  325  YYSFVGLHCPECGSDKTGCSIDSDVDKRSVLFASHHSMPADEQRRNLCKFLIAATAKD  382



>ref|XP_001757602.1| predicted protein [Physcomitrella patens]
 gb|EDQ77659.1| predicted protein [Physcomitrella patens]
Length=435

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 98/171 (57%), Gaps = 20/171 (12%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GK   IS Y PLD+FSGS +R+ KA+ DLF TPQNN RVF+ G  +F        P + +
Sbjct  210  GKAKAISKYSPLDLFSGSDERIIKALVDLFETPQNNVRVFLEGEQVF------GAPADGQ  263

Query  183  A----GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAI  350
            +      + E+ L  +  A EG R + F  L++ A+  S  L++LL VQKLDT+DIEGAI
Sbjct  264  SIDEEVSSLEEKLAAVSVAPEGERVSVFQRLVASALNKSKALDQLLRVQKLDTYDIEGAI  323

Query  351  HVYYNVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
              Y   +        ++     K +  + S++ E+S  ++R++LIA TAKD
Sbjct  324  LAYDKFM--------EMADNADKEW--IKSLTWEQSCCVVRNFLIAGTAKD  364



>emb|CDP17915.1| unnamed protein product [Coffea canephora]
Length=236

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 73/102 (72%), Gaps = 0/102 (0%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +I  IS YDPLDMFSG+KDR+ K IK L+ T Q NF VF+NG L+FG L GG + TN   
Sbjct  89   QILEISDYDPLDMFSGAKDRVHKVIKALYNTSQINFGVFLNGSLVFGSLDGGTKSTNYMV  148

Query  186  GQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLE  311
            GQ  EDALK++I A  GM T   LELI+EA+  SGLL+RLLE
Sbjct  149  GQDIEDALKHVIMADNGMVTEKLLELITEALLRSGLLDRLLE  190



>ref|XP_001761338.1| predicted protein [Physcomitrella patens]
 gb|EDQ73727.1| predicted protein [Physcomitrella patens]
Length=483

 Score =   107 bits (268),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 102/176 (58%), Gaps = 13/176 (7%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GKI  +S Y PLD+FSG+ + + KA+  +F TPQNN R+F+ G  IFGG   G   + ++
Sbjct  235  GKIKTMSKYCPLDLFSGNVEGIHKALVQMFETPQNNIRIFLKGVEIFGGPEDGG--STNE  292

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVY-  359
               A E+ L  ++ A EG R   F  L++  +  S +L++LL +QKLDT+ IEGA   Y 
Sbjct  293  LMVALEEKLGAVMVAPEGERVLIFQRLVASVLNKSKVLDQLLRLQKLDTYAIEGANLAYS  352

Query  360  --------YNVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
                      ++S  C  C+D      K +  + S+S EES  ++R++LIAATAKD
Sbjct  353  KFTGMTDDAGLLSAVCSFCQDTQKKRDKAW--IKSLSWEESRCVVRNFLIAATAKD  406



>gb|AEM36351.1| At1g58936-like protein [Arabidopsis thaliana]
Length=177

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 73/104 (70%), Gaps = 2/104 (2%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA  185
            +IS IS YDPLD+FSG KDR+ KAIK L+ TPQNNF+VFVNG L+FGG  GG   T SK 
Sbjct  3    QISQISEYDPLDLFSGFKDRIHKAIKALYTTPQNNFQVFVNGSLVFGGFRGGLCKTTSKL  62

Query  186  GQAFEDALKNIIFAKE--GMRTNYFLELISEAVFSSGLLNRLLE  311
              AFE  LK+ I  ++   +   +F+EL++E V +S  L++LL+
Sbjct  63   ELAFEHLLKDFIKTQDNSSLHAKHFIELVAEIVNASRALDQLLD  106



>tpg|DAA64566.1| TPA_exp: non-functional inositol-pentakisphosphate 2-kinase 277 
[Ricinus communis]
Length=277

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/69 (70%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +3

Query  12   SYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQ  191
            S +S YDPLD+FSGSK+R+ KAI DL+ TPQNNFRVF+NG LIFGGLGGG   T+   GQ
Sbjct  205  SEVSQYDPLDIFSGSKERIQKAISDLYATPQNNFRVFLNGSLIFGGLGGGTNKTSIVIGQ  264

Query  192  AFEDALKNI  218
             FEDALK I
Sbjct  265  GFEDALKGI  273



>ref|XP_008795957.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X4 [Phoenix 
dactylifera]
Length=404

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/168 (35%), Positives = 87/168 (52%), Gaps = 53/168 (32%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G+IS +S Y+PLD+FSGSKDR+ +A+  LF TPQNNFR+F+NG                 
Sbjct  200  GEISKVSEYNPLDLFSGSKDRIYQAMTALFATPQNNFRIFLNG-----------------  242

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
                      ++IF   G                 G+ +  +   + +T  IE  I    
Sbjct  243  ----------SLIFGGLG----------------GGMDSSAVRSHETNTA-IEDLI----  271

Query  363  NVISQPCVVCKDLGSG-LSKRFNTLHSISMEESWKILRDYLIAATAKD  503
                +PC+VCK+ G   L  ++++LHS+ +E+  KI+RDYLIA+TAKD
Sbjct  272  ----KPCMVCKNSGDPELLDQYSSLHSLPLEKRLKIVRDYLIASTAKD  315



>ref|XP_004349251.1| hypothetical protein CAOG_02501 [Capsaspora owczarzaki ATCC 30864]
 gb|EFW44476.1| hypothetical protein CAOG_02501 [Capsaspora owczarzaki ATCC 30864]
Length=456

 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 62/196 (32%), Positives = 95/196 (48%), Gaps = 29/196 (15%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G I   S Y PLD+FSG++ R+++A+  L   PQNN RVF NG  I  G       +NS+
Sbjct  180  GSIDRRSRYCPLDLFSGTRHRVERALHSLVDVPQNNVRVFRNGRAILTGDKAPPADSNSR  239

Query  183  AGQA-FEDALKNIIFA------KEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIE  341
            A  A  +  L +++ A       +      F+ L++E +    LL RL   Q+LD  DIE
Sbjct  240  AYIAELDRHLVDLVPAAADDSDAQPPHVQTFVSLLAEILLQEPLLQRLQAAQRLDHLDIE  299

Query  342  GAIHVYYNVISQ-PC------------------VVCKDLGSGLSKRFNTLH---SISMEE  455
            G   +Y +VI + P                   VV + L    +    ++H   ++S++E
Sbjct  300  GLKGLYDSVIERHPVGQDHWLWDGRFDAPEWSRVVQQALARSSTAPSLSVHDVAALSLDE  359

Query  456  SWKILRDYLIAATAKD  503
               I+ +YL+AAT KD
Sbjct  360  KAAIIAEYLLAATVKD  375



>ref|XP_005832271.1| hypothetical protein GUITHDRAFT_108933 [Guillardia theta CCMP2712]
 gb|EKX45291.1| hypothetical protein GUITHDRAFT_108933 [Guillardia theta CCMP2712]
Length=420

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 87/173 (50%), Gaps = 24/173 (14%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GKI+ IS+YDPLD+FSG   R+  A++++   PQN FRV+V            + P+++ 
Sbjct  185  GKITSISSYDPLDLFSGDLLRMQTAVRNMMQDPQNVFRVWV-----------CSGPSSAI  233

Query  183  AGQAFEDALKNIIFAKEGMRTNY-----FLELISEAVFSSGLLNRLLEVQKLDTFDIEGA  347
                 E+ L+ ++    G+  ++     F  L ++ V  S +L R+ E+Q LD  DIE  
Sbjct  234  RHLGSEEELREVL-GSPGLSRSWESEEDFCRLFAKVVQHSKVLVRIRELQALDALDIENI  292

Query  348  IHVYYNVISQPCVVCKDLGSGLSKRFNTLHSISMEESW-KILRDYLIAATAKD  503
             H++       C+   D  S    R +    +     W +++ +YLIA +AKD
Sbjct  293  YHMHR------CLANPDEYSEADARSSAPAKLPPVGDWDRLIEEYLIAHSAKD  339



>dbj|GAM24665.1| hypothetical protein SAMD00019534_078400 [Acytostelium subglobosum 
LB1]
Length=384

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/173 (32%), Positives = 82/173 (47%), Gaps = 11/173 (6%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G I +IS+Y PLD+FSG  +R  +AI+ L   PQNN +++ +G L + G  GG E     
Sbjct  157  GSIHHISSYCPLDLFSGDAERQRRAIRALIECPQNNLKIYKDGQLFYTGTLGGGEKARKD  216

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVF----SSGLLNRLLEVQKLDTFDIEGAI  350
                F D L            +    L+   V        +LN LL+ Q+ D  DIE   
Sbjct  217  ILTLFPDEL-----VASQSHDDTAARLVETVVTILQKEKDVLNNLLKAQQYDDMDIEAIY  271

Query  351  HVYYNVISQPCVVCKDLGSGLS--KRFNTLHSISMEESWKILRDYLIAATAKD  503
            ++Y  ++ +       L +      RF +L  I+ EE+ + +  YLIA TAKD
Sbjct  272  YLYTLLLQRQQQDTSSLPNNYDDLDRFASLKDITSEEAERHIERYLIATTAKD  324



>ref|XP_007017602.1| Inositol-pentakisphosphate 2-kinase 1, putative isoform 2 [Theobroma 
cacao]
 gb|EOY14827.1| Inositol-pentakisphosphate 2-kinase 1, putative isoform 2 [Theobroma 
cacao]
Length=390

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            +IS  S Y+PLD+FSGS+DR+ KAIK L+ TPQNNFRVF+NG  +F
Sbjct  203  EISEYSEYNPLDLFSGSRDRICKAIKALYATPQNNFRVFLNGSRVF  248


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = +3

Query  384  VVCKDLGS-GLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            VVC++L +  LS ++ +LHSI ++ES KI++DYL+AATAKD
Sbjct  262  VVCRELSNDKLSHQYTSLHSIPLDESLKIVKDYLMAATAKD  302



>ref|XP_007017601.1| Inositol-pentakisphosphate 2-kinase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY14826.1| Inositol-pentakisphosphate 2-kinase family protein, putative 
isoform 1 [Theobroma cacao]
Length=492

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            +IS  S Y+PLD+FSGS+DR+ KAIK L+ TPQNNFRVF+NG  +F
Sbjct  203  EISEYSEYNPLDLFSGSRDRICKAIKALYATPQNNFRVFLNGSRVF  248


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 34/41 (83%), Gaps = 1/41 (2%)
 Frame = +3

Query  384  VVCKDLGS-GLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
            VVC++L +  LS ++ +LHSI ++ES KI++DYL+AATAKD
Sbjct  262  VVCRELSNDKLSHQYTSLHSIPLDESLKIVKDYLMAATAKD  302



>emb|CCI44944.1| unnamed protein product [Albugo candida]
Length=787

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/139 (32%), Positives = 68/139 (49%), Gaps = 22/139 (16%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVN---GCLIFgglgggAEPT  173
            GKI  +SAY PLD+FSG+ DR+ KA+  L  TPQNNFR FV    G ++    G  A+  
Sbjct  313  GKIDEVSAYCPLDLFSGNYDRVRKALCALQSTPQNNFRAFVRSSEGEVVNAITGMNADAL  372

Query  174  NSKAGQA----------FEDALKNIIFAKEGMRTNY---------FLELISEAVFSSGLL  296
               A +A          +  +  +I    E   + +          +EL+++ +    +L
Sbjct  373  PKGASRASYSCHRKRLGYRHSCHSIGTEAEAESSKFGTEEHVIFDLVELLADVLLGHTVL  432

Query  297  NRLLEVQKLDTFDIEGAIH  353
            N L E+Q LD  +++G  H
Sbjct  433  NDLKEMQMLDHINVDGMWH  451



>gb|EJW78215.1| hypothetical protein WUBG_10877 [Wuchereria bancrofti]
Length=263

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 51/174 (29%), Positives = 77/174 (44%), Gaps = 31/174 (18%)
 Frame = +3

Query  27   YD--PLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAFE  200
            YD  PLD+FSG   R+ KA+  LF+ P  N R+F++G LI           +S   Q   
Sbjct  31   YDFCPLDLFSGDLKRMRKALNSLFVVPHRNLRIFLDGTLI-----------HSDEHQLTS  79

Query  201  DALKNIIFAKEGMRTNYFLELISE-----------AVFSSGLLNRLLEVQKLDTFDIEGA  347
            + L  ++F    +     +  +             AV  SG+L +LL  Q++DT  I  A
Sbjct  80   EQLHELLFRDTSVSVQQLISALCCILVNAPSDDLFAVHDSGVLTKLLNGQRIDTIGIVRA  139

Query  348  IHVYYNVISQPCVVCKDL--GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
              +Y N+      V K+L     L K+  T   +       ++  YL+AAT KD
Sbjct  140  YQIYTNLSE---TVQKELLDKCLLPKKDVTF--LHQNTDRALVERYLLAATMKD  188



>ref|XP_008199701.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Tribolium 
castaneum]
 ref|XP_008199702.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Tribolium 
castaneum]
Length=457

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 65/211 (31%), Positives = 100/211 (47%), Gaps = 49/211 (23%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNG-------CLIFgglggg  161
            G+I+ IS+Y P+D+FSG   R+  A+K L  +PQNNF+VF NG       C I       
Sbjct  185  GQINSISSYCPVDLFSGEPSRMVSALKALIDSPQNNFKVFKNGELYYGENCEIELFKNFI  244

Query  162  AEPTNSKAGQAFEDALKNI-IFAKEGMRTNY-------------FLE---LISEAVFSSG  290
            AE   ++  + +E  ++   +  K+ + TN+             F E   +I E  F + 
Sbjct  245  AEFFRTER-ETYETLVREFCVLVKQCLLTNFATIEKTNNCNMKLFCEWNKIIQENSFQTK  303

Query  291  L-----LNRLLEVQKLDTFDIEGAIHVYYNVISQPCV----VCKDLGSGLSKRFNT----  431
            L     L R+L VQ L   D+EG    YY ++++  +      K+L   +S+R  T    
Sbjct  304  LPKGCVLERILSVQML---DVEGN-QYYYKLLAKKKLGEYDYVKELVKEVSRRPGTCLKC  359

Query  432  ----LHSIS---MEESWKILRDYLIAATAKD  503
                L +I    M E+  +L  YLI+A AKD
Sbjct  360  IVMMLGNIDEKIMRENHLVLVPYLISAIAKD  390



>ref|XP_003294485.1| hypothetical protein DICPUDRAFT_43505 [Dictyostelium purpureum]
 gb|EGC28988.1| hypothetical protein DICPUDRAFT_43505 [Dictyostelium purpureum]
Length=482

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 88/190 (46%), Gaps = 37/190 (19%)
 Frame = +3

Query  9    ISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAG  188
            I  IS Y P+D+FSG   R + +IK++   PQNN +++ NG L F         T S  G
Sbjct  217  IGDISNYCPIDLFSGDPKRQEYSIKEMINHPQNNLKIYYNGVLSF---------TGSLGG  267

Query  189  QAFEDALKN------IIFAKEGMRT------------------NYFLELISEAVFSSGLL  296
             A  D L N      +++  + +R                   + F +L++  +    +L
Sbjct  268  GAERDQLSNCKILSSLLYENDIIRVSSNGQEEGVENIDIHSTIDAFSKLVTIILNRETIL  327

Query  297  NRLLEVQKLDTFDIEGAIHVYYNVISQPCVVCKDLGSGLSKRF-NTLHSISMEESWKILR  473
            + + +VQ  D +DIEG  ++Y  +        K+    +SK   + L+ +S ++   I+ 
Sbjct  328  SSIKKVQLFDEYDIEGIYYIYNKLNGNE---SKNQSLDISKESQDQLNQLSTDQMKDIIN  384

Query  474  DYLIAATAKD  503
             ++I+ TAKD
Sbjct  385  RFMISCTAKD  394



>ref|XP_002287547.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED94990.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=503

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 63/123 (51%), Gaps = 13/123 (11%)
 Frame = +3

Query  21   SAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAFE  200
            S Y PLD+FSG+  R  +A+ ++ +  QNNFRV+ NG L+F       E   +   Q+ +
Sbjct  180  SKYCPLDLFSGNLIRTIQAVTEMSLNMQNNFRVWCNGSLMF-------EEYETPTDQSCQ  232

Query  201  DALKNIIFAKEGMRT------NYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
              L N+     GM           ++++++ + +  +LN L ++Q  D  D +GA  VY 
Sbjct  233  KILNNLFGNNTGMADAKSILLRVIVDIVAKVLINEPVLNNLQQMQMRDVIDGDGATLVYE  292

Query  363  NVI  371
             ++
Sbjct  293  RLV  295



>ref|XP_003141648.1| hypothetical protein LOAG_06064 [Loa loa]
 gb|EFO22421.1| hypothetical protein LOAG_06064 [Loa loa]
Length=444

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/174 (30%), Positives = 77/174 (44%), Gaps = 31/174 (18%)
 Frame = +3

Query  27   YD--PLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAFE  200
            YD  PLD+FSG   R+ KA+  LF  P  N R+F++G LI           +S   Q   
Sbjct  203  YDFCPLDLFSGDLKRMRKALNSLFKVPHRNLRIFLDGSLI-----------HSDERQLTG  251

Query  201  DALKNIIFAKEGMRTNYFLELISE-----------AVFSSGLLNRLLEVQKLDTFDIEGA  347
            + L+  +F    +     +  +             AV  SG+L +LL  Q++DT  I  A
Sbjct  252  EQLRESLFRDGSVSVQQLISALCCILVDAPSDDLFAVHDSGVLTKLLNGQRVDTIGIVRA  311

Query  348  IHVYYNVISQPCVVCKDL--GSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
              +Y N+   P  V K+L     L K+  T   +       ++  YL+AAT KD
Sbjct  312  YQIYTNL---PETVQKELLDKCLLPKKGVTF--LHQNTDRALVERYLLAATMKD  360



>emb|CDQ05695.1| Protein Bm6305, isoform b [Brugia malayi]
Length=441

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/179 (28%), Positives = 76/179 (42%), Gaps = 41/179 (23%)
 Frame = +3

Query  27   YD--PLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAFE  200
            YD  PLD+FSG   R+ KA+  LF+ P  N R+F++G LI           +S   Q   
Sbjct  202  YDFCPLDLFSGDLKRMRKALNSLFVVPHRNLRIFLDGSLI-----------HSDENQLTS  250

Query  201  DALKNIIFAKEGMRTNYFLELISE-----------AVFSSGLLNRLLEVQKLDTFDIEGA  347
            + L  ++F    +     +  +             AV  SG+L +LL  Q++DT  I  A
Sbjct  251  EQLHELLFRDTSVSVQQLITALCCILVNAPSDDLFAVHDSGVLTKLLNGQRIDTIGIVRA  310

Query  348  IHVYYNV-------ISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
              +Y N+       +   C++ K       K    LH         ++  YL+AAT KD
Sbjct  311  YQIYTNLSETMQKELLDKCLLPK-------KDVTFLHQ---NTDRALVERYLLAATMKD  359



>emb|CCA21884.1| conserved hypothetical protein [Albugo laibachii Nc14]
Length=631

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 67/140 (48%), Gaps = 22/140 (16%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVN---GCLIFgglgggAEPT  173
            GK+  +SAY PLD+FSG   R+ KA+  L  TPQNNFR FV    G ++    G  A+  
Sbjct  313  GKVDEVSAYCPLDLFSGDPHRVRKALCALQSTPQNNFRAFVRSSEGEVVNAITGMNADAL  372

Query  174  NSKAGQA----------FEDALKNIIFAKEGMRTNY---------FLELISEAVFSSGLL  296
               A +A          +  +  +I    E   + +          +EL+++ +    +L
Sbjct  373  PKGASRASYSCHRKRLGYRHSCHSIGTEAEAEISKFGTEEHVIFDLVELLADVLLGHTVL  432

Query  297  NRLLEVQKLDTFDIEGAIHV  356
            N L E+Q LD  +++G  H+
Sbjct  433  NDLKEMQMLDHINVDGLWHM  452



>ref|XP_009823933.1| hypothetical protein H257_02125 [Aphanomyces astaci]
 gb|ETV87134.1| hypothetical protein H257_02125 [Aphanomyces astaci]
Length=474

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 59/115 (51%), Gaps = 23/115 (20%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GK+   SAY PLD+FS  K R+ +A+  L  TPQNN RVF + C              ++
Sbjct  194  GKVVRASAYCPLDLFSNDKARIARALTSLSSTPQNNLRVF-SSC--------------TE  238

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSS-GLLNRLLEVQKLDTFDIEG  344
            AG + E + ++ + A +       L+L+ E + S   LL+ L  +   DT DIEG
Sbjct  239  AGDSLEHSAEHSMAADQ-------LDLVVELLHSHVDLLDDLKAMHAKDTLDIEG  286



>emb|CBN74385.1| conserved unknown protein [Ectocarpus siliculosus]
Length=519

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 38/130 (29%), Positives = 64/130 (49%), Gaps = 6/130 (5%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G I     Y P +++SG   R    +K+L  TPQN  R + NG ++FG   G      ++
Sbjct  217  GSIDRPCLYHPRELYSGDAGRAAATLKELMKTPQNKLRAWENGNMLFGAGSGKGGEDMTE  276

Query  183  AGQ-AFEDALKNIIFAK-----EGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEG  344
            +G+ A E AL   + A      +G      ++L+ E +    L++RL+  Q LD  ++EG
Sbjct  277  SGETAGEVALGKAVVAARLAGGDGTPAEALMDLVGEILAKEPLVSRLVAAQALDVLEVEG  336

Query  345  AIHVYYNVIS  374
               V+  ++S
Sbjct  337  GGLVFDKLVS  346



>gb|ELU02473.1| hypothetical protein CAPTEDRAFT_191375 [Capitella teleta]
Length=430

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK + +S Y PLD+FSG + R+  A+K+LF  PQNN R+F +G LIF
Sbjct  165  GKWASVSGYCPLDLFSGDEQRMTFALKELFRNPQNNLRIFQDGNLIF  211



>emb|CDY00419.1| BnaC07g14070D [Brassica napus]
Length=258

 Score = 56.6 bits (135),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +3

Query  6    KISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRV  119
            +IS  S YDPLD+FSGSKDR+ K I+ L+ TPQNN +V
Sbjct  182  EISETSEYDPLDLFSGSKDRIHKVIRALYATPQNNLKV  219



>ref|XP_002074949.1| GK23328 [Drosophila willistoni]
 gb|EDW85935.1| GK23328 [Drosophila willistoni]
Length=648

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GKI  +S Y P+D+FSG+  R+  A+  LF  PQNN RVF NG LI+
Sbjct  279  GKIKQLSGYCPMDLFSGAPGRMLDALNALFACPQNNLRVFQNGNLIY  325



>ref|XP_008479233.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Diaphorina citri]
Length=483

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  9    ISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            +S +S Y PLD+FSG K R+ KAIK L  TPQNN R+F NG L F
Sbjct  192  VSSLSDYCPLDLFSGDKTRMLKAIKSLLRTPQNNVRIFQNGNLKF  236



>ref|NP_001014346.1| inositol-pentakisphosphate 2-kinase [Danio rerio]
 gb|AAH91783.1| Inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Danio rerio]
 gb|AAI65752.1| Ippk protein [Danio rerio]
Length=483

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 55/113 (49%), Gaps = 6/113 (5%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFggl-gggAEPTNS  179
            GK   +S Y PLD+FSGSK R+  A+K+L   PQNN ++F  G LIF        +P  +
Sbjct  176  GKWKRLSRYCPLDLFSGSKQRMYVALKNLLEEPQNNLKIFKGGELIFSCKDDAKQQPDLN  235

Query  180  KAGQAFEDALKNIIFAKEGMRT-----NYFLELISEAVFSSGLLNRLLEVQKL  323
               Q       +      G +      N F+++I  A+ S G  NR  E +K+
Sbjct  236  NLIQHLRPYFPHTNGLYNGHQPGKVILNEFIQVICSALLSGGDSNRSGEPRKM  288



>ref|XP_007322116.1| hypothetical protein SERLADRAFT_475955 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO21159.1| hypothetical protein SERLADRAFT_475955 [Serpula lacrymans var. 
lacrymans S7.9]
Length=426

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 65/126 (52%), Gaps = 16/126 (13%)
 Frame = +3

Query  9    ISYISAYDPLDMFSGSKDRLDKAIKDLFMT------PQNNFRVFVNGCLIFgglgggAEP  170
            ++ ISAY PLD++SG +DR+ +AI DL+          NN R+FV+G L+        +P
Sbjct  181  VAPISAYCPLDLYSGEEDRITRAIHDLWDAWIKSDGSLNNLRIFVHGSLL--------KP  232

Query  171  TNSKAGQAFEDALK-NIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQK-LDTFDIEG  344
            +++ + +   D L  +  +A      + F   +   +  S +L  L  +Q+ LD  DIEG
Sbjct  233  SDADSSRILADVLHVSESYASSSHLRDAFTSTVLRILLDSDILRVLSRLQRTLDPLDIEG  292

Query  345  AIHVYY  362
               +++
Sbjct  293  LSKLWF  298



>gb|AAY79345.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Danio rerio]
Length=483

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 55/113 (49%), Gaps = 6/113 (5%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFggl-gggAEPTNS  179
            GK   +S Y PLD+FSGSK R+  A+K+L   PQNN ++F  G LIF        +P  +
Sbjct  176  GKWKRLSRYCPLDLFSGSKQRMYVALKNLLEEPQNNLKIFKGGELIFSCKDDAKQQPDLN  235

Query  180  KAGQAFEDALKNIIFAKEGMRT-----NYFLELISEAVFSSGLLNRLLEVQKL  323
               Q       +      G +      N F+++I  A+ S G  NR  E +K+
Sbjct  236  NLIQHLRPYFPHTNGLYNGHQPGKVILNEFIQVICSALLSGGDSNRSGEPRKM  288



>sp|Q4JL91.3|IPPK_DANRE RecName: Full=Inositol-pentakisphosphate 2-kinase; AltName: Full=Inositol-1,3,4,5,6-pentakisphosphate 
2-kinase; AltName: 
Full=Ins(1,3,4,5,6)P5 2-kinase; Short=InsP5 2-kinase [Danio 
rerio]
Length=483

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 55/113 (49%), Gaps = 6/113 (5%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFggl-gggAEPTNS  179
            GK   +S Y PLD+FSGSK R+  A+K+L   PQNN ++F  G LIF        +P  +
Sbjct  176  GKWKRLSRYCPLDLFSGSKQRMYVALKNLLEEPQNNLKIFKGGELIFSCKDDAKQQPDLN  235

Query  180  KAGQAFEDALKNIIFAKEGMRT-----NYFLELISEAVFSSGLLNRLLEVQKL  323
               Q       +      G +      N F+++I  A+ S G  NR  E +K+
Sbjct  236  NLIQHLRPYFPHTNGLYNGHQPGKVILNEFIQVICSALLSGGDSNRSGEPRKM  288



>ref|XP_002631799.1| Hypothetical protein CBG21018 [Caenorhabditis briggsae]
Length=378

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 48/180 (27%), Positives = 73/180 (41%), Gaps = 21/180 (12%)
 Frame = +3

Query  3    GKISYISAYD--PLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAE---  167
            G   +   YD  P+D+FSG+  R+ KAI  LF+ P  N R+F++G  +        E   
Sbjct  195  GHSHFSEMYDFCPMDLFSGNYSRMHKAIHSLFLVPHRNLRIFIDGNQVHSDEKPLEEAVF  254

Query  168  -----PTNSKAGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTF  332
                 P N       ED +  +  A  G ++     L      +S +L ++L  QK+D  
Sbjct  255  SETLFPRNEATS---EDLISALCLALSGNQSKKKFRL-----RNSSVLGQILRAQKVDEI  306

Query  333  DIEGAIHVYYNVISQPCVVCKDLGSGLSKRFNTL---HSISMEESWKILRDYLIAATAKD  503
             I  A  +Y  +         D  S        +    S+  E   + LR Y +AAT KD
Sbjct  307  GIVQAHAIYDRMDHHTKTALLDKSSLTRAGLEAILERKSLENEHLLQQLRRYFLAATMKD  366



>gb|EFA81684.1| hypothetical protein PPL_05678 [Polysphondylium pallidum PN500]
Length=502

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 58/125 (46%), Gaps = 22/125 (18%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAE-----  167
            G I  IS Y PLD+FSG+ DR  +AI+ L   PQNN +++ +G L + G  GG       
Sbjct  204  GSIHSISKYCPLDLFSGAVDRQKRAIRALLECPQNNLKIYKDGSLFYTGSLGGKSVHSLE  263

Query  168  ------PTNSKAGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDT  329
                   T  +  Q+ E  +  +        TNY + ++        +L+ LL  Q+ D 
Sbjct  264  SLCTLLDTPEETSQSVESTIDRL--------TNYLVSILQT---EHAVLDNLLTAQRYDD  312

Query  330  FDIEG  344
             DIE 
Sbjct  313  LDIEA  317



>emb|CAP37932.2| Protein CBG21018 [Caenorhabditis briggsae]
Length=449

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 48/180 (27%), Positives = 73/180 (41%), Gaps = 21/180 (12%)
 Frame = +3

Query  3    GKISYISAYD--PLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAE---  167
            G   +   YD  P+D+FSG+  R+ KAI  LF+ P  N R+F++G  +        E   
Sbjct  201  GHSHFSEMYDFCPMDLFSGNYSRMHKAIHSLFLVPHRNLRIFIDGNQVHSDEKPLEEAVF  260

Query  168  -----PTNSKAGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTF  332
                 P N       ED +  +  A  G ++     L      +S +L ++L  QK+D  
Sbjct  261  SETLFPRNEATS---EDLISALCLALSGNQSKKKFRL-----RNSSVLGQILRAQKVDEI  312

Query  333  DIEGAIHVYYNVISQPCVVCKDLGSGLSKRFNTL---HSISMEESWKILRDYLIAATAKD  503
             I  A  +Y  +         D  S        +    S+  E   + LR Y +AAT KD
Sbjct  313  GIVQAHAIYDRMDHHTKTALLDKSSLTRAGLEAILERKSLENEHLLQQLRRYFLAATMKD  372



>ref|NP_496564.2| Protein Y17G7B.13 [Caenorhabditis elegans]
 emb|CAA19460.2| Protein Y17G7B.13 [Caenorhabditis elegans]
Length=454

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 75/178 (42%), Gaps = 17/178 (10%)
 Frame = +3

Query  3    GKISYISAYD--PLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTN  176
            G+  +   YD  PLD+FSG+  R+ KAI  LF+ P  N R+FV+G  +        E   
Sbjct  203  GQSHFSEMYDFCPLDLFSGNYCRMQKAIHSLFLVPHRNLRIFVDGNQVHSDEKPLEEKMI  262

Query  177  S-----KAGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIE  341
            S     +     ED +  +  A  G  +     L      +S +L ++L  QK+D   I 
Sbjct  263  SEILFPRHDATSEDLISALCLALSGNHSKKKFRL-----RNSSVLGQILRAQKVDEIGII  317

Query  342  GAIHVYYNVISQPCVVCKDLGSGLSKRFNTL----HSISMEESWKILRDYLIAATAKD  503
             A H  Y  +           S L++    L     S   EE  + LR Y +AAT KD
Sbjct  318  QA-HAIYETMDNHVKTSLLDKSALTRAGLELILEQSSHENEELLQQLRRYFLAATMKD  374



>ref|XP_004647610.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Octodon degus]
Length=489

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 49/175 (28%), Positives = 71/175 (41%), Gaps = 51/175 (29%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAE-----  167
            GK   IS Y PLD+FSG+K R+  A+K L    QNN ++F NG LI+G     +      
Sbjct  172  GKWKQISEYCPLDLFSGNKQRMHFALKSLLQESQNNLKIFKNGELIYGCGDARSPAADWR  231

Query  168  -----------PTNSKAG--QAFEDALKNIIFA-----------------KEGMRTNYFL  257
                       P+N  AG  Q     ++ ++                   + G R  +  
Sbjct  232  ELAHHLKPFFFPSNGLAGGAQCTRAVIRELVHVITRVLLSSSDKGRVGALRPGTRGPHVC  291

Query  258  EL--ISEAVFSSG-------------LLNRLLEVQKLDTFDIEGAIHVYYNVISQ  377
            E    S ++   G             LL + L+VQ LD  DIEG ++  YN + Q
Sbjct  292  EASPFSRSLHRQGKNTPERSGLPKGCLLYKTLQVQMLDLLDIEG-LYPLYNRVEQ  345



>gb|ETN60510.1| hypothetical protein AND_007864 [Anopheles darlingi]
Length=550

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 50/95 (53%), Gaps = 14/95 (15%)
 Frame = +3

Query  9    ISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAG  188
            I+ IS Y PLD+FSG   R+ +A+K L   PQNNF++  NG +++           ++  
Sbjct  260  IAKISKYCPLDLFSGKPIRVLQAVKGLIGAPQNNFKLLKNGKIVY---------DETREK  310

Query  189  QAFEDALKNIIFAKEGM----RTNYFLELISEAVF  281
             AF   LK  +F ++G     R N FL LI E + 
Sbjct  311  SAFNRILKE-MFPRDGRTKEERKNIFLNLIKEVLL  344



>ref|XP_003113660.1| hypothetical protein CRE_26086 [Caenorhabditis remanei]
 gb|EFP07572.1| hypothetical protein CRE_26086 [Caenorhabditis remanei]
Length=397

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 48/181 (27%), Positives = 76/181 (42%), Gaps = 24/181 (13%)
 Frame = +3

Query  3    GKISYISAYD--PLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAE---  167
            G+  +   YD  P+D+FSG+  R+ KAI  LF+ P  N R+F++G  +        +   
Sbjct  203  GQSHFSQMYDFCPMDLFSGNYSRMHKAIHSLFLVPHRNLRIFIDGNQVHSDEKPLEKEIF  262

Query  168  -----PTNSKAGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTF  332
                 P N       +D +  + FA  G ++          + +S +L ++L+ QK+D  
Sbjct  263  SETLFPRNEATS---DDLISALCFALSGNQSKKKFH-----IRNSSVLGQILQAQKVDEI  314

Query  333  DIEGAIHVYYNVISQPCVVCKDLGS----GLSKRFNTLHSISMEESWKILRDYLIAATAK  500
             I  A  +Y  +         D  S    GL          S  E  + LR Y +AAT K
Sbjct  315  GIVEAHAIYDRMDPHTKSTLLDKSSLTRAGLEAILGP--KSSENEDLQKLRKYFLAATMK  372

Query  501  D  503
            D
Sbjct  373  D  373



>gb|KFH73726.1| hypothetical protein MVEG_00940 [Mortierella verticillata NRRL 
6337]
Length=467

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 63/124 (51%), Gaps = 15/124 (12%)
 Frame = +3

Query  18   ISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAF  197
            +S Y P+D+FSG +  +  A++ L  TPQNN R+FV G            P+  K     
Sbjct  194  LSLYCPIDLFSGQELLVHDALESLVQTPQNNLRLFVEGV------QQTVTPSAMKVS---  244

Query  198  EDALKNIIFAKEGMRTNY--FLELISEAVFSSGLLNRLLEVQ-KLDTFDIEGAIHVYYNV  368
                K  + A++     Y   ++++S+ + +S LL RL  +Q  LD+ DIE  IH +Y  
Sbjct  245  --LTKEPLEARKRDDEEYPTIIDVLSKILVNSTLLERLARLQLSLDSLDIE-TIHQFYVH  301

Query  369  ISQP  380
            I+ P
Sbjct  302  IANP  305



>ref|XP_010834292.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Bison 
bison bison]
Length=426

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 57/122 (47%), Gaps = 13/122 (11%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GK   IS Y PLD++SG+K R+  A+K L    QNN ++F NG LI+G     + P    
Sbjct  172  GKWKQISKYCPLDLYSGNKQRMYFALKSLLQEAQNNLKIFKNGELIYGCKDARS-PMADW  230

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
            +  A    LK   F   G        L S    +  ++  L  VQ LD  DIEG   +Y 
Sbjct  231  SELAHH--LKPFFFPSNG--------LASGPHCTRAVIREL--VQMLDLLDIEGLYPLYR  278

Query  363  NV  368
             V
Sbjct  279  RV  280



>ref|XP_006063159.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Bubalus 
bubalis]
Length=426

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 57/122 (47%), Gaps = 13/122 (11%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GK   IS Y PLD++SG+K R+  A+K L    QNN ++F NG LI+G     + P    
Sbjct  172  GKWKQISKYCPLDLYSGNKQRMYFALKSLLQEAQNNLKIFKNGELIYGCKDARS-PMADW  230

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
            +  A    LK   F   G        L S    +  ++  L  VQ LD  DIEG   +Y 
Sbjct  231  SELAHH--LKPFFFPSNG--------LASGPHCTRAVIREL--VQMLDLLDIEGLYPLYR  278

Query  363  NV  368
             V
Sbjct  279  RV  280



>ref|XP_007229670.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Astyanax mexicanus]
Length=422

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 68/169 (40%), Gaps = 47/169 (28%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFggl-gggAEPTNS  179
            GK + +S Y PLD+FSGSK R+  AIK L   PQNN ++F  G LI+        +P  +
Sbjct  110  GKWNRLSRYCPLDLFSGSKQRMFVAIKHLLEEPQNNLKIFKGGELIYSCKDDAKQQPDLN  169

Query  180  KAGQAFEDALKNIIFAKEGMRT-----NYFLELISEAVFSSG------------------  290
            +  Q       +      G ++     N F+++I  A+  SG                  
Sbjct  170  ELVQHLWPYFHHSNGLYNGHQSSKAVFNEFIQVICGALLGSGDSSRSGEPRKVQLAESRS  229

Query  291  -----------------------LLNRLLEVQKLDTFDIEGAIHVYYNV  368
                                   +L ++L+VQ LD  DIEG   +Y  V
Sbjct  230  VCEASPLHRELLRSGNHGLPKDSVLAKILQVQMLDNLDIEGVYPLYKRV  278



>gb|EYC08479.1| hypothetical protein Y032_0065g3576, partial [Ancylostoma ceylanicum]
Length=415

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/174 (28%), Positives = 75/174 (43%), Gaps = 15/174 (9%)
 Frame = +3

Query  3    GKISYISAYD--PLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAE---  167
            G   Y   YD  PLD++SG+  R+  A++ L   P  N R+F++G L+            
Sbjct  196  GSNHYEEMYDFCPLDLYSGNLARMKSALEALLKVPHRNLRLFIDGNLMHSDETPLDPALF  255

Query  168  -PTNSKAGQA-FEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIE  341
             PT   +GQ   +D L  +     G    +   L   +V     L ++L  QK+D+  I 
Sbjct  256  TPTLFPSGQGNVDDLLTAMCLVLAGCYDIHDFSLRDHSV-----LGQILAAQKIDSVGIL  310

Query  342  GAIHVYYNVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
             A  +++   S P  V K+L          L  +   +   +L  YL+AAT KD
Sbjct  311  RAHQIFH---SLPAFVQKELLDKNRLPVRGLEVLEATDDRALLEKYLLAATMKD  361



>emb|CDJ91583.1| Inositol-pentakisphosphate 2-kinase domain containing protein 
[Haemonchus contortus]
Length=433

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 73/177 (41%), Gaps = 21/177 (12%)
 Frame = +3

Query  3    GKISYISAYD--PLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTN  176
            G   Y   YD  P+D+FSG+  R+  A++ L   P  N R+FV+G LI            
Sbjct  188  GSDHYEEMYDFCPIDLFSGNLSRMKSALEALLKVPHRNLRIFVDGNLIHSDESLLDATLF  247

Query  177  S----KAGQAFED----ALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTF  332
            S     +GQ   D    AL  ++   E +R     E          +L ++L  QK+D  
Sbjct  248  STTLFPSGQGNADDLITALCLVLAGCEDVRDFSLRE--------DSVLGQILAAQKIDLV  299

Query  333  DIEGAIHVYYNVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
             I  A  +Y    S P  V K+L          L  +   +   +L  YL+AAT KD
Sbjct  300  GIVKAHQIYK---SLPAAVQKELHDKSRLPVRGLEVLEATDDRALLEQYLLAATMKD  353



>emb|CBK22859.2| unnamed protein product [Blastocystis hominis]
Length=146

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 63/118 (53%), Gaps = 10/118 (8%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNG--CLIFgglgggAEPTN  176
            GKIS IS+Y P+ +FS +  +  ++I  LF TPQNN   F++G  C +         P +
Sbjct  31   GKISSISSYCPVQLFSSAIGQF-QSILHLFETPQNNLTCFLDGQKCQV----STIPLPID  85

Query  177  SKAGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQ--KLDTFDIEG  344
            S A ++F   L+  + A     T   + LI+ A   SG+LN LL VQ  + ++ DIE 
Sbjct  86   SSAIKSFARELELALPAVLTKETAISV-LITLAFQRSGVLNDLLRVQVGETESLDIES  142



>gb|EYC08478.1| hypothetical protein Y032_0065g3576 [Ancylostoma ceylanicum]
Length=413

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 48/174 (28%), Positives = 75/174 (43%), Gaps = 15/174 (9%)
 Frame = +3

Query  3    GKISYISAYD--PLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAE---  167
            G   Y   YD  PLD++SG+  R+  A++ L   P  N R+F++G L+            
Sbjct  194  GSNHYEEMYDFCPLDLYSGNLARMKSALEALLKVPHRNLRLFIDGNLMHSDETPLDPALF  253

Query  168  -PTNSKAGQA-FEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIE  341
             PT   +GQ   +D L  +     G    +   L   +V     L ++L  QK+D+  I 
Sbjct  254  TPTLFPSGQGNVDDLLTAMCLVLAGCYDIHDFSLRDHSV-----LGQILAAQKIDSVGIL  308

Query  342  GAIHVYYNVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
             A  +++   S P  V K+L          L  +   +   +L  YL+AAT KD
Sbjct  309  RAHQIFH---SLPAFVQKELLDKNRLPVRGLEVLEATDDRALLEKYLLAATMKD  359



>ref|XP_010018096.1| PREDICTED: inositol-pentakisphosphate 2-kinase, partial [Nestor 
notabilis]
 gb|KFQ54374.1| Inositol-pentakisphosphate 2-kinase, partial [Nestor notabilis]
Length=464

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK    S Y PLD+FSG+K R+  A+K L   PQNN ++F NG LI+
Sbjct  145  GKWKRPSKYCPLDLFSGNKQRMHFALKSLLQEPQNNLKIFKNGELIY  191



>ref|XP_005141642.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Melopsittacus 
undulatus]
Length=536

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK    S Y PLD+FSG+K R+  A+K L   PQNN ++F NG LI+
Sbjct  217  GKWKRPSKYCPLDLFSGNKQRMHFALKSLLQEPQNNLKIFKNGELIY  263



>ref|XP_008769756.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Rattus 
norvegicus]
 ref|XP_008769757.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Rattus 
norvegicus]
Length=427

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 41/79 (52%), Gaps = 3/79 (4%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GK   IS Y PLD++SG+K R+  A+K L    QNN R+F NG LI+G     +   + K
Sbjct  110  GKWKKISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLRIFKNGELIYGCADARSPVADLK  169

Query  183  AGQAFEDALKNIIFAKEGM  239
               A    LK   F   G+
Sbjct  170  ---ALAHHLKPFFFPSNGL  185



>ref|XP_009905956.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Picoides pubescens]
Length=467

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK    S Y PLD+FSG+K R+  A+K L   PQNN ++F NG LI+
Sbjct  148  GKWKRPSKYCPLDLFSGNKQRMHFALKSLLQEPQNNLKIFKNGELIY  194



>gb|KFV73789.1| Inositol-pentakisphosphate 2-kinase, partial [Picoides pubescens]
Length=475

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK    S Y PLD+FSG+K R+  A+K L   PQNN ++F NG LI+
Sbjct  156  GKWKRPSKYCPLDLFSGNKQRMHFALKSLLQEPQNNLKIFKNGELIY  202



>ref|XP_008318919.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Cynoglossus semilaevis]
Length=501

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/167 (27%), Positives = 65/167 (39%), Gaps = 45/167 (27%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTN--  176
            GK    S Y PLD+FSG++ R+  AI+ L   PQNNF++F  G  I+    G  +  +  
Sbjct  175  GKWKRRSLYCPLDLFSGNRQRMHFAIRHLIEEPQNNFKIFKGGQCIYSSKEGSDDSPDLN  234

Query  177  -------------------SKAGQA----FEDALKNIIFAKEGMRTNYFLELISE-----  272
                                  G+A    F   L N + +  G       +   E     
Sbjct  235  SLLHHLRPYVMHGNNRINSHMTGKAVLNDFIQVLVNALLSSRGGDAGVVTDRRGEGRSAC  294

Query  273  ---------------AVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNV  368
                            + SS +L+R+L+ Q LDT DIEG   +Y  V
Sbjct  295  EASLFNKERIRHGSQGLPSSSVLSRILQTQMLDTLDIEGLYPLYRRV  341



>ref|XP_008577572.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Galeopterus variegatus]
Length=469

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 68/155 (44%), Gaps = 31/155 (20%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAE-----  167
            GK   IS Y PLD++SG+K R+  A+K L    QNN ++F NG LI+G     +      
Sbjct  172  GKWKQISRYCPLDLYSGNKQRMHFALKSLLQEAQNNLKIFKNGELIYGCGDARSPVADWS  231

Query  168  -----------PTNSKAG--QAFEDALKNIIF---------AKEGMRTNYFL---ELISE  272
                       P+N  AG  Q     ++ ++          A +G    + +        
Sbjct  232  ELAHHLKPFFFPSNGLAGGPQCARAVVRELVRVVARVLLSGADKGCPLMFLVGKNTPECS  291

Query  273  AVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNVISQ  377
             +    LL + L+VQ LD  DIEG ++  YN + Q
Sbjct  292  GLPKGCLLYKTLQVQMLDLLDIEG-LYPLYNRVEQ  325



>gb|EDL98114.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Rattus norvegicus]
Length=489

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 41/79 (52%), Gaps = 3/79 (4%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GK   IS Y PLD++SG+K R+  A+K L    QNN R+F NG LI+G     +   + K
Sbjct  172  GKWKKISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLRIFKNGELIYGCADARSPVADLK  231

Query  183  AGQAFEDALKNIIFAKEGM  239
               A    LK   F   G+
Sbjct  232  ---ALAHHLKPFFFPSNGL  247



>ref|NP_001008556.1| inositol-pentakisphosphate 2-kinase [Rattus norvegicus]
 sp|Q5PXE9.1|IPPK_RAT RecName: Full=Inositol-pentakisphosphate 2-kinase; AltName: Full=Inositol-1,3,4,5,6-pentakisphosphate 
2-kinase; AltName: 
Full=Ins(1,3,4,5,6)P5 2-kinase; Short=InsP5 2-kinase; Short=rIPK1 
[Rattus norvegicus]
 gb|AAV76010.1| inositol polyphosphate kinase 1 [Rattus norvegicus]
Length=489

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/79 (39%), Positives = 41/79 (52%), Gaps = 3/79 (4%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GK   IS Y PLD++SG+K R+  A+K L    QNN R+F NG LI+G     +   + K
Sbjct  172  GKWKKISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLRIFKNGELIYGCADARSPVADLK  231

Query  183  AGQAFEDALKNIIFAKEGM  239
               A    LK   F   G+
Sbjct  232  ---ALAHHLKPFFFPSNGL  247



>ref|XP_005066372.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Mesocricetus 
auratus]
Length=489

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG K R+  A+K L    QNN RVF NG LI+
Sbjct  172  GKWKKISKYCPLDLYSGDKQRMHFALKSLLQEAQNNLRVFKNGKLIY  218



>ref|XP_005408970.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Chinchilla 
lanigera]
Length=511

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 68/172 (40%), Gaps = 50/172 (29%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAE-----  167
            GK   IS Y PLD+FSG+K R+  A+K L    QNN ++F NG LI+G     +      
Sbjct  172  GKWKQISEYCPLDLFSGNKQRMHFALKSLLQESQNNLKIFKNGELIYGCGDAQSPAADWR  231

Query  168  -----------PTNSKAGQAF--EDALKNIIFA-----------------KEGMRTNYFL  257
                       P+N  AG A      ++ ++                   + G R  +  
Sbjct  232  ELAHHLKPFFFPSNGLAGGAHCTRAVIRELVHVITRVLLSSSDKGRVGALRPGPRGPHVC  291

Query  258  EL--ISEAVFSSG-------------LLNRLLEVQKLDTFDIEGAIHVYYNV  368
            E    S ++   G             LL + L+VQ LD  DIEG   +Y  V
Sbjct  292  EASPFSRSLHRQGKNTPERSGLPKGCLLYKTLQVQMLDLLDIEGLYPLYNRV  343



>ref|XP_003505388.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Cricetulus 
griseus]
 gb|EGV99805.1| Inositol-pentakisphosphate 2-kinase [Cricetulus griseus]
Length=489

 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K L    QNN R+F NG LI+
Sbjct  172  GKWKKISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLRIFKNGQLIY  218



>ref|XP_007506451.1| PREDICTED: uncharacterized protein LOC100030309 [Monodelphis 
domestica]
Length=675

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD+FSG+K R+  A+K L    QNN ++F NG LI+
Sbjct  492  GKWKQISKYCPLDLFSGNKQRMHFALKSLLQEAQNNLKIFKNGELIY  538



>ref|XP_005408971.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Chinchilla 
lanigera]
Length=489

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 68/172 (40%), Gaps = 50/172 (29%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAE-----  167
            GK   IS Y PLD+FSG+K R+  A+K L    QNN ++F NG LI+G     +      
Sbjct  172  GKWKQISEYCPLDLFSGNKQRMHFALKSLLQESQNNLKIFKNGELIYGCGDAQSPAADWR  231

Query  168  -----------PTNSKAGQAF--EDALKNIIFA-----------------KEGMRTNYFL  257
                       P+N  AG A      ++ ++                   + G R  +  
Sbjct  232  ELAHHLKPFFFPSNGLAGGAHCTRAVIRELVHVITRVLLSSSDKGRVGALRPGPRGPHVC  291

Query  258  EL--ISEAVFSSG-------------LLNRLLEVQKLDTFDIEGAIHVYYNV  368
            E    S ++   G             LL + L+VQ LD  DIEG   +Y  V
Sbjct  292  EASPFSRSLHRQGKNTPERSGLPKGCLLYKTLQVQMLDLLDIEGLYPLYNRV  343



>ref|XP_004209697.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Hydra vulgaris]
Length=396

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 76/169 (45%), Gaps = 13/169 (8%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
             K S IS+Y PLD+F+     +  A+  L MTPQNN  V V+G  I           +SK
Sbjct  169  AKTSQISSYCPLDLFNNCTCGVSSALNSLTMTPQNNLVVSVDGEKINNLQQFNIGSISSK  228

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYY  362
                     + +I    G + +  LE   + +   G+LN L  +Q LD  DIE  I+  Y
Sbjct  229  ---------EILITFCGGKKHDKHLEY-CQPMGKGGILNTLRSLQMLDCIDIEN-IYDLY  277

Query  363  NVISQPCVVCKDLGSGLSKRF--NTLHSISMEESWKILRDYLIAATAKD  503
            N  S   V   D  S +  +   + ++ I       ++  YLI++T KD
Sbjct  278  NQYSSQYVFDNDFSSEIWAKVVQDIVNGIKKVSDLSMIYQYLISSTFKD  326



>ref|XP_007617413.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Cricetulus 
griseus]
Length=521

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K L    QNN R+F NG LI+
Sbjct  176  GKWKKISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLRIFKNGQLIY  222



>gb|ERE78538.1| inositol-pentakisphosphate 2-kinase [Cricetulus griseus]
Length=476

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K L    QNN R+F NG LI+
Sbjct  159  GKWKKISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLRIFKNGQLIY  205



>ref|XP_006025938.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Alligator sinensis]
Length=490

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   +S Y PLD+FSGSK R+  A+K L    QNN ++F NG LI+
Sbjct  172  GKWKRLSKYCPLDLFSGSKQRMHFALKSLLQEAQNNLKIFKNGELIY  218



>ref|XP_006261188.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Alligator mississippiensis]
Length=482

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   +S Y PLD+FSGSK R+  A+K L    QNN ++F NG LI+
Sbjct  164  GKWKRLSKYCPLDLFSGSKQRMHFALKSLLQEAQNNLKIFKNGELIY  210



>ref|XP_004898275.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Heterocephalus 
glaber]
 ref|XP_004870138.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Heterocephalus 
glaber]
 gb|EHB11566.1| Inositol-pentakisphosphate 2-kinase [Heterocephalus glaber]
Length=489

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD+FSG+K R+  A+K L    QNN ++F NG LI+
Sbjct  172  GKWKQISKYCPLDLFSGNKQRMHFALKSLLQESQNNLKIFKNGELIY  218



>ref|XP_003748212.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Metaseiulus 
occidentalis]
Length=449

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            G++  IS Y PLD+FSG  +R++ AI +L   PQNN RVF +   IF
Sbjct  178  GRVQQISNYCPLDLFSGCPERMECAILELLHNPQNNLRVFCDRRQIF  224



>ref|XP_006992344.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Peromyscus maniculatus 
bairdii]
Length=489

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K L    QNN R+F NG LI+
Sbjct  172  GKWKKISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLRIFKNGELIY  218



>ref|XP_010608886.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Fukomys 
damarensis]
 gb|KFO20765.1| Inositol-pentakisphosphate 2-kinase [Fukomys damarensis]
Length=489

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD+FSG+K R+  A+K L    QNN ++F NG LI+
Sbjct  172  GKWKQISKYCPLDLFSGNKQRMHFALKSLLQESQNNLKIFKNGELIY  218



>ref|XP_004652359.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Jaculus jaculus]
Length=489

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K L    QNN R+F NG LI+
Sbjct  172  GKWKKISKYCPLDLYSGNKQRMHFALKSLLQETQNNLRIFKNGELIY  218



>ref|XP_005355230.1| PREDICTED: LOW QUALITY PROTEIN: inositol-pentakisphosphate 2-kinase 
[Microtus ochrogaster]
Length=490

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K L    QNN R+F NG LI+
Sbjct  173  GKWKKISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLRIFKNGELIY  219



>ref|XP_010973179.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Camelus dromedarius]
Length=467

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 48/155 (31%), Positives = 66/155 (43%), Gaps = 38/155 (25%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GK   IS Y PLD++SG+K R+  A+K L    QNN ++F NG LI+     G +   S 
Sbjct  172  GKWKQISKYCPLDLYSGNKQRMYFALKSLLQEAQNNLKIFKNGELIY-----GCKDARSP  226

Query  183  AGQAFEDA--LKNIIFAKEGMRT---------NYFLELISEAVFS---------------  284
                 E A  LK   F   G+ +            + +I+  + S               
Sbjct  227  VADWSELARHLKPFFFPSNGLASGPHCTRAVIRELVRVITRVLLSGLDKALMFLVGKNTP  286

Query  285  --SG-----LLNRLLEVQKLDTFDIEGAIHVYYNV  368
              SG     LL + L+VQ LD  DIEG   +Y  V
Sbjct  287  ERSGLPKGCLLYKTLQVQMLDLLDIEGLYPLYRRV  321



>ref|XP_007428725.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Python bivittatus]
Length=488

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK  ++S Y PLD+FSG+K R+  A+++L    QNN ++F NG LI+
Sbjct  169  GKWKHLSKYCPLDLFSGNKQRMHFALRNLLYEAQNNLKIFKNGELIY  215



>gb|ERG81447.1| inositol-pentakisphosphate 2-kinase [Ascaris suum]
Length=461

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/165 (25%), Positives = 72/165 (44%), Gaps = 14/165 (8%)
 Frame = +3

Query  27   YD--PLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKA----G  188
            YD  PLD+FSG+  R+  A+  L   P  N R+F+NG +I       +    ++     G
Sbjct  209  YDFCPLDLFSGNLQRMRHALNALIAVPHRNLRIFINGTVIHSDEVRLSTEQLTQTFIGYG  268

Query  189  QAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEGAIHVYYNV  368
             + +  +  +     G  ++   E+       S +L +L+  Q++D+  I  A  +Y   
Sbjct  269  ISLDQLVTALCCVLSGAHSDRSFEM-----HRSSVLRKLINAQRIDSVGIVRAYQIYN--  321

Query  369  ISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
             S P  V K+L +        L  +       ++  YL+AAT KD
Sbjct  322  -SLPPHVQKELLNKCLLPRKGLSFLQKSTDRALIERYLLAATVKD  365



>ref|XP_010608887.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Fukomys 
damarensis]
Length=467

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD+FSG+K R+  A+K L    QNN ++F NG LI+
Sbjct  150  GKWKQISKYCPLDLFSGNKQRMHFALKSLLQESQNNLKIFKNGELIY  196



>ref|XP_003468284.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Cavia porcellus]
Length=489

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD+FSG+K R+  A+K L    QNN ++F NG LI+
Sbjct  172  GKWKQISKYCPLDLFSGNKQRMHFALKSLLHEAQNNLKIFKNGELIY  218



>ref|XP_006517044.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Mus 
musculus]
Length=322

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A++ L    QNN R+F NG LI+
Sbjct  172  GKWKKISKYCPLDLYSGNKQRMHFALRSLLQETQNNLRIFKNGELIY  218



>ref|XP_010873347.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X2 [Esox 
lucius]
Length=498

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 55/107 (51%), Gaps = 17/107 (16%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GK   +S Y PLD+FSG+K R+  AIK L   PQNNF++F  G  I+             
Sbjct  177  GKWKRLSRYCPLDLFSGNKQRMYLAIKHLIEEPQNNFKIFKGGECIY-------------  223

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLE---LISEAVFSSGLLNRLLEV  314
            + +   D L+++    + +R  YFL    LI+    S  +LN L++V
Sbjct  224  SCKDDADVLQDLDELAQHLRP-YFLPSGSLINGHQASKVVLNELIQV  269



>ref|XP_010873338.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Esox 
lucius]
Length=499

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 55/107 (51%), Gaps = 17/107 (16%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GK   +S Y PLD+FSG+K R+  AIK L   PQNNF++F  G  I+             
Sbjct  177  GKWKRLSRYCPLDLFSGNKQRMYLAIKHLIEEPQNNFKIFKGGECIY-------------  223

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLE---LISEAVFSSGLLNRLLEV  314
            + +   D L+++    + +R  YFL    LI+    S  +LN L++V
Sbjct  224  SCKDDADVLQDLDELAQHLRP-YFLPSGSLINGHQASKVVLNELIQV  269



>ref|XP_003251884.2| PREDICTED: uncharacterized protein LOC100576733 [Apis mellifera]
Length=459

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 48/96 (50%), Gaps = 5/96 (5%)
 Frame = +3

Query  9    ISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAG  188
            I+  S Y P D+FSG + R+  A+K L  +PQNN ++F NG L++       E + S   
Sbjct  65   ITCRSTYCPFDLFSGVETRMKSALKGLLKSPQNNLKIFKNGILVY-----DQESSLSDLE  119

Query  189  QAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLL  296
             A  D  +N I + +    + F  LI  A+    +L
Sbjct  120  CALSDWFRNSINSTKKEYIDKFCNLICTALLHPFIL  155



>ref|XP_007907076.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Callorhinchus 
milii]
Length=493

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD+FSG+K R+  A+K L    QNN ++F NG LIF
Sbjct  175  GKWKRISKYCPLDLFSGNKQRMYFALKSLLQEAQNNLKIFKNGELIF  221



>ref|XP_008851096.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Nannospalax galili]
Length=489

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K +    QNN R+F NG LI+
Sbjct  172  GKWKKISKYCPLDLYSGNKQRMHFALKSMLQEAQNNLRIFKNGELIY  218



>ref|XP_008865587.1| hypothetical protein H310_03491 [Aphanomyces invadans]
 gb|ETW05810.1| hypothetical protein H310_03491 [Aphanomyces invadans]
Length=458

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 59/128 (46%), Gaps = 26/128 (20%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GK+S  S Y PLD+FS  + R+ +A+  L  TPQNN RVF                 ++ 
Sbjct  189  GKLSQSSQYCPLDLFSNDRGRIARALASLTATPQNNLRVF-----------------SAV  231

Query  183  AGQAFEDALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQKLDTFDIEG--AIHV  356
            A Q      + I    +  R +  +E++   V   GLL+ L  +   D  D+EG  A+  
Sbjct  232  ATQGVLSTDQVI----QARRMDLLVEILHSHV---GLLDDLKTMHAKDALDVEGMFALTQ  284

Query  357  YYNVISQP  380
             ++V+  P
Sbjct  285  LHDVLVPP  292



>ref|NP_001263328.1| inositol-pentakisphosphate 2-kinase isoform b [Mus musculus]
Length=538

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A++ L    QNN R+F NG LI+
Sbjct  221  GKWKKISKYCPLDLYSGNKQRMHFALRSLLQETQNNLRIFKNGELIY  267



>ref|XP_006625233.1| PREDICTED: uncharacterized protein LOC102678697 [Apis dorsata]
Length=325

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 33/127 (26%), Positives = 61/127 (48%), Gaps = 13/127 (10%)
 Frame = +3

Query  21   SAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSKAGQAFE  200
            S Y P D+FSG + R+  A+K L  +PQNN ++F NG L++       E + +    A  
Sbjct  6    STYCPFDLFSGVETRMKSALKGLLKSPQNNLKIFKNGILVY-----DQESSLNDLECALS  60

Query  201  DALKNIIFAKEGMRTNYFLELISEAV--------FSSGLLNRLLEVQKLDTFDIEGAIHV  356
            D  +N + + +    + F  LI  A+        + S + +       LDT D++   ++
Sbjct  61   DWFRNSVNSTKKEYIDKFCNLICTALLHPFILEEYKSNIFSSYELYTSLDTHDLKTTSYI  120

Query  357  YYNVISQ  377
              ++I++
Sbjct  121  NTDLIAK  127



>dbj|BAE20447.1| unnamed protein product [Mus musculus]
Length=489

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A++ L    QNN R+F NG LI+
Sbjct  172  GKWKKISKYCPLDLYSGNKQRMHFALRSLLQETQNNLRIFKNGELIY  218



>ref|NP_951011.1| inositol-pentakisphosphate 2-kinase isoform a [Mus musculus]
 sp|Q6P1C1.1|IPPK_MOUSE RecName: Full=Inositol-pentakisphosphate 2-kinase; AltName: Full=Inositol-1,3,4,5,6-pentakisphosphate 
2-kinase; AltName: 
Full=Ins(1,3,4,5,6)P5 2-kinase; Short=InsP5 2-kinase [Mus musculus]
 gb|AAH62167.1| Inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Mus musculus]
 gb|AAH65157.1| Inositol 1,3,4,5,6-pentakisphosphate 2-kinase [Mus musculus]
 dbj|BAE39551.1| unnamed protein product [Mus musculus]
 dbj|BAE35623.1| unnamed protein product [Mus musculus]
 gb|EDL41076.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase, isoform CRA_a 
[Mus musculus]
Length=489

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A++ L    QNN R+F NG LI+
Sbjct  172  GKWKKISKYCPLDLYSGNKQRMHFALRSLLQETQNNLRIFKNGELIY  218



>ref|XP_008053337.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Tarsius syrichta]
Length=514

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K L    QNN ++F NG LI+
Sbjct  110  GKWKQISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLKIFKNGELIY  156



>ref|XP_007529252.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Erinaceus europaeus]
Length=518

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K L    QNN ++F NG LI+
Sbjct  199  GKWKQISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLKIFKNGELIY  245



>ref|XP_001987591.1| GH22003 [Drosophila grimshawi]
 gb|EDW02458.1| GH22003 [Drosophila grimshawi]
Length=644

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GKI  +  Y PL++FSG+  R+  A+  LF  PQNN RVF +G LI+
Sbjct  301  GKIKRLGDYCPLELFSGTPGRMLDALNALFACPQNNLRVFQSGNLIY  347



>ref|XP_005605221.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Equus caballus]
Length=597

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K L    QNN ++F NG LI+
Sbjct  255  GKWKQISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLKIFKNGELIY  301



>gb|AAH24630.1| Ippk protein [Mus musculus]
Length=427

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A++ L    QNN R+F NG LI+
Sbjct  110  GKWKKISKYCPLDLYSGNKQRMHFALRSLLQETQNNLRIFKNGELIY  156



>ref|XP_006717298.1| PREDICTED: inositol-pentakisphosphate 2-kinase isoform X1 [Homo 
sapiens]
Length=324

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K L    QNN ++F NG LI+
Sbjct  172  GKWKQISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLKIFKNGELIY  218



>ref|XP_006161538.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Tupaia chinensis]
Length=641

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K L    QNN ++F NG LI+
Sbjct  260  GKWKQISQYCPLDLYSGNKQRMHFALKSLLQEAQNNLKIFKNGELIY  306



>ref|XP_004351454.1| hypothetical protein DFA_10812 [Dictyostelium fasciculatum]
 gb|EGG14938.1| hypothetical protein DFA_10812 [Dictyostelium fasciculatum]
Length=384

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 76/172 (44%), Gaps = 26/172 (15%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            G +  IS Y P+D++S  + R  +A+  L   PQNN +VF +G L F G  GG    N  
Sbjct  207  GSVDRISKYCPIDLYSLDRSRQLRALDSLIDCPQNNLKVFKDGVLYFTGQLGGGGTGNEN  266

Query  183  AGQAFE----DALKNIIFAKEGMRTNYFLELISEAVFSSGLLNRLLEVQK-LDTFDIEGA  347
                 +    D+L N I   E  +                LL  L +VQ+  D +DIE  
Sbjct  267  GTSTLDIKSLDSLFNNINILEKEKQ---------------LLINLAQVQREYDPYDIETI  311

Query  348  IHVYYNVISQPCVVCKDLGSGLSKRFNTLHSISMEESWKILRDYLIAATAKD  503
             ++Y  + +Q             +RF  L  ++ +E   I+  +LIA TAKD
Sbjct  312  YYLYCKLHNQA------YQEDDVERFKDLSHLTNKEMQDIIERFLIATTAKD  357



>ref|XP_004384280.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Trichechus manatus 
latirostris]
Length=492

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K L    QNN ++F NG LI+
Sbjct  172  GKWKQISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLKIFKNGELIY  218



>gb|EDL41077.1| inositol 1,3,4,5,6-pentakisphosphate 2-kinase, isoform CRA_b 
[Mus musculus]
Length=473

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A++ L    QNN R+F NG LI+
Sbjct  156  GKWKKISKYCPLDLYSGNKQRMHFALRSLLQETQNNLRIFKNGELIY  202



>ref|XP_008689206.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Ursus maritimus]
Length=398

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K L    QNN ++F NG LI+
Sbjct  110  GKWKQISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLKIFKNGELIY  156



>ref|NP_001286649.1| Ipk1, isoform D [Drosophila melanogaster]
 gb|AHN56444.1| Ipk1, isoform D [Drosophila melanogaster]
Length=576

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GKI  +  Y PLD+FSG+  R+  A+  L   PQNN RVF N  LI+
Sbjct  163  GKIKRLGHYCPLDLFSGTPSRMLDALDALLACPQNNLRVFQNSNLIY  209



>ref|XP_007951203.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Orycteropus afer 
afer]
Length=492

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K L    QNN ++F NG LI+
Sbjct  172  GKWKQISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLKIFKNGELIY  218



>ref|XP_005469745.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like isoform X1 
[Oreochromis niloticus]
Length=503

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/169 (27%), Positives = 65/169 (38%), Gaps = 49/169 (29%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIFgglgggAEPTNSK  182
            GK    S Y PLD+FSG++ R+  AI+ L   PQNNF+VF  G  I+    G  E  +  
Sbjct  175  GKWKRRSFYCPLDLFSGNRQRMHFAIRHLIEEPQNNFKVFKGGQCIYSSKEGSDESPDMN  234

Query  183  AGQAFEDALKNIIFAKEGMRT--------NYFLELISEAVFSSG----------------  290
            +           +     M +        N F++++  A+ SSG                
Sbjct  235  S--LLHHLRPYFLHTNNRMNSHVTSKAVLNDFIQVLVNALLSSGGGDGSVVADRQAEGRG  292

Query  291  -----------------------LLNRLLEVQKLDTFDIEGAIHVYYNV  368
                                   +L R+L+ Q LDT DIEG   +Y  V
Sbjct  293  FCEASIFNKERIRHGSRGLPSDSVLFRILQTQMLDTLDIEGLYPLYRQV  341



>ref|XP_004717792.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Echinops telfairi]
Length=492

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K L    QNN ++F NG LI+
Sbjct  172  GKWKQISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLKIFKNGELIY  218



>ref|XP_002128315.1| PREDICTED: inositol-pentakisphosphate 2-kinase-like [Ciona intestinalis]
Length=493

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  21   SAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            S Y PLD+FSG+ DR+  A++ L   PQNNFRVF+NG L F
Sbjct  192  SLYCPLDLFSGNIDRMTFALRCLAQNPQNNFRVFLNGELKF  232



>ref|NP_001261111.1| Ipk1, isoform C [Drosophila melanogaster]
 gb|AGB93643.1| Ipk1, isoform C [Drosophila melanogaster]
Length=715

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GKI  +  Y PLD+FSG+  R+  A+  L   PQNN RVF N  LI+
Sbjct  303  GKIKRLGHYCPLDLFSGTPSRMLDALDALLACPQNNLRVFQNSNLIY  349



>ref|XP_002039668.1| GM15781 [Drosophila sechellia]
 gb|EDW56533.1| GM15781 [Drosophila sechellia]
Length=714

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GKI  +  Y PLD+FSG+  R+  A+  L   PQNN RVF N  LI+
Sbjct  303  GKIKRLGHYCPLDLFSGTPSRMLDALDALLACPQNNLRVFQNSNLIY  349



>ref|XP_006750592.1| PREDICTED: inositol-pentakisphosphate 2-kinase [Leptonychotes 
weddellii]
Length=327

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +3

Query  3    GKISYISAYDPLDMFSGSKDRLDKAIKDLFMTPQNNFRVFVNGCLIF  143
            GK   IS Y PLD++SG+K R+  A+K L    QNN ++F NG LI+
Sbjct  8    GKWKQISKYCPLDLYSGNKQRMHFALKSLLQEAQNNLKIFKNGELIY  54



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 517811659326