BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16396_g1_i1 len=824 path=[802:0-305 1108:306-823]

Length=824
                                                                      Score     E

ref|XP_010650015.1|  PREDICTED: protein CRABS CLAW isoform X1           241   5e-76   
ref|XP_002263611.1|  PREDICTED: protein CRABS CLAW isoform X2           240   7e-76   Vitis vinifera
ref|XP_009600446.1|  PREDICTED: protein CRABS CLAW-like                 238   8e-75   
emb|CBI27316.3|  unnamed protein product                                237   1e-74   
ref|XP_009797005.1|  PREDICTED: protein CRABS CLAW                      237   2e-74   
ref|XP_007045805.1|  Plant-specific transcription factor YABBY fa...    236   2e-73   
gb|AAW83048.1|  CRABS CLAW                                              233   3e-73   Petunia x hybrida [garden petunia]
ref|XP_010260715.1|  PREDICTED: protein CRABS CLAW-like isoform X2      228   4e-71   
gb|AIF75109.1|  CRC2                                                    226   1e-70   
ref|XP_002512055.1|  Protein CRABS CLAW, putative                       228   1e-70   Ricinus communis
gb|KDP41331.1|  hypothetical protein JCGZ_15738                         224   2e-69   
gb|AAW83051.1|  CRABS CLAW                                              223   4e-69   Gossypium hirsutum [American cotton]
ref|XP_008339785.1|  PREDICTED: protein CRABS CLAW-like isoform X2      222   8e-69   
gb|AAW83052.1|  CRABS CLAW                                              222   8e-69   Gossypium hirsutum [American cotton]
ref|XP_010260708.1|  PREDICTED: protein CRABS CLAW-like isoform X1      223   9e-69   
ref|XP_008339784.1|  PREDICTED: protein CRABS CLAW-like isoform X1      222   1e-68   
ref|XP_003520126.1|  PREDICTED: protein CRABS CLAW-like                 219   9e-68   
ref|XP_003517857.1|  PREDICTED: protein CRABS CLAW-like                 219   1e-67   
ref|XP_006484236.1|  PREDICTED: protein CRABS CLAW-like                 219   1e-67   
ref|XP_006366257.1|  PREDICTED: protein CRABS CLAW-like                 219   1e-67   
ref|XP_008243820.1|  PREDICTED: protein CRABS CLAW                      219   2e-67   
gb|AAL60054.1|  crabs claw                                              219   2e-67   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_010257971.1|  PREDICTED: protein CRABS CLAW-like isoform X1      219   3e-67   
ref|XP_004228849.1|  PREDICTED: protein CRABS CLAW-like                 218   4e-67   
ref|XP_007223999.1|  hypothetical protein PRUPE_ppa014900mg             218   5e-67   
ref|XP_010257972.1|  PREDICTED: protein CRABS CLAW-like isoform X2      218   5e-67   
gb|KHN29962.1|  Protein DROOPING LEAF                                   218   6e-67   
gb|AAW83045.1|  CRABS CLAW                                              218   6e-67   Cynophalla flexuosa [bottle codroot]
ref|XP_006348666.1|  PREDICTED: protein CRABS CLAW-like                 217   7e-67   
ref|XP_006437883.1|  hypothetical protein CICLE_v10033770mg             217   8e-67   
gb|KHN05619.1|  Protein DROOPING LEAF                                   218   9e-67   
emb|CDP00459.1|  unnamed protein product                                217   9e-67   
ref|XP_007153487.1|  hypothetical protein PHAVU_003G039800g             216   1e-66   
ref|XP_010046616.1|  PREDICTED: protein CRABS CLAW                      216   1e-66   
gb|AID67119.1|  CRC protein                                             215   2e-66   
ref|XP_010680651.1|  PREDICTED: protein CRABS CLAW                      215   5e-66   
gb|KCW86473.1|  hypothetical protein EUGRSUZ_B03140                     214   6e-66   
gb|AID67117.1|  CRC protein                                             214   1e-65   
ref|XP_009627054.1|  PREDICTED: protein CRABS CLAW-like                 214   1e-65   
gb|AID67120.1|  CRC protein                                             214   1e-65   
ref|XP_004135432.1|  PREDICTED: protein CRABS CLAW-like                 214   2e-65   
gb|AAS10180.1|  YABBY-like transcription factor CRABS CLAW-like p...    213   2e-65   Antirrhinum majus [garden snapdragon]
ref|XP_004155290.1|  PREDICTED: protein CRABS CLAW-like                 213   2e-65   
gb|AGH62810.1|  crabs claw protein                                      213   5e-65   
ref|XP_004239032.1|  PREDICTED: protein CRABS CLAW                      211   7e-65   
ref|XP_008389395.1|  PREDICTED: protein CRABS CLAW isoform X3           212   9e-65   
ref|XP_008389394.1|  PREDICTED: protein CRABS CLAW isoform X2           212   1e-64   
gb|AGH62812.1|  crabs claw protein                                      211   1e-64   
ref|XP_008389393.1|  PREDICTED: protein CRABS CLAW isoform X1           212   2e-64   
ref|XP_004490226.1|  PREDICTED: protein CRABS CLAW-like isoform X2      211   3e-64   
gb|AID67116.1|  CRC protein                                             209   7e-64   
ref|XP_011070915.1|  PREDICTED: protein CRABS CLAW                      209   1e-63   
ref|XP_004490225.1|  PREDICTED: protein CRABS CLAW-like isoform X1      208   2e-63   
gb|AAW83044.1|  CRABS CLAW                                              207   7e-63   Aquilegia formosa
ref|XP_003614201.1|  CRABS CLAW                                         208   1e-62   
ref|XP_004509753.1|  PREDICTED: protein CRABS CLAW-like                 207   1e-62   
gb|EPS70015.1|  hypothetical protein M569_04747                         206   1e-62   
ref|XP_009356541.1|  PREDICTED: protein CRABS CLAW                      204   3e-61   
ref|XP_010936439.1|  PREDICTED: protein DROOPING LEAF-like              202   1e-60   
ref|XP_011011686.1|  PREDICTED: protein CRABS CLAW-like                 200   3e-60   
gb|ABP35569.1|  YABBY transcription factor                              197   4e-59   Lilium longiflorum [Easter lily]
gb|AAW83050.1|  CRABS CLAW                                              196   1e-58   Cleomella sparsifolia
ref|XP_010091608.1|  hypothetical protein L484_026456                   196   2e-58   
ref|XP_011018913.1|  PREDICTED: protein CRABS CLAW-like                 195   5e-58   
ref|XP_004298356.1|  PREDICTED: protein DROOPING LEAF-like              196   5e-58   
ref|XP_002311351.2|  CRABS CLAW family protein                          194   6e-58   Populus trichocarpa [western balsam poplar]
gb|KFK41341.1|  hypothetical protein AALP_AA2G117700                    194   1e-57   
ref|XP_010228969.1|  PREDICTED: protein DROOPING LEAF isoform X2        194   1e-57   
ref|NP_001049375.1|  Os03g0215200                                       193   3e-57   Oryza sativa Japonica Group [Japonica rice]
dbj|BAH83538.1|  DL related protein                                     193   4e-57   Triticum aestivum [Canadian hard winter wheat]
gb|EYU42115.1|  hypothetical protein MIMGU_mgv1a014827mg                192   4e-57   
ref|XP_006391053.1|  hypothetical protein EUTSA_v10019126mg             192   1e-56   
ref|XP_006301241.1|  hypothetical protein CARUB_v10021641mg             191   1e-56   
emb|CDX95957.1|  BnaA07g27740D                                          191   2e-56   
ref|XP_009105464.1|  PREDICTED: protein CRABS CLAW                      190   3e-56   
dbj|BAJ14106.1|  DROOPING LEAF                                          190   3e-56   
ref|NP_001148730.1|  protein DROOPING LEAF                              191   5e-56   Zea mays [maize]
ref|XP_002888705.1|  hypothetical protein ARALYDRAFT_476042             189   5e-56   
gb|AAU12183.1|  CRABS CLAW                                              189   7e-56   Lepidium africanum
ref|XP_002468276.1|  hypothetical protein SORBIDRAFT_01g042850          189   1e-55   Sorghum bicolor [broomcorn]
gb|AAW83049.1|  CRABS CLAW                                              189   1e-55   Lepidium africanum
ref|XP_003558497.1|  PREDICTED: protein DROOPING LEAF isoform X1        189   1e-55   
ref|XP_010470890.1|  PREDICTED: protein CRABS CLAW-like                 189   1e-55   
ref|XP_010228970.1|  PREDICTED: protein DROOPING LEAF isoform X3        189   1e-55   
ref|XP_002316077.1|  CRABS CLAW family protein                          188   1e-55   Populus trichocarpa [western balsam poplar]
gb|ADI58463.1|  drooping leaf                                           188   2e-55   
ref|XP_006649635.1|  PREDICTED: protein DROOPING LEAF-like              189   2e-55   
ref|NP_177078.1|  putative transcription factor CRABS CLAW              188   2e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010939214.1|  PREDICTED: protein DROOPING LEAF-like isofor...    187   2e-55   
ref|XP_010939213.1|  PREDICTED: protein DROOPING LEAF-like isofor...    188   3e-55   
gb|ABF94636.1|  Drooping leaf protein, putative, expressed              188   3e-55   Oryza sativa Japonica Group [Japonica rice]
gb|AAM66994.1|  transcription factor CRC                                186   8e-55   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK04901.1|  predicted protein                                      186   2e-54   
ref|XP_010519368.1|  PREDICTED: protein CRABS CLAW-like isoform X3      186   2e-54   
ref|NP_001183591.1|  uncharacterized protein LOC100502185               186   2e-54   
ref|XP_010519367.1|  PREDICTED: protein CRABS CLAW-like isoform X2      185   4e-54   
ref|XP_008676312.1|  PREDICTED: protein DROOPING LEAF isoform X1        185   5e-54   
dbj|BAI68347.1|  hypothetical protein                                   184   6e-54   
ref|XP_004985190.1|  PREDICTED: protein DROOPING LEAF-like              184   1e-53   
gb|ACG60679.1|  At1g69180 Crabs claw (CRC) transcription factor p...    183   1e-53   Brassica oleracea var. alboglabra
gb|AFW89195.1|  putative YABBY domain transcription factor family...    187   2e-53   
ref|XP_009405981.1|  PREDICTED: protein DROOPING LEAF-like              183   2e-53   
ref|XP_008785629.1|  PREDICTED: protein DROOPING LEAF-like              182   3e-53   
ref|XP_009395243.1|  PREDICTED: protein DROOPING LEAF-like              182   5e-53   
ref|XP_010519366.1|  PREDICTED: protein CRABS CLAW-like isoform X1      181   3e-52   
emb|CAQ17052.1|  crabs claw                                             179   8e-52   Eschscholzia californica
ref|XP_008658974.1|  PREDICTED: uncharacterized protein LOC100502...    182   1e-51   
gb|AAQ11881.1|  CRC-related protein                                     179   1e-51   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009419736.1|  PREDICTED: protein DROOPING LEAF-like              177   3e-51   
ref|XP_010551365.1|  PREDICTED: LOW QUALITY PROTEIN: protein CRAB...    175   2e-50   
ref|XP_010511942.1|  PREDICTED: protein CRABS CLAW                      174   4e-50   
ref|XP_010415547.1|  PREDICTED: protein CRABS CLAW-like                 173   1e-49   
gb|ABW75762.1|  CRABS CLAW protein                                      171   2e-49   Betula papyrifera [canoe birch]
gb|ABW75758.1|  CRABS CLAW protein                                      170   4e-49   Casuarina stricta
gb|ABW75752.1|  CRABS CLAW protein                                      170   4e-49   Physocarpus amurensis
gb|ABW75670.1|  CRABS CLAW protein                                      169   5e-49   Chrysolepis chrysophylla
ref|XP_009400168.1|  PREDICTED: protein DROOPING LEAF-like              172   6e-49   
gb|ABW75757.1|  CRABS CLAW protein                                      169   7e-49   Alfaroa costaricensis
gb|ABW75764.1|  CRABS CLAW protein                                      167   4e-48   Betula papyrifera [canoe birch]
ref|XP_009415804.1|  PREDICTED: protein DROOPING LEAF-like              169   4e-48   
gb|ABW75715.1|  CRABS CLAW protein                                      167   7e-48   Quercus garryana [Oregon oak]
gb|ABW75702.1|  CRABS CLAW protein                                      166   8e-48   Quercus agrifolia [coast live oak]
gb|ABW75704.1|  CRABS CLAW protein                                      166   9e-48   Quercus alba
gb|ABW75729.1|  CRABS CLAW protein                                      166   1e-47   Quercus palustris [pin oak]
ref|XP_011081463.1|  PREDICTED: protein CRABS CLAW-like                 166   2e-47   
gb|ABW75717.1|  CRABS CLAW protein                                      165   3e-47   Quercus glauca
gb|ABW75690.1|  CRABS CLAW protein                                      165   3e-47   Lithocarpus laoticus
gb|ABW75674.1|  CRABS CLAW protein                                      165   3e-47   Lithocarpus balansae
gb|ABW75649.1|  CRABS CLAW protein                                      165   3e-47   Castanea crenata [Japanese chestnut]
gb|ABW75681.1|  CRABS CLAW protein                                      165   3e-47   Lithocarpus dealbatus
gb|ABW75672.1|  CRABS CLAW protein                                      165   4e-47   Colombobalanus excelsa
ref|XP_006856377.1|  hypothetical protein AMTR_s00047p00199030          166   7e-47   
gb|ABW75699.1|  CRABS CLAW protein                                      164   7e-47   Lithocarpus silvicolarum
gb|ABW75763.1|  CRABS CLAW protein                                      164   9e-47   Betula papyrifera [canoe birch]
gb|ABW75726.1|  CRABS CLAW protein                                      163   1e-46   Quercus myrsinifolia [shira-kashi]
gb|ABW75660.1|  CRABS CLAW protein                                      163   1e-46   Castanopsis carlesii
gb|ABW75751.1|  CRABS CLAW protein                                      163   2e-46   Fagus grandifolia
gb|ABW75760.1|  CRABS CLAW protein                                      162   3e-46   Morella cerifera [candleberry]
gb|ABW75761.1|  CRABS CLAW protein                                      159   7e-45   Ruellia anaticollis
gb|ABW75759.1|  CRABS CLAW protein                                      158   1e-44   Rhoiptelea chiliantha
dbj|BAJ83622.1|  CRC-like YABBY protein                                 159   3e-44   
ref|XP_009391477.1|  PREDICTED: protein DROOPING LEAF-like              160   8e-44   
gb|ABW75689.1|  CRABS CLAW protein                                      153   9e-43   Lithocarpus grandifolius
dbj|BAJ83627.1|  CRC-like YABBY protein                                 155   9e-43   
gb|KDO70311.1|  hypothetical protein CISIN_1g046045mg                   151   4e-42   
gb|EMS61056.1|  Protein DROOPING LEAF                                   153   2e-41   
gb|EYU28883.1|  hypothetical protein MIMGU_mgv1a018836mg                145   2e-39   
gb|ADW76862.1|  drooping leaf                                           143   7e-38   
ref|XP_008778120.1|  PREDICTED: protein YABBY 2-like isoform X1         141   3e-37   
ref|XP_007202630.1|  hypothetical protein PRUPE_ppa012028mg             140   9e-37   
gb|EMT28826.1|  hypothetical protein F775_30685                         140   1e-36   
ref|XP_004287301.1|  PREDICTED: axial regulator YABBY 5-like            139   3e-36   
gb|KHG29380.1|  Axial regulator YABBY 1 -like protein                   138   5e-36   
ref|XP_010905004.1|  PREDICTED: protein YABBY 2-like                    137   1e-35   
ref|XP_006445302.1|  hypothetical protein CICLE_v10022170mg             137   2e-35   
ref|XP_009393989.1|  PREDICTED: protein DROOPING LEAF-like              135   2e-35   
gb|AGD94962.1|  transcription factor YABBY1                             137   2e-35   
gb|KDO48950.1|  hypothetical protein CISIN_1g029862mg                   135   4e-35   
ref|XP_006487832.1|  PREDICTED: putative axial regulator YABBY 2-...    135   4e-35   
emb|CDP19940.1|  unnamed protein product                                136   4e-35   
ref|XP_010264212.1|  PREDICTED: protein YABBY 4-like                    136   5e-35   
emb|CAN70458.1|  hypothetical protein VITISV_031595                     135   7e-35   Vitis vinifera
ref|XP_010247851.1|  PREDICTED: putative axial regulator YABBY 2 ...    135   8e-35   
ref|XP_008242786.1|  PREDICTED: axial regulator YABBY 5                 134   1e-34   
ref|XP_006295133.1|  hypothetical protein CARUB_v10024208mg             134   1e-34   
emb|CDP09914.1|  unnamed protein product                                134   1e-34   
ref|XP_009407727.1|  PREDICTED: protein YABBY 2-like                    134   1e-34   
ref|XP_002280334.1|  PREDICTED: axial regulator YABBY 1 isoform X2      135   1e-34   Vitis vinifera
ref|XP_009406691.1|  PREDICTED: protein YABBY 2-like                    134   1e-34   
ref|XP_011088989.1|  PREDICTED: putative axial regulator YABBY 2        134   1e-34   
ref|XP_010661657.1|  PREDICTED: axial regulator YABBY 1 isoform X1      135   2e-34   
ref|XP_002266233.1|  PREDICTED: protein YABBY 4                         134   2e-34   Vitis vinifera
ref|XP_004306943.1|  PREDICTED: axial regulator YABBY 1-like            134   2e-34   
ref|XP_007132510.1|  hypothetical protein PHAVU_011G100300g             133   2e-34   
gb|AHZ90132.1|  YABBY2                                                  133   2e-34   
ref|XP_007052113.1|  Plant-specific transcription factor YABBY fa...    134   3e-34   
ref|XP_003549900.1|  PREDICTED: protein YABBY 4-like                    134   3e-34   
gb|AAO22990.1|  YABBY transcription factor CDM51                        134   3e-34   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|NP_001234390.1|  FAS protein                                        133   3e-34   
gb|AAS10177.1|  YABBY-like transcription factor GRAMINIFOLIA            134   3e-34   Antirrhinum majus [garden snapdragon]
ref|XP_002532573.1|  Axial regulator YABBY1, putative                   134   3e-34   Ricinus communis
ref|XP_009798278.1|  PREDICTED: axial regulator YABBY 5-like            133   4e-34   
ref|XP_010090516.1|  hypothetical protein L484_017140                   133   4e-34   
ref|XP_010263070.1|  PREDICTED: putative axial regulator YABBY 2 ...    133   4e-34   
gb|EYU31966.1|  hypothetical protein MIMGU_mgv1a013346mg                134   5e-34   
ref|XP_010247861.1|  PREDICTED: putative axial regulator YABBY 2 ...    132   6e-34   
gb|KHG22928.1|  Axial regulator YABBY 1 -like protein                   133   7e-34   
gb|KDO48952.1|  hypothetical protein CISIN_1g029862mg                   132   7e-34   
ref|XP_006487833.1|  PREDICTED: putative axial regulator YABBY 2-...    132   8e-34   
ref|XP_009792036.1|  PREDICTED: axial regulator YABBY 5-like isof...    132   8e-34   
dbj|BAQ19377.1|  filamentous flower                                     133   8e-34   
gb|KDO48375.1|  hypothetical protein CISIN_1g028144mg                   133   9e-34   
dbj|BAD83708.1|  filamentous flower like protein                        134   9e-34   Nuphar japonica
ref|XP_006477249.1|  PREDICTED: axial regulator YABBY 3-like isof...    133   9e-34   
ref|XP_006440374.1|  hypothetical protein CICLE_v10021834mg             132   1e-33   
ref|XP_011090395.1|  PREDICTED: axial regulator YABBY 1                 132   1e-33   
ref|NP_850080.1|  axial regulator YABBY 5                               131   1e-33   Arabidopsis thaliana [mouse-ear cress]
gb|KDP25628.1|  hypothetical protein JCGZ_20784                         132   1e-33   
ref|XP_002324648.2|  hypothetical protein POPTR_0018s12990g             132   1e-33   Populus trichocarpa [western balsam poplar]
ref|XP_007015607.1|  Plant-specific transcription factor YABBY fa...    131   1e-33   
ref|XP_010053914.1|  PREDICTED: axial regulator YABBY 1                 132   2e-33   
ref|XP_009611999.1|  PREDICTED: putative axial regulator YABBY 2 ...    131   2e-33   
gb|ABW80974.1|  YABBY2                                                  131   2e-33   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009792035.1|  PREDICTED: axial regulator YABBY 5-like isof...    131   2e-33   
dbj|BAD72170.1|  filamentous flower like protein                        131   2e-33   Amborella trichopoda
dbj|BAD72169.1|  YABBY5 like protein                                    130   2e-33   Cabomba caroliniana
dbj|BAJ83624.1|  YAB5-like YABBY protein                                130   2e-33   
ref|XP_007039924.1|  Plant-specific transcription factor YABBY fa...    131   3e-33   
ref|XP_008787013.1|  PREDICTED: protein YABBY 4-like                    132   3e-33   
gb|EYU31965.1|  hypothetical protein MIMGU_mgv1a013346mg                132   3e-33   
ref|XP_009792034.1|  PREDICTED: axial regulator YABBY 5-like isof...    130   3e-33   
ref|XP_009612000.1|  PREDICTED: axial regulator YABBY 5-like isof...    130   3e-33   
ref|XP_002308074.1|  plant-specific transcription factor YABBY fa...    130   3e-33   Populus trichocarpa [western balsam poplar]
ref|XP_004487438.1|  PREDICTED: putative axial regulator YABBY 2-...    130   3e-33   
ref|XP_011033940.1|  PREDICTED: axial regulator YABBY 1                 131   4e-33   
gb|AAS10179.1|  YABBY2-like transcription factor YAB2                   130   4e-33   Antirrhinum majus [garden snapdragon]
ref|XP_006840962.1|  hypothetical protein AMTR_s00085p00032940          131   4e-33   
ref|XP_010056343.1|  PREDICTED: axial regulator YABBY 1-like            131   4e-33   
ref|XP_002320712.1|  abnormal floral organs family protein              131   4e-33   Populus trichocarpa [western balsam poplar]
ref|XP_011017779.1|  PREDICTED: axial regulator YABBY 5-like            130   4e-33   
gb|AEK35321.1|  YABBY3-like protein                                     131   4e-33   
dbj|BAF56419.1|  YABBY2 like protein                                    130   5e-33   Ruscus aculeatus
ref|XP_010685467.1|  PREDICTED: putative axial regulator YABBY 2 ...    130   5e-33   
ref|XP_009792033.1|  PREDICTED: axial regulator YABBY 5-like isof...    130   5e-33   
ref|XP_004508482.1|  PREDICTED: axial regulator YABBY 5-like            130   6e-33   
ref|XP_006477248.1|  PREDICTED: axial regulator YABBY 3-like isof...    131   6e-33   
ref|XP_011018257.1|  PREDICTED: protein YABBY 4-like                    130   7e-33   
ref|XP_006368172.1|  hypothetical protein POPTR_0001s00240g             130   7e-33   
ref|XP_010105229.1|  hypothetical protein L484_012344                   130   7e-33   
ref|XP_003525801.1|  PREDICTED: protein YABBY 4-like isoform X1         130   7e-33   
gb|KFK43154.1|  hypothetical protein AALP_AA1G086900                    129   8e-33   
gb|AAS10178.1|  YABBY-like transcription factor PROLONGATA              129   9e-33   Antirrhinum majus [garden snapdragon]
gb|AFY26892.1|  YABBY2-like transcription factor YAB2                   129   9e-33   
ref|XP_006440375.1|  hypothetical protein CICLE_v10021834mg             131   1e-32   
ref|XP_010093672.1|  hypothetical protein L484_019011                   130   1e-32   
ref|XP_011017468.1|  PREDICTED: axial regulator YABBY 1                 130   1e-32   
ref|XP_003577247.1|  PREDICTED: protein YABBY 6-like isoform X2         129   1e-32   
ref|XP_006409724.1|  hypothetical protein EUTSA_v10017320mg             128   1e-32   
ref|XP_006591839.1|  PREDICTED: uncharacterized protein LOC100500...    129   1e-32   
ref|XP_003517025.1|  PREDICTED: axial regulator YABBY 1-like            130   1e-32   
ref|XP_009364015.1|  PREDICTED: axial regulator YABBY 5-like            129   1e-32   
ref|XP_011033925.1|  PREDICTED: protein YABBY 4-like                    129   1e-32   
ref|NP_001281031.1|  axial regulator YABBY 5                            129   1e-32   
gb|KDO85746.1|  hypothetical protein CISIN_1g027215mg                   130   1e-32   
ref|XP_010048072.1|  PREDICTED: axial regulator YABBY 5                 129   2e-32   
gb|KCW73030.1|  hypothetical protein EUGRSUZ_E01474                     131   2e-32   
ref|XP_010685466.1|  PREDICTED: putative axial regulator YABBY 2 ...    129   2e-32   
ref|XP_010263069.1|  PREDICTED: putative axial regulator YABBY 2 ...    128   2e-32   
ref|XP_003609353.1|  YABBY protein                                      128   2e-32   
ref|XP_002527201.1|  Axial regulator YABBY5, putative                   128   2e-32   Ricinus communis
ref|NP_001050783.1|  Os03g0650000                                       128   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001141765.1|  uncharacterized protein LOC100273901               128   2e-32   Zea mays [maize]
gb|ACG33156.1|  axial regulator YABBY2                                  128   2e-32   Zea mays [maize]
ref|XP_007134824.1|  hypothetical protein PHAVU_010G079200g             129   2e-32   
ref|XP_002304427.1|  hypothetical protein POPTR_0003s11230g             129   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011020144.1|  PREDICTED: axial regulator YABBY 5-like            128   3e-32   
emb|CDX97491.1|  BnaC08g13560D                                          128   3e-32   
ref|XP_007209583.1|  hypothetical protein PRUPE_ppa011209mg             129   3e-32   
ref|XP_009781194.1|  PREDICTED: protein YABBY 4-like                    128   3e-32   
ref|XP_008457474.1|  PREDICTED: axial regulator YABBY 5                 128   4e-32   
ref|XP_008238617.1|  PREDICTED: protein YABBY 4-like                    129   4e-32   
ref|XP_010653257.1|  PREDICTED: axial regulator YABBY 5 isoform X4      127   4e-32   
ref|XP_009389764.1|  PREDICTED: protein YABBY 2-like                    127   4e-32   
ref|XP_006657460.1|  PREDICTED: protein YABBY 1-like                    127   4e-32   
ref|XP_006417685.1|  hypothetical protein EUTSA_v10008858mg             127   4e-32   
gb|KHN41251.1|  Putative axial regulator YABBY 2                        127   4e-32   
ref|XP_004173692.1|  PREDICTED: axial regulator YABBY 5-like            127   5e-32   
ref|XP_010917944.1|  PREDICTED: protein YABBY 2-like isoform X7         127   5e-32   
ref|XP_009339707.1|  PREDICTED: axial regulator YABBY 1-like            128   5e-32   
ref|XP_002889696.1|  hypothetical protein ARALYDRAFT_470907             127   5e-32   
ref|XP_010088882.1|  hypothetical protein L484_020870                   128   5e-32   
ref|XP_004963175.1|  PREDICTED: protein YABBY 6-like isoform X2         127   5e-32   
ref|XP_003561769.1|  PREDICTED: protein YABBY 2-like                    127   5e-32   
ref|XP_004139305.1|  PREDICTED: axial regulator YABBY 5-like            127   5e-32   
ref|XP_009375773.1|  PREDICTED: axial regulator YABBY 1 isoform X2      129   5e-32   
gb|KDO80207.1|  hypothetical protein CISIN_1g028980mg                   127   5e-32   
ref|XP_006417684.1|  hypothetical protein EUTSA_v10008858mg             127   5e-32   
ref|XP_007218311.1|  hypothetical protein PRUPE_ppa010905mg             128   6e-32   
ref|XP_008385588.1|  PREDICTED: putative axial regulator YABBY 2 ...    127   6e-32   
gb|ACL68660.1|  graminifolia protein                                    128   6e-32   
ref|XP_006450896.1|  hypothetical protein CICLE_v10009560mg             127   7e-32   
gb|KDP28784.1|  hypothetical protein JCGZ_14555                         128   7e-32   
ref|XP_009375772.1|  PREDICTED: axial regulator YABBY 1 isoform X1      128   7e-32   
ref|XP_010687959.1|  PREDICTED: axial regulator YABBY 5                 127   7e-32   
ref|XP_010263071.1|  PREDICTED: putative axial regulator YABBY 2 ...    127   7e-32   
ref|XP_008232595.1|  PREDICTED: axial regulator YABBY 1 isoform X2      128   7e-32   
ref|XP_006650352.1|  PREDICTED: protein YABBY 2-like                    127   7e-32   
gb|KDO48951.1|  hypothetical protein CISIN_1g029862mg                   127   7e-32   
ref|XP_009793076.1|  PREDICTED: axial regulator YABBY 1                 128   7e-32   
gb|ACJ85113.1|  unknown                                                 127   7e-32   
ref|XP_004963174.1|  PREDICTED: protein YABBY 6-like isoform X1         127   8e-32   
ref|XP_009609785.1|  PREDICTED: axial regulator YABBY 1                 128   8e-32   
ref|XP_009611997.1|  PREDICTED: putative axial regulator YABBY 2 ...    127   8e-32   
gb|KDO80208.1|  hypothetical protein CISIN_1g028980mg                   127   8e-32   
ref|XP_010254434.1|  PREDICTED: axial regulator YABBY 5-like            127   9e-32   
gb|ADY39185.1|  transcription factor INO                                126   9e-32   
ref|XP_010524377.1|  PREDICTED: axial regulator YABBY 1-like            128   9e-32   
ref|XP_008344381.1|  PREDICTED: axial regulator YABBY 1-like            128   9e-32   
ref|XP_003521963.1|  PREDICTED: axial regulator YABBY 1-like            127   9e-32   
ref|XP_010488902.1|  PREDICTED: putative axial regulator YABBY 2        127   1e-31   
gb|ACU23522.1|  unknown                                                 127   1e-31   
ref|XP_008796843.1|  PREDICTED: protein YABBY 4-like                    127   1e-31   
ref|XP_008232594.1|  PREDICTED: axial regulator YABBY 1 isoform X1      127   1e-31   
ref|XP_009359375.1|  PREDICTED: axial regulator YABBY 1-like            127   1e-31   
ref|XP_009133935.1|  PREDICTED: axial regulator YABBY 5                 125   1e-31   
ref|XP_011078402.1|  PREDICTED: axial regulator YABBY 5                 126   1e-31   
emb|CDP15572.1|  unnamed protein product                                126   1e-31   
ref|XP_006358281.1|  PREDICTED: axial regulator YABBY 5-like            126   1e-31   
gb|AGD94963.1|  transcription factor YABBY2                             126   1e-31   
ref|XP_010917942.1|  PREDICTED: protein YABBY 2-like isoform X5         125   1e-31   
ref|XP_002277937.1|  PREDICTED: putative axial regulator YABBY 2 ...    126   1e-31   
emb|CDP10425.1|  unnamed protein product                                126   1e-31   
emb|CDX83239.1|  BnaA03g22670D                                          125   1e-31   
ref|XP_010651638.1|  PREDICTED: putative axial regulator YABBY 2 ...    126   2e-31   
ref|XP_003577246.1|  PREDICTED: protein YABBY 6-like isoform X1         126   2e-31   
ref|NP_001058937.1|  Os07g0160100                                       125   2e-31   
ref|NP_001236663.1|  uncharacterized protein LOC100500091               126   2e-31   
ref|XP_008230517.1|  PREDICTED: putative axial regulator YABBY 2 ...    126   2e-31   
ref|NP_001077490.1|  transcription factor YABBY family protein          126   2e-31   
gb|AAC72847.1|  unknown                                                 125   2e-31   
emb|CDY38528.1|  BnaC03g26690D                                          125   2e-31   
gb|KDP32424.1|  hypothetical protein JCGZ_13349                         126   2e-31   
gb|ADY39186.1|  transcription factor INO                                125   2e-31   
gb|EYU34993.1|  hypothetical protein MIMGU_mgv1a014582mg                126   2e-31   
ref|XP_007150002.1|  hypothetical protein PHAVU_005G117600g             125   2e-31   
ref|XP_008381158.1|  PREDICTED: axial regulator YABBY 1-like            127   2e-31   
ref|XP_002442565.1|  hypothetical protein SORBIDRAFT_08g022030          126   2e-31   
ref|XP_010917943.1|  PREDICTED: protein YABBY 2-like isoform X6         125   2e-31   
ref|XP_010458084.1|  PREDICTED: putative axial regulator YABBY 2        125   2e-31   
gb|KHG19574.1|  Axial regulator YABBY 1 -like protein                   126   2e-31   
ref|XP_008810627.1|  PREDICTED: protein YABBY 2-like isoform X2         125   2e-31   
ref|XP_002285328.1|  PREDICTED: axial regulator YABBY 5 isoform X1      125   2e-31   
gb|AEK35322.1|  YABBY2-like protein                                     126   2e-31   
ref|XP_008373809.1|  PREDICTED: axial regulator YABBY 1-like            126   3e-31   
gb|ACJ86053.1|  unknown                                                 126   3e-31   
ref|XP_004298663.1|  PREDICTED: axial regulator YABBY 1-like            127   3e-31   
ref|XP_003596925.1|  YABBY protein                                      125   3e-31   
ref|XP_010544625.1|  PREDICTED: axial regulator YABBY 1-like            126   3e-31   
ref|XP_006303358.1|  hypothetical protein CARUB_v10010384mg             125   3e-31   
ref|XP_008230525.1|  PREDICTED: putative axial regulator YABBY 2 ...    125   3e-31   
gb|AEK35324.1|  YABBY5-like protein                                     125   3e-31   
gb|KHG24875.1|  Axial regulator YABBY 5 -like protein                   125   3e-31   
ref|XP_010533151.1|  PREDICTED: axial regulator YABBY 5                 125   3e-31   
ref|XP_004229793.1|  PREDICTED: axial regulator YABBY 1                 127   3e-31   
ref|XP_010653256.1|  PREDICTED: axial regulator YABBY 5 isoform X3      125   3e-31   
ref|XP_006842053.1|  hypothetical protein AMTR_s00078p00029420          126   3e-31   
ref|XP_010653254.1|  PREDICTED: axial regulator YABBY 5 isoform X2      125   4e-31   
ref|XP_008364378.1|  PREDICTED: axial regulator YABBY 1-like isof...    126   4e-31   
ref|XP_006347890.1|  PREDICTED: axial regulator YABBY 1-like            126   4e-31   
ref|XP_006594909.1|  PREDICTED: putative axial regulator YABBY 2-...    124   4e-31   
ref|XP_010259025.1|  PREDICTED: protein YABBY 4-like                    125   4e-31   
ref|XP_010917941.1|  PREDICTED: protein YABBY 2-like isoform X4         124   5e-31   
ref|XP_004140176.1|  PREDICTED: putative axial regulator YABBY 2-...    124   5e-31   
dbj|BAD72168.1|  YABBY2 like protein                                    125   5e-31   
emb|CDX95059.1|  BnaC05g06120D                                          125   5e-31   
ref|XP_009148101.1|  PREDICTED: putative axial regulator YABBY 2 ...    125   5e-31   
ref|XP_003540284.1|  PREDICTED: putative axial regulator YABBY 2-...    124   5e-31   
ref|XP_002263154.2|  PREDICTED: axial regulator YABBY 5 isoform X1      125   5e-31   
ref|XP_008449608.1|  PREDICTED: putative axial regulator YABBY 2        124   5e-31   
ref|XP_008382120.1|  PREDICTED: putative axial regulator YABBY 2 ...    125   5e-31   
gb|AFK33997.1|  unknown                                                 124   6e-31   
gb|AGT16533.1|  axial regulator                                         125   6e-31   
ref|XP_009626437.1|  PREDICTED: axial regulator YABBY 5-like            124   6e-31   
ref|XP_008790360.1|  PREDICTED: protein YABBY 2-like isoform X2         124   6e-31   
ref|XP_003543399.1|  PREDICTED: putative axial regulator YABBY 2-...    124   6e-31   
ref|NP_001276158.1|  uncharacterized protein LOC100785458               124   6e-31   
ref|XP_009368867.1|  PREDICTED: axial regulator YABBY 5-like            124   6e-31   
gb|AFN26939.1|  FIL protein                                             125   6e-31   
ref|XP_010475645.1|  PREDICTED: putative axial regulator YABBY 2        124   7e-31   
ref|XP_009148102.1|  PREDICTED: putative axial regulator YABBY 2 ...    124   7e-31   
ref|XP_008790367.1|  PREDICTED: protein YABBY 2-like isoform X3         124   7e-31   
ref|XP_009408517.1|  PREDICTED: axial regulator YABBY 5-like            124   7e-31   
ref|XP_002878987.1|  plant-specific transcription factor yabby fa...    124   8e-31   
gb|AID67134.1|  YAB2 protein                                            124   8e-31   
ref|XP_006361110.1|  PREDICTED: putative axial regulator YABBY 2-...    124   8e-31   
ref|XP_008364377.1|  PREDICTED: axial regulator YABBY 1-like isof...    125   8e-31   
ref|XP_010510888.1|  PREDICTED: axial regulator YABBY 5                 123   9e-31   
gb|EMT27813.1|  Protein YABBY 6                                         124   9e-31   
dbj|BAC82106.1|  putative transcription factor                          124   9e-31   
ref|XP_008385589.1|  PREDICTED: putative axial regulator YABBY 2 ...    124   9e-31   
ref|XP_006409726.1|  hypothetical protein EUTSA_v10017320mg             123   1e-30   
ref|XP_009110892.1|  PREDICTED: putative axial regulator YABBY 2 ...    124   1e-30   
ref|XP_009600360.1|  PREDICTED: axial regulator YABBY 1-like            124   1e-30   
ref|NP_001280989.1|  putative axial regulator YABBY 2                   124   1e-30   
gb|KDP42970.1|  hypothetical protein JCGZ_23912                         124   2e-30   
ref|XP_009110891.1|  PREDICTED: putative axial regulator YABBY 2 ...    123   2e-30   
gb|AID67135.1|  YAB2 protein                                            124   2e-30   
ref|XP_007150001.1|  hypothetical protein PHAVU_005G117600g             123   2e-30   
ref|XP_007013479.1|  Plant-specific transcription factor YABBY fa...    123   2e-30   
ref|XP_008790352.1|  PREDICTED: protein YABBY 2-like isoform X1         122   2e-30   
ref|XP_010651637.1|  PREDICTED: putative axial regulator YABBY 2 ...    123   2e-30   
ref|XP_009378606.1|  PREDICTED: putative axial regulator YABBY 2 ...    123   2e-30   
dbj|BAJ89435.1|  predicted protein                                      123   2e-30   
dbj|BAJ83625.1|  FIL-like YABBY protein                                 124   2e-30   
ref|XP_009607227.1|  PREDICTED: axial regulator YABBY 5-like isof...    123   2e-30   
ref|XP_006826429.1|  hypothetical protein AMTR_s00004p00165390          124   2e-30   
ref|XP_006355492.1|  PREDICTED: protein YABBY 4                         124   3e-30   
ref|XP_004251722.1|  PREDICTED: axial regulator YABBY 5-like isof...    123   3e-30   
ref|XP_010651636.1|  PREDICTED: putative axial regulator YABBY 2 ...    122   3e-30   
gb|ACA64096.1|  YABBY1                                                  124   3e-30   
gb|AID67123.1|  FAS protein                                             122   3e-30   
gb|AID67122.1|  FAS protein                                             122   3e-30   
gb|AID67130.1|  YAB1 protein                                            123   3e-30   
ref|XP_009346562.1|  PREDICTED: axial regulator YABBY 3-like            124   3e-30   
gb|KCW73031.1|  hypothetical protein EUGRSUZ_E01474                     125   3e-30   
ref|XP_009611998.1|  PREDICTED: putative axial regulator YABBY 2 ...    122   3e-30   
ref|XP_004982272.1|  PREDICTED: protein YABBY 2-like                    122   3e-30   
ref|XP_006664216.1|  PREDICTED: protein YABBY 6-like                    123   4e-30   
ref|XP_010473042.1|  PREDICTED: axial regulator YABBY 5-like            121   4e-30   
ref|XP_006345225.1|  PREDICTED: axial regulator YABBY 5-like            122   5e-30   
ref|XP_006386566.1|  hypothetical protein POPTR_0002s14600g             122   5e-30   
ref|XP_008448889.1|  PREDICTED: protein YABBY 4-like                    122   5e-30   
ref|NP_001238347.1|  uncharacterized protein LOC100499942               122   5e-30   
ref|XP_006397699.1|  hypothetical protein EUTSA_v10001617mg             123   5e-30   
ref|XP_009118373.1|  PREDICTED: putative axial regulator YABBY 2 ...    122   5e-30   
dbj|BAK08176.1|  predicted protein                                      122   6e-30   
gb|AID67136.1|  YAB2 protein                                            122   6e-30   
gb|KHG14718.1|  Axial regulator YABBY 5 -like protein                   122   6e-30   
emb|CDY56250.1|  BnaA07g38010D                                          122   6e-30   
ref|XP_009104095.1|  PREDICTED: axial regulator YABBY 1 isoform X3      122   6e-30   
gb|ABK95415.1|  unknown                                                 122   6e-30   
dbj|BAJ83620.1|  FIL-like YABBY protein                                 122   6e-30   
ref|XP_004150647.1|  PREDICTED: protein YABBY 4-like                    122   7e-30   
ref|XP_010031584.1|  PREDICTED: putative axial regulator YABBY 2 ...    122   7e-30   
gb|AID67133.1|  YAB2 protein                                            122   7e-30   
dbj|BAJ83621.1|  INO-like YABBY protein                                 122   7e-30   
gb|AID67113.1|  YAB5 protein                                            121   7e-30   
dbj|BAJ83626.1|  INO-like YABBY protein                                 122   7e-30   
ref|XP_010544370.1|  PREDICTED: axial regulator YABBY 3                 122   7e-30   
gb|AID67126.1|  FAS protein                                             121   8e-30   
ref|XP_007155017.1|  hypothetical protein PHAVU_003G166100g             121   8e-30   
ref|XP_006594908.1|  PREDICTED: putative axial regulator YABBY 2-...    121   8e-30   
gb|ADE75601.1|  unknown                                                 121   9e-30   
dbj|BAC82107.1|  putative transcription factor                          122   9e-30   
ref|XP_009104094.1|  PREDICTED: axial regulator YABBY 1 isoform X2      122   1e-29   
ref|XP_004241356.1|  PREDICTED: putative axial regulator YABBY 2 ...    121   1e-29   
gb|AID67112.1|  YAB5 protein                                            121   1e-29   
ref|XP_002515880.1|  Axial regulator YABBY2, putative                   121   1e-29   
ref|XP_004150030.1|  PREDICTED: axial regulator YABBY 5-like            121   1e-29   
gb|AID67127.1|  YAB1 protein                                            122   1e-29   
ref|XP_009104093.1|  PREDICTED: axial regulator YABBY 1 isoform X1      122   1e-29   
ref|XP_009118372.1|  PREDICTED: putative axial regulator YABBY 2 ...    121   1e-29   
ref|XP_011044615.1|  PREDICTED: putative axial regulator YABBY 2 ...    121   1e-29   
ref|XP_009382346.1|  PREDICTED: axial regulator YABBY 1-like            122   1e-29   
gb|AAU12182.1|  CRABS CLAW                                              119   1e-29   
emb|CAN74459.1|  hypothetical protein VITISV_012710                     120   1e-29   
ref|XP_002459367.1|  hypothetical protein SORBIDRAFT_02g003390          120   1e-29   
ref|XP_006840679.1|  hypothetical protein AMTR_s00096p00054100          121   1e-29   
ref|XP_003542627.1|  PREDICTED: axial regulator YABBY 5-like            121   1e-29   
gb|AID67111.1|  YAB5 protein                                            120   1e-29   
ref|XP_006417686.1|  hypothetical protein EUTSA_v10008858mg             120   1e-29   
ref|XP_009398350.1|  PREDICTED: axial regulator YABBY 5-like isof...    120   2e-29   
gb|ACU19358.1|  unknown                                                 120   2e-29   
ref|XP_010676179.1|  PREDICTED: protein YABBY 4-like isoform X2         121   2e-29   
ref|XP_009378607.1|  PREDICTED: putative axial regulator YABBY 2 ...    120   2e-29   
ref|XP_006340315.1|  PREDICTED: putative axial regulator YABBY 2-...    120   2e-29   
ref|XP_002323368.2|  hypothetical protein POPTR_0016s06760g             120   2e-29   
ref|XP_010250140.1|  PREDICTED: axial regulator YABBY 5-like isof...    120   2e-29   
ref|XP_011090281.1|  PREDICTED: putative axial regulator YABBY 2 ...    120   2e-29   
ref|XP_011044616.1|  PREDICTED: putative axial regulator YABBY 2 ...    120   2e-29   
ref|XP_010322450.1|  PREDICTED: putative axial regulator YABBY 2 ...    120   2e-29   
gb|AID67132.1|  YAB1 protein                                            121   2e-29   
gb|ABK25610.1|  unknown                                                 120   3e-29   
ref|XP_010676177.1|  PREDICTED: axial regulator YABBY 1-like isof...    121   3e-29   
gb|AID67125.1|  FAS protein                                             120   3e-29   
ref|XP_004506104.1|  PREDICTED: axial regulator YABBY 1-like            120   3e-29   
ref|XP_007155627.1|  hypothetical protein PHAVU_003G217700g             120   3e-29   
ref|XP_009785258.1|  PREDICTED: axial regulator YABBY 5                 120   4e-29   
ref|XP_010031586.1|  PREDICTED: putative axial regulator YABBY 2 ...    120   4e-29   
emb|CDY22681.1|  BnaC08g43150D                                          120   4e-29   
ref|XP_009398349.1|  PREDICTED: axial regulator YABBY 5-like isof...    120   4e-29   
ref|XP_003557576.1|  PREDICTED: protein YABBY 1-like                    119   4e-29   
ref|XP_007021795.1|  Plant-specific transcription factor YABBY fa...    119   4e-29   
ref|XP_009133711.1|  PREDICTED: axial regulator YABBY 1                 120   5e-29   
ref|XP_002882000.1|  hypothetical protein ARALYDRAFT_903959             120   5e-29   
ref|XP_010031585.1|  PREDICTED: putative axial regulator YABBY 2 ...    119   6e-29   
ref|XP_008667127.1|  PREDICTED: uncharacterized protein LOC100272...    120   6e-29   
gb|AID67114.1|  YAB5 protein                                            119   6e-29   
emb|CDX95636.1|  BnaC03g25170D                                          120   6e-29   
ref|XP_006294955.1|  hypothetical protein CARUB_v10024011mg             120   7e-29   
ref|XP_009762053.1|  PREDICTED: axial regulator YABBY 5-like isof...    119   8e-29   
ref|XP_009762052.1|  PREDICTED: axial regulator YABBY 5-like isof...    119   9e-29   
ref|XP_009622268.1|  PREDICTED: axial regulator YABBY 5-like isof...    119   9e-29   
gb|ADE77754.1|  unknown                                                 118   9e-29   
gb|AES90958.2|  plant-specific transcription factor YABBY family ...    119   9e-29   
ref|XP_010917940.1|  PREDICTED: protein YABBY 2-like isoform X3         119   1e-28   
ref|NP_001149388.1|  LOC100283014                                       118   1e-28   
gb|AID67128.1|  YAB1 protein                                            119   1e-28   
ref|NP_566037.1|  axial regulator YABBY 1                               119   1e-28   
ref|NP_001140845.1|  uncharacterized protein LOC100272921               119   1e-28   
ref|XP_004242778.1|  PREDICTED: axial regulator YABBY 5                 118   1e-28   
gb|KHG30510.1|  Putative axial regulator YABBY 2 -like protein          118   2e-28   
ref|XP_010506457.1|  PREDICTED: axial regulator YABBY 1                 119   2e-28   
ref|XP_010508202.1|  PREDICTED: axial regulator YABBY 1-like            119   2e-28   
gb|KCW86700.1|  hypothetical protein EUGRSUZ_B03310                     118   2e-28   
ref|XP_009408705.1|  PREDICTED: protein YABBY 5-like                    118   2e-28   
ref|XP_008667122.1|  PREDICTED: uncharacterized protein LOC100272...    118   2e-28   
gb|ACN35306.1|  unknown                                                 118   2e-28   
gb|AID67131.1|  YAB1 protein                                            118   2e-28   
gb|AEK35323.1|  YABBY2-like protein                                     117   3e-28   



>ref|XP_010650015.1| PREDICTED: protein CRABS CLAW isoform X1 [Vitis vinifera]
Length=175

 Score =   241 bits (614),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 129/167 (77%), Positives = 142/167 (85%), Gaps = 3/167 (2%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MDL  P SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLSTRPPL
Sbjct  4    EEKATMDLV-PPSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLSTRPPL  62

Query  563  QPQCHDHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRF  387
            Q QC DH  +   V CN F++GQSSSSS ++S      KAPFVVKPPEKKHRLPSAYNRF
Sbjct  63   QGQCLDHQMSLQGV-CNDFRKGQSSSSSSSTSSEPVSPKAPFVVKPPEKKHRLPSAYNRF  121

Query  386  MKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            MKEEIQRIK ANPEIPHREAFSAAAKNWARYIPN+P+ S SES++N 
Sbjct  122  MKEEIQRIKVANPEIPHREAFSAAAKNWARYIPNSPAGSVSESSNNG  168



>ref|XP_002263611.1| PREDICTED: protein CRABS CLAW isoform X2 [Vitis vinifera]
Length=168

 Score =   240 bits (612),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 142/166 (86%), Gaps = 3/166 (2%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MDL  P SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLSTRPPL
Sbjct  4    EEKATMDLV-PPSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLSTRPPL  62

Query  563  QPQCHDHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRF  387
            Q QC DH  +   V CN F++GQSSSSS ++S      KAPFVVKPPEKKHRLPSAYNRF
Sbjct  63   QGQCLDHQMSLQGV-CNDFRKGQSSSSSSSTSSEPVSPKAPFVVKPPEKKHRLPSAYNRF  121

Query  386  MKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            MKEEIQRIK ANPEIPHREAFSAAAKNWARYIPN+P+ S SES++N
Sbjct  122  MKEEIQRIKVANPEIPHREAFSAAAKNWARYIPNSPAGSVSESSNN  167



>ref|XP_009600446.1| PREDICTED: protein CRABS CLAW-like [Nicotiana tomentosiformis]
 gb|AAW83046.1| CRABS CLAW [Nicotiana tabacum]
Length=181

 Score =   238 bits (607),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 139/165 (84%), Gaps = 4/165 (2%)
 Frame = -1

Query  737  KTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP  558
            K SMDL Q SSEHLCYVRCSFCNTVLAVGIP KR+L+TVTVKCGHCSNLSFLSTRPPLQ 
Sbjct  20   KNSMDLVQ-SSEHLCYVRCSFCNTVLAVGIPYKRLLDTVTVKCGHCSNLSFLSTRPPLQG  78

Query  557  QCHDHH-ANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMK  381
            QC DH  A       + FK+GQSSSSS +       KAPFVVKPPEKKHRLPSAYNRFMK
Sbjct  79   QCFDHQSALQHQTFFSDFKKGQSSSSSSSEPSSP--KAPFVVKPPEKKHRLPSAYNRFMK  136

Query  380  EEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            +EIQRIKAANPEIPHREAFSAAAKNWARYIPNTP+ + +ES++NA
Sbjct  137  DEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPNGTLAESSNNA  181



>emb|CBI27316.3| unnamed protein product [Vitis vinifera]
Length=160

 Score =   237 bits (604),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 139/161 (86%), Gaps = 3/161 (2%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MDL  P SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLSTRPPLQ QC 
Sbjct  1    MDLV-PPSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLSTRPPLQGQCL  59

Query  548  DHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEI  372
            DH  +   V CN F++GQSSSSS ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEI
Sbjct  60   DHQMSLQGV-CNDFRKGQSSSSSSSTSSEPVSPKAPFVVKPPEKKHRLPSAYNRFMKEEI  118

Query  371  QRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            QRIK ANPEIPHREAFSAAAKNWARYIPN+P+ S SES++N
Sbjct  119  QRIKVANPEIPHREAFSAAAKNWARYIPNSPAGSVSESSNN  159



>ref|XP_009797005.1| PREDICTED: protein CRABS CLAW [Nicotiana sylvestris]
 gb|AAW83047.1| CRABS CLAW [Nicotiana tabacum]
Length=181

 Score =   237 bits (604),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 139/165 (84%), Gaps = 4/165 (2%)
 Frame = -1

Query  737  KTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP  558
            + SMDL Q SSEHLCYVRCSFCNTVLAVGIP KR+L+TVTVKCGHCSNLSFLSTRPPLQ 
Sbjct  20   RNSMDLVQ-SSEHLCYVRCSFCNTVLAVGIPYKRLLDTVTVKCGHCSNLSFLSTRPPLQG  78

Query  557  QCHDHH-ANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMK  381
            QC DH  A       + FK+GQSSSSS +       KAPFVVKPPEKKHRLPSAYNRFMK
Sbjct  79   QCFDHQTALQHQAFFSDFKKGQSSSSSSSEPSSP--KAPFVVKPPEKKHRLPSAYNRFMK  136

Query  380  EEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            +EIQRIKAANPEIPHREAFSAAAKNWARYIPNTP+ + +ES++NA
Sbjct  137  DEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPNGTLAESSNNA  181



>ref|XP_007045805.1| Plant-specific transcription factor YABBY family protein [Theobroma 
cacao]
 gb|EOY01637.1| Plant-specific transcription factor YABBY family protein [Theobroma 
cacao]
Length=238

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 137/173 (79%), Gaps = 3/173 (2%)
 Frame = -1

Query  761  LDLQTKEIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFL  582
             D    E K  MDL  P SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFL
Sbjct  66   FDNMNLEEKVGMDLV-PQSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFL  124

Query  581  STRPPLQPQCHDHHAN-NFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRL  408
            STRPPLQ QC D   + +    C  F++GQS S S + S   S  KAPFVVKPPEKKHRL
Sbjct  125  STRPPLQGQCLDPQTSLSLQSFCGDFRKGQSPSPSSSPSSEPSSPKAPFVVKPPEKKHRL  184

Query  407  PSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            PSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPN+P+ S S S SN
Sbjct  185  PSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNSPATSVSGSRSN  237



>gb|AAW83048.1| CRABS CLAW [Petunia x hybrida]
Length=162

 Score =   233 bits (594),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/163 (79%), Positives = 138/163 (85%), Gaps = 3/163 (2%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MDLAQ +SEHLCYVRCSFCNTVLAVGIP KR+L+TVTVKCGHCSNLSFLSTRPPLQ QC 
Sbjct  1    MDLAQ-TSEHLCYVRCSFCNTVLAVGIPFKRLLDTVTVKCGHCSNLSFLSTRPPLQGQCF  59

Query  548  DHH-ANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEE  375
            DH  A       + +K+GQSSSS  +SS   S  KAPFVVKPPEKKHRLPSAYNRFMKEE
Sbjct  60   DHQTALQHQAFFSDYKKGQSSSSFSSSSSEPSSPKAPFVVKPPEKKHRLPSAYNRFMKEE  119

Query  374  IQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            IQRIKAANPEIPHREAFSAAAKNWARYIPNTP+   SES +NA
Sbjct  120  IQRIKAANPEIPHREAFSAAAKNWARYIPNTPNGPLSESRNNA  162



>ref|XP_010260715.1| PREDICTED: protein CRABS CLAW-like isoform X2 [Nelumbo nucifera]
Length=182

 Score =   228 bits (582),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 132/156 (85%), Gaps = 1/156 (1%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHAN  534
            PSSEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLSTRPPL  Q  DHH  
Sbjct  5    PSSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLSTRPPLPGQRMDHHQL  64

Query  533  NFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKA  357
             F V CN ++R QSSSSS ++S      K P+VVKPPE+KHRLPSAYNRFMKEEIQRIKA
Sbjct  65   GFQVFCNDYRRTQSSSSSSSTSSQQMSPKVPYVVKPPERKHRLPSAYNRFMKEEIQRIKA  124

Query  356  ANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            ANPEIPHREAFS AAKNWARY+P+ P+ S SE+N N
Sbjct  125  ANPEIPHREAFSTAAKNWARYVPHPPTGSVSENNKN  160



>gb|AIF75109.1| CRC2 [Petunia axillaris subsp. axillaris]
Length=160

 Score =   226 bits (577),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 136/162 (84%), Gaps = 3/162 (2%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MDL Q SSEH CYVRC+FC+TVLAVGIP KR+L+TVTVKCGHCSNLSFLS RPPLQ QC 
Sbjct  1    MDLVQ-SSEHFCYVRCNFCSTVLAVGIPYKRLLDTVTVKCGHCSNLSFLSARPPLQGQCL  59

Query  548  DHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEI  372
            DHH +    S + FK GQSSSS+ ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEI
Sbjct  60   DHHTSLQGFS-SEFKIGQSSSSTSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEI  118

Query  371  QRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            QRIKAANPEIPHREAFSAAAKNWARYIPN P+ S SES++N 
Sbjct  119  QRIKAANPEIPHREAFSAAAKNWARYIPNAPNVSLSESSNNV  160



>ref|XP_002512055.1| Protein CRABS CLAW, putative [Ricinus communis]
 gb|EEF50724.1| Protein CRABS CLAW, putative [Ricinus communis]
Length=193

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 135/166 (81%), Gaps = 3/166 (2%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MDL  P SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLSTRPPL
Sbjct  4    EEKVTMDLV-PPSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLSTRPPL  62

Query  563  QPQCHDHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRF  387
            Q QC DH         +  K+GQSSSSS ++S      KAPFVVKPPEKKHRLPSAYNRF
Sbjct  63   QGQCLDHQLT-LQSFFSDLKKGQSSSSSSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRF  121

Query  386  MKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            MKEEIQRIKAANPEIPHREAFS AAKNWARYIPN+ + S S S+ N
Sbjct  122  MKEEIQRIKAANPEIPHREAFSTAAKNWARYIPNSTAGSVSGSSCN  167



>gb|KDP41331.1| hypothetical protein JCGZ_15738 [Jatropha curcas]
Length=179

 Score =   224 bits (570),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 137/176 (78%), Gaps = 12/176 (7%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MDL  P SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLSTRPPL
Sbjct  4    EEKVTMDLV-PPSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLSTRPPL  62

Query  563  QPQCHDH--HANNFPVSC----NGF----KRGQsssssptssepssP-KAPFVVKPPEKK  417
            Q QC DH          C     GF    ++GQSSSSS ++S      KAPFVVKPPEKK
Sbjct  63   QGQCLDHPLTLQVLIYVCTKKKQGFFSDLRKGQSSSSSSSTSSEPLSPKAPFVVKPPEKK  122

Query  416  HRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            HRLPSAYNRFMKEEIQRIKAANPEIPHREAFS AAKNWARYIPN+   S S SN+N
Sbjct  123  HRLPSAYNRFMKEEIQRIKAANPEIPHREAFSTAAKNWARYIPNSAGGSVSGSNNN  178



>gb|AAW83051.1| CRABS CLAW [Gossypium hirsutum]
Length=166

 Score =   223 bits (567),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 131/152 (86%), Gaps = 3/152 (2%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHAN  534
            P SEHLCYVRC+FCNTVLAVGIPCKR+LETVTVKCGHCSNLSFLSTRPPLQ QC D   +
Sbjct  2    PQSEHLCYVRCNFCNTVLAVGIPCKRLLETVTVKCGHCSNLSFLSTRPPLQGQCLDPQTS  61

Query  533  -NFPVSCNGFKRGQs--ssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRI  363
                  C  F++G    S SS TSSEPSSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRI
Sbjct  62   LTLQSFCGDFRKGTQFPSPSSSTSSEPSSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRI  121

Query  362  KAANPEIPHREAFSAAAKNWARYIPNTPSRST  267
            KAANPEIPHREAFSAAAKNWARYIPN+P+ S+
Sbjct  122  KAANPEIPHREAFSAAAKNWARYIPNSPAASS  153



>ref|XP_008339785.1| PREDICTED: protein CRABS CLAW-like isoform X2 [Malus domestica]
Length=172

 Score =   222 bits (566),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 127/156 (81%), Gaps = 4/156 (3%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MDL    SEHLCYVRC+FCNTVLAVGIPCKR+++TVTVKCGHCSNLSFLSTRPPL
Sbjct  4    EEKVTMDLINQPSEHLCYVRCNFCNTVLAVGIPCKRLMDTVTVKCGHCSNLSFLSTRPPL  63

Query  563  QPQCHDHHANNFPVS---CNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAY  396
            Q QC   H  +  +    CN FK+ QSS+SS   S      KAPFVVKPPEKKHRLPSAY
Sbjct  64   QGQCLPDHPTSLTLQAGCCNDFKKDQSSTSSSPVSSDPPSPKAPFVVKPPEKKHRLPSAY  123

Query  395  NRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIP  288
            NRFMK+EIQRIKAANPEIPHREAFSAAAKNWARYIP
Sbjct  124  NRFMKDEIQRIKAANPEIPHREAFSAAAKNWARYIP  159



>gb|AAW83052.1| CRABS CLAW [Gossypium hirsutum]
Length=170

 Score =   222 bits (566),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 131/152 (86%), Gaps = 3/152 (2%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHAN  534
            P SEHLCYVRC+FCNTVLAVGIPCKR+LETVTVKCGHCSNLSFLSTRPPLQ QC D   +
Sbjct  2    PQSEHLCYVRCNFCNTVLAVGIPCKRLLETVTVKCGHCSNLSFLSTRPPLQGQCLDPQTS  61

Query  533  -NFPVSCNGFKRGQs--ssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRI  363
                  C  F++G    S SS TSSEPSSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRI
Sbjct  62   LTLQSFCGDFRKGTQFPSPSSSTSSEPSSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRI  121

Query  362  KAANPEIPHREAFSAAAKNWARYIPNTPSRST  267
            KAANPEIPHREAFSAAAKNWARYIPN+P+ S+
Sbjct  122  KAANPEIPHREAFSAAAKNWARYIPNSPAASS  153



>ref|XP_010260708.1| PREDICTED: protein CRABS CLAW-like isoform X1 [Nelumbo nucifera]
Length=187

 Score =   223 bits (567),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 132/161 (82%), Gaps = 6/161 (4%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHAN  534
            PSSEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLSTRPPL  Q  DHH  
Sbjct  5    PSSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLSTRPPLPGQRMDHHQL  64

Query  533  NFP-----VSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEI  372
             F      V CN ++R QSSSSS ++S      K P+VVKPPE+KHRLPSAYNRFMKEEI
Sbjct  65   GFQFLEKQVFCNDYRRTQSSSSSSSTSSQQMSPKVPYVVKPPERKHRLPSAYNRFMKEEI  124

Query  371  QRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            QRIKAANPEIPHREAFS AAKNWARY+P+ P+ S SE+N N
Sbjct  125  QRIKAANPEIPHREAFSTAAKNWARYVPHPPTGSVSENNKN  165



>ref|XP_008339784.1| PREDICTED: protein CRABS CLAW-like isoform X1 [Malus domestica]
Length=173

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 127/157 (81%), Gaps = 5/157 (3%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MDL    SEHLCYVRC+FCNTVLAVGIPCKR+++TVTVKCGHCSNLSFLSTRPPL
Sbjct  4    EEKVTMDLINQPSEHLCYVRCNFCNTVLAVGIPCKRLMDTVTVKCGHCSNLSFLSTRPPL  63

Query  563  QPQCHDHHANNFPVS----CNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSA  399
            Q QC   H  +  +     CN FK+ QSS+SS   S      KAPFVVKPPEKKHRLPSA
Sbjct  64   QGQCLPDHPTSLTLQQAGCCNDFKKDQSSTSSSPVSSDPPSPKAPFVVKPPEKKHRLPSA  123

Query  398  YNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIP  288
            YNRFMK+EIQRIKAANPEIPHREAFSAAAKNWARYIP
Sbjct  124  YNRFMKDEIQRIKAANPEIPHREAFSAAAKNWARYIP  160



>ref|XP_003520126.1| PREDICTED: protein CRABS CLAW-like [Glycine max]
Length=173

 Score =   219 bits (559),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 137/175 (78%), Gaps = 15/175 (9%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MDL  P SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLSTRPP 
Sbjct  4    EDKLTMDLV-PPSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLSTRPPS  62

Query  563  -QPQCHDHHANNFPVSCNGF----KRGQsssssptssepssPKAP----FVVKPPEKKHR  411
             Q Q  DH      +S  GF    K+GQ+SSSS + +  +   +P    FVVKPPEKKHR
Sbjct  63   SQSQSVDH-----TLSLQGFYSNAKKGQASSSSSSPTTSNESVSPKAASFVVKPPEKKHR  117

Query  410  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWAR+IPN+P+ S S +  NA
Sbjct  118  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARFIPNSPTSSVSATKVNA  172



>ref|XP_003517857.1| PREDICTED: protein CRABS CLAW-like [Glycine max]
Length=174

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 137/175 (78%), Gaps = 14/175 (8%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MDL  P SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLSTRPP 
Sbjct  4    EDKLTMDLV-PPSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLSTRPPS  62

Query  563  -QPQCHDHHANNFPVSCNGF----KRGQsssssptssepssPKAP----FVVKPPEKKHR  411
             Q Q  DH      +S  GF    K+GQ+SSSS + +  +   +P    FVVKPPEKKHR
Sbjct  63   SQNQSIDHTT----LSLQGFYSNAKKGQASSSSSSPTTSNESVSPKAASFVVKPPEKKHR  118

Query  410  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWAR+IPN+P+ S S +  NA
Sbjct  119  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARFIPNSPTSSVSATKVNA  173



>ref|XP_006484236.1| PREDICTED: protein CRABS CLAW-like [Citrus sinensis]
Length=171

 Score =   219 bits (557),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 130/166 (78%), Gaps = 2/166 (1%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E   S DL  P SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLSTRPP 
Sbjct  4    EDNISTDLQVPQSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLSTRPPQ  63

Query  563  Q-PQCHDHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNR  390
            Q P             CN FK G +SSSS ++S      KAPFVVKPPEKKHRLPSAYNR
Sbjct  64   QGPSQMSLRFQEKQSFCNDFKLGNASSSSSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNR  123

Query  389  FMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
            FMKEEIQRIKAANPEIPHREAFS AAKNWARYIPN+ + STS S+S
Sbjct  124  FMKEEIQRIKAANPEIPHREAFSTAAKNWARYIPNSLAGSTSGSSS  169



>ref|XP_006366257.1| PREDICTED: protein CRABS CLAW-like [Solanum tuberosum]
Length=181

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 136/170 (80%), Gaps = 19/170 (11%)
 Frame = -1

Query  734  TSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQ  555
             SMD     SEHLCYVRCSFCN +LAVGIPCK++L+TVTVKCGHC NLSFLS+RPPLQPQ
Sbjct  22   NSMD----PSEHLCYVRCSFCNIILAVGIPCKKLLDTVTVKCGHCGNLSFLSSRPPLQPQ  77

Query  554  CHDH-----HANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNR  390
              DH     H + F    N FK+GQSSSSS  SS     KAPFVVKPPEKKHRLPSAYNR
Sbjct  78   FFDHQPIHQHQDFF----NNFKKGQSSSSSEPSSP----KAPFVVKPPEKKHRLPSAYNR  129

Query  389  FMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRST--SESNSNA  246
            FMK+EIQRIKAA+PEIPHREAFSAAAKNWARYIPNTP+ +   SE+N+N 
Sbjct  130  FMKDEIQRIKAAHPEIPHREAFSAAAKNWARYIPNTPNGTLLRSENNNNG  179



>ref|XP_008243820.1| PREDICTED: protein CRABS CLAW [Prunus mume]
Length=179

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 134/169 (79%), Gaps = 4/169 (2%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MDL    SEHLCYVRC+FC+TVLAVG+P KR+L+TVTVKCGHCSNLSFLSTRP L
Sbjct  4    EEKVTMDLINQPSEHLCYVRCNFCSTVLAVGLPFKRLLDTVTVKCGHCSNLSFLSTRPAL  63

Query  563  QPQCHDHHANNFPVS---CNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAY  396
            Q QC   H  +  +    C+ F++GQSSSSS   S   S  KAPFVVKPPEKKHRLPSAY
Sbjct  64   QGQCLSDHPTSLTLQAGCCSDFRKGQSSSSSSPISSEPSSPKAPFVVKPPEKKHRLPSAY  123

Query  395  NRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            NRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIP+  + S S S S+
Sbjct  124  NRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPSPSAGSDSGSCSS  172



>gb|AAL60054.1| crabs claw [Nicotiana langsdorffii x Nicotiana sanderae]
Length=181

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 137/166 (83%), Gaps = 6/166 (4%)
 Frame = -1

Query  737  KTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP  558
            K SMDL Q SSEHLCYVRCSFCNTVLAVGIP KR+L+TVTVKCGH  NLSFLSTRPPLQ 
Sbjct  20   KNSMDLVQ-SSEHLCYVRCSFCNTVLAVGIPYKRLLDTVTVKCGHLRNLSFLSTRPPLQG  78

Query  557  QCHDHHANNFPVSCNGF--KRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFM  384
            QC DH      +    F     +  SSS +SSEPSSPKAPFVVKPPEKKHRLPSAYNRFM
Sbjct  79   QCFDHQT---ALQHQAFFSDSKKDQSSSSSSSEPSSPKAPFVVKPPEKKHRLPSAYNRFM  135

Query  383  KEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            K+EIQRIKAANPEIPHR+AFSAAAK WARYIPNTP+ + +ES++NA
Sbjct  136  KDEIQRIKAANPEIPHRDAFSAAAKKWARYIPNTPNGTLAESSNNA  181



>ref|XP_010257971.1| PREDICTED: protein CRABS CLAW-like isoform X1 [Nelumbo nucifera]
Length=187

 Score =   219 bits (557),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 133/160 (83%), Gaps = 3/160 (2%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MD   PSSEHLCYVRC+FCNTVLAVGIPCKR L+TVTVKCGHCSNLSFLSTRPPLQ Q  
Sbjct  1    MDYV-PSSEHLCYVRCNFCNTVLAVGIPCKRFLDTVTVKCGHCSNLSFLSTRPPLQGQRL  59

Query  548  DHH--ANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEE  375
            D    +    V  NG+++ QSSSSS TS++ +SP  P+VVKPPEKKHRLPSAYNRFMKEE
Sbjct  60   DQQLGSQKLQVFGNGYRKSQSSSSSSTSTQQTSPNVPYVVKPPEKKHRLPSAYNRFMKEE  119

Query  374  IQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESN  255
            IQRIKAANPEIPHREAFS AAKNWARYIP  P+ S SE+N
Sbjct  120  IQRIKAANPEIPHREAFSTAAKNWARYIPYPPNGSISENN  159



>ref|XP_004228849.1| PREDICTED: protein CRABS CLAW-like [Solanum lycopersicum]
Length=173

 Score =   218 bits (555),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 130/154 (84%), Gaps = 13/154 (8%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDH-----  543
            SEHLCYVRCSFCNT+LAVGIPCK++L+TVTVKCGHC NLSFLS+RPP+QPQ  DH     
Sbjct  27   SEHLCYVRCSFCNTILAVGIPCKKLLDTVTVKCGHCGNLSFLSSRPPIQPQFFDHQPILQ  86

Query  542  HANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRI  363
            H + F    N FK+GQSSSSS  SS     KAPFVVKPPEKKHRLPSAYNRFMK+EIQRI
Sbjct  87   HQDFF----NNFKKGQSSSSSEPSSP----KAPFVVKPPEKKHRLPSAYNRFMKDEIQRI  138

Query  362  KAANPEIPHREAFSAAAKNWARYIPNTPSRSTSE  261
            KAA+P+IPHREAFSAAAKNWARYIPNTP+ + +E
Sbjct  139  KAAHPQIPHREAFSAAAKNWARYIPNTPNGTLAE  172



>ref|XP_007223999.1| hypothetical protein PRUPE_ppa014900mg, partial [Prunus persica]
 gb|EMJ25198.1| hypothetical protein PRUPE_ppa014900mg, partial [Prunus persica]
Length=176

 Score =   218 bits (554),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 134/170 (79%), Gaps = 5/170 (3%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MDL    SEHLCYVRC+FC+TVLAVG+P KR+L+TVTVKCGHCSNLSFLSTRP L
Sbjct  4    EEKVTMDLINQPSEHLCYVRCNFCSTVLAVGLPFKRLLDTVTVKCGHCSNLSFLSTRPAL  63

Query  563  QPQCHDHHANNFPVS----CNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSA  399
            Q QC   H  +  +     C+ F++GQSSSSS   S   S  KAPFVVKPPEKKHRLPSA
Sbjct  64   QGQCLSDHPTSLTLQQAGCCSEFRKGQSSSSSSPISSEPSSPKAPFVVKPPEKKHRLPSA  123

Query  398  YNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            YNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIP+  + S S S S+
Sbjct  124  YNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPSPSAGSDSGSCSS  173



>ref|XP_010257972.1| PREDICTED: protein CRABS CLAW-like isoform X2 [Nelumbo nucifera]
Length=184

 Score =   218 bits (555),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 133/158 (84%), Gaps = 2/158 (1%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MD   PSSEHLCYVRC+FCNTVLAVGIPCKR L+TVTVKCGHCSNLSFLSTRPPLQ Q  
Sbjct  1    MDYV-PSSEHLCYVRCNFCNTVLAVGIPCKRFLDTVTVKCGHCSNLSFLSTRPPLQGQRL  59

Query  548  DHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQ  369
            D    +  V  NG+++ QSSSSS TS++ +SP  P+VVKPPEKKHRLPSAYNRFMKEEIQ
Sbjct  60   DQQLGS-QVFGNGYRKSQSSSSSSTSTQQTSPNVPYVVKPPEKKHRLPSAYNRFMKEEIQ  118

Query  368  RIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESN  255
            RIKAANPEIPHREAFS AAKNWARYIP  P+ S SE+N
Sbjct  119  RIKAANPEIPHREAFSTAAKNWARYIPYPPNGSISENN  156



>gb|KHN29962.1| Protein DROOPING LEAF [Glycine soja]
Length=182

 Score =   218 bits (554),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 139/180 (77%), Gaps = 16/180 (9%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MDL  P SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLSTRPP 
Sbjct  4    EDKLTMDLV-PPSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLSTRPPS  62

Query  563  -QPQCHDHHANNFPVSCNGF----KRGQsssssptssepssPKAP----FVVKPPEKKHR  411
             Q Q  DH      +S  GF    K+GQ+SSSS + +  +   +P    FVVKPPEKKHR
Sbjct  63   SQSQSVDH-----TLSLQGFYSNAKKGQASSSSSSPTTSNESVSPKAASFVVKPPEKKHR  117

Query  410  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA*RMED  231
            LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWAR+IPN+P+ S S +  N  R+ D
Sbjct  118  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARFIPNSPTSSVSATKVNV-RIRD  176



>gb|AAW83045.1| CRABS CLAW [Cynophalla flexuosa]
Length=186

 Score =   218 bits (554),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 130/163 (80%), Gaps = 8/163 (5%)
 Frame = -1

Query  743  EIKTSMDLAQPS-SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPP  567
            E K+ MD   P+ SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLS RPP
Sbjct  4    EEKSVMDSQAPTQSEHLCYVRCNFCNTVLAVGIPCKRMLDTVTVKCGHCSNLSFLSVRPP  63

Query  566  LQPQCHDHHAN----NFPVSCNGFKRGQsssssptssepssP---KAPFVVKPPEKKHRL  408
            L  QC DH  N          N  K+G SSSSS +S+    P   KAPFVVKPPEKKHRL
Sbjct  64   LHGQCLDHQVNLTLQTQSFCGNELKKGSSSSSSSSSTSSDQPSSPKAPFVVKPPEKKHRL  123

Query  407  PSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTP  279
            PSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPN+P
Sbjct  124  PSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNSP  166



>ref|XP_006348666.1| PREDICTED: protein CRABS CLAW-like [Solanum tuberosum]
Length=161

 Score =   217 bits (552),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 130/162 (80%), Gaps = 2/162 (1%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MD  Q +SEHLCYVRC+FCNTVLAVGIP KR+++TVTVKCGHCSNLSFLSTRPP+Q QC 
Sbjct  1    MDCVQ-TSEHLCYVRCNFCNTVLAVGIPYKRLMDTVTVKCGHCSNLSFLSTRPPIQGQCF  59

Query  548  DHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEI  372
            DH  N          +GQ+SSS+ ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEI
Sbjct  60   DHQPNLQGYCSEFINKGQASSSASSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEI  119

Query  371  QRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            QRIKA NPEIPHREAFSAAAKNWARYIPN P+ S S + +N 
Sbjct  120  QRIKAENPEIPHREAFSAAAKNWARYIPNPPNGSLSGNTNNV  161



>ref|XP_006437883.1| hypothetical protein CICLE_v10033770mg [Citrus clementina]
 gb|ESR51123.1| hypothetical protein CICLE_v10033770mg [Citrus clementina]
Length=174

 Score =   217 bits (553),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 130/168 (77%), Gaps = 2/168 (1%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E   S DL  P SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLSTRPP 
Sbjct  4    EDSISTDLQVPQSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLSTRPPQ  63

Query  563  Q-PQCHDHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNR  390
            Q P             CN FK G +SSSS ++S      KAPFVVKPPEKKHRLPSAYNR
Sbjct  64   QGPSQMSLRFQEKQSFCNDFKLGNASSSSSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNR  123

Query  389  FMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            FMKEEIQRIKAA PEIPHREAFS AAKNWARYIPN+ + STS S+S+ 
Sbjct  124  FMKEEIQRIKAATPEIPHREAFSTAAKNWARYIPNSLAGSTSGSSSHV  171



>gb|KHN05619.1| Protein DROOPING LEAF [Glycine soja]
Length=206

 Score =   218 bits (555),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 139/180 (77%), Gaps = 15/180 (8%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MDL  P SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLSTRPP 
Sbjct  4    EDKLTMDLV-PPSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLSTRPPS  62

Query  563  -QPQCHDHHANNFPVSCNGF----KRGQsssssptssepssPKAP----FVVKPPEKKHR  411
             Q Q  DH      +S  GF    K+GQ+SSSS + +  +   +P    FVVKPPEKKHR
Sbjct  63   SQNQSIDHTT----LSLQGFYSNAKKGQASSSSSSPTTSNESVSPKAASFVVKPPEKKHR  118

Query  410  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA*RMED  231
            LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWAR+IPN+P+ S S +  N  R+ D
Sbjct  119  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARFIPNSPTSSVSATKVNV-RIRD  177



>emb|CDP00459.1| unnamed protein product [Coffea canephora]
Length=172

 Score =   217 bits (552),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 133/164 (81%), Gaps = 6/164 (4%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPP--LQPQ  555
            MDL Q  SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHC NLSFLSTRPP  LQ Q
Sbjct  1    MDLVQ-QSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCGNLSFLSTRPPPPLQGQ  59

Query  554  CHDHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKE  378
            C +H         +  K+GQSSSSS ++S   S  KAPFVVKPPEKKHRLPSAYNRFMKE
Sbjct  60   CFEHQPT-IQTFFSDLKKGQSSSSSSSTSGEPSSPKAPFVVKPPEKKHRLPSAYNRFMKE  118

Query  377  EIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSE-SNSN  249
            EIQRIKA NPEIPHREAFSAAAKNWARYIP  P+ S +E SNSN
Sbjct  119  EIQRIKATNPEIPHREAFSAAAKNWARYIPTAPTGSIAESSNSN  162



>ref|XP_007153487.1| hypothetical protein PHAVU_003G039800g [Phaseolus vulgaris]
 gb|ESW25481.1| hypothetical protein PHAVU_003G039800g [Phaseolus vulgaris]
Length=173

 Score =   216 bits (551),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 136/174 (78%), Gaps = 15/174 (9%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPP-  567
            + K +MDL  P SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLSTRPP 
Sbjct  4    DDKLTMDLV-PPSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLSTRPPN  62

Query  566  LQPQCHDHHANNFPVSCNGF----KRGQsssssptssepssPKAP----FVVKPPEKKHR  411
             Q Q  DH      +S  GF    K+GQ+SSSS + +  +   +P    FVVKPPEKKHR
Sbjct  63   SQNQSIDH-----TLSLQGFYSNAKKGQASSSSSSPTTSNESVSPKAASFVVKPPEKKHR  117

Query  410  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWAR+IPN+P+ S S S  N
Sbjct  118  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARFIPNSPTSSVSASKVN  171



>ref|XP_010046616.1| PREDICTED: protein CRABS CLAW [Eucalyptus grandis]
 gb|KCW86472.1| hypothetical protein EUGRSUZ_B03140 [Eucalyptus grandis]
Length=167

 Score =   216 bits (550),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 131/160 (82%), Gaps = 14/160 (9%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K SM+   P SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLSTR PL
Sbjct  2    EDKASME--APPSEHLCYVRCNFCNTVLAVGIPCKRMLDTVTVKCGHCSNLSFLSTRTPL  59

Query  563  QPQCHDHHANNFPVSCNGF----KRGQsssssptssep---ssPKAPFVVKPPEKKHRLP  405
            Q QC DH     P+S  GF    +RGQSSSSS ++S     S   APFVVKPPEKKHRLP
Sbjct  60   QGQCLDH-----PLSLQGFSSDFRRGQSSSSSSSTSGDQPLSPKAAPFVVKPPEKKHRLP  114

Query  404  SAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPN  285
            SAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIP+
Sbjct  115  SAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPH  154



>gb|AID67119.1| CRC protein [Solanum virginianum]
 gb|AID67121.1| CRC protein [Solanum torvum]
Length=152

 Score =   215 bits (548),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 133/161 (83%), Gaps = 9/161 (6%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            M+  Q SSEHLCYV C+FCNT+LAVGIP KR+++TVTVKCGHCSNLSFLSTRPP+Q QC 
Sbjct  1    MEFVQ-SSEHLCYVHCNFCNTILAVGIPYKRLMDTVTVKCGHCSNLSFLSTRPPIQGQCF  59

Query  548  DHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQ  369
            DH           F+   SSS+S TSSEP SPKAPFVVKPPEKKHRLPSAYNRFMKEEIQ
Sbjct  60   DHQPT--------FQGQASSSTSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQ  111

Query  368  RIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            RIKA NPEIPHREAFSAAAKNWARYIPN+P+ S SE+ +N 
Sbjct  112  RIKAENPEIPHREAFSAAAKNWARYIPNSPNGSLSENTNNV  152



>ref|XP_010680651.1| PREDICTED: protein CRABS CLAW [Beta vulgaris subsp. vulgaris]
 ref|XP_010680652.1| PREDICTED: protein CRABS CLAW [Beta vulgaris subsp. vulgaris]
Length=182

 Score =   215 bits (548),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 134/176 (76%), Gaps = 13/176 (7%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K SM++A P  EHLCYVRC+FCNTVLAV IPCKR+LETVTVKCGHC N+SFLSTRPPL
Sbjct  6    EDKVSMEMA-PPPEHLCYVRCNFCNTVLAVVIPCKRLLETVTVKCGHCGNVSFLSTRPPL  64

Query  563  QPQCHDHHAN----NFPVSCNGF--------KRGQsssssptssepssPKAPFVVKPPEK  420
            Q QC DH       NF     GF        K+GQSSSSS ++        P+VVKPPEK
Sbjct  65   QGQCLDHQITLQGFNFMEKPGGFCSTVDHHSKKGQSSSSSSSTLTEPVSPRPYVVKPPEK  124

Query  419  KHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
            KHRLPSAYNRFMKEEIQRIK ANPEIPHREAFS AAKNWAR++P++P+ S +ES++
Sbjct  125  KHRLPSAYNRFMKEEIQRIKTANPEIPHREAFSTAAKNWARFLPHSPAGSLAESSN  180



>gb|KCW86473.1| hypothetical protein EUGRSUZ_B03140 [Eucalyptus grandis]
Length=168

 Score =   214 bits (546),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 119/156 (76%), Positives = 129/156 (83%), Gaps = 5/156 (3%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K SM+   P SEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFLSTR PL
Sbjct  2    EDKASME--APPSEHLCYVRCNFCNTVLAVGIPCKRMLDTVTVKCGHCSNLSFLSTRTPL  59

Query  563  QPQCHDHHANNFPVSCNGFKRGQsssssptssep---ssPKAPFVVKPPEKKHRLPSAYN  393
            Q QC DH  +      + F+RGQSSSSS ++S     S   APFVVKPPEKKHRLPSAYN
Sbjct  60   QGQCLDHPLSLQQGFSSDFRRGQSSSSSSSTSGDQPLSPKAAPFVVKPPEKKHRLPSAYN  119

Query  392  RFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPN  285
            RFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIP+
Sbjct  120  RFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPH  155



>gb|AID67117.1| CRC protein [Solanum sisymbriifolium]
 gb|AID67118.1| CRC protein [Solanum aethiopicum]
Length=161

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 132/163 (81%), Gaps = 4/163 (2%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            M+  Q SSEHLCYV C+FCNT+LAVGIP KR+++TVTVKCGHCSNLSFLS RPP+Q QC 
Sbjct  1    MEFVQ-SSEHLCYVHCNFCNTILAVGIPYKRLMDTVTVKCGHCSNLSFLSARPPIQGQCL  59

Query  548  DHHANNFPVSCNGFK-RGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEE  375
            DH    F   C+ FK +GQ+SSS+ ++S      KAPFVVKPPEKKHRLPSAYNRFMKEE
Sbjct  60   DHQPT-FQGYCSEFKNKGQASSSASSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEE  118

Query  374  IQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            IQRIKA NPEIPHREAFSAAAKNWARYIPN P+ S  E+ +N 
Sbjct  119  IQRIKAENPEIPHREAFSAAAKNWARYIPNPPNGSLPENTNNV  161



>ref|XP_009627054.1| PREDICTED: protein CRABS CLAW-like [Nicotiana tomentosiformis]
Length=164

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 134/164 (82%), Gaps = 5/164 (3%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MDL Q S EHLCYVRC++CNTVLAVGIP KR+L+TVTVK GHCSNLSFLSTRPPLQ QC 
Sbjct  1    MDLVQ-SPEHLCYVRCNYCNTVLAVGIPYKRLLDTVTVKYGHCSNLSFLSTRPPLQGQCF  59

Query  548  DHHAN-NFPVSCNGFKRGQsssssptssepssP--KAPFVVKPPEKKHRLPSAYNRFMKE  378
            DH         C+ FK+GQSS+S+ +SS   S   KAPFVVKP EKKHRLPSAYNRFMKE
Sbjct  60   DHQLTLQQQGLCSEFKKGQSSTSASSSSSDQSISPKAPFVVKPSEKKHRLPSAYNRFMKE  119

Query  377  EIQRIKAANPEIPHREAFSAAAKNWARYIPN-TPSRSTSESNSN  249
            EIQRI+A NPEIPHREAFSAAAKNWARYI N +P+ + SESN+N
Sbjct  120  EIQRIEAENPEIPHREAFSAAAKNWARYISNGSPNGTLSESNTN  163



>gb|AID67120.1| CRC protein [Solanum mammosum]
Length=161

 Score =   214 bits (544),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 133/163 (82%), Gaps = 4/163 (2%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            M+  Q SSEHLCYV C+FCNTVLAV IP KR+++TVTVKCGHCSNLSFLSTRPP+Q QC 
Sbjct  1    MEFVQ-SSEHLCYVHCNFCNTVLAVEIPYKRIMDTVTVKCGHCSNLSFLSTRPPIQGQCF  59

Query  548  DHHANNFPVSCNGFK-RGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEE  375
            DH +  F   C+ FK +GQ+SSS+ ++S      KAPFVVKPPEKKHRLPSAYNRFMKEE
Sbjct  60   DHQST-FQGYCSEFKNKGQASSSASSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEE  118

Query  374  IQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            IQRIKA NPEIPHREAFSAAAKNWARYIPN P+   +E+ +N 
Sbjct  119  IQRIKAENPEIPHREAFSAAAKNWARYIPNPPNGFLTENANNV  161



>ref|XP_004135432.1| PREDICTED: protein CRABS CLAW-like [Cucumis sativus]
Length=173

 Score =   214 bits (544),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 137/173 (79%), Gaps = 6/173 (3%)
 Frame = -1

Query  755  LQTKEIKTSM-DLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLS  579
            +   E K+SM DL QPS EH CYV+C+FCNTVLAVGIPC+  L+TVTVKCGHCSNLSFLS
Sbjct  1    MSNSEDKSSMADLVQPS-EHFCYVKCNFCNTVLAVGIPCRHWLDTVTVKCGHCSNLSFLS  59

Query  578  TRPPLQPQCHDHHANNFPVSCNG---FKRGQsssssptssepssPKAPFVVKPPEKKHRL  408
            TRPPLQ QC DH    F V  +     ++G S+SS+ T+S  ++    FVVKPPEKKHRL
Sbjct  60   TRPPLQGQCIDHPLT-FQVGFSNNDHIRKGASTSSTSTASSITNDSPNFVVKPPEKKHRL  118

Query  407  PSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            PSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPN+ + S S +++N
Sbjct  119  PSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNSAAGSVSGTHNN  171



>gb|AAS10180.1| YABBY-like transcription factor CRABS CLAW-like protein [Antirrhinum 
majus]
Length=165

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 128/149 (86%), Gaps = 3/149 (2%)
 Frame = -1

Query  728  MDLA-QPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQC  552
            MD+A Q SSEHLCYVRC+FC+TVLAVGIPCKR+++TVTVKCGHCSNLSFLSTRPP+Q Q 
Sbjct  1    MDMANQSSSEHLCYVRCNFCSTVLAVGIPCKRLMDTVTVKCGHCSNLSFLSTRPPIQGQY  60

Query  551  HDHHANNFPVS-CNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKE  378
            +DH  +    S C+ FK+G SSS S ++S      KAPFVVKPPEKKHRLPSAYNRFMKE
Sbjct  61   YDHQTSLHHQSLCSEFKKGGSSSFSSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKE  120

Query  377  EIQRIKAANPEIPHREAFSAAAKNWARYI  291
            EIQRIKAANPEIPHREAFSAAAKNWARYI
Sbjct  121  EIQRIKAANPEIPHREAFSAAAKNWARYI  149



>ref|XP_004155290.1| PREDICTED: protein CRABS CLAW-like [Cucumis sativus]
 ref|XP_008446454.1| PREDICTED: protein CRABS CLAW [Cucumis melo]
 gb|KGN51988.1| hypothetical protein Csa_5G606780 [Cucumis sativus]
Length=175

 Score =   213 bits (543),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 136/174 (78%), Gaps = 6/174 (3%)
 Frame = -1

Query  755  LQTKEIKTSM-DLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLS  579
            +   E K+SM DL QPS EH CYV+C+FCNTVLAVGIPC+  L+TVTVKCGHCSNLSFLS
Sbjct  1    MSNSEDKSSMADLVQPS-EHFCYVKCNFCNTVLAVGIPCRHWLDTVTVKCGHCSNLSFLS  59

Query  578  TRPPLQPQCHDH---HANNFPVSCNGFKRGQsssssptssepssPKAP-FVVKPPEKKHR  411
            TRPPLQ QC DH     +    S N   R  +S+SS +++   +  +P FVVKPPEKKHR
Sbjct  60   TRPPLQGQCIDHPLTFQSQVGFSNNDHIRKGASTSSTSTASSITNDSPNFVVKPPEKKHR  119

Query  410  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPN+ + S S +++N
Sbjct  120  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNSAAGSVSGTHNN  173



>gb|AGH62810.1| crabs claw protein [Epimedium sagittatum]
Length=177

 Score =   213 bits (541),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 135/180 (75%), Gaps = 10/180 (6%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTR--PPLQPQ  555
            MD   P SE LCYVRC+FCNTVLAVGIPCKR L+TVTVKCGHCS+LSFLST+  PP+QPQ
Sbjct  1    MDFI-PPSEQLCYVRCNFCNTVLAVGIPCKRSLDTVTVKCGHCSSLSFLSTKAPPPVQPQ  59

Query  554  CHDHHA----NNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRF  387
            C DHH       F           SSS+  T+  P++PK PFV+KPPE+KHRLPSAYNRF
Sbjct  60   CFDHHPLIGFQGFSYDFKAHSSSSSSSTISTTQPPTTPKEPFVIKPPERKHRLPSAYNRF  119

Query  386  MKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA*RMEDEATQASLG  207
            MKEEIQRIKAANPEIPHREAFS AAKNWARYIP++ S   SE++ N   +  E  QAS+G
Sbjct  120  MKEEIQRIKAANPEIPHREAFSTAAKNWARYIPHSASAPGSETDKN---VAQEKRQASIG  176



>ref|XP_004239032.1| PREDICTED: protein CRABS CLAW [Solanum lycopersicum]
Length=158

 Score =   211 bits (538),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 130/159 (82%), Gaps = 4/159 (3%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MD  Q SSEHLCYVRC+FCNTVLAVGIP KR+++TVTVKCGHCSNLSFL+TRPP+Q QC 
Sbjct  1    MDYVQ-SSEHLCYVRCNFCNTVLAVGIPYKRLMDTVTVKCGHCSNLSFLTTRPPIQGQCF  59

Query  548  DHHANNFPVSCNGFK-RGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEE  375
            DH  N     C+  K +GQ+SSS+ ++S      KAPFVVKPPEKKHRLPSAYNRFMKEE
Sbjct  60   DHQPN-IQGYCSELKNKGQASSSTSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEE  118

Query  374  IQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSES  258
            IQRIK+ NPEIPHREAFSAAAKNWARY+PN P+   + +
Sbjct  119  IQRIKSENPEIPHREAFSAAAKNWARYLPNPPNSGNTNN  157



>ref|XP_008389395.1| PREDICTED: protein CRABS CLAW isoform X3 [Malus domestica]
Length=177

 Score =   212 bits (539),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 128/157 (82%), Gaps = 5/157 (3%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MD     SE+LCYVRC+FCNTVLAVG+PCKR+++T+TVKCGHCSNLSFLSTR PL
Sbjct  4    EEKVTMDFINQPSENLCYVRCNFCNTVLAVGLPCKRLMDTITVKCGHCSNLSFLSTRSPL  63

Query  563  QPQCHDHHANNFPVS---CNGFKRGQsssssptssepssP--KAPFVVKPPEKKHRLPSA  399
            + QC   H  +  +    CN F++GQSSSSS +    + P  KAPFVVKPPEKKHRLPSA
Sbjct  64   EGQCLPDHPTSLTLQAGCCNDFRKGQSSSSSSSPVSGNPPSPKAPFVVKPPEKKHRLPSA  123

Query  398  YNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIP  288
            YNRFMK+EI+RIKAANPE+PHREAFSAAAKNWARYIP
Sbjct  124  YNRFMKDEIKRIKAANPEVPHREAFSAAAKNWARYIP  160



>ref|XP_008389394.1| PREDICTED: protein CRABS CLAW isoform X2 [Malus domestica]
Length=178

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/158 (70%), Positives = 128/158 (81%), Gaps = 6/158 (4%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MD     SE+LCYVRC+FCNTVLAVG+PCKR+++T+TVKCGHCSNLSFLSTR PL
Sbjct  4    EEKVTMDFINQPSENLCYVRCNFCNTVLAVGLPCKRLMDTITVKCGHCSNLSFLSTRSPL  63

Query  563  QPQCHDHHANNFPVS----CNGFKRGQsssssptssepssP--KAPFVVKPPEKKHRLPS  402
            + QC   H  +  +     CN F++GQSSSSS +    + P  KAPFVVKPPEKKHRLPS
Sbjct  64   EGQCLPDHPTSLTLQQAGCCNDFRKGQSSSSSSSPVSGNPPSPKAPFVVKPPEKKHRLPS  123

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIP  288
            AYNRFMK+EI+RIKAANPE+PHREAFSAAAKNWARYIP
Sbjct  124  AYNRFMKDEIKRIKAANPEVPHREAFSAAAKNWARYIP  161



>gb|AGH62812.1| crabs claw protein, partial [Epimedium leptorrhizum]
Length=177

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 135/180 (75%), Gaps = 10/180 (6%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTR--PPLQPQ  555
            MD   P  EHLCYVRC+FCNTVLAVGIPCKR L+TVTVKCGHCS+LSFLST+  PP+QPQ
Sbjct  1    MDFI-PPFEHLCYVRCNFCNTVLAVGIPCKRSLDTVTVKCGHCSSLSFLSTKAPPPVQPQ  59

Query  554  CHDHHA----NNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRF  387
            C DHH       F           SSS+  T+  P++PK PFV+KPPE+KHRLPSAYNRF
Sbjct  60   CFDHHPLIGFQGFSYDFKAHSSSSSSSTISTTQPPTTPKEPFVIKPPERKHRLPSAYNRF  119

Query  386  MKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA*RMEDEATQASLG  207
            MKEEIQRIKAANPE+PHREAFS AAKNWARYIP++ S   SE++ N   +  E  QAS+G
Sbjct  120  MKEEIQRIKAANPEMPHREAFSTAAKNWARYIPHSASAPGSETDKN---VAQEKRQASIG  176



>ref|XP_008389393.1| PREDICTED: protein CRABS CLAW isoform X1 [Malus domestica]
Length=196

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 128/157 (82%), Gaps = 5/157 (3%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MD     SE+LCYVRC+FCNTVLAVG+PCKR+++T+TVKCGHCSNLSFLSTR PL
Sbjct  4    EEKVTMDFINQPSENLCYVRCNFCNTVLAVGLPCKRLMDTITVKCGHCSNLSFLSTRSPL  63

Query  563  QPQCHDHHANNFPVS---CNGFKRGQsssssptssepssP--KAPFVVKPPEKKHRLPSA  399
            + QC   H  +  +    CN F++GQSSSSS +    + P  KAPFVVKPPEKKHRLPSA
Sbjct  64   EGQCLPDHPTSLTLQAGCCNDFRKGQSSSSSSSPVSGNPPSPKAPFVVKPPEKKHRLPSA  123

Query  398  YNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIP  288
            YNRFMK+EI+RIKAANPE+PHREAFSAAAKNWARYIP
Sbjct  124  YNRFMKDEIKRIKAANPEVPHREAFSAAAKNWARYIP  160



>ref|XP_004490226.1| PREDICTED: protein CRABS CLAW-like isoform X2 [Cicer arietinum]
Length=173

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 133/170 (78%), Gaps = 11/170 (6%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MDL  PS +HLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFL+TRPP 
Sbjct  4    EEKLTMDLIPPSDQHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLTTRPPT  63

Query  563  QPQCHDHHANNFPVSCNGF---KRGQsssssptssepssPK-----APFVVKPPEKKHRL  408
                 +H   +  ++  G    K+GQ++SSS +S   S+       APFVVKPPEKKHRL
Sbjct  64   S---KNHTLVDHTLTLQGVYSCKKGQATSSSSSSPTTSTESLSPKAAPFVVKPPEKKHRL  120

Query  407  PSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSES  258
            PSAYNRFMKEEIQRIKAANP+IPHREAFSAAAKNWAR+IPN+P+ S   S
Sbjct  121  PSAYNRFMKEEIQRIKAANPQIPHREAFSAAAKNWARFIPNSPTSSIPAS  170



>gb|AID67116.1| CRC protein [Solanum melongena]
Length=161

 Score =   209 bits (532),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 131/163 (80%), Gaps = 4/163 (2%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            M+  Q SSEHLCYV C+FCNTVLAV IP KR+++TVTVKC HCSNLSFLS RPP+Q QC 
Sbjct  1    MEFVQ-SSEHLCYVHCNFCNTVLAVEIPYKRIMDTVTVKCDHCSNLSFLSARPPIQGQCF  59

Query  548  DHHANNFPVSCNGFK-RGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEE  375
            DH +  F   C+ FK +GQ+SSS+ ++S      KAPFVVKPPEKKHRLP AYNRFMKEE
Sbjct  60   DHQST-FQGYCSEFKNKGQASSSASSTSSEPLSPKAPFVVKPPEKKHRLPFAYNRFMKEE  118

Query  374  IQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            IQRIKA NPEIPHREAFSAAAKNWARYIPN P+ S +E+ +N 
Sbjct  119  IQRIKAENPEIPHREAFSAAAKNWARYIPNPPNGSLTENANNV  161



>ref|XP_011070915.1| PREDICTED: protein CRABS CLAW [Sesamum indicum]
Length=182

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 136/179 (76%), Gaps = 19/179 (11%)
 Frame = -1

Query  728  MDLAQP--SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLST---RPPL  564
            MD  Q   S EH CY+RC+FCNTVLAVGIPCK++L+TVTVKCGHCSNLSFLST   +PP+
Sbjct  1    MDEQQQVQSFEHFCYIRCNFCNTVLAVGIPCKKLLDTVTVKCGHCSNLSFLSTCTAKPPI  60

Query  563  QPQCHD---HHANNF----PVSCNGFK-RGQsssssptssepssP------KAPFVVKPP  426
            QPQC +   HHA+         C+ FK  GQS SSS ++S  +        KAP+VVKPP
Sbjct  61   QPQCFNIDHHHASTLFHHHQGLCSEFKINGQSVSSSSSTSSSTISTQPSSPKAPYVVKPP  120

Query  425  EKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            EKKHRLPSAYNRFMKEEIQRIKAA+PEIPHREAFSAAAKNWARYIPNTP  S S S SN
Sbjct  121  EKKHRLPSAYNRFMKEEIQRIKAADPEIPHREAFSAAAKNWARYIPNTPQGSASTSGSN  179



>ref|XP_004490225.1| PREDICTED: protein CRABS CLAW-like isoform X1 [Cicer arietinum]
Length=174

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 129/168 (77%), Gaps = 6/168 (4%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MDL  PS +HLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFL+TRPP 
Sbjct  4    EEKLTMDLIPPSDQHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLTTRPPT  63

Query  563  -QPQCHDHHANNFPVSCNGFKRGQsssssptssepssPK-----APFVVKPPEKKHRLPS  402
             +      H           K+GQ++SSS +S   S+       APFVVKPPEKKHRLPS
Sbjct  64   SKNHTLVDHTLTLQQGVYSCKKGQATSSSSSSPTTSTESLSPKAAPFVVKPPEKKHRLPS  123

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSES  258
            AYNRFMKEEIQRIKAANP+IPHREAFSAAAKNWAR+IPN+P+ S   S
Sbjct  124  AYNRFMKEEIQRIKAANPQIPHREAFSAAAKNWARFIPNSPTSSIPAS  171



>gb|AAW83044.1| CRABS CLAW [Aquilegia formosa]
Length=174

 Score =   207 bits (527),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 129/163 (79%), Gaps = 4/163 (2%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MDL  PS EHLCYVRC+FC+TVLAVGIPCKR L+TVTVKCGHC N+SFLSTRPP+Q QC 
Sbjct  1    MDLI-PSPEHLCYVRCNFCSTVLAVGIPCKRTLDTVTVKCGHCGNISFLSTRPPIQGQCL  59

Query  548  DHHANNFPVSCNGFKRGQssssspt---ssepssPKAPFVVKPPEKKHRLPSAYNRFMKE  378
            DH  + F    N +++GQSSSSS +       S  +  +VVKPPE+KHRLPSAYNR+MKE
Sbjct  60   DHQVDAFQSFRNEYRKGQSSSSSSSTSCGQPTSPNEPNYVVKPPERKHRLPSAYNRYMKE  119

Query  377  EIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            EIQRIK+ANPEIPHREAFS+AAKNWA+Y+P++ + + S    N
Sbjct  120  EIQRIKSANPEIPHREAFSSAAKNWAKYVPHSQAGTVSGGKKN  162



>ref|XP_003614201.1| CRABS CLAW [Medicago truncatula]
 gb|AES97159.1| YABBY-like transcription factor CRABS CLAW-like protein [Medicago 
truncatula]
Length=216

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 130/172 (76%), Gaps = 12/172 (7%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MDL  PS +HLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHCSNLSFL+TRPP 
Sbjct  4    EEKVTMDLVPPSDQHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCSNLSFLTTRPPS  63

Query  563  -QPQCHDHHANNFPVSCNGFKRGQsssssptssepssPKA------PFVVKPPEKKHRLP  405
             + Q  DH      +S  G    +    S +SS  +S ++      PFVVKPPEKKHRLP
Sbjct  64   SKNQTVDHT-----LSLQGIYSSKKGQPSSSSSPTTSTESLSPRPPPFVVKPPEKKHRLP  118

Query  404  SAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            SAYNRFMKEEIQRIK ANP+IPHREAFSAAAKNWARYIPN+P+ S S +  N
Sbjct  119  SAYNRFMKEEIQRIKVANPQIPHREAFSAAAKNWARYIPNSPTSSISATKRN  170



>ref|XP_004509753.1| PREDICTED: protein CRABS CLAW-like [Cicer arietinum]
Length=178

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 130/167 (78%), Gaps = 13/167 (8%)
 Frame = -1

Query  737  KTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL-Q  561
            K +MDL  PSS+H CYVRC+FCNTVLAVGIPCKR+++TVTVKCGHCSNLSFLSTRP   Q
Sbjct  11   KVTMDLV-PSSDHFCYVRCNFCNTVLAVGIPCKRLVDTVTVKCGHCSNLSFLSTRPSYNQ  69

Query  560  PQCHDH----HANNFPVSCNGFKRGQsssssptssepss----PKAPFVVKPPEKKHRLP  405
                DH    H   F    +  K+GQ+SSSS +++          APFVVKPPEKKHRLP
Sbjct  70   NHAIDHSLTLHHQRF---YSDLKKGQASSSSSSTTTSGEPVSPKAAPFVVKPPEKKHRLP  126

Query  404  SAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTS  264
            SAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPN+P+ S S
Sbjct  127  SAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNSPTCSVS  173



>gb|EPS70015.1| hypothetical protein M569_04747 [Genlisea aurea]
Length=180

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 128/165 (78%), Gaps = 12/165 (7%)
 Frame = -1

Query  704  EHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQ---CHDHHAN  534
            +HLCYVRCSFCNT+LAVGIPC+R+LETVTVKCGHCSNLSFL+++ P+Q Q   C DH   
Sbjct  12   QHLCYVRCSFCNTILAVGIPCRRLLETVTVKCGHCSNLSFLTSKSPIQMQQSPCCDHQQQ  71

Query  533  NFPVS-------CNGFKRGQsssssptssep--ssPKAPFVVKPPEKKHRLPSAYNRFMK  381
                        C+ FKR QSSSS  +      SSPKAPFVVKPPEKKHRLPSAYNRFMK
Sbjct  72   QQQQQLTLHQGLCSDFKRVQSSSSPSSRISAEPSSPKAPFVVKPPEKKHRLPSAYNRFMK  131

Query  380  EEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            EEIQRIKAANPEIPHREAFSAAAKNWARYIP +   S S +++NA
Sbjct  132  EEIQRIKAANPEIPHREAFSAAAKNWARYIPGSSEASVSTTSNNA  176



>ref|XP_009356541.1| PREDICTED: protein CRABS CLAW [Pyrus x bretschneideri]
Length=206

 Score =   204 bits (519),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 125/157 (80%), Gaps = 5/157 (3%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +MD     SE+LCYVRC+FCNTVLAVG+PCKR+++T+TVKCGHCSNLSFLSTR PL
Sbjct  4    EEKVTMDFINQPSENLCYVRCNFCNTVLAVGLPCKRLMDTITVKCGHCSNLSFLSTRSPL  63

Query  563  QPQCHDHHANNFPVS---CNGFKRGQsssssptssepssP--KAPFVVKPPEKKHRLPSA  399
            + QC   H  +  +    C  F++GQSSSSS +    + P  KAPFVVKPPEKKHRLPSA
Sbjct  64   EGQCLPDHPTSLTLQAGCCTDFRKGQSSSSSLSPVSSNPPSPKAPFVVKPPEKKHRLPSA  123

Query  398  YNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIP  288
            YNRFMK+EI+RIKA NPE+PHREAFSAAAKNWAR IP
Sbjct  124  YNRFMKDEIKRIKATNPEVPHREAFSAAAKNWARCIP  160



>ref|XP_010936439.1| PREDICTED: protein DROOPING LEAF-like [Elaeis guineensis]
Length=190

 Score =   202 bits (513),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 122/164 (74%), Gaps = 2/164 (1%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MDL  P+ EHLCYVRC++CNTVLAVG+PCKR+++TVTVKCGHC++LSFLS RP +Q  C 
Sbjct  1    MDLVSPT-EHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNHLSFLSPRPMVQSLCP  59

Query  548  DHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEI  372
              H   F  SCN  +RGQ      ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEI
Sbjct  60   TDHPMAFQGSCNDCRRGQPLLPPSSTSSEQMIPKAPFVVKPPEKKHRLPSAYNRFMKEEI  119

Query  371  QRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA*R  240
            QRIKAA P+IPHREAFS AAKNWA+  P   +  ++  N+ A R
Sbjct  120  QRIKAAKPDIPHREAFSMAAKNWAKCDPRCSTSVSTPENTGAVR  163



>ref|XP_011011686.1| PREDICTED: protein CRABS CLAW-like [Populus euphratica]
Length=180

 Score =   200 bits (509),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 133/184 (72%), Gaps = 19/184 (10%)
 Frame = -1

Query  761  LDLQTKEIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFL  582
            ++L+ K I T +     SS+HL YVRC+FCNTVLAV IPCKR+L+TVTVKCGHC+NLSFL
Sbjct  1    MNLEEKVIDTDV----LSSDHLSYVRCNFCNTVLAVRIPCKRMLDTVTVKCGHCNNLSFL  56

Query  581  STRPPLQPQCHD--HHANNFPVSCN-------------GFKRGQsssssptssepssPKA  447
            STRPP      D  HH +   VS N              F++G+ SSSS TSSEP  PK 
Sbjct  57   STRPPNLGNFLDIDHHLSVQGVSSNEKLLFKETQGFSTDFRKGEYSSSSSTSSEPLVPKV  116

Query  446  PFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRST  267
            PFVVKPPEKKHRLPS YNRFMKEEIQRIKAANPEIPHREAFS AAKNWARY+PNT + S 
Sbjct  117  PFVVKPPEKKHRLPSTYNRFMKEEIQRIKAANPEIPHREAFSTAAKNWARYLPNTGAGSG  176

Query  266  SESN  255
               N
Sbjct  177  GSKN  180



>gb|ABP35569.1| YABBY transcription factor [Lilium longiflorum]
Length=190

 Score =   197 bits (502),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 126/162 (78%), Gaps = 5/162 (3%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MDL  PS +HLCYVRC++CNTVLAVG+PCKR+++TVTVKCGHC+++SF++ RP +QP   
Sbjct  1    MDLVSPS-DHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNHISFINPRPLVQPLTP  59

Query  548  DHHANNFPVSCNGFKRGQsssssptssepssP---KAPFVVKPPEKKHRLPSAYNRFMKE  378
            D H N F   CN  ++ Q +S  PTSS  S     KAPFVVKPPEKKHRLPSAYNRFMKE
Sbjct  60   DQHIN-FQGHCNDCRKHQPTSQMPTSSTSSEQMIPKAPFVVKPPEKKHRLPSAYNRFMKE  118

Query  377  EIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
            EIQRIKAA P+IPHREAFS AAKNWA+  P   + STSE+N 
Sbjct  119  EIQRIKAAKPDIPHREAFSMAAKNWAKCDPRATNTSTSENNG  160



>gb|AAW83050.1| CRABS CLAW [Carsonia sparsifolia]
Length=185

 Score =   196 bits (499),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/173 (63%), Positives = 129/173 (75%), Gaps = 10/173 (6%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K +M      S+HLCYVRC+FC+T+LAVGIP  R+L+TVTVKCGHC NLSFL+T  PL
Sbjct  4    EEKPAMASRANQSDHLCYVRCNFCSTILAVGIPLTRMLDTVTVKCGHCGNLSFLTTTKPL  63

Query  563  QPQCHDHHAN------NFPVSCNGFKRGQsssssptssepssPKAP---FVVKPPEKKHR  411
            Q QC D H +      +F  S N  K+G SSSSS +S+    P  P   FVVKPPEKK R
Sbjct  64   QGQCLDRHVSLTLQMQSFGGS-NELKKGGSSSSSSSSTSSDQPPFPTAAFVVKPPEKKQR  122

Query  410  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
            LPSAYNRFM+EEIQRIKAANPEIPHREAFSAAAKNWA+YIPN+P+  ++  N+
Sbjct  123  LPSAYNRFMREEIQRIKAANPEIPHREAFSAAAKNWAKYIPNSPTSISTGGNA  175



>ref|XP_010091608.1| hypothetical protein L484_026456 [Morus notabilis]
 gb|EXB44874.1| hypothetical protein L484_026456 [Morus notabilis]
Length=190

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 125/152 (82%), Gaps = 6/152 (4%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K ++D   PS++HLCYVRC+FC+TVLAV +P KR+L+TVTVKCGHCSNLSFLSTRPPL
Sbjct  4    EEKVAVDFVPPSTDHLCYVRCNFCSTVLAVALPYKRLLDTVTVKCGHCSNLSFLSTRPPL  63

Query  563  QP--QCHDHHANNFPVSCNGFKRGQs----ssssptssepssPKAPFVVKPPEKKHRLPS  402
            QP  Q  DH   + P  CN F++G      SSSS  SSEP SPKAPFV+KPPEKKHRLPS
Sbjct  64   QPAHQFLDHPNLSLPGFCNEFRKGHYSSSSSSSSSISSEPISPKAPFVLKPPEKKHRLPS  123

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKN  306
            AYNRFMKEEIQRIKAANPEIPHREAFSAAAKN
Sbjct  124  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKN  155



>ref|XP_011018913.1| PREDICTED: protein CRABS CLAW-like [Populus euphratica]
Length=180

 Score =   195 bits (495),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 132/177 (75%), Gaps = 20/177 (11%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            E K S ++  PSSEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHC+NLSFLSTRPP 
Sbjct  4    EEKASTEV--PSSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCNNLSFLSTRPPN  61

Query  563  QPQCHD--HHANNFPVS-------------CNGFKRGQsssssptssepssPKAPFVVKP  429
            Q QC D  H  +   VS             C   ++G+SSSSS +S +P     PFVVKP
Sbjct  62   QGQCLDPYHRLSLQGVSSNEKFLFKEKQGFCTDIRKGESSSSSTSSEQPVRT-VPFVVKP  120

Query  428  PEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNW--ARYIPNTPSRSTS  264
            PEKKHRLPSAYNRFMKEEI+RIKAA+PEIPHREAFS AAKNW  ARY+P + + S S
Sbjct  121  PEKKHRLPSAYNRFMKEEIKRIKAADPEIPHREAFSTAAKNWARARYLPKSGAGSGS  177



>ref|XP_004298356.1| PREDICTED: protein DROOPING LEAF-like [Fragaria vesca subsp. 
vesca]
Length=216

 Score =   196 bits (498),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 126/169 (75%), Gaps = 5/169 (3%)
 Frame = -1

Query  743  EIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRP--  570
            E K  MDL QPS EHLCYVRC+FCNTVLAVG+P KR+++TVTVKCGHCSNLSFL+TRP  
Sbjct  4    EDKVPMDLVQPS-EHLCYVRCNFCNTVLAVGLPFKRMMDTVTVKCGHCSNLSFLTTRPNN  62

Query  569  --PLQPQCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAY  396
               +QP  H     ++           SSSS  +   PSSPKAPFV KPPEKKHR+PSAY
Sbjct  63   PIQIQPAPHQLFLQSYSTDSRRGGHSSSSSSPTSLESPSSPKAPFVCKPPEKKHRVPSAY  122

Query  395  NRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            NRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  ++   + + S S+
Sbjct  123  NRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYPSSSGEAAATASGSS  171



>ref|XP_002311351.2| CRABS CLAW family protein [Populus trichocarpa]
 gb|EEE88718.2| CRABS CLAW family protein [Populus trichocarpa]
Length=180

 Score =   194 bits (494),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 127/167 (76%), Gaps = 18/167 (11%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHD--HH  540
            PSSEHLCYVRC+FCNTVLAVGIPCKR+L+TVTVKCGHC+NLSFLSTRPP Q QC D  H 
Sbjct  12   PSSEHLCYVRCNFCNTVLAVGIPCKRLLDTVTVKCGHCNNLSFLSTRPPNQGQCLDQYHR  71

Query  539  ANNFPVS-------------CNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSA  399
             +   VS             C   ++G+SSSSS +S +P     PFVVKPPEKKHRLPSA
Sbjct  72   LSLQGVSSNEKFLFKEKQGFCTDIRKGESSSSSTSSEQPVPT-VPFVVKPPEKKHRLPSA  130

Query  398  YNRFMKEEIQRIKAANPEIPHREAFSAAAKNW--ARYIPNTPSRSTS  264
            YNRFMKEEI+RIKAA+PEIPHREAFS AAKNW  ARY+P + + S S
Sbjct  131  YNRFMKEEIKRIKAADPEIPHREAFSTAAKNWARARYLPKSGAGSGS  177



>gb|KFK41341.1| hypothetical protein AALP_AA2G117700 [Arabis alpina]
Length=179

 Score =   194 bits (492),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 129/173 (75%), Gaps = 9/173 (5%)
 Frame = -1

Query  755  LQTKEIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLST  576
            +  +E  T    A P +EHL YVRCS CNT+LAVGIP KR+L+TVTVKCGHC NLSFL+T
Sbjct  1    MNLEEKPTMASRAAPQTEHLYYVRCSICNTILAVGIPVKRMLDTVTVKCGHCGNLSFLTT  60

Query  575  RPPLQPQCHDHHANNFPVSCNG---FKRGQsssssptsseps--sPKAPFVVKPPEKKHR  411
             PPLQ     H +    +   G   +K+G SSSSS ++S     SP+ PFVVKPPEKK R
Sbjct  61   SPPLQ----GHVSLTLQMQSFGGSEYKKGSSSSSSSSTSSDQPPSPRPPFVVKPPEKKQR  116

Query  410  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
            LPSAYNRFM++EIQRIK+ANPEIPHREAFSAAAKNWA+YIPN+P+  TS  N+
Sbjct  117  LPSAYNRFMRDEIQRIKSANPEIPHREAFSAAAKNWAKYIPNSPTSLTSGGNN  169



>ref|XP_010228969.1| PREDICTED: protein DROOPING LEAF isoform X2 [Brachypodium distachyon]
Length=203

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 123/170 (72%), Gaps = 9/170 (5%)
 Frame = -1

Query  737  KTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPP---  567
            ++SMDL  PS EHLCYVRC++CNTVLAVG+PCKR+++TVTVKCGHC+NLSFLS RPP   
Sbjct  3    QSSMDLVSPS-EHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNNLSFLSPRPPPMV  61

Query  566  --LQPQCHDHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAY  396
              L P  H H    F   C   +R Q      + +   +  +APFVVKPPEKKHRLPSAY
Sbjct  62   QPLSPNDHHHPMGPF-QGCTDCRRNQPLPPLASPTSSDASPRAPFVVKPPEKKHRLPSAY  120

Query  395  NRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            NRFM+EEIQRIKAA P+IPHREAFS AAKNWA+  P   S + S SNS +
Sbjct  121  NRFMREEIQRIKAAKPDIPHREAFSMAAKNWAKCDPRC-SSAVSASNSTS  169



>ref|NP_001049375.1| Os03g0215200 [Oryza sativa Japonica Group]
 sp|Q76EJ0.1|YABDL_ORYSJ RecName: Full=Protein DROOPING LEAF; AltName: Full=Protein CRABS 
CLAW homolog; Short=Protein CRC homolog [Oryza sativa Japonica 
Group]
 gb|AAR84663.1| drooping leaf [Oryza sativa Japonica Group]
 dbj|BAD06551.1| DL protein [Oryza sativa Japonica Group]
 dbj|BAD06552.1| DL protein [Oryza sativa Japonica Group]
 gb|ABF94635.1| Drooping leaf protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11289.1| Os03g0215200 [Oryza sativa Japonica Group]
 gb|EAY89040.1| hypothetical protein OsI_10525 [Oryza sativa Indica Group]
Length=194

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 101/149 (68%), Positives = 115/149 (77%), Gaps = 3/149 (2%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL-QPQC  552
            MDL  PS EHLCYVRC++CNTVLAVG+PCKR+++TVTVKCGHC+NLSFLS RPP+ QP  
Sbjct  1    MDLVSPS-EHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNNLSFLSPRPPMVQPLS  59

Query  551  -HDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEE  375
              DH    F   C   +R Q       +S   SP+APFVVKPPEKKHRLPSAYNRFM+EE
Sbjct  60   PTDHPLGPFQGPCTDCRRNQPLPLVSPTSNEGSPRAPFVVKPPEKKHRLPSAYNRFMREE  119

Query  374  IQRIKAANPEIPHREAFSAAAKNWARYIP  288
            IQRIKAA P+IPHREAFS AAKNWA+  P
Sbjct  120  IQRIKAAKPDIPHREAFSMAAKNWAKCDP  148



>dbj|BAH83538.1| DL related protein [Triticum aestivum]
 dbj|BAJ54068.1| DL-like protein [Triticum aestivum]
Length=200

 Score =   193 bits (491),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 120/166 (72%), Gaps = 9/166 (5%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPP-----  567
            SMDL  PS EHLCYVRC++CNTVLAVG+PCKR+++TVTVKCGHC+NLSFLS RPP     
Sbjct  3    SMDLVSPS-EHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNNLSFLSPRPPPMVQP  61

Query  566  LQPQCHDHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNR  390
            L P  H H    F   C   +R Q      + +   +  +APFVVKPPEKKHRLPSAYNR
Sbjct  62   LSPNDHHHPMGPF-QGCTDCRRNQPLPPLASPTSSDASPRAPFVVKPPEKKHRLPSAYNR  120

Query  389  FMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
            FM+EEIQRIKAA P+IPHREAFS AAKNWA+  P   S + S SNS
Sbjct  121  FMREEIQRIKAAKPDIPHREAFSMAAKNWAKCDPRC-SSTVSASNS  165



>gb|EYU42115.1| hypothetical protein MIMGU_mgv1a014827mg [Erythranthe guttata]
Length=177

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 126/180 (70%), Gaps = 25/180 (14%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPP----L  564
            +MDL Q SSEH+CYVRC+FCNT+LAV IP K++LETVTVKCGHCSNLSFLST+PP    L
Sbjct  3    TMDLVQYSSEHICYVRCNFCNTILAVEIPRKQMLETVTVKCGHCSNLSFLSTKPPPLHDL  62

Query  563  QPQCHDHHANNFPVSCNGFKRGQs----------------ssssptssepssPKAPFVVK  432
            Q     H      ++    K+GQS                  +S + +  ++   PFVVK
Sbjct  63   QTTLRLHG-----LTSREHKKGQSATSSSSSSSINNNTSSDETSLSLNTTTTTTTPFVVK  117

Query  431  PPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
            PPEK+HRLPSAYN FMKEEIQRIKAANPE+PHREAFSAAAKNW+RYIPNTP    S S++
Sbjct  118  PPEKRHRLPSAYNIFMKEEIQRIKAANPEVPHREAFSAAAKNWSRYIPNTPQGPVSRSSN  177



>ref|XP_006391053.1| hypothetical protein EUTSA_v10019126mg [Eutrema salsugineum]
 gb|ESQ28339.1| hypothetical protein EUTSA_v10019126mg [Eutrema salsugineum]
Length=214

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/178 (61%), Positives = 130/178 (73%), Gaps = 10/178 (6%)
 Frame = -1

Query  767  SILDLQTKEIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLS  588
            SI  +  +E  T    A   +EHL YVRCS CNT+LAVGIP KR+L+TVTVKCGHC NLS
Sbjct  31   SIKIMNLEEKPTMASRASSQAEHLYYVRCSICNTILAVGIPLKRMLDTVTVKCGHCGNLS  90

Query  587  FLSTRPPLQPQCHDHHANNFPVSCNG----FKRGQsssssptsseps--sPKAPFVVKPP  426
            FL+T PPLQ     H +    +   G    +K+G SSSSS ++S     SP+ PFVVKPP
Sbjct  91   FLTTSPPLQ----GHVSLTLQMQSFGGSHEYKKGSSSSSSSSTSSDQPPSPRPPFVVKPP  146

Query  425  EKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
            EKK RLPSAYNRFM++EIQRIK+ANPEIPHREAFSAAAKNWA+YIPN+P+  TS  N+
Sbjct  147  EKKQRLPSAYNRFMRDEIQRIKSANPEIPHREAFSAAAKNWAKYIPNSPTSITSGGNN  204



>ref|XP_006301241.1| hypothetical protein CARUB_v10021641mg [Capsella rubella]
 gb|AAZ23116.1| transcription factor CRC [Brassica juncea]
 gb|EOA34139.1| hypothetical protein CARUB_v10021641mg [Capsella rubella]
Length=179

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 129/171 (75%), Gaps = 11/171 (6%)
 Frame = -1

Query  761  LDLQTKEIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFL  582
            ++L+ K   TS   A P +EHL YVRCS CNT+LAVGIP KR+L+TVTVKCGHC NLSFL
Sbjct  1    MNLEEKPTMTSK--ASPQAEHLYYVRCSICNTILAVGIPLKRMLDTVTVKCGHCGNLSFL  58

Query  581  STRPPLQPQCHDHHANNFPVSCNG---FKRGQsssssptsseps--sPKAPFVVKPPEKK  417
            +T PPLQ     H +    +   G   +K+G SSSSS ++S     SP  PFVVKPPEKK
Sbjct  59   TTSPPLQ----GHVSLTLQMQSFGGSEYKKGSSSSSSSSTSSDQPPSPTPPFVVKPPEKK  114

Query  416  HRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTS  264
             RLPSAYNRFM++EIQRIK+ANPEIPHREAFSAAAKNWA+YIPN+P+  TS
Sbjct  115  QRLPSAYNRFMRDEIQRIKSANPEIPHREAFSAAAKNWAKYIPNSPTSLTS  165



>emb|CDX95957.1| BnaA07g27740D [Brassica napus]
Length=180

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = -1

Query  755  LQTKEIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLST  576
            +  +E  T      P +EHL YVRCS CNT+LAVGIP KR+L+TVTVKCGHC NLSFL+T
Sbjct  1    MNLEEKPTMASRVSPQAEHLYYVRCSICNTILAVGIPMKRMLDTVTVKCGHCGNLSFLTT  60

Query  575  RPPLQPQCHDHHANNFPVSCNGFKRGQsssssptsseps--sPKAPFVVKPPEKKHRLPS  402
             PPLQ               + +K+G SSSSS ++S     SP+ PFVVKPPEKK RLPS
Sbjct  61   TPPLQGHVSLTLQQMQSFGGSEYKKGSSSSSSSSTSSDQPPSPRPPFVVKPPEKKQRLPS  120

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
            AYNRFM++EIQRIK+ANPEIPHREAFSAAAKNWA+YIPN+P+  TS +++
Sbjct  121  AYNRFMRDEIQRIKSANPEIPHREAFSAAAKNWAKYIPNSPTSITSGASN  170



>ref|XP_009105464.1| PREDICTED: protein CRABS CLAW [Brassica rapa]
Length=179

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/173 (61%), Positives = 129/173 (75%), Gaps = 9/173 (5%)
 Frame = -1

Query  755  LQTKEIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLST  576
            +  +E  T      P +EHL YVRCS CNT+LAVGIP KR+L+TVTVKCGHC NLSFL+T
Sbjct  1    MNLEEKPTMASRVSPQAEHLYYVRCSICNTILAVGIPMKRMLDTVTVKCGHCGNLSFLTT  60

Query  575  RPPLQPQCHDHHANNFPVSCNG---FKRGQsssssptsseps--sPKAPFVVKPPEKKHR  411
             PPLQ     H +    +   G   +K+G SSSSS ++S     SP+ PFVVKPPEKK R
Sbjct  61   TPPLQ----GHVSLTLQMQSFGGSEYKKGSSSSSSSSTSSDQPPSPRPPFVVKPPEKKQR  116

Query  410  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
            LPSAYNRFM++EIQRIK+ANPEIPHREAFSAAAKNWA+YIPN+P+  TS +++
Sbjct  117  LPSAYNRFMRDEIQRIKSANPEIPHREAFSAAAKNWAKYIPNSPTSITSGASN  169



>dbj|BAJ14106.1| DROOPING LEAF [Juncus prismatocarpus subsp. leschenaultii]
 dbj|BAJ14110.1| DROOPING LEAF [Juncus wallichianus]
Length=189

 Score =   190 bits (483),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 121/163 (74%), Gaps = 7/163 (4%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL-QPQC  552
            MDL  P+ EHLCYVRC++CNTVLAVG+PCKR+++TVTVKCGHC+NLSFLS RP + Q   
Sbjct  1    MDLVAPT-EHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNNLSFLSPRPSMVQSLL  59

Query  551  HDHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEE  375
                  +F  SCN  +R Q      +S    +  KAPFVVKPPEKKHRLPSAYNRFM+EE
Sbjct  60   SSDPTMDFQGSCNDCRRNQPLLPPSSSLSQQTTPKAPFVVKPPEKKHRLPSAYNRFMREE  119

Query  374  IQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            IQRIKAA P+IPHREAFS AAKNWA+  P    RS+S S++N 
Sbjct  120  IQRIKAAKPDIPHREAFSMAAKNWAKCDP----RSSSSSDNNV  158



>ref|NP_001148730.1| protein DROOPING LEAF [Zea mays]
 gb|ACG32674.1| protein DROOPING LEAF [Zea mays]
 gb|ACN25845.1| unknown [Zea mays]
 dbj|BAH83539.1| DL related protein [Zea mays]
 dbj|BAH83541.1| DL related protein [Zea mays]
 gb|ADX60151.1| C2C2-YABBY transcription factor [Zea mays]
 tpg|DAA44085.1| TPA: putative YABBY domain transcription factor family protein 
[Zea mays]
Length=205

 Score =   191 bits (484),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 101/165 (61%), Positives = 125/165 (76%), Gaps = 5/165 (3%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL-QPQC  552
            MD+    SEHLCYVRC++CNTVLAVG+PCKR+++TVTVKCGHC+NLS+LS RPP+ QP  
Sbjct  1    MDMVS-QSEHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNNLSYLSPRPPMVQPLS  59

Query  551  -HDHHANNFPVS--CNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMK  381
              DH    F     CN  +R Q    +  SS   SP+ PFVVKPPEKKHRLPSAYNRFM+
Sbjct  60   PTDHPLGPFQCQGPCNDCRRNQPLPLASPSSTELSPRMPFVVKPPEKKHRLPSAYNRFMR  119

Query  380  EEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            EEIQRIKAA P+IPHREAFS AAKNWA+  P   + +++E++++A
Sbjct  120  EEIQRIKAAKPDIPHREAFSMAAKNWAKCDPRCSTAASTETSNSA  164



>ref|XP_002888705.1| hypothetical protein ARALYDRAFT_476042 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64964.1| hypothetical protein ARALYDRAFT_476042 [Arabidopsis lyrata subsp. 
lyrata]
Length=181

 Score =   189 bits (481),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 122/157 (78%), Gaps = 9/157 (6%)
 Frame = -1

Query  719  AQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHH  540
            A P +EHL YVRCS CNT+LAVGIP KR+L+TVTVKCGHC NLSFL+T PPLQ     H 
Sbjct  14   ASPQTEHLYYVRCSICNTILAVGIPLKRMLDTVTVKCGHCGNLSFLTTTPPLQ----GHV  69

Query  539  ANNFPVSCNG---FKRGQsssssptsseps--sPKAPFVVKPPEKKHRLPSAYNRFMKEE  375
            +    +   G   +K+G SSSSS ++S     SP  PFVVKPPEKK RLPSAYNRFM++E
Sbjct  70   SLTLQMQSFGGSEYKKGSSSSSSSSTSSDQPPSPTPPFVVKPPEKKQRLPSAYNRFMRDE  129

Query  374  IQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTS  264
            IQRIK+ANPEIPHREAFSAAAKNWA+YIPN+P+  TS
Sbjct  130  IQRIKSANPEIPHREAFSAAAKNWAKYIPNSPTSITS  166



>gb|AAU12183.1| CRABS CLAW [Lepidium africanum]
Length=173

 Score =   189 bits (480),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 124/169 (73%), Gaps = 9/169 (5%)
 Frame = -1

Query  746  KEIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPP  567
            +E  T    A P +EHL YVRCS CNT+LAVGIP KR+L+TVTVKCGHC NLSFL+T  P
Sbjct  5    QEKPTMTSRASPQAEHLYYVRCSICNTILAVGIPMKRMLDTVTVKCGHCGNLSFLTTSLP  64

Query  566  LQPQCHDHHANNFPVSCNG---FKRGQsssssptsseps--sPKAPFVVKPPEKKHRLPS  402
            L    H H +    +   G   +K+G SSSSS ++S     SP  PFVVKPPEKK RLPS
Sbjct  65   L----HGHVSLTLQMQSFGGSEYKKGSSSSSSSSTSSDQPPSPTPPFVVKPPEKKQRLPS  120

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESN  255
            AYNRFM++EIQRIK ANPEIPHREAFSAAAKNWA+YIPN+P+  TS  N
Sbjct  121  AYNRFMRDEIQRIKTANPEIPHREAFSAAAKNWAKYIPNSPTSLTSGGN  169



>ref|XP_002468276.1| hypothetical protein SORBIDRAFT_01g042850 [Sorghum bicolor]
 gb|EER95274.1| hypothetical protein SORBIDRAFT_01g042850 [Sorghum bicolor]
 dbj|BAH83537.1| DL related protein [Sorghum bicolor]
Length=204

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 123/164 (75%), Gaps = 6/164 (4%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL-QPQC  552
            MD+    SEHLCYVRC++CNTVLAVG+PCKR+++TVTVKCGHC+NLS+LS RPP+ QP  
Sbjct  1    MDMVS-QSEHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNNLSYLSPRPPMVQPLS  59

Query  551  -HDHHANNFPVS--CNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMK  381
              DH    F     CN  +R Q    +  +S   SP+ PFVVKPPEKKHRLPSAYNRFM+
Sbjct  60   PTDHPLGPFQCQGPCNDCRRNQPLPLASPTSTELSPRMPFVVKPPEKKHRLPSAYNRFMR  119

Query  380  EEIQRIKAANPEIPHREAFSAAAKNWARYIPN-TPSRSTSESNS  252
            EEIQRIKAA P+IPHREAFS AAKNWA+  P  + + ST+ SNS
Sbjct  120  EEIQRIKAAKPDIPHREAFSMAAKNWAKCDPRCSTTASTATSNS  163



>gb|AAW83049.1| CRABS CLAW [Lepidium africanum]
Length=188

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 124/169 (73%), Gaps = 9/169 (5%)
 Frame = -1

Query  746  KEIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPP  567
            +E  T    A P +EHL YVRCS CNT+LAVGIP KR+L+TVTVKCGHC NLSFL+T  P
Sbjct  5    QEKPTMTSRASPQAEHLYYVRCSICNTILAVGIPMKRMLDTVTVKCGHCGNLSFLTTSLP  64

Query  566  LQPQCHDHHANNFPVSCNG---FKRGQsssssptsseps--sPKAPFVVKPPEKKHRLPS  402
            L    H H +    +   G   +K+G SSSSS ++S     SP  PFVVKPPEKK RLPS
Sbjct  65   L----HGHVSLTLQMQSFGGSEYKKGSSSSSSSSTSSDQPPSPTPPFVVKPPEKKQRLPS  120

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESN  255
            AYNRFM++EIQRIK ANPEIPHREAFSAAAKNWA+YIPN+P+  TS  N
Sbjct  121  AYNRFMRDEIQRIKTANPEIPHREAFSAAAKNWAKYIPNSPTSLTSGGN  169



>ref|XP_003558497.1| PREDICTED: protein DROOPING LEAF isoform X1 [Brachypodium distachyon]
Length=205

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 123/172 (72%), Gaps = 11/172 (6%)
 Frame = -1

Query  737  KTSMDLAQPSSEHLCYVRCSFCNTVLA--VGIPCKRVLETVTVKCGHCSNLSFLSTRPP-  567
            ++SMDL  PS EHLCYVRC++CNTVLA  VG+PCKR+++TVTVKCGHC+NLSFLS RPP 
Sbjct  3    QSSMDLVSPS-EHLCYVRCTYCNTVLALQVGVPCKRLMDTVTVKCGHCNNLSFLSPRPPP  61

Query  566  ----LQPQCHDHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPS  402
                L P  H H    F   C   +R Q      + +   +  +APFVVKPPEKKHRLPS
Sbjct  62   MVQPLSPNDHHHPMGPF-QGCTDCRRNQPLPPLASPTSSDASPRAPFVVKPPEKKHRLPS  120

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            AYNRFM+EEIQRIKAA P+IPHREAFS AAKNWA+  P   S + S SNS +
Sbjct  121  AYNRFMREEIQRIKAAKPDIPHREAFSMAAKNWAKCDPRC-SSAVSASNSTS  171



>ref|XP_010470890.1| PREDICTED: protein CRABS CLAW-like [Camelina sativa]
Length=180

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 123/161 (76%), Gaps = 9/161 (6%)
 Frame = -1

Query  719  AQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHH  540
            A   +EHL YVRCS CNT+LAVGIP KR+L+TVTVKCGHC NLSFL+T PPLQ     H 
Sbjct  14   ASSQAEHLYYVRCSICNTILAVGIPLKRMLDTVTVKCGHCGNLSFLTTSPPLQ----GHV  69

Query  539  ANNFPVSCNG---FKRGQsssssptsseps--sPKAPFVVKPPEKKHRLPSAYNRFMKEE  375
            +    +   G   +K+G SSSSS ++S     SP  PFVVKPPEKK RLPSAYNRFM++E
Sbjct  70   SLTLQMQSFGGSEYKKGSSSSSSSSTSSDQPPSPTPPFVVKPPEKKQRLPSAYNRFMRDE  129

Query  374  IQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
            IQRIK+ANPEIPHREAFSAAAKNWA+YIPN+P+  TS  N+
Sbjct  130  IQRIKSANPEIPHREAFSAAAKNWAKYIPNSPTSITSGGNN  170



>ref|XP_010228970.1| PREDICTED: protein DROOPING LEAF isoform X3 [Brachypodium distachyon]
Length=203

 Score =   189 bits (481),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/172 (60%), Positives = 123/172 (72%), Gaps = 11/172 (6%)
 Frame = -1

Query  737  KTSMDLAQPSSEHLCYVRCSFCNTVLA--VGIPCKRVLETVTVKCGHCSNLSFLSTRPP-  567
            ++SMDL  PS EHLCYVRC++CNTVLA  VG+PCKR+++TVTVKCGHC+NLSFLS RPP 
Sbjct  3    QSSMDLVSPS-EHLCYVRCTYCNTVLALQVGVPCKRLMDTVTVKCGHCNNLSFLSPRPPP  61

Query  566  ----LQPQCHDHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPS  402
                L P  H H    F   C   +R Q      + +   +  +APFVVKPPEKKHRLPS
Sbjct  62   MVQPLSPNDHHHPMGPF-QGCTDCRRNQPLPPLASPTSSDASPRAPFVVKPPEKKHRLPS  120

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            AYNRFM+EEIQRIKAA P+IPHREAFS AAKNWA+  P   S + S SNS +
Sbjct  121  AYNRFMREEIQRIKAAKPDIPHREAFSMAAKNWAKCDPRC-SSAVSASNSTS  171



>ref|XP_002316077.1| CRABS CLAW family protein [Populus trichocarpa]
 gb|EEF02248.1| CRABS CLAW family protein [Populus trichocarpa]
Length=180

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 127/185 (69%), Gaps = 21/185 (11%)
 Frame = -1

Query  761  LDLQTKEIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFL  582
            ++L+ K I T +     SS+HL YVRC+FCNTVLAV IP KR+L+TVTVKCGHC+NLSFL
Sbjct  1    MNLEEKVIDTDV----LSSDHLSYVRCNFCNTVLAVRIPFKRMLDTVTVKCGHCNNLSFL  56

Query  581  STRPPLQPQCHD---HHANNFPVS-------------CNGFKRGQsssssptssepssPK  450
            STR P      D   HH +   VS             C  F++G+ SSSS +S      K
Sbjct  57   STRSPNLGNFLDIDHHHLSLQGVSSNEKLLFKETQGFCTDFRKGEYSSSSTSSEPLVP-K  115

Query  449  APFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRS  270
             PFVVKPPEKKHRLPS YNRFMKEEIQRIKAANPEIPHREAFS AAKNWARY+PN+ + S
Sbjct  116  VPFVVKPPEKKHRLPSTYNRFMKEEIQRIKAANPEIPHREAFSTAAKNWARYLPNSGAGS  175

Query  269  TSESN  255
                N
Sbjct  176  GGSKN  180



>gb|ADI58463.1| drooping leaf [Cymbidium goeringii]
Length=189

 Score =   188 bits (478),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 123/160 (77%), Gaps = 2/160 (1%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MDL   S EHLCYVRC++CNTVLAVG+PCKR+++TVTVKCGHC++LSFL+ R  LQ   +
Sbjct  1    MDLVS-SREHLCYVRCAYCNTVLAVGVPCKRLMDTVTVKCGHCNHLSFLNPRRLLQAH-Y  58

Query  548  DHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQ  369
                  F   CN  ++GQ S++S ++S   +PKAPFVVKPPEKKHRLPSAYNRFM+EEIQ
Sbjct  59   SEQPLGFQDPCNDCRKGQLSAASSSTSTEQAPKAPFVVKPPEKKHRLPSAYNRFMREEIQ  118

Query  368  RIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            RIKAA P+IPHREAFS AAKNWA+  P   +   S S++N
Sbjct  119  RIKAAKPDIPHREAFSTAAKNWAKCDPRAVNSVNSTSDNN  158



>ref|XP_006649635.1| PREDICTED: protein DROOPING LEAF-like [Oryza brachyantha]
Length=196

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 116/151 (77%), Gaps = 5/151 (3%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLA--VGIPCKRVLETVTVKCGHCSNLSFLSTRPPL-QP  558
            MDL  PS EHLCYVRC++CNTVLA  VG+PCKR+++TVTVKCGHC+NLSFLS RPP+ QP
Sbjct  1    MDLVSPS-EHLCYVRCTYCNTVLALQVGVPCKRLMDTVTVKCGHCNNLSFLSPRPPMVQP  59

Query  557  QC-HDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMK  381
                DH    F   C   +R Q       +S  +SP+APFVVKPPEKKHRLPSAYNRFM+
Sbjct  60   LSPTDHPLGPFQGPCTDCRRNQPLPLVSPTSNEASPRAPFVVKPPEKKHRLPSAYNRFMR  119

Query  380  EEIQRIKAANPEIPHREAFSAAAKNWARYIP  288
            EEIQRIKAA P+IPHREAFS AAKNWA+  P
Sbjct  120  EEIQRIKAAKPDIPHREAFSMAAKNWAKCDP  150



>ref|NP_177078.1| putative transcription factor CRABS CLAW [Arabidopsis thaliana]
 sp|Q8L925.2|CRC_ARATH RecName: Full=Protein CRABS CLAW [Arabidopsis thaliana]
 gb|AAD30526.1|AF132606_1 transcription factor CRC [Arabidopsis thaliana]
 gb|AAG52485.1|AC018364_3 transcription factor CRC; 87968-89174 [Arabidopsis thaliana]
 gb|AAP40440.1| putative transcription factor CRC [Arabidopsis thaliana]
 gb|ABE65756.1| transcription factor CRC [Arabidopsis thaliana]
 dbj|BAF01454.1| transcription factor CRC [Arabidopsis thaliana]
 gb|AEE34891.1| putative transcription factor CRABS CLAW [Arabidopsis thaliana]
Length=181

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 127/171 (74%), Gaps = 10/171 (6%)
 Frame = -1

Query  761  LDLQTKEIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFL  582
            ++L+ K   T+   A P +EHL YVRCS CNT+LAVGIP KR+L+TVTVKCGHC NLSFL
Sbjct  1    MNLEEKPTMTA-SRASPQAEHLYYVRCSICNTILAVGIPLKRMLDTVTVKCGHCGNLSFL  59

Query  581  STRPPLQPQCHDHHANNFPVSCNG---FKRGQsssssptssepssPKAP--FVVKPPEKK  417
            +T PPLQ     H +    +   G   +K+G SSSSS ++S    P     FVVKPPEKK
Sbjct  60   TTTPPLQ----GHVSLTLQMQSFGGSDYKKGSSSSSSSSTSSDQPPSPSPPFVVKPPEKK  115

Query  416  HRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTS  264
             RLPSAYNRFM++EIQRIK+ANPEIPHREAFSAAAKNWA+YIPN+P+  TS
Sbjct  116  QRLPSAYNRFMRDEIQRIKSANPEIPHREAFSAAAKNWAKYIPNSPTSITS  166



>ref|XP_010939214.1| PREDICTED: protein DROOPING LEAF-like isoform X2 [Elaeis guineensis]
Length=171

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 120/162 (74%), Gaps = 3/162 (2%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MDL  P +EH+CYVRC++CNTVLAVG+PCK +++TVTVKCGHC++LSFLS RP +Q  C 
Sbjct  1    MDLV-PPTEHVCYVRCTYCNTVLAVGVPCKWLMDTVTVKCGHCNHLSFLSPRPMMQTFCP  59

Query  548  DHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEI  372
              H   F   CN   RGQ SS S ++S      KA FVVKPPEKKHRLPSAYNRFMKEEI
Sbjct  60   TDHQMAFQGPCNDCWRGQPSSPSSSTSSEKMIPKASFVVKPPEKKHRLPSAYNRFMKEEI  119

Query  371  QRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            QRIKAA P+IPHREAFS AAKNWA+  P   S + S S+  A
Sbjct  120  QRIKAAKPDIPHREAFSMAAKNWAKCDPRC-STTVSASDGAA  160



>ref|XP_010939213.1| PREDICTED: protein DROOPING LEAF-like isoform X1 [Elaeis guineensis]
Length=188

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 120/162 (74%), Gaps = 3/162 (2%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MDL  P +EH+CYVRC++CNTVLAVG+PCK +++TVTVKCGHC++LSFLS RP +Q  C 
Sbjct  1    MDLV-PPTEHVCYVRCTYCNTVLAVGVPCKWLMDTVTVKCGHCNHLSFLSPRPMMQTFCP  59

Query  548  DHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEI  372
              H   F   CN   RGQ SS S ++S      KA FVVKPPEKKHRLPSAYNRFMKEEI
Sbjct  60   TDHQMAFQGPCNDCWRGQPSSPSSSTSSEKMIPKASFVVKPPEKKHRLPSAYNRFMKEEI  119

Query  371  QRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            QRIKAA P+IPHREAFS AAKNWA+  P   S + S S+  A
Sbjct  120  QRIKAAKPDIPHREAFSMAAKNWAKCDPRC-STTVSASDGAA  160



>gb|ABF94636.1| Drooping leaf protein, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EEE58585.1| hypothetical protein OsJ_09912 [Oryza sativa Japonica Group]
Length=196

 Score =   188 bits (477),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 115/151 (76%), Gaps = 5/151 (3%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLA--VGIPCKRVLETVTVKCGHCSNLSFLSTRPPL-QP  558
            MDL  PS EHLCYVRC++CNTVLA  VG+PCKR+++TVTVKCGHC+NLSFLS RPP+ QP
Sbjct  1    MDLVSPS-EHLCYVRCTYCNTVLALQVGVPCKRLMDTVTVKCGHCNNLSFLSPRPPMVQP  59

Query  557  QC-HDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMK  381
                DH    F   C   +R Q       +S   SP+APFVVKPPEKKHRLPSAYNRFM+
Sbjct  60   LSPTDHPLGPFQGPCTDCRRNQPLPLVSPTSNEGSPRAPFVVKPPEKKHRLPSAYNRFMR  119

Query  380  EEIQRIKAANPEIPHREAFSAAAKNWARYIP  288
            EEIQRIKAA P+IPHREAFS AAKNWA+  P
Sbjct  120  EEIQRIKAAKPDIPHREAFSMAAKNWAKCDP  150



>gb|AAM66994.1| transcription factor CRC [Arabidopsis thaliana]
Length=173

 Score =   186 bits (473),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 121/161 (75%), Gaps = 9/161 (6%)
 Frame = -1

Query  719  AQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHH  540
            A P +EHL YVRCS CNT+LAVGIP KR+L+TVTVKCGHC NLSFL+T PPLQ     H 
Sbjct  6    ASPQAEHLYYVRCSICNTILAVGIPLKRMLDTVTVKCGHCGNLSFLTTTPPLQ----GHV  61

Query  539  ANNFPVSCNG---FKRGQsssssptssepssPKAP--FVVKPPEKKHRLPSAYNRFMKEE  375
            +    +   G   +K+G SSSSS ++S    P     FVVKPPEKK RLPSAYNRFM++E
Sbjct  62   SLTLQMQSFGGSDYKKGSSSSSSSSTSSDQPPSPSPPFVVKPPEKKQRLPSAYNRFMRDE  121

Query  374  IQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
            IQRIK+ANPEIPHREAFSAAAKNWA YIPN+P+  TS  ++
Sbjct  122  IQRIKSANPEIPHREAFSAAAKNWATYIPNSPTSITSGGHN  162



>dbj|BAK04901.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=200

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/168 (61%), Positives = 119/168 (71%), Gaps = 11/168 (7%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLA--VGIPCKRVLETVTVKCGHCSNLSFLSTRPP---  567
            SMDL  PS EHLCYVRC++CNTVLA  VG+PCKR+++TVTVKCGHC+NLSFLS RPP   
Sbjct  3    SMDLVSPS-EHLCYVRCTYCNTVLALQVGVPCKRLMDTVTVKCGHCNNLSFLSPRPPPMV  61

Query  566  --LQPQCHDHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAY  396
              L P  H H    F   C   +R Q      + +   +  +APFVVKPPEKKHRLPSAY
Sbjct  62   QPLSPNDHHHPMGPF-QGCTDCRRNQPLPPLASPTSSDASPRAPFVVKPPEKKHRLPSAY  120

Query  395  NRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
            NRFM+EEIQRIKAA P+ PHREAFS AAKNWA+  P   S + S SNS
Sbjct  121  NRFMREEIQRIKAAKPDTPHREAFSMAAKNWAKCDPRC-SSTVSTSNS  167



>ref|XP_010519368.1| PREDICTED: protein CRABS CLAW-like isoform X3 [Tarenaya hassleriana]
Length=184

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 121/150 (81%), Gaps = 7/150 (5%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHAN-N  531
            S+HL YVRC+FCNT+LAV +P +R+LETVTVKCGHC NLSFLSTRP LQ  C D H + +
Sbjct  17   SDHLYYVRCNFCNTILAVEMPFRRMLETVTVKCGHCGNLSFLSTRP-LQDPCLDRHLSLS  75

Query  530  FPVSC--NGFKRGQsssssptssep---ssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQR  366
                C  N FK+G SSSSS +S+      SP+ PFVVKPPEKK RLPSAYNRFM+EEIQR
Sbjct  76   LQSFCGNNEFKKGSSSSSSSSSTSSYQPLSPREPFVVKPPEKKQRLPSAYNRFMREEIQR  135

Query  365  IKAANPEIPHREAFSAAAKNWARYIPNTPS  276
            IKAANPEIPHREAFS AAKNWA+YIPN+P+
Sbjct  136  IKAANPEIPHREAFSTAAKNWAKYIPNSPT  165



>ref|NP_001183591.1| uncharacterized protein LOC100502185 [Zea mays]
 gb|ACR37678.1| unknown [Zea mays]
 dbj|BAH83540.1| DL related protein [Zea mays]
 dbj|BAH83542.1| DL related protein [Zea mays]
Length=206

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 119/158 (75%), Gaps = 7/158 (4%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL-QPQCHDHHANN  531
            SEHLCYVRC++CNTVLAVG+PCKR+++TVTVKCGHC+NLS+LS RPP+ QP     H   
Sbjct  7    SEHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNNLSYLSPRPPMVQPLSPTDHPLG  66

Query  530  FPVSCNG----FKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRI  363
             P  C G     +R Q    +  +S   +P+ PFVVKPPEKKHRLPSAYNRFM+EEIQRI
Sbjct  67   -PFQCQGPCSECRRNQPLPLASPTSTDLTPRMPFVVKPPEKKHRLPSAYNRFMREEIQRI  125

Query  362  KAANPEIPHREAFSAAAKNWARYIPN-TPSRSTSESNS  252
            KAA P+IPHREAFS AAKNWA+  P  + + ST+ SNS
Sbjct  126  KAAKPDIPHREAFSMAAKNWAKCDPRCSTTASTATSNS  163



>ref|XP_010519367.1| PREDICTED: protein CRABS CLAW-like isoform X2 [Tarenaya hassleriana]
Length=186

 Score =   185 bits (469),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 120/152 (79%), Gaps = 9/152 (6%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHAN--  534
            S+HL YVRC+FCNT+LAV +P +R+LETVTVKCGHC NLSFLSTRP LQ  C D H +  
Sbjct  17   SDHLYYVRCNFCNTILAVEMPFRRMLETVTVKCGHCGNLSFLSTRP-LQDPCLDRHLSLS  75

Query  533  -NFPVSC--NGFKRGQsssssptssep---ssPKAPFVVKPPEKKHRLPSAYNRFMKEEI  372
                  C  N FK+G SSSSS +S+      SP+ PFVVKPPEKK RLPSAYNRFM+EEI
Sbjct  76   LQMQSFCGNNEFKKGSSSSSSSSSTSSYQPLSPREPFVVKPPEKKQRLPSAYNRFMREEI  135

Query  371  QRIKAANPEIPHREAFSAAAKNWARYIPNTPS  276
            QRIKAANPEIPHREAFS AAKNWA+YIPN+P+
Sbjct  136  QRIKAANPEIPHREAFSTAAKNWAKYIPNSPT  167



>ref|XP_008676312.1| PREDICTED: protein DROOPING LEAF isoform X1 [Zea mays]
 tpg|DAA44084.1| TPA: putative YABBY domain transcription factor family protein 
[Zea mays]
Length=207

 Score =   185 bits (470),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 125/167 (75%), Gaps = 7/167 (4%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLA--VGIPCKRVLETVTVKCGHCSNLSFLSTRPPL-QP  558
            MD+    SEHLCYVRC++CNTVLA  VG+PCKR+++TVTVKCGHC+NLS+LS RPP+ QP
Sbjct  1    MDMVS-QSEHLCYVRCTYCNTVLALQVGVPCKRLMDTVTVKCGHCNNLSYLSPRPPMVQP  59

Query  557  QC-HDHHANNFPVS--CNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRF  387
                DH    F     CN  +R Q    +  SS   SP+ PFVVKPPEKKHRLPSAYNRF
Sbjct  60   LSPTDHPLGPFQCQGPCNDCRRNQPLPLASPSSTELSPRMPFVVKPPEKKHRLPSAYNRF  119

Query  386  MKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            M+EEIQRIKAA P+IPHREAFS AAKNWA+  P   + +++E++++A
Sbjct  120  MREEIQRIKAAKPDIPHREAFSMAAKNWAKCDPRCSTAASTETSNSA  166



>dbj|BAI68347.1| hypothetical protein [Asparagus asparagoides]
Length=192

 Score =   184 bits (468),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 131/179 (73%), Gaps = 7/179 (4%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPP-LQPQC  552
            MDL  P  EHLCYVRC++C+TVLAVG+PCKR+++ VTVKCGHC++LS+L+ RP  L P  
Sbjct  1    MDLVTPQ-EHLCYVRCAYCSTVLAVGVPCKRMMDAVTVKCGHCNSLSYLNPRPAGLVPSL  59

Query  551  H--DHHANNFPVSCNGFKRG-QsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMK  381
            +  D+H        N +++G Q   SS TSSE +SPKAP+VVKPPEKKHRLPSAYNRFM+
Sbjct  60   NSSDYHNTGLQSPFNYYRKGHQLLPSSSTSSEDTSPKAPYVVKPPEKKHRLPSAYNRFMR  119

Query  380  EEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN--A*RMEDEATQASL  210
            EEIQRIKAANPE+PHREAFS AAKNWA+Y P      T+E +    A  +E E T   L
Sbjct  120  EEIQRIKAANPEMPHREAFSTAAKNWAKYEPRGLICLTAEKDGTPKAIALEHEKTNGLL  178



>ref|XP_004985190.1| PREDICTED: protein DROOPING LEAF-like [Setaria italica]
Length=195

 Score =   184 bits (467),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 124/165 (75%), Gaps = 8/165 (5%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLA--VGIPCKRVLETVTVKCGHCSNLSFLSTRPPL-QP  558
            MDL    SEHLCYVRC++CNTVLA  VG+PCKR+++TVTVKCGHC+NLS+LS RPP+ QP
Sbjct  1    MDLVS-QSEHLCYVRCTYCNTVLALQVGVPCKRLMDTVTVKCGHCNNLSYLSPRPPMVQP  59

Query  557  QC-HDHHA-NNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFM  384
                DHH    F   CN  +R Q    +  +S+ S  + PFVVKPPEKKHRLPSAYNRFM
Sbjct  60   LSPTDHHPLGPFQGPCNDCRRNQPMPLASPTSDASP-RMPFVVKPPEKKHRLPSAYNRFM  118

Query  383  KEEIQRIKAANPEIPHREAFSAAAKNWARYIPN-TPSRSTSESNS  252
            +EEIQRIKAA P+IPHREAFS AAKNWA+  P  + + ST+ SNS
Sbjct  119  REEIQRIKAAKPDIPHREAFSMAAKNWAKCDPRCSTTVSTATSNS  163



>gb|ACG60679.1| At1g69180 Crabs claw (CRC) transcription factor protein-like 
protein [Brassica oleracea var. alboglabra]
Length=184

 Score =   183 bits (465),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 126/165 (76%), Gaps = 9/165 (5%)
 Frame = -1

Query  755  LQTKEIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLST  576
            +  +E  T    A P +E+L YVRCS CNT+LAVGIP KR+L+TVTVKCGHC NLSFL+T
Sbjct  1    MNLEEKPTMASRALPQAENLYYVRCSICNTILAVGIPMKRMLDTVTVKCGHCGNLSFLTT  60

Query  575  RPPLQPQCHDHHANNFPV-SCNG--FKRGQsssssptsseps--sPKAPFVVKPPEKKHR  411
             PPLQ     H +    + S +G  +K+G SSSSS ++S     SP+ PFVVK PEKK R
Sbjct  61   TPPLQ----GHVSLTLQMQSFDGSEYKKGSSSSSSSSTSSDQPPSPRPPFVVKAPEKKQR  116

Query  410  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPS  276
            LPSAYNRFM++EIQRIK+ANPEIPHREAFSAAAKNWA+YIPN+P+
Sbjct  117  LPSAYNRFMRDEIQRIKSANPEIPHREAFSAAAKNWAKYIPNSPT  161



>gb|AFW89195.1| putative YABBY domain transcription factor family protein [Zea 
mays]
Length=308

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 123/168 (73%), Gaps = 8/168 (5%)
 Frame = -1

Query  737  KTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPL-Q  561
            + SMD     SEHLCYVRC++CNTVLAVG+PCKR+++TVTVKCGHC+NLS+LS RPP+ Q
Sbjct  100  QASMDTVS-QSEHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNNLSYLSPRPPMVQ  158

Query  560  PQCHDHHANNFPVSCNG----FKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYN  393
            P     H    P  C G     +R Q    +  +S   +P+ PFVVKPPEKKHRLPSAYN
Sbjct  159  PLSPTDHPLG-PFQCQGPCSECRRNQPLPLASPTSTDLTPRMPFVVKPPEKKHRLPSAYN  217

Query  392  RFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPN-TPSRSTSESNS  252
            RFM+EEIQRIKAA P+IPHREAFS AAKNWA+  P  + + ST+ SNS
Sbjct  218  RFMREEIQRIKAAKPDIPHREAFSMAAKNWAKCDPRCSTTASTATSNS  265



>ref|XP_009405981.1| PREDICTED: protein DROOPING LEAF-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score =   183 bits (464),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 118/162 (73%), Gaps = 3/162 (2%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQC-  552
            MDL  P+ E LCYVRC++CNTVLAVG+PCKR+++T+TVKCGHC++LSFL  RP +Q    
Sbjct  1    MDLVSPT-EQLCYVRCTYCNTVLAVGVPCKRMMDTITVKCGHCNHLSFLGPRPIVQSLTP  59

Query  551  HDHHANNFPVSCNGFKRGQsssssptssepssPKAP-FVVKPPEKKHRLPSAYNRFMKEE  375
             +HH       C    RGQ S  S ++S     ++P FV+KPPEKKHR+PSAYNRFMKEE
Sbjct  60   TNHHLIGLQGPCTDCLRGQPSPPSSSTSIEQMIQSPQFVMKPPEKKHRMPSAYNRFMKEE  119

Query  374  IQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            IQRIKAA P+IPHREAFS AAKNWA+  P   S   S S++N
Sbjct  120  IQRIKAAKPDIPHREAFSMAAKNWAKCDPRCSSTIVSPSDTN  161



>ref|XP_008785629.1| PREDICTED: protein DROOPING LEAF-like [Phoenix dactylifera]
Length=186

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 119/162 (73%), Gaps = 5/162 (3%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MDLA P +EH+CYV C++CNTVLAVG+P K +++TVTVKCGHC++LSFLS RP +Q  C 
Sbjct  1    MDLA-PPTEHVCYVHCTYCNTVLAVGVPFKWLMDTVTVKCGHCNHLSFLSPRPMMQTLCP  59

Query  548  DHHANNFPVSCNGFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEI  372
              H   F   CN   RGQ SS S + S      KA FVVKPPEKKHRLPSAYNRFMKEEI
Sbjct  60   TDHQMAFQGPCNDCWRGQPSSPSSSISSEQMIPKASFVVKPPEKKHRLPSAYNRFMKEEI  119

Query  371  QRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            QRIKAA P+IPHREAFS AAKNWA+  P+    ST+ S+  A
Sbjct  120  QRIKAAKPDIPHREAFSMAAKNWAKCDPHC---STTTSDGAA  158



>ref|XP_009395243.1| PREDICTED: protein DROOPING LEAF-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   182 bits (462),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 115/161 (71%), Gaps = 2/161 (1%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MDL  P+ EHLCYVRC++CNTVLAVG+PCKR+++TVTVKCGHC++LSFLS RP +Q    
Sbjct  1    MDLVSPT-EHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNHLSFLSPRPLVQSPSP  59

Query  548  DHHANNFPVSCNGFKRGQsssssptssepssPKAP-FVVKPPEKKHRLPSAYNRFMKEEI  372
              +       C    RGQ     P+SS     + P +VVKPPEKKHR+PSAYNRFMKEEI
Sbjct  60   TDYEMGLQGPCTECLRGQPLPPPPSSSSEQMIQKPTYVVKPPEKKHRMPSAYNRFMKEEI  119

Query  371  QRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            QRIKAA P+IPHREAFS AAKNWA+  P   + ++   NS 
Sbjct  120  QRIKAAKPDIPHREAFSMAAKNWAKCDPRCSTIASISGNSK  160



>ref|XP_010519366.1| PREDICTED: protein CRABS CLAW-like isoform X1 [Tarenaya hassleriana]
Length=199

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 123/169 (73%), Gaps = 22/169 (13%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHH----  540
            S+HL YVRC+FCNT+LAV +P +R+LETVTVKCGHC NLSFLSTRP LQ  C D H    
Sbjct  17   SDHLYYVRCNFCNTILAVEMPFRRMLETVTVKCGHCGNLSFLSTRP-LQDPCLDRHLSLS  75

Query  539  ------------ANNFPVSC--NGFKRGQsssssptsseps---sPKAPFVVKPPEKKHR  411
                        A++    C  N FK+G SSSSS +S+      SP+ PFVVKPPEKK R
Sbjct  76   LQVYICIHTHIHAHSLYSFCGNNEFKKGSSSSSSSSSTSSYQPLSPREPFVVKPPEKKQR  135

Query  410  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTS  264
            LPSAYNRFM+EEIQRIKAANPEIPHREAFS AAKNWA+YIPN+P+   S
Sbjct  136  LPSAYNRFMREEIQRIKAANPEIPHREAFSTAAKNWAKYIPNSPTSIAS  184



>emb|CAQ17052.1| crabs claw [Eschscholzia californica]
Length=185

 Score =   179 bits (453),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 121/159 (76%), Gaps = 6/159 (4%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHA--N  534
            +EHLCYVRC++CNT LAVG+PC+R +ETVTVKCG+C+ LSFLSTRP  Q    DH    +
Sbjct  7    TEHLCYVRCNYCNTALAVGVPCRRSVETVTVKCGYCNCLSFLSTRPLTQSPSLDHQMLIS  66

Query  533  NFPVS-CNGFKR-GQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRI  363
             F    C  +++ GQS  SS ++S       APFVVKPPE+KHRLPSAYNRFMKEEIQRI
Sbjct  67   GFHQGFCGDYRKPGQSPMSSSSTSSQPIIPSAPFVVKPPERKHRLPSAYNRFMKEEIQRI  126

Query  362  KAANPEIPHREAFSAAAKNWARYIPN-TPSRSTSESNSN  249
            KAA+P+IPHREAFS AAKNWARY+P+ +P+ S S  + N
Sbjct  127  KAAHPDIPHREAFSTAAKNWARYVPHPSPAGSVSSESIN  165



>ref|XP_008658974.1| PREDICTED: uncharacterized protein LOC100502185 isoform X1 [Zea 
mays]
Length=310

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 123/170 (72%), Gaps = 10/170 (6%)
 Frame = -1

Query  737  KTSMDLAQPSSEHLCYVRCSFCNTVLA--VGIPCKRVLETVTVKCGHCSNLSFLSTRPPL  564
            + SMD     SEHLCYVRC++CNTVLA  VG+PCKR+++TVTVKCGHC+NLS+LS RPP+
Sbjct  100  QASMDTVS-QSEHLCYVRCTYCNTVLALQVGVPCKRLMDTVTVKCGHCNNLSYLSPRPPM  158

Query  563  -QPQCHDHHANNFPVSCNG----FKRGQsssssptssepssPKAPFVVKPPEKKHRLPSA  399
             QP     H    P  C G     +R Q    +  +S   +P+ PFVVKPPEKKHRLPSA
Sbjct  159  VQPLSPTDHPLG-PFQCQGPCSECRRNQPLPLASPTSTDLTPRMPFVVKPPEKKHRLPSA  217

Query  398  YNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPN-TPSRSTSESNS  252
            YNRFM+EEIQRIKAA P+IPHREAFS AAKNWA+  P  + + ST+ SNS
Sbjct  218  YNRFMREEIQRIKAAKPDIPHREAFSMAAKNWAKCDPRCSTTASTATSNS  267



>gb|AAQ11881.1| CRC-related protein [Triticum aestivum]
Length=199

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 119/166 (72%), Gaps = 9/166 (5%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLA--VGIPCKRVLETVTVKCGHCSNLSFLSTRPP----  567
            MDL  PS EHLCYVRC++ NTVL+  VG+PCKR+++TVTVKCGHC+NLSFLS RPP    
Sbjct  1    MDLVSPS-EHLCYVRCTYRNTVLSLQVGVPCKRLMDTVTVKCGHCNNLSFLSPRPPPMVQ  59

Query  566  -LQPQCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNR  390
             L P  H H    F    +  +       +  +S  +SP+APFVVKPPEKKHRLPSAYNR
Sbjct  60   PLSPNDHHHPMGPFQGWTDCRRNQPLPPLASPTSSDASPRAPFVVKPPEKKHRLPSAYNR  119

Query  389  FMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
            FM+EEIQRIKAA P+IPHREAFS AAKNWA+  P   S + S SNS
Sbjct  120  FMREEIQRIKAAKPDIPHREAFSMAAKNWAKCDPRC-SSTVSASNS  164



>ref|XP_009419736.1| PREDICTED: protein DROOPING LEAF-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 118/164 (72%), Gaps = 4/164 (2%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MDL  P ++ LCYVRC++CNTVLAVG+PCKRV++TVTVKCGHCS+LSFLS R  +Q    
Sbjct  1    MDLV-PPTDRLCYVRCTYCNTVLAVGVPCKRVMDTVTVKCGHCSHLSFLSPRATVQSLTP  59

Query  548  DHHANNFPVSCNGFKRGQsssssptss--epssPKAPFVVKPPEKKHRLPSAYNRFMKEE  375
              H       C+   RGQ S  S +S+  E    K  FV+KPPEKKHR+PSAYNRFMKEE
Sbjct  60   TDHRMGLQGPCSDCLRGQPSPPSSSSNSSEQMIQKPRFVMKPPEKKHRMPSAYNRFMKEE  119

Query  374  IQRIKAANPEIPHREAFSAAAKNWARYIPN-TPSRSTSESNSNA  246
            IQRIKAA P+IPHREAFS A+KNWA+  P  + + STS  NS+ 
Sbjct  120  IQRIKAAKPDIPHREAFSMASKNWAKCDPRCSTTISTSSDNSSG  163



>ref|XP_010551365.1| PREDICTED: LOW QUALITY PROTEIN: protein CRABS CLAW [Tarenaya 
hassleriana]
Length=178

 Score =   175 bits (444),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 114/159 (72%), Gaps = 8/159 (5%)
 Frame = -1

Query  704  EHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHANNFP  525
            +HL Y RC+ CNT+LAV IP +R LET TVKCGHC NLSFL+TRPP  P    H +    
Sbjct  10   DHLFYARCTICNTILAVEIPFRRTLETATVKCGHCGNLSFLTTRPPQGPNLDRHLSLTLQ  69

Query  524  VS--CNG--FKRGQsssssptssepssPK----APFVVKPPEKKHRLPSAYNRFMKEEIQ  369
            +   C+   F +G SSSSS +SS  S        PFV KPPEKK RLPSAYNRFM++EIQ
Sbjct  70   MQSFCDTKEFNKGSSSSSSSSSSTSSDQALSPLTPFVAKPPEKKQRLPSAYNRFMRDEIQ  129

Query  368  RIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
            RIKAANPEIPHREAFSAAAKNWA+YIPN+P+  TS   +
Sbjct  130  RIKAANPEIPHREAFSAAAKNWAKYIPNSPTSLTSGGKT  168



>ref|XP_010511942.1| PREDICTED: protein CRABS CLAW [Camelina sativa]
Length=179

 Score =   174 bits (442),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 123/175 (70%), Gaps = 11/175 (6%)
 Frame = -1

Query  761  LDLQTKEIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFL  582
            ++L+ K   TS   +Q  +EHL YVRCS CNT+LAVGIP KR+L+TVTVKCGHC NLSFL
Sbjct  1    MNLEEKPTMTSKASSQ--AEHLYYVRCSICNTILAVGIPLKRMLDTVTVKCGHCGNLSFL  58

Query  581  STRPPLQPQCHDHHANNFPVSCNG---FKRGQsssssptssepssPKAPFVVKPP--EKK  417
            +T PPLQ     H +    +   G   +K+G SSSSS ++S    P           EKK
Sbjct  59   TTSPPLQ----GHVSLTLQMQSFGGSEYKKGSSSSSSSSTSSDQPPPPTPPFVVKPPEKK  114

Query  416  HRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
             RLPSAYNRFM++EIQRIK+ANPEIPHREAFSAAAKNWA+YIPN+P+  TS  N+
Sbjct  115  QRLPSAYNRFMRDEIQRIKSANPEIPHREAFSAAAKNWAKYIPNSPTSITSGGNN  169



>ref|XP_010415547.1| PREDICTED: protein CRABS CLAW-like [Camelina sativa]
Length=179

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 122/175 (70%), Gaps = 11/175 (6%)
 Frame = -1

Query  761  LDLQTKEIKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFL  582
            ++L+ K   TS   +Q  +EHL YVRCS CNT+LAVGIP KR+L+TVTVKCGHC NLSFL
Sbjct  1    MNLEEKPTMTSKASSQ--AEHLYYVRCSICNTILAVGIPLKRMLDTVTVKCGHCGNLSFL  58

Query  581  STRPPLQPQCHDHHANNFPVSCNG---FKRGQsssssptssepssPKAPFVVKPP--EKK  417
            +T PPLQ     H +    +   G   +K+G SSSSS ++S    P           EKK
Sbjct  59   TTSPPLQ----GHVSLTLQMQSFGGSEYKKGSSSSSSSSTSSDQPPPPTPPFVVKPPEKK  114

Query  416  HRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
             RLPSAYNRFM +EIQRIK+ANPEIPHREAFSAAAKNWA+YIPN+P+  TS  N+
Sbjct  115  QRLPSAYNRFMTDEIQRIKSANPEIPHREAFSAAAKNWAKYIPNSPTSITSGGNN  169



>gb|ABW75762.1| CRABS CLAW protein [Betula papyrifera]
Length=125

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 104/128 (81%), Gaps = 8/128 (6%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDH----HANNFPVSCNGF  507
            C TVLAVGIP KR++ETVTVKCGHCSNLSF+STRPPLQ QC DH        F   CN F
Sbjct  1    CYTVLAVGIPFKRLMETVTVKCGHCSNLSFISTRPPLQGQCLDHPMTLQKQGF---CNDF  57

Query  506  KRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  330
            ++GQSSS+S ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE
Sbjct  58   RKGQSSSTSSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  117

Query  329  AFSAAAKN  306
            AFS AAKN
Sbjct  118  AFSTAAKN  125



>gb|ABW75758.1| CRABS CLAW protein [Casuarina stricta]
Length=125

 Score =   170 bits (430),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 105/128 (82%), Gaps = 8/128 (6%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHA----NNFPVSCNGF  507
            C TVLAVGIP KR+L+TVTVKCGHCSNLSF+STRPPLQ QC DH A    + F   CN F
Sbjct  1    CFTVLAVGIPFKRLLDTVTVKCGHCSNLSFISTRPPLQGQCLDHPATLQKHGF---CNDF  57

Query  506  KRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  330
            ++GQ SSSS ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE
Sbjct  58   RKGQPSSSSSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  117

Query  329  AFSAAAKN  306
            AFS AAKN
Sbjct  118  AFSTAAKN  125



>gb|ABW75752.1| CRABS CLAW protein [Physocarpus amurensis]
Length=128

 Score =   170 bits (430),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 104/128 (81%), Gaps = 5/128 (4%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHANNFPVS---CNGF-  507
            CNTVLAVG+P KR+L+TVTVKCGHCSNLSFLSTRPPLQ QC   H  +  +    CN + 
Sbjct  1    CNTVLAVGLPYKRLLDTVTVKCGHCSNLSFLSTRPPLQGQCLPDHLTSLTLQAGCCNDYS  60

Query  506  KRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  330
            K+GQSSSSS   S      KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE
Sbjct  61   KKGQSSSSSSPISSDPPSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  120

Query  329  AFSAAAKN  306
            AFSAAAKN
Sbjct  121  AFSAAAKN  128



>gb|ABW75670.1| CRABS CLAW protein [Chrysolepis chrysophylla]
 gb|ABW75671.1| CRABS CLAW protein [Chrysolepis sempervirens]
Length=124

 Score =   169 bits (429),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 107/127 (84%), Gaps = 7/127 (6%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDH----HANNFPVSCNGF  507
            CNTVLAVGIP KR+L+TVTVKCGHCSNLSF+STRPP+Q QC DH        F   CN F
Sbjct  1    CNTVLAVGIPFKRLLDTVTVKCGHCSNLSFISTRPPVQGQCPDHSLSLQKQGF---CNDF  57

Query  506  KRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREA  327
            ++  SSSSS TSSEP SPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREA
Sbjct  58   RKVHSSSSSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREA  117

Query  326  FSAAAKN  306
            FS AAKN
Sbjct  118  FSTAAKN  124



>ref|XP_009400168.1| PREDICTED: protein DROOPING LEAF-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 119/154 (77%), Gaps = 12/154 (8%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MD   P+ EHLCYVRC++CNTVLAVG+PCK V++T+TV+CGHC++LSFLS+R  +Q    
Sbjct  1    MDSVSPA-EHLCYVRCTYCNTVLAVGVPCKPVMDTITVRCGHCNHLSFLSSRTMVQ----  55

Query  548  DHHANNFPV----SCNGFKRGQsssssptss---epssPKAPFVVKPPEKKHRLPSAYNR  390
             H  N+F +    +C    RGQ+SSSS +SS   E ++ K  FVVKPPEKKHR+PSAYNR
Sbjct  56   SHSCNDFQMGLQGACADCLRGQASSSSSSSSTSSEQTTQKPTFVVKPPEKKHRMPSAYNR  115

Query  389  FMKEEIQRIKAANPEIPHREAFSAAAKNWARYIP  288
            FM+EEIQRIKA+ P+IPHREAFS AAKNWA+  P
Sbjct  116  FMREEIQRIKASKPDIPHREAFSMAAKNWAKCDP  149



>gb|ABW75757.1| CRABS CLAW protein [Alfaroa costaricensis]
Length=124

 Score =   169 bits (428),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 108/129 (84%), Gaps = 11/129 (9%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHANNFPVS------CN  513
            C TVLAVGIP KR+L+TVTVKCGHCSNLSF+STR PLQ QC D      P+S      CN
Sbjct  1    CYTVLAVGIPIKRLLDTVTVKCGHCSNLSFISTRAPLQGQCLD-----LPLSLQKQGFCN  55

Query  512  GFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHR  333
             F++GQSSSSS ++SEP SPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIK+ANPEIPHR
Sbjct  56   DFRKGQSSSSSSSTSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKSANPEIPHR  115

Query  332  EAFSAAAKN  306
            EAFS AAKN
Sbjct  116  EAFSTAAKN  124



>gb|ABW75764.1| CRABS CLAW protein [Betula papyrifera]
Length=125

 Score =   167 bits (424),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 103/128 (80%), Gaps = 8/128 (6%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDH----HANNFPVSCNGF  507
            C TVLAVGIP KR++ETVTVKCGHCSNLSF+STRPPL  QC DH        F   CN F
Sbjct  1    CYTVLAVGIPFKRLMETVTVKCGHCSNLSFISTRPPLPGQCLDHPMTLQKQGF---CNDF  57

Query  506  KRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  330
            ++GQSSSSS ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE
Sbjct  58   RKGQSSSSSSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  117

Query  329  AFSAAAKN  306
            AFS AAKN
Sbjct  118  AFSTAAKN  125



>ref|XP_009415804.1| PREDICTED: protein DROOPING LEAF-like [Musa acuminata subsp. 
malaccensis]
Length=188

 Score =   169 bits (429),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 110/168 (65%), Gaps = 19/168 (11%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MD +   +EH+CYVRCS+CNTVL VG+P KR+++TVTV+CGHC +LSFL         C 
Sbjct  1    MDYSVSPTEHICYVRCSYCNTVLKVGVPSKRMIDTVTVRCGHCDHLSFL---------CP  51

Query  548  DHHANNFPVSCNGFKRG-------QsssssptssepssPKAPFVVKPPEKKHRLPSAYNR  390
              H      +C  + RG          SSS +  E    K PFV KPPEKKHR+PSAYNR
Sbjct  52   SDHQMALQETCTDYIRGIPLSLPPPPPSSSSSLREQIIQKPPFVTKPPEKKHRMPSAYNR  111

Query  389  FMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            FM+EEIQRIKAA P+IPHREAFS A+KNWAR     P RSTS S S A
Sbjct  112  FMREEIQRIKAAKPDIPHREAFSKASKNWAR---CDPRRSTSVSISGA  156



>gb|ABW75715.1| CRABS CLAW protein [Quercus garryana]
 gb|ABW75716.1| CRABS CLAW protein [Quercus garryana]
Length=126

 Score =   167 bits (422),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 100/126 (79%), Positives = 108/126 (86%), Gaps = 3/126 (2%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHAN-NFPVSCNGFKR-  501
            CNTVLAVGIP KR+L+TVTVKCGHCSNLSF+STRPP+Q QC DH  +    + CN F++ 
Sbjct  1    CNTVLAVGIPFKRLLDTVTVKCGHCSNLSFISTRPPVQGQCPDHSLSLQKQIFCNDFRKV  60

Query  500  -GQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAF  324
               SSSSS TSSEP SPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAF
Sbjct  61   HSSSSSSSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAF  120

Query  323  SAAAKN  306
            S AAKN
Sbjct  121  STAAKN  126



>gb|ABW75702.1| CRABS CLAW protein [Quercus agrifolia]
 gb|ABW75703.1| CRABS CLAW protein [Quercus agrifolia]
 gb|ABW75713.1| CRABS CLAW protein [Quercus falcata]
 gb|ABW75714.1| CRABS CLAW protein [Quercus falcata]
 gb|ABW75721.1| CRABS CLAW protein [Quercus marilandica]
 gb|ABW75722.1| CRABS CLAW protein [Quercus marilandica]
 gb|ABW75723.1| CRABS CLAW protein [Quercus marilandica]
 gb|ABW75728.1| CRABS CLAW protein [Quercus nigra]
 gb|ABW75736.1| CRABS CLAW protein [Quercus rubra]
 gb|ABW75737.1| CRABS CLAW protein [Quercus rubra]
 gb|ABW75738.1| CRABS CLAW protein [Quercus rubra]
 gb|ABW75739.1| CRABS CLAW protein [Quercus rubra]
 gb|ABW75740.1| CRABS CLAW protein [Quercus rubra]
Length=125

 Score =   166 bits (421),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 104/125 (83%), Gaps = 2/125 (2%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHANNFPVS-CNGFKRG  498
            CNTVLAVGIP KR+L+TVTVKCGHCSNLSF+STRPP+Q QC DH  +    S CN F++ 
Sbjct  1    CNTVLAVGIPFKRLLDTVTVKCGHCSNLSFISTRPPVQGQCPDHSLSLQKQSFCNDFRKV  60

Query  497  QsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFS  321
             SSSSS ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFS
Sbjct  61   HSSSSSSSTSIEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFS  120

Query  320  AAAKN  306
             AAKN
Sbjct  121  TAAKN  125



>gb|ABW75704.1| CRABS CLAW protein [Quercus alba]
 gb|ABW75705.1| CRABS CLAW protein [Quercus alba]
 gb|ABW75706.1| CRABS CLAW protein [Quercus alba]
 gb|ABW75711.1| CRABS CLAW protein [Quercus dentata]
 gb|ABW75712.1| CRABS CLAW protein [Quercus engelmannii]
 gb|ABW75718.1| CRABS CLAW protein [Quercus griffithii]
 gb|ABW75732.1| CRABS CLAW protein [Quercus robur]
 gb|ABW75733.1| CRABS CLAW protein [Quercus robur]
 gb|ABW75734.1| CRABS CLAW protein [Quercus robur]
 gb|ABW75735.1| CRABS CLAW protein [Quercus robur]
 gb|ABW75741.1| CRABS CLAW protein [Quercus rugosa]
 gb|ABW75742.1| CRABS CLAW protein [Quercus rugosa]
Length=125

 Score =   166 bits (421),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 104/125 (83%), Gaps = 2/125 (2%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHANNFPVS-CNGFKRG  498
            CNTVLAVGIP KR+L+TVTVKCGHCSNLSF+STRPP+Q QC DH  +    S CN F++ 
Sbjct  1    CNTVLAVGIPFKRLLDTVTVKCGHCSNLSFISTRPPVQGQCPDHSLSLQKQSFCNDFRKV  60

Query  497  QsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFS  321
             SSSSS ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFS
Sbjct  61   HSSSSSSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFS  120

Query  320  AAAKN  306
             AAKN
Sbjct  121  TAAKN  125



>gb|ABW75729.1| CRABS CLAW protein [Quercus palustris]
 gb|ABW75730.1| CRABS CLAW protein [Quercus palustris]
 gb|ABW75731.1| CRABS CLAW protein [Quercus palustris]
Length=125

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 103/125 (82%), Gaps = 2/125 (2%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHANNFPVS-CNGFKRG  498
            CNTVLAVGIP KR+L+TVTVKCGHCSNLSF+STRPP+Q QC DH  +    S CN F++ 
Sbjct  1    CNTVLAVGIPFKRLLDTVTVKCGHCSNLSFISTRPPVQGQCPDHSLSLQKQSFCNDFRKV  60

Query  497  QsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFS  321
              SSSS ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFS
Sbjct  61   HPSSSSSSTSIEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFS  120

Query  320  AAAKN  306
             AAKN
Sbjct  121  TAAKN  125



>ref|XP_011081463.1| PREDICTED: protein CRABS CLAW-like [Sesamum indicum]
Length=149

 Score =   166 bits (421),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 105/124 (85%), Gaps = 9/124 (7%)
 Frame = -1

Query  641  KRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHAN-----NFPVSCNGFKRGQ-sssss  480
            +R LETVTVKCGHCSNLSFLS +PP+QPQ +DH        NF   C+ FK+GQ SSSSS
Sbjct  15   ERELETVTVKCGHCSNLSFLSAKPPIQPQFYDHQTTLHQQTNF---CSEFKKGQCSSSSS  71

Query  479  ptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWA  300
             TS+EP SPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIK ANPEIPHREAFSAAAKNWA
Sbjct  72   STSTEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKTANPEIPHREAFSAAAKNWA  131

Query  299  RYIP  288
            RYIP
Sbjct  132  RYIP  135



>gb|ABW75717.1| CRABS CLAW protein [Quercus glauca]
 gb|ABW75724.1| CRABS CLAW protein [Quercus myrsinifolia]
 gb|ABW75725.1| CRABS CLAW protein [Quercus myrsinifolia]
 gb|ABW75727.1| CRABS CLAW protein [Quercus myrsinifolia]
Length=125

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 102/128 (80%), Gaps = 8/128 (6%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDH----HANNFPVSCNGF  507
            CNTVLAVGIP KR+L+TVTVKCGHCSNLSF+STRPP+Q QC DH        F   CN F
Sbjct  1    CNTVLAVGIPFKRLLDTVTVKCGHCSNLSFISTRPPVQGQCPDHSLSLQKQGF---CNDF  57

Query  506  KRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  330
            ++  SSS + ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE
Sbjct  58   RKVHSSSPTSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  117

Query  329  AFSAAAKN  306
            AFS AAKN
Sbjct  118  AFSTAAKN  125



>gb|ABW75690.1| CRABS CLAW protein [Lithocarpus laoticus]
 gb|ABW75691.1| CRABS CLAW protein [Lithocarpus laoticus]
Length=125

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 104/128 (81%), Gaps = 8/128 (6%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDH----HANNFPVSCNGF  507
            CNTVLAVGIP KR+L+TVTVKCGHCSNLSF+STRPP+Q QC DH        F   CN F
Sbjct  1    CNTVLAVGIPFKRLLDTVTVKCGHCSNLSFISTRPPVQGQCPDHSLSLQKQGF---CNDF  57

Query  506  KRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  330
            ++  SSSSS ++S   S  KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE
Sbjct  58   RKVHSSSSSSSTSSEPSSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  117

Query  329  AFSAAAKN  306
            AFS AAKN
Sbjct  118  AFSTAAKN  125



>gb|ABW75674.1| CRABS CLAW protein [Lithocarpus balansae]
 gb|ABW75675.1| CRABS CLAW protein [Lithocarpus balansae]
 gb|ABW75676.1| CRABS CLAW protein [Lithocarpus balansae]
Length=125

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 104/128 (81%), Gaps = 8/128 (6%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDH----HANNFPVSCNGF  507
            CNTVLAVGIP KR+L+TVTVKCGHCSNLSF+STRPP+Q QC DH        F   CN F
Sbjct  1    CNTVLAVGIPFKRLLDTVTVKCGHCSNLSFISTRPPVQGQCPDHSLSLQKQGF---CNDF  57

Query  506  KRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  330
            ++  SSSSS ++S   S  KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE
Sbjct  58   RKVHSSSSSSSTSNEPSSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  117

Query  329  AFSAAAKN  306
            AFS AAKN
Sbjct  118  AFSTAAKN  125



>gb|ABW75649.1| CRABS CLAW protein [Castanea crenata]
 gb|ABW75650.1| CRABS CLAW protein [Castanea crenata]
 gb|ABW75651.1| CRABS CLAW protein [Castanea henryi]
 gb|ABW75652.1| CRABS CLAW protein [Castanea mollissima]
 gb|ABW75653.1| CRABS CLAW protein [Castanea mollissima]
 gb|ABW75654.1| CRABS CLAW protein [Castanea pumila]
 gb|ABW75655.1| CRABS CLAW protein [Castanea sativa]
 gb|ABW75656.1| CRABS CLAW protein [Castanea sativa]
 gb|ABW75657.1| CRABS CLAW protein [Castanea sativa]
 gb|ABW75658.1| CRABS CLAW protein [Castanopsis argyrophylla]
 gb|ABW75659.1| CRABS CLAW protein [Castanopsis argyrophylla]
 gb|ABW75661.1| CRABS CLAW protein [Castanopsis carlesii]
 gb|ABW75662.1| CRABS CLAW protein [Castanopsis carlesii]
 gb|ABW75663.1| CRABS CLAW protein [Castanopsis fissa]
 gb|ABW75664.1| CRABS CLAW protein [Castanopsis fissa]
 gb|ABW75665.1| CRABS CLAW protein [Castanopsis fissa]
 gb|ABW75666.1| CRABS CLAW protein [Castanopsis fissa]
 gb|ABW75667.1| CRABS CLAW protein [Castanopsis fissa]
 gb|ABW75668.1| CRABS CLAW protein [Castanopsis fleuryi]
 gb|ABW75669.1| CRABS CLAW protein [Castanopsis fleuryi]
 gb|ABW75673.1| CRABS CLAW protein [Formanodendron doichangensis]
 gb|ABW75677.1| CRABS CLAW protein [Lithocarpus corneus]
 gb|ABW75678.1| CRABS CLAW protein [Lithocarpus corneus]
 gb|ABW75679.1| CRABS CLAW protein [Lithocarpus corneus]
 gb|ABW75680.1| CRABS CLAW protein [Lithocarpus dealbatus]
 gb|ABW75682.1| CRABS CLAW protein [Lithocarpus dealbatus]
 gb|ABW75683.1| CRABS CLAW protein [Notholithocarpus densiflorus var. echinoides]
 gb|ABW75684.1| CRABS CLAW protein [Notholithocarpus densiflorus var. echinoides]
 gb|ABW75685.1| CRABS CLAW protein [Notholithocarpus densiflorus var. echinoides]
 gb|ABW75686.1| CRABS CLAW protein [Notholithocarpus densiflorus var. densiflorus]
 gb|ABW75687.1| CRABS CLAW protein [Notholithocarpus densiflorus var. densiflorus]
 gb|ABW75688.1| CRABS CLAW protein [Notholithocarpus densiflorus var. densiflorus]
 gb|ABW75692.1| CRABS CLAW protein [Lithocarpus pachylepis]
 gb|ABW75693.1| CRABS CLAW protein [Lithocarpus pachylepis]
 gb|ABW75694.1| CRABS CLAW protein [Lithocarpus revolutus]
 gb|ABW75695.1| CRABS CLAW protein [Lithocarpus revolutus]
 gb|ABW75696.1| CRABS CLAW protein [Lithocarpus ruminatus]
 gb|ABW75697.1| CRABS CLAW protein [Lithocarpus ruminatus]
 gb|ABW75698.1| CRABS CLAW protein [Lithocarpus ruminatus]
 gb|ABW75700.1| CRABS CLAW protein [Lithocarpus turbinatus]
 gb|ABW75701.1| CRABS CLAW protein [Lithocarpus xylocarpus]
 gb|ABW75707.1| CRABS CLAW protein [Quercus baronii]
 gb|ABW75708.1| CRABS CLAW protein [Quercus baronii]
 gb|ABW75709.1| CRABS CLAW protein [Quercus cerris]
 gb|ABW75710.1| CRABS CLAW protein [Quercus cerris]
 gb|ABW75719.1| CRABS CLAW protein [Quercus lamellosa]
 gb|ABW75720.1| CRABS CLAW protein [Quercus lamellosa]
 gb|ABW75743.1| CRABS CLAW protein [Quercus suber]
 gb|ABW75744.1| CRABS CLAW protein [Quercus tomentella]
 gb|ABW75745.1| CRABS CLAW protein [Quercus tomentella]
 gb|ABW75746.1| CRABS CLAW protein [Quercus tomentella]
Length=125

 Score =   165 bits (418),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 103/128 (80%), Gaps = 8/128 (6%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDH----HANNFPVSCNGF  507
            CNTVLAVGIP KR+L+TVTVKCGHCSNLSF+STRPP+Q QC DH        F   CN F
Sbjct  1    CNTVLAVGIPFKRLLDTVTVKCGHCSNLSFISTRPPVQGQCPDHSLSLQKQGF---CNDF  57

Query  506  KRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  330
            ++  SSSSS ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE
Sbjct  58   RKVHSSSSSSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  117

Query  329  AFSAAAKN  306
            AFS AAKN
Sbjct  118  AFSTAAKN  125



>gb|ABW75681.1| CRABS CLAW protein [Lithocarpus dealbatus]
Length=125

 Score =   165 bits (417),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 103/128 (80%), Gaps = 8/128 (6%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDH----HANNFPVSCNGF  507
            CNTVLAVGIP KR+L+TVTVKCGHCSNLSF+STRPP+Q QC DH        F   CN F
Sbjct  1    CNTVLAVGIPFKRLLDTVTVKCGHCSNLSFISTRPPVQGQCPDHSLSLQKQGF---CNDF  57

Query  506  KRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  330
            ++  SSSSS ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE
Sbjct  58   RKIHSSSSSSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  117

Query  329  AFSAAAKN  306
            AFS AAKN
Sbjct  118  AFSTAAKN  125



>gb|ABW75672.1| CRABS CLAW protein [Colombobalanus excelsa]
 gb|ABW75747.1| CRABS CLAW protein [Trigonobalanus verticillata]
 gb|ABW75748.1| CRABS CLAW protein [Trigonobalanus verticillata]
 gb|ABW75749.1| CRABS CLAW protein [Trigonobalanus verticillata]
 gb|ABW75750.1| CRABS CLAW protein [Trigonobalanus verticillata]
Length=125

 Score =   165 bits (417),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 103/128 (80%), Gaps = 8/128 (6%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDH----HANNFPVSCNGF  507
            CNTVLAVGIP KR+L+TVTVKCGHCSNLSF+STRPP+Q QC DH        F   CN F
Sbjct  1    CNTVLAVGIPFKRLLDTVTVKCGHCSNLSFISTRPPVQGQCPDHSLSLQNQGF---CNDF  57

Query  506  KRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  330
            ++  SSSSS ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE
Sbjct  58   RKVHSSSSSSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  117

Query  329  AFSAAAKN  306
            AFS AAKN
Sbjct  118  AFSTAAKN  125



>ref|XP_006856377.1| hypothetical protein AMTR_s00047p00199030 [Amborella trichopoda]
 emb|CAI47004.1| putative crabs claw transcription factor [Amborella trichopoda]
 gb|ERN17844.1| hypothetical protein AMTR_s00047p00199030 [Amborella trichopoda]
Length=196

 Score =   166 bits (421),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 117/157 (75%), Gaps = 0/157 (0%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MD    S++HLCYVRC+FC+T+LAVG+PC+R+++TVTVKCGHCS+LSFLS RP LQ Q  
Sbjct  1    MDFLPGSTDHLCYVRCNFCDTLLAVGVPCRRLMDTVTVKCGHCSHLSFLSARPLLQNQSL  60

Query  548  DHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQ  369
            +  +       N   +  SSSS  T ++   PK P VVKPPEKKHRLPSAYNRFMKEEI+
Sbjct  61   ELLSTQNFCGDNKKSQQSSSSSPLTPNQQVVPKVPNVVKPPEKKHRLPSAYNRFMKEEIK  120

Query  368  RIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSES  258
            RIKA NPEIPHREAFS AAKNWAR+ P     ST+ +
Sbjct  121  RIKAGNPEIPHREAFSMAAKNWARFDPQLLHGSTTST  157



>gb|ABW75699.1| CRABS CLAW protein [Lithocarpus silvicolarum]
Length=125

 Score =   164 bits (415),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 103/128 (80%), Gaps = 8/128 (6%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDH----HANNFPVSCNGF  507
            CNTVLAVGIP KR+L+TVTVKCGHCSNLSF+STRPP+Q QC DH        F   CN F
Sbjct  1    CNTVLAVGIPFKRLLDTVTVKCGHCSNLSFISTRPPVQGQCPDHSLSLQKQGF---CNDF  57

Query  506  KRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  330
            ++  SSSSS ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANP+IPHRE
Sbjct  58   RKVHSSSSSSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPQIPHRE  117

Query  329  AFSAAAKN  306
            AFS AAKN
Sbjct  118  AFSTAAKN  125



>gb|ABW75763.1| CRABS CLAW protein [Betula papyrifera]
Length=125

 Score =   164 bits (414),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 102/128 (80%), Gaps = 8/128 (6%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDH----HANNFPVSCNGF  507
            C TVLAVGIP KR++ETVTVKCGHCSNLSF+S RPPL  QC DH        F   CN F
Sbjct  1    CYTVLAVGIPFKRLMETVTVKCGHCSNLSFISNRPPLPGQCLDHPMTLQKQGF---CNDF  57

Query  506  KRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  330
            ++GQSSSSS ++S      +APFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE
Sbjct  58   RKGQSSSSSSSTSSEPLSPEAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  117

Query  329  AFSAAAKN  306
            AFS AAKN
Sbjct  118  AFSTAAKN  125



>gb|ABW75726.1| CRABS CLAW protein [Quercus myrsinifolia]
Length=125

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 102/128 (80%), Gaps = 8/128 (6%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDH----HANNFPVSCNGF  507
            CNTVLAVGIP KR+L+TVTVKCGHCSNLSF+STRPP+Q QC DH        F   CN F
Sbjct  1    CNTVLAVGIPFKRLLDTVTVKCGHCSNLSFISTRPPVQGQCPDHSLSLQKQGF---CNDF  57

Query  506  KRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  330
            ++  SSS + ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEI+RIKAANPEIPHRE
Sbjct  58   RKVHSSSPTSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIRRIKAANPEIPHRE  117

Query  329  AFSAAAKN  306
            AFS AAKN
Sbjct  118  AFSTAAKN  125



>gb|ABW75660.1| CRABS CLAW protein [Castanopsis carlesii]
Length=125

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 102/128 (80%), Gaps = 8/128 (6%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDH----HANNFPVSCNGF  507
            CNTVLAVGIP KR+L+TVTVKCGHCSNLSF+STRPP+Q QC DH        F   CN F
Sbjct  1    CNTVLAVGIPFKRLLDTVTVKCGHCSNLSFISTRPPVQGQCPDHSLSLQKQGF---CNDF  57

Query  506  KRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHRE  330
            ++  SSSSS ++S      KAPFVVKPPEKKHRLPS YNRFMKEEIQRIKAANPEIPHRE
Sbjct  58   RKVHSSSSSSSTSSEPLSPKAPFVVKPPEKKHRLPSDYNRFMKEEIQRIKAANPEIPHRE  117

Query  329  AFSAAAKN  306
            AFS AAKN
Sbjct  118  AFSTAAKN  125



>gb|ABW75751.1| CRABS CLAW protein [Fagus grandifolia]
 gb|ABW75765.1| CRABS CLAW protein [Fagus grandifolia subsp. mexicana]
Length=125

 Score =   163 bits (412),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 102/125 (82%), Gaps = 2/125 (2%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDH-HANNFPVSCNGFKRG  498
            CNTVLAVGIP KR+L+TVTVKCGHCSNLSF+STRPP+Q QC DH  A       N F++ 
Sbjct  1    CNTVLAVGIPFKRLLDTVTVKCGHCSNLSFISTRPPVQGQCLDHPLALQMQGFGNDFRKV  60

Query  497  QsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFS  321
             SSSSS ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFS
Sbjct  61   HSSSSSTSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFS  120

Query  320  AAAKN  306
             AAKN
Sbjct  121  TAAKN  125



>gb|ABW75760.1| CRABS CLAW protein [Morella cerifera]
Length=126

 Score =   162 bits (411),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 101/131 (77%), Gaps = 13/131 (10%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHANNFPVS------CN  513
            C TVLAVGIP +R+L+TVTVKCGHCSNLSF+STR PLQ QCHD      P++      C+
Sbjct  1    CYTVLAVGIPFRRLLDTVTVKCGHCSNLSFISTRAPLQGQCHD-----LPLTLQKQSFCS  55

Query  512  GFKRGQsssssptssep--ssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIP  339
             FK GQSSSSS  +     S    PFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIP
Sbjct  56   DFKMGQSSSSSSATFSEPLSPKAVPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIP  115

Query  338  HREAFSAAAKN  306
            HREAFS AAKN
Sbjct  116  HREAFSTAAKN  126



>gb|ABW75761.1| CRABS CLAW protein [Ruellia anaticollis]
Length=135

 Score =   159 bits (402),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 98/135 (73%), Gaps = 12/135 (9%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHAN------------N  531
            CNTVLAVGIPCKR++ETVTVKCGHCSNLSFLSTRPP+     DH  N             
Sbjct  1    CNTVLAVGIPCKRLMETVTVKCGHCSNLSFLSTRPPVHQGFIDHQTNLHQTYTEWYCKQV  60

Query  530  FPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAAN  351
            F            SSSS +  +P SPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIK AN
Sbjct  61   FSTEFKKSGTSSLSSSSTSGDQPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKTAN  120

Query  350  PEIPHREAFSAAAKN  306
            PEIPHREAFSAAAKN
Sbjct  121  PEIPHREAFSAAAKN  135



>gb|ABW75759.1| CRABS CLAW protein [Rhoiptelea chiliantha]
Length=125

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 102/130 (78%), Gaps = 12/130 (9%)
 Frame = -1

Query  674  CNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHANNFPVS------CN  513
            C TVLA+GIP KR+L+TVTVKCG CSN+SF+STR PLQ QC D      P++      CN
Sbjct  1    CYTVLALGIPLKRLLDTVTVKCGRCSNISFISTRAPLQGQCLD-----LPLTLQKQGLCN  55

Query  512  GFKRGQsssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPH  336
             F++GQSSSSS ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEI H
Sbjct  56   DFRKGQSSSSSSSASSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEITH  115

Query  335  REAFSAAAKN  306
            REAFS AAKN
Sbjct  116  REAFSTAAKN  125



>dbj|BAJ83622.1| CRC-like YABBY protein [Cabomba caroliniana]
Length=174

 Score =   159 bits (401),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 110/163 (67%), Gaps = 11/163 (7%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRP---------PLQP  558
            SSEHLCYVRC+FC+TVLAVG+P KR+L+TVTVKCGHCSNLSF++T+P         P+ P
Sbjct  6    SSEHLCYVRCNFCSTVLAVGVPRKRLLDTVTVKCGHCSNLSFITTKPAISHATPHSPVDP  65

Query  557  QCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKE  378
               D   +   +S        S+       + S  K   V KPPEKKHRLPSAYNRFM+E
Sbjct  66   L--DITMSLPSLSSTSSSFLSSAILQSADCDESVDKVRHVAKPPEKKHRLPSAYNRFMRE  123

Query  377  EIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            EIQR+KAA+P++ H+EAFS AAKNWAR+ P   +  T+   +N
Sbjct  124  EIQRLKAADPKLTHKEAFSKAAKNWARFDPQLLNIGTTSEINN  166



>ref|XP_009391477.1| PREDICTED: protein DROOPING LEAF-like [Musa acuminata subsp. 
malaccensis]
Length=239

 Score =   160 bits (404),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 109/153 (71%), Gaps = 7/153 (5%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MDL  P  EHLCYVRC++CNTVLAVG+P K +++TVTV+CGHC+++SFLS RP  Q    
Sbjct  53   MDLVSPM-EHLCYVRCTYCNTVLAVGVPSKPMMDTVTVRCGHCNHVSFLSPRPMEQSHSP  111

Query  548  DHHANNFPVSCNGFKRGQsssssptssepssPKAP------FVVKPPEKKHRLPSAYNRF  387
             +H       C    R Q S SS +SS  S+   P      FVVKPPEKKHR+PSAYNRF
Sbjct  112  TNHQLGLQGGCMDCLRSQPSPSSSSSSSSSNSNEPTIQKPSFVVKPPEKKHRMPSAYNRF  171

Query  386  MKEEIQRIKAANPEIPHREAFSAAAKNWARYIP  288
            M+EEIQRIKA+ P+IPHREAFS A+KNWA+  P
Sbjct  172  MREEIQRIKASKPDIPHREAFSMASKNWAKCDP  204



>gb|ABW75689.1| CRABS CLAW protein [Lithocarpus grandifolius]
Length=119

 Score =   153 bits (387),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 97/122 (80%), Gaps = 8/122 (7%)
 Frame = -1

Query  656  VGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDH----HANNFPVSCNGFKRGQss  489
            VGIP KR+L+TVTVKCGHCSNLSF+STRPP+Q QC DH        F   CN F++  SS
Sbjct  1    VGIPFKRLLDTVTVKCGHCSNLSFISTRPPVQGQCPDHSLSLQKQGF---CNDFRKVHSS  57

Query  488  sssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAA  312
            SSS ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFS AA
Sbjct  58   SSSSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSTAA  117

Query  311  KN  306
            KN
Sbjct  118  KN  119



>dbj|BAJ83627.1| CRC-like YABBY protein [Cabomba caroliniana]
Length=174

 Score =   155 bits (392),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 85/166 (51%), Positives = 107/166 (64%), Gaps = 17/166 (10%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHANN  531
            SSEHLCYVRC+FC+TVLAVG+P KR+L+TVTVKCGHCSNLSF++T+P +      H   +
Sbjct  6    SSEHLCYVRCNFCSTVLAVGVPRKRLLDTVTVKCGHCSNLSFITTKPAIS-----HATPH  60

Query  530  FPVS------------CNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRF  387
             PV                     S+       + S  K   V KPPEKKHRLPSAYNRF
Sbjct  61   SPVGPLDITMSLPSLSSTSSSFLSSAILQSADCDESVDKVRHVAKPPEKKHRLPSAYNRF  120

Query  386  MKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            M+EEIQR+KAA+P++ H+ AFS AAKNWAR+ P   +  T+   +N
Sbjct  121  MREEIQRLKAADPKLTHKGAFSKAAKNWARFDPQLLNIGTTSEINN  166



>gb|KDO70311.1| hypothetical protein CISIN_1g046045mg, partial [Citrus sinensis]
Length=119

 Score =   151 bits (382),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 95/121 (79%), Gaps = 6/121 (5%)
 Frame = -1

Query  656  VGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHANNFPVS---CNGFKRGQsss  486
            VGIPCKR+L+TVTVKCGHCSNLSFLSTRPP  PQ     +  F      CN FK G +SS
Sbjct  1    VGIPCKRLLDTVTVKCGHCSNLSFLSTRPP--PQGPSQMSLRFQEKQSFCNDFKLGNASS  58

Query  485  ssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAK  309
            SS ++S      KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFS AAK
Sbjct  59   SSSSTSSEPLSPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSTAAK  118

Query  308  N  306
            N
Sbjct  119  N  119



>gb|EMS61056.1| Protein DROOPING LEAF [Triticum urartu]
Length=220

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 98/141 (70%), Gaps = 8/141 (6%)
 Frame = -1

Query  656  VGIPCKRVLETVTVKCGHCSNLSFLSTRPP-----LQPQCHDHHANNFPVSCNGFKRGQs  492
            VG+PCKR+++TVTVKCGHC+NLSFLS RPP     L P  H H    F   C   +R Q 
Sbjct  49   VGVPCKRLMDTVTVKCGHCNNLSFLSPRPPPMVQPLSPNDHHHPMGPF-QGCTDCRRNQP  107

Query  491  ssssptssepssP-KAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAA  315
                 + +   +  +APFVVKPPEKKHRLPSAYNRFM+EEIQRIKAA P+IPHREAFS A
Sbjct  108  LPPLASPTSSDASPRAPFVVKPPEKKHRLPSAYNRFMREEIQRIKAAKPDIPHREAFSMA  167

Query  314  AKNWARYIPNTPSRSTSESNS  252
            AKNWA+  P   S + S SNS
Sbjct  168  AKNWAKCDPRC-SSTVSASNS  187



>gb|EYU28883.1| hypothetical protein MIMGU_mgv1a018836mg, partial [Erythranthe 
guttata]
Length=121

 Score =   145 bits (365),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 95/125 (76%), Gaps = 14/125 (11%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            MD   PSSEHLCYVRC+FC TVLAVGIPCKR++ETVTVKCGHCSNLSFL+T+PP+Q QC 
Sbjct  1    MDHLAPSSEHLCYVRCNFCTTVLAVGIPCKRLMETVTVKCGHCSNLSFLTTKPPVQGQCF  60

Query  548  D-----HHANNFPVSCNGFKRGQsssssptssepssP-----KAPFVVKPPEKKHRLPSA  399
            D     HH +     C+ FK+G   SSS +S+  S+      +APFVVKPPEKKHRLPSA
Sbjct  61   DQQTILHHQS----LCSEFKKGGLPSSSSSSTSTSTDPSLSPRAPFVVKPPEKKHRLPSA  116

Query  398  YNRFM  384
            YNRFM
Sbjct  117  YNRFM  121



>gb|ADW76862.1| drooping leaf [Cymbidium faberi]
Length=191

 Score =   143 bits (360),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 114/162 (70%), Gaps = 4/162 (2%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLA--VGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQ  555
            MDL   S EHLCYVRC++CNTVLA  VG+PC R+++TVT KCGHC++LSFL+ R  LQ  
Sbjct  1    MDLVS-SREHLCYVRCAYCNTVLALQVGVPCMRLMDTVTGKCGHCNHLSFLNPRRLLQAH  59

Query  554  CHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEE  375
             +      F   CN   +GQ SSSS ++S   +PK+PFVVKPP+KKH LPS YNRFMK+E
Sbjct  60   -YSEQPLGFQDPCNDCGKGQLSSSSSSTSTEQAPKSPFVVKPPKKKHPLPSTYNRFMKKE  118

Query  374  IQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSN  249
            IQRIKA  P+IPH EAF+   KNWA Y P   +   S S++N
Sbjct  119  IQRIKAPEPDIPHTEAFTTTTKNWANYHPRAVNSVNSASDNN  160



>ref|XP_008778120.1| PREDICTED: protein YABBY 2-like isoform X1 [Phoenix dactylifera]
Length=181

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 94/148 (64%), Gaps = 8/148 (5%)
 Frame = -1

Query  719  AQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL------SFLSTRPPLQP  558
            AQ ++EH+CYV C+FCNT+LAV +P   +L  VTV+CGHC+NL        L T P  + 
Sbjct  3    AQITTEHVCYVHCNFCNTILAVSVPGNNLLNVVTVRCGHCTNLLYVNMSGLLQTVPLQEI  62

Query  557  QCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKE  378
            Q H+  + +  V C    +   +S   +         P  ++PPEK+ R+PSAYNRF+KE
Sbjct  63   QAHNVGSEDHRVECGSSSKCSRTSLMYSMLNDQQQTLP--IRPPEKRQRVPSAYNRFIKE  120

Query  377  EIQRIKAANPEIPHREAFSAAAKNWARY  294
            EIQRIKA NP+I HREAFS AAKNWA +
Sbjct  121  EIQRIKANNPDISHREAFSTAAKNWAHF  148



>ref|XP_007202630.1| hypothetical protein PRUPE_ppa012028mg [Prunus persica]
 gb|EMJ03829.1| hypothetical protein PRUPE_ppa012028mg [Prunus persica]
Length=187

 Score =   140 bits (352),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 96/146 (66%), Gaps = 7/146 (5%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL-------SFLSTRPPLQPQC  552
            ++E LCY+ C+FCN VLAV +PC  +L+ VTV+CGHC+NL       +F S  P +Q Q 
Sbjct  8    ATEQLCYIPCNFCNIVLAVSVPCSSLLDIVTVRCGHCTNLWSVNMAAAFQSLWPDVQAQN  67

Query  551  HDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEI  372
            ++++A N+ +      +     ++   +     +   V +PPEK+ R+PSAYN+F+KEEI
Sbjct  68   YNYNAQNYRIESGSSSKCNKKIATRDPTADHVTEERGVNRPPEKRQRVPSAYNQFIKEEI  127

Query  371  QRIKAANPEIPHREAFSAAAKNWARY  294
            QRIKA NP+I HREAFS AAKNWA +
Sbjct  128  QRIKANNPDISHREAFSTAAKNWAHF  153



>gb|EMT28826.1| hypothetical protein F775_30685 [Aegilops tauschii]
Length=223

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/160 (54%), Positives = 101/160 (63%), Gaps = 27/160 (17%)
 Frame = -1

Query  656  VGIPCKRVLETVTVKCGHCSNLSFLSTRP-----PLQPQCHDHHANNFPVSCNGFKRGQ-  495
            VG+PCKR+++TVTVKCGHC+NLSFLS RP     PL P  H H    F   C   +R Q 
Sbjct  49   VGVPCKRLMDTVTVKCGHCNNLSFLSPRPPPMVQPLSPNDHHHPMGPF-QGCTDCRRNQP  107

Query  494  sssssptssepssPKAPFVVKPPEKKHRLPSAYNRFM-------------------KEEI  372
                +  +S  +SP+APFVVKPPEKKHRLPSAYNRFM                   +EEI
Sbjct  108  LPPLASPTSSDASPRAPFVVKPPEKKHRLPSAYNRFMRLIGHGRKCTILVSCCCALREEI  167

Query  371  QRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNS  252
            QRIKAA P+IPHREAFS AAKNWA+  P   S + S SNS
Sbjct  168  QRIKAAKPDIPHREAFSMAAKNWAKCDPRC-SSTVSASNS  206



>ref|XP_004287301.1| PREDICTED: axial regulator YABBY 5-like [Fragaria vesca subsp. 
vesca]
Length=186

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 90/144 (63%), Gaps = 7/144 (5%)
 Frame = -1

Query  704  EHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQC-------HD  546
            E LCY+ C+FCN VLAV +PC  +L+ VTV+CGHC+NL  ++     Q          H+
Sbjct  10   EQLCYIPCNFCNIVLAVSVPCSSLLDIVTVRCGHCTNLWSVNMAAAFQSLSWQDVQAQHN  69

Query  545  HHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQR  366
            H+A N+ +      +G    ++  S          V +PPEK+ R+PSAYN+F+KEEIQR
Sbjct  70   HNAQNYRIDSGSSSKGNKKIATRDSIADHRATEERVNRPPEKRQRVPSAYNQFIKEEIQR  129

Query  365  IKAANPEIPHREAFSAAAKNWARY  294
            IKA NP+I HREAFS AAKNWA +
Sbjct  130  IKANNPDISHREAFSTAAKNWAHF  153



>gb|KHG29380.1| Axial regulator YABBY 1 -like protein [Gossypium arboreum]
Length=207

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 78/175 (45%), Positives = 107/175 (61%), Gaps = 23/175 (13%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHA-  537
            P SE LCYV C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P  +  H  
Sbjct  13   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLMPSANQFHLP  72

Query  536  -NNFPVSCNGFK------------RGQsssssptssepssP--KAPFVVKPPEKKHRLPS  402
             N F  S N  +            +G +S  +  +        + P + +PPEK+ R+PS
Sbjct  73   HNFFTPSHNLLEEISNPSPNILLNQGNTSDITLPTRGVVDELPRPPVINRPPEKRQRVPS  132

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY-------IPNTPSRSTSES  258
            AYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +       +P+ P++ T+ES
Sbjct  133  AYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHFPHIHFGLMPDQPAKRTNES  187



>ref|XP_010905004.1| PREDICTED: protein YABBY 2-like [Elaeis guineensis]
Length=212

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 94/148 (64%), Gaps = 8/148 (5%)
 Frame = -1

Query  719  AQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP------  558
            AQ ++EH+CYV C+FCNT+LAV +P   +L  VTV+CGHC+NL  ++T   LQ       
Sbjct  34   AQITTEHVCYVHCNFCNTILAVSVPGNNLLNIVTVRCGHCTNLLSVNTSGLLQTVALQDL  93

Query  557  QCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKE  378
            Q H+  +  + + C    +   +S   +         P  + PP+K+ R+PSAYNRF+KE
Sbjct  94   QAHNVGSQEYRMECGSSSKCNRASLMHSMLNDQQQTPP--IHPPQKRQRVPSAYNRFIKE  151

Query  377  EIQRIKAANPEIPHREAFSAAAKNWARY  294
            EIQRIKA NP+I HREAFS AAKNWA +
Sbjct  152  EIQRIKANNPDISHREAFSTAAKNWAHF  179



>ref|XP_006445302.1| hypothetical protein CICLE_v10022170mg [Citrus clementina]
 ref|XP_006490878.1| PREDICTED: axial regulator YABBY 1-like [Citrus sinensis]
 gb|ESR58542.1| hypothetical protein CICLE_v10022170mg [Citrus clementina]
 gb|KDO85745.1| hypothetical protein CISIN_1g027215mg [Citrus sinensis]
Length=218

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 94/157 (60%), Gaps = 18/157 (11%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHAN-  534
            SSE LCYV C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P  +  H   
Sbjct  16   SSEQLCYVHCTFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPAANQLHLGH  75

Query  533  -------------NFPVSCNGFK----RGQsssssptssepssPKAPFVVKPPEKKHRLP  405
                         N P +           QS            PK+P V +PPEK+ R+P
Sbjct  76   PFFTPQNLLEEIRNVPANMLMINPPNPADQSVMPVRVVDHQEIPKSPVVNRPPEKRQRVP  135

Query  404  SAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            SAYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  136  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  172



>ref|XP_009393989.1| PREDICTED: protein DROOPING LEAF-like [Musa acuminata subsp. 
malaccensis]
Length=144

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 97/159 (61%), Gaps = 35/159 (22%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQC-  552
            MDL  P+ EHLCY+RC++CNT+LAVG+P + ++++VTV CGHC++LSFL+ R  +Q  C 
Sbjct  1    MDLVSPA-EHLCYIRCTYCNTLLAVGVPRRWLMDSVTVHCGHCNHLSFLNPRDVIQCLCP  59

Query  551  ---HDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPE--------KKHRLP  405
                     +FP  C G                       +++PP         KKHR P
Sbjct  60   AVPQMGFQVHFPGPCTGL----------------------MMEPPSLRSSSSVPKKHRAP  97

Query  404  SAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIP  288
            SAYN FM+EEIQRIKAA P+IPHREAFS AAKNWA+  P
Sbjct  98   SAYNHFMREEIQRIKAAKPDIPHREAFSMAAKNWAKCDP  136



>gb|AGD94962.1| transcription factor YABBY1 [Vitis pseudoreticulata]
Length=210

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 97/160 (61%), Gaps = 14/160 (9%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQC  552
            S D   P+S+ LCYV C+FC+T LAV +PC  + +TVTV+CGHC+NL  ++ R  L P  
Sbjct  8    SPDHLSPTSDQLCYVHCNFCDTALAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPAA  67

Query  551  HDHHANNFPVSCNGF--------------KRGQsssssptssepssPKAPFVVKPPEKKH  414
            +  H  + P S +                +   + +  P       PK P V +PPEK+ 
Sbjct  68   NQLHLGHSPFSPHNLLEEIRSPPSSMLTNQPNPNEAVMPVRGVDEIPKPPVVNRPPEKRQ  127

Query  413  RLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            R+PSAYNRF+K+EIQRIKA NP I HREAFSAAAKNWA +
Sbjct  128  RVPSAYNRFIKDEIQRIKAGNPGISHREAFSAAAKNWAHF  167



>gb|KDO48950.1| hypothetical protein CISIN_1g029862mg [Citrus sinensis]
Length=186

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 100/155 (65%), Gaps = 13/155 (8%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL------SFLSTRP  570
            S+DLA   SE +CYV C++CNT+LAV +PC  +   VTV+CGHC+NL      S L   P
Sbjct  2    SLDLA---SERVCYVHCNYCNTILAVSVPCSSLFNIVTVRCGHCANLLNVNMVSALQAVP  58

Query  569  PLQPQCHDHHAN---NFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSA  399
               PQ    H N   +    C    +    SS+  ++E  +P+ P  ++PPEK+ R+PSA
Sbjct  59   LQDPQLQKQHINLEDSITKDCGSSSKCNKFSSAFETAEHETPRMP-PIRPPEKRQRVPSA  117

Query  398  YNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            YNRF+KEEIQRIKA+NP+I HREAFS AAKNWA +
Sbjct  118  YNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHF  152



>ref|XP_006487832.1| PREDICTED: putative axial regulator YABBY 2-like isoform X1 [Citrus 
sinensis]
Length=186

 Score =   135 bits (341),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 100/155 (65%), Gaps = 13/155 (8%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL------SFLSTRP  570
            S+DL   SSE +CYV C++CNT+LAV +PC  +   VTV+CGHC+NL      S L   P
Sbjct  2    SLDL---SSERVCYVHCNYCNTILAVSVPCSSLFNIVTVRCGHCANLLNVNMVSALQAVP  58

Query  569  PLQPQCHDHHAN---NFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSA  399
               PQ    H N   +    C    +    SS+  ++E  +P+ P  ++PPEK+ R+PSA
Sbjct  59   LQDPQLQKQHINLEDSITKDCGSSSKCNKFSSAFETAEHETPRMP-PIRPPEKRQRVPSA  117

Query  398  YNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            YNRF+KEEIQRIKA+NP+I HREAFS AAKNWA +
Sbjct  118  YNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHF  152



>emb|CDP19940.1| unnamed protein product [Coffea canephora]
Length=214

 Score =   136 bits (343),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 98/157 (62%), Gaps = 14/157 (9%)
 Frame = -1

Query  722  LAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP---QC  552
            LA P +E LCYV C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P   Q 
Sbjct  15   LAAPPTEQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPSANQL  74

Query  551  HDHHA-----------NNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLP  405
            H  H+            N P +    +   + S  P       PK P   +PPEK+ R+P
Sbjct  75   HLGHSFFSPQNLLEELRNTPPNLLINQPNPNESLMPVRGVDELPKPPVANRPPEKRQRVP  134

Query  404  SAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            SAYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  135  SAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  171



>ref|XP_010264212.1| PREDICTED: protein YABBY 4-like [Nelumbo nucifera]
Length=211

 Score =   136 bits (342),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 98/162 (60%), Gaps = 17/162 (10%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQC  552
            S+D   PS E LCYV C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P  
Sbjct  8    SLDHLSPS-EQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPAA  66

Query  551  HDHHANN--FPVSCNGFKR--------------GQsssssptssepssPKAPFVVKPPEK  420
            +  H  N  F  S N  +                  S  S        P+ P V +PPEK
Sbjct  67   NQLHLGNTFFSPSHNFLEEIPSPQPNLLIDQPNPNDSIVSVRGGSDELPRPPAVNRPPEK  126

Query  419  KHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            + R+PSAYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  127  RQRVPSAYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHF  168



>emb|CAN70458.1| hypothetical protein VITISV_031595 [Vitis vinifera]
Length=210

 Score =   135 bits (341),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 97/160 (61%), Gaps = 14/160 (9%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQC  552
            S D   P+S+ LCYV C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P  
Sbjct  8    SPDHLSPTSDQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPAA  67

Query  551  HDHHANNF--------------PVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKH  414
            +  H  +               P S    +   + +  P       PK P V +PPEK+ 
Sbjct  68   NQLHLGHSLFSPHNJLEEIRSPPSSMLTNQPNPNEAVMPVRGVDEIPKPPVVNRPPEKRQ  127

Query  413  RLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            R+PSAYNRF+K+EIQRIKA NP I HREAFSAAAKNWA +
Sbjct  128  RVPSAYNRFIKDEIQRIKAGNPGISHREAFSAAAKNWAHF  167



>ref|XP_010247851.1| PREDICTED: putative axial regulator YABBY 2 isoform X1 [Nelumbo 
nucifera]
Length=184

 Score =   135 bits (339),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 97/152 (64%), Gaps = 9/152 (6%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL------SFLSTRP  570
            S+D+A   SEH+CYV C+FCNT+LAV +P   +   VTV+CGHC+NL      + + + P
Sbjct  2    SLDVA---SEHVCYVNCNFCNTILAVSVPSTSLYNIVTVRCGHCANLLSVNMGALIQSLP  58

Query  569  PLQPQCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNR  390
                Q  +H+++   +S +     + +      +  +       ++PPEK+ R+PSAYNR
Sbjct  59   LQDIQLQNHNSSTGDLSKDSGSSSKCNKVPMLDTAENEQPRMLPIRPPEKRQRVPSAYNR  118

Query  389  FMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            F+KEEIQRIKA+NP+I HREAFS AAKNWA +
Sbjct  119  FIKEEIQRIKASNPDISHREAFSTAAKNWAHF  150



>ref|XP_008242786.1| PREDICTED: axial regulator YABBY 5 [Prunus mume]
Length=188

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 96/147 (65%), Gaps = 8/147 (5%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL-------SFLS-TRPPLQPQ  555
            ++E LCY+ C+FCN VLAV +PC  + + VTV+CGHC+NL       +F S + P +Q Q
Sbjct  8    ATEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSLSWPDVQAQ  67

Query  554  CHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEE  375
             ++++A N+ +      +     ++   +     +   V +PPEK+ R+PSAYN+F+KEE
Sbjct  68   NYNYNAQNYRIESGSSSKCNKKIATRDPTADHVTEERGVNRPPEKRQRVPSAYNQFIKEE  127

Query  374  IQRIKAANPEIPHREAFSAAAKNWARY  294
            IQRIKA NP+I HREAFS AAKNWA +
Sbjct  128  IQRIKANNPDISHREAFSTAAKNWAHF  154



>ref|XP_006295133.1| hypothetical protein CARUB_v10024208mg [Capsella rubella]
 ref|XP_006295134.1| hypothetical protein CARUB_v10024208mg [Capsella rubella]
 gb|EOA28031.1| hypothetical protein CARUB_v10024208mg [Capsella rubella]
 gb|EOA28032.1| hypothetical protein CARUB_v10024208mg [Capsella rubella]
Length=164

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 90/140 (64%), Gaps = 1/140 (1%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH-DHHAN  534
            SSE LCY+ C+FCN VLAV +PC  + + VTV+CGHC+NL  ++    LQ     +  A 
Sbjct  7    SSEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAALQSLSRPNFQAT  66

Query  533  NFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAA  354
            N+ V   G      + +    S  +  +   V +PPEK+ R+PSAYN+F+KEEIQRIKA 
Sbjct  67   NYAVPDYGSTSRGHTKTPSRISTRTITEQRIVNRPPEKRQRVPSAYNQFIKEEIQRIKAN  126

Query  353  NPEIPHREAFSAAAKNWARY  294
            NP+I HREAFS AAKNWA +
Sbjct  127  NPDISHREAFSTAAKNWAHF  146



>emb|CDP09914.1| unnamed protein product [Coffea canephora]
Length=189

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 95/157 (61%), Gaps = 18/157 (11%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP---QCHDHH  540
            SSE LCYV C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P   Q H+H 
Sbjct  20   SSEQLCYVHCNICDTVLAVSVPCTSLFQTVTVRCGHCTNLLPVNMRGLLLPSANQLHNHF  79

Query  539  ANNFPVSCNGF---------------KRGQsssssptssepssPKAPFVVKPPEKKHRLP  405
             + F      F                     +  P +     P+ P + +PPE++ R+P
Sbjct  80   GHTFFSPSPNFLDQISSPTPNFLMNQTTASDFTLPPQTGFSDLPRPPVMNRPPERRQRIP  139

Query  404  SAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            SAYNRF+KEEIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  140  SAYNRFIKEEIQRIKATNPDISHREAFSAAAKNWAHF  176



>ref|XP_009407727.1| PREDICTED: protein YABBY 2-like [Musa acuminata subsp. malaccensis]
Length=181

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/145 (49%), Positives = 95/145 (66%), Gaps = 3/145 (2%)
 Frame = -1

Query  719  AQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP-QCHDH  543
            AQ   EH+CY+ C+FCNT+LAV +P   +   VTV+CGHC+NL  ++    LQ     D 
Sbjct  3    AQIVPEHVCYIHCNFCNTILAVSVPGNSMFNVVTVRCGHCANLLSVNMGALLQAFPIQDF  62

Query  542  HANNFPVSCNGFKRGQsssssptssepssPKAPFVV--KPPEKKHRLPSAYNRFMKEEIQ  369
             A+NF    N  + G SS  + +S      +   +V  +PPEK+ R+PSAYNRF++EEIQ
Sbjct  63   QAHNFGSQSNRLEIGSSSRCNRSSLYSMKDEQQQIVALRPPEKRQRVPSAYNRFIREEIQ  122

Query  368  RIKAANPEIPHREAFSAAAKNWARY  294
            RIKA NP+I H+EAFSAAAKNWA +
Sbjct  123  RIKANNPDISHKEAFSAAAKNWAHF  147



>ref|XP_002280334.1| PREDICTED: axial regulator YABBY 1 isoform X2 [Vitis vinifera]
 emb|CBI38884.3| unnamed protein product [Vitis vinifera]
Length=210

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 97/160 (61%), Gaps = 14/160 (9%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQC  552
            S D   P+S+ LCYV C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P  
Sbjct  8    SPDHLSPTSDQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPAA  67

Query  551  HDHHANNF--------------PVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKH  414
            +  H  +               P S    +   + +  P       PK P V +PPEK+ 
Sbjct  68   NQLHLGHSLFSPHNILEEIRSPPSSMLINQPNPNEAVMPVRGVDEIPKPPVVNRPPEKRQ  127

Query  413  RLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            R+PSAYNRF+K+EIQRIKA NP I HREAFSAAAKNWA +
Sbjct  128  RVPSAYNRFIKDEIQRIKAGNPGISHREAFSAAAKNWAHF  167



>ref|XP_009406691.1| PREDICTED: protein YABBY 2-like [Musa acuminata subsp. malaccensis]
Length=188

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/148 (48%), Positives = 91/148 (61%), Gaps = 8/148 (5%)
 Frame = -1

Query  719  AQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL------SFLSTRPPLQP  558
            AQ + EH+CYV C+FCNT+LAV +P  ++   VTV+CGHC+NL      S L T P    
Sbjct  3    AQVAPEHICYVHCNFCNTILAVSVPGNKLFNMVTVRCGHCANLLSVHMGSVLHTLPLQDL  62

Query  557  QCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKE  378
            Q +    N  P+      +   +S   +         P  V+PPEK+ R+PSAYNRF+KE
Sbjct  63   QTYSIAPNGNPMEYGSSSKYAMTSLMYSMKNDRQQALP--VRPPEKRQRVPSAYNRFIKE  120

Query  377  EIQRIKAANPEIPHREAFSAAAKNWARY  294
            EIQRIKA NP I H+EAFSAAAKNWA +
Sbjct  121  EIQRIKANNPNISHKEAFSAAAKNWAHF  148



>ref|XP_011088989.1| PREDICTED: putative axial regulator YABBY 2 [Sesamum indicum]
 ref|XP_011088990.1| PREDICTED: putative axial regulator YABBY 2 [Sesamum indicum]
Length=185

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 110/192 (57%), Gaps = 24/192 (13%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQC  552
            SM++   +SE +CYV C+FCNT+LAV +PC  +   VTV+CGHC+NL  ++    LQ   
Sbjct  2    SMEM---TSERVCYVHCNFCNTILAVSVPCGSMFTIVTVRCGHCANLLSVNMGALLQ---  55

Query  551  HDHHANNFPVSCNGFKRGQsssssptssepssPKAPFV-----------VKPPEKKHRLP  405
               H  +F +       G+++     SS   S   P             ++PPEK+ R+P
Sbjct  56   -SVHLQDFQLQKQQSVVGEATIRDIGSSSKCSRFGPVPQVDQEQPKAAPIRPPEKRQRVP  114

Query  404  SAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA*RMED--  231
            SAYNRF+KEEIQRIKA+NPEI HREAFS AAKNWA + P+       E N  A +++   
Sbjct  115  SAYNRFIKEEIQRIKASNPEISHREAFSTAAKNWAHF-PHIHFGLKLEGNKQAAKLDHQV  173

Query  230  ---EATQASLGL  204
               E T+ SLG 
Sbjct  174  AAAEGTEKSLGF  185



>ref|XP_010661657.1| PREDICTED: axial regulator YABBY 1 isoform X1 [Vitis vinifera]
Length=211

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 98/161 (61%), Gaps = 15/161 (9%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQC  552
            S D   P+S+ LCYV C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P  
Sbjct  8    SPDHLSPTSDQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPAA  67

Query  551  HDHHANNFPVSCNGFKRGQ---------------sssssptssepssPKAPFVVKPPEKK  417
            +  H  +   S +   + +               + +  P       PK P V +PPEK+
Sbjct  68   NQLHLGHSLFSPHNILQEEIRSPPSSMLINQPNPNEAVMPVRGVDEIPKPPVVNRPPEKR  127

Query  416  HRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
             R+PSAYNRF+K+EIQRIKA NP I HREAFSAAAKNWA +
Sbjct  128  QRVPSAYNRFIKDEIQRIKAGNPGISHREAFSAAAKNWAHF  168



>ref|XP_002266233.1| PREDICTED: protein YABBY 4 [Vitis vinifera]
 emb|CBI31883.3| unnamed protein product [Vitis vinifera]
Length=211

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 94/169 (56%), Gaps = 42/169 (25%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHH--  540
            P SE LCYV C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P  +  H  
Sbjct  13   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNLRGLLLPSANQLHLG  72

Query  539  ---------------------------ANNFPVSCNGFKRGQsssssptssepssPKAPF  441
                                       AN+F VS  G                  P+ P 
Sbjct  73   HAFFSPSHNLLEEIPNPSPNFLINQTTANDFSVSARG-------------GADELPRPPV  119

Query  440  VVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            + +PPEK+ R+PSAYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  120  INRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHF  168



>ref|XP_004306943.1| PREDICTED: axial regulator YABBY 1-like [Fragaria vesca subsp. 
vesca]
Length=218

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 93/156 (60%), Gaps = 19/156 (12%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL------------------SFL  582
            S+ LCYV C+FC+TVLAV +PC  + +TVTV+CGHCSNL                  SF 
Sbjct  20   SDQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCSNLLSVNMRGLLLPAAANLGHSFF  79

Query  581  STRPPLQPQCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPS  402
            + +  LQ +  +  +N F    N     +S        E      P V +PPEK+ R+PS
Sbjct  80   TPQNLLQEEIRNAPSNTFTNQPN-MMMNESFMPMIRGVEEIPKPPPVVNRPPEKRQRVPS  138

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            AYNRF+KEEIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  139  AYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHF  174



>ref|XP_007132510.1| hypothetical protein PHAVU_011G100300g [Phaseolus vulgaris]
 gb|ESW04504.1| hypothetical protein PHAVU_011G100300g [Phaseolus vulgaris]
Length=183

 Score =   133 bits (335),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 108/183 (59%), Gaps = 9/183 (5%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL------SFLSTRPP  567
            M +   ++E +CYV C+FCNT+LAV +P   +L  VTV+CGHC+NL      + L   PP
Sbjct  1    MSMEMMATERVCYVHCNFCNTILAVSVPYSSLLTIVTVRCGHCANLLSVNMGASLQAFPP  60

Query  566  LQPQCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFV--VKPPEKKHRLPSAYN  393
             +PQ    H +    S        S  +   + E    + P +  ++P EK+HR+PSAYN
Sbjct  61   QEPQSQKQHLSFEEPSSKELGSSSSKCNKIAAFEAVEHEQPRIPPIRPTEKRHRVPSAYN  120

Query  392  RFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA*RMEDEATQAS  213
            RF+KEEIQRIKA+NP+I HREAFS+AAKNWA + P+       + NS A   + EA + S
Sbjct  121  RFIKEEIQRIKASNPDISHREAFSSAAKNWAHF-PHIHFGLKLDGNSQAKLDQGEAAEKS  179

Query  212  LGL  204
             G 
Sbjct  180  NGF  182



>gb|AHZ90132.1| YABBY2 [Incarvillea arguta]
Length=172

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 100/166 (60%), Gaps = 23/166 (14%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH--DHHA  537
            +SE +CY+ C+FCNT+L V +PC  +L  VTV+CGHCSNL  ++    L    H  DH  
Sbjct  6    NSERVCYLHCNFCNTILVVNVPCNSMLSLVTVRCGHCSNLLSVNMGALLHHSLHLQDH--  63

Query  536  NNFPVSCNGFKRGQsssssptssepssPKA---------PFVVKPPEKKHRLPSAYNRFM  384
                     F+R QS +    + + S   +         P  ++PPEK+ R+PSAYNRF+
Sbjct  64   ---------FQRQQSLTDVHAAIKDSGSSSSKPEDELPKPTPIRPPEKRQRVPSAYNRFI  114

Query  383  KEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA  246
            KEEIQRIKA+NPEI HREAFSAAAKNWA ++P+       E N  A
Sbjct  115  KEEIQRIKASNPEITHREAFSAAAKNWA-HLPHIHFGMKLEGNKQA  159



>ref|XP_007052113.1| Plant-specific transcription factor YABBY family protein isoform 
1 [Theobroma cacao]
 gb|EOX96270.1| Plant-specific transcription factor YABBY family protein isoform 
1 [Theobroma cacao]
Length=212

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 101/171 (59%), Gaps = 23/171 (13%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP---QCHDHHA  537
            S+ LCYV C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P   Q H  H+
Sbjct  16   SDQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPAANQLHLGHS  75

Query  536  NNFP-------------VSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAY  396
               P             +  N      +   +        PK P V +PPEK+ R+PSAY
Sbjct  76   FFTPQNLLEEIRSAPPNMLINQPNPSDTVMPAIRGGVEEIPKPPVVNRPPEKRQRVPSAY  135

Query  395  NRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY-------IPNTPSRSTS  264
            NRF+K+EIQRIKA NP+I HREAFSAAAKNWA +       +P+ P + T+
Sbjct  136  NRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKTN  186



>ref|XP_003549900.1| PREDICTED: protein YABBY 4-like [Glycine max]
 gb|KHN09788.1| Protein YABBY 5 [Glycine soja]
Length=215

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 96/159 (60%), Gaps = 19/159 (12%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP---QCHDH  543
            P SE LCYV C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P   Q H  
Sbjct  14   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLMPSPTQFHLG  73

Query  542  HA----------------NNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHR  411
            H+                 NF ++   F      S    ++    P+ P   +PPEK+ R
Sbjct  74   HSFFSPSHNLLEEIPNPTPNFLMNQTNFSASHEFSMPARTAADELPRPPITNRPPEKRQR  133

Query  410  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            +PSAYNRF+K+EIQRIK+ NP+I HREAFSAAAKNWA +
Sbjct  134  VPSAYNRFIKDEIQRIKSVNPDITHREAFSAAAKNWAHF  172



>gb|AAO22990.1| YABBY transcription factor CDM51 [Chrysanthemum x morifolium]
Length=220

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 93/160 (58%), Gaps = 20/160 (13%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQ--CHDHH  540
            P+SE LCYV+C+FC+TVLAV +PC  +  TVTV+CGHC+NL  ++ R  L P        
Sbjct  18   PTSEQLCYVQCNFCDTVLAVSVPCGSLFTTVTVRCGHCTNLLSVNMRALLFPASVTTTAA  77

Query  539  ANNFPVSCNGFKRGQssssspts------------------sepssPKAPFVVKPPEKKH  414
            AN F +  N F           +                       PK P   +PPEK+ 
Sbjct  78   ANQFHLGHNFFSAQSLMEEMRNTPANLFLNQPNPNDHFGPVRVDELPKPPVANRPPEKRQ  137

Query  413  RLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            R+PSAYNRF+KEEIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  138  RVPSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHF  177



>ref|NP_001234390.1| FAS protein [Solanum lycopersicum]
 gb|ACD37255.1| FAS protein [Solanum lycopersicum]
 gb|ACD37256.1| FAS protein [Solanum lycopersicum]
Length=177

 Score =   133 bits (334),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 104/159 (65%), Gaps = 20/159 (13%)
 Frame = -1

Query  719  AQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL------SFLSTRP----  570
            + PSSE +CY++C+FCNT+LAV +PC  +L  VTV+CGHC+N+      S +   P    
Sbjct  9    SSPSSERVCYLQCNFCNTILAVSVPCSNMLTLVTVRCGHCANMLSVNIGSLIQALPLQDV  68

Query  569  -PLQPQCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFV------VKPPEKKHR  411
              LQ Q + +  NN   S N    G SSSSS   +  SS  +P +      ++PPEK+ R
Sbjct  69   QKLQRQQYTNVENN---SSNYKAYGSSSSSSSKFNRYSSIVSPQIEPKIPSIRPPEKRQR  125

Query  410  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            +PSAYNRF+KEEIQRIKA+NP+I HREAFS AAKNWA +
Sbjct  126  VPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHF  164



>gb|AAS10177.1| YABBY-like transcription factor GRAMINIFOLIA [Antirrhinum majus]
Length=211

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 96/152 (63%), Gaps = 14/152 (9%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP---QCHDHHA  537
            SE LCYV C+FC+TVLAV +PC  +++TVTV+CGHC+NL  ++ R  L P   Q H  H+
Sbjct  17   SEQLCYVHCNFCDTVLAVSVPCTSLIKTVTVRCGHCTNLLSVNMRGLLLPAANQLHLGHS  76

Query  536  -----------NNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNR  390
                        N P +    +   + S  P       PK P   +PPEK+ R+PSAYNR
Sbjct  77   FFSPQNLLEEIRNSPSNLLMNQPNPNDSMMPVRGLDELPKPPVANRPPEKRQRVPSAYNR  136

Query  389  FMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            F+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  137  FIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  168



>ref|XP_002532573.1| Axial regulator YABBY1, putative [Ricinus communis]
 gb|EEF29807.1| Axial regulator YABBY1, putative [Ricinus communis]
Length=214

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 95/156 (61%), Gaps = 16/156 (10%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHA-  537
            P+SE LCYV C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  + P  +  H  
Sbjct  13   PTSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLILPSANQFHLG  72

Query  536  -----------NNFPVSCNGFKRGQsssss----ptssepssPKAPFVVKPPEKKHRLPS  402
                       +  P     F   Q++ +             P+ P + +PPEK+ R+PS
Sbjct  73   HSFFSPHHNILDEIPNPSPNFLINQTNVNDFSIPTRGMTDELPRPPVINRPPEKRQRVPS  132

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            AYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  133  AYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  168



>ref|XP_009798278.1| PREDICTED: axial regulator YABBY 5-like [Nicotiana sylvestris]
 gb|AII20188.1| FAS protein [Nicotiana tabacum]
Length=190

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 109/189 (58%), Gaps = 14/189 (7%)
 Frame = -1

Query  731  SMDLAQP-SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP-  558
            S+D+    SSE +CYV C+FCNT+LAV +PC  +   VTV+CGHCSNL  +S +  LQP 
Sbjct  2    SLDMTSSISSERVCYVHCNFCNTILAVSVPCSNIFAIVTVRCGHCSNLLSVSMQSSLQPL  61

Query  557  --------QCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPS  402
                    Q    +  N   +C      + +  S     P +      ++PPEK+ R+PS
Sbjct  62   PLQDPQKQQRQQSNVENGSKACGSSSSSKFNRFSAIDYSPQNEPRITPIRPPEKRQRVPS  121

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA---*RMED  231
            AYNRF+KEEIQRIKA+NP+I HR+AFS AAKNWA + P+       ESN  A     +  
Sbjct  122  AYNRFIKEEIQRIKASNPDISHRQAFSTAAKNWAHF-PHIHFGLKLESNKQAKLDHAVAG  180

Query  230  EATQASLGL  204
            E+   SLGL
Sbjct  181  ESPHKSLGL  189



>ref|XP_010090516.1| hypothetical protein L484_017140 [Morus notabilis]
 gb|EXB39665.1| hypothetical protein L484_017140 [Morus notabilis]
Length=190

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 74/155 (48%), Positives = 95/155 (61%), Gaps = 13/155 (8%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL-------SFLSTRP  570
            M L   +SE +CYV C+FCNT+LAV +PC  +   VTV+CGHC NL       + L T P
Sbjct  1    MSLDMMASERVCYVHCNFCNTILAVSVPCSSLFTIVTVRCGHCGNLLSVNMEAASLQTVP  60

Query  569  PLQPQCHDHHANNFPVSCNGFK---RGQsssssptssepssPKAPFVVKPPEKKHRLPSA  399
            P  PQ     + N PV   G        ++       E  +  +P  ++PPEK+ R+PSA
Sbjct  61   PQDPQKQISSSEN-PVKEYGSSSKCNKHANLLESVDHEQPARSSP--IRPPEKRQRVPSA  117

Query  398  YNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            YNRF+KEEIQRIKA+NP+I HREAFS AAKNWA +
Sbjct  118  YNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHF  152



>ref|XP_010263070.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Nelumbo 
nucifera]
Length=183

 Score =   133 bits (334),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 98/152 (64%), Gaps = 9/152 (6%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP--  558
            S+D+A   SEH+CYV C+FCNT+LAV +P   +   VTV+CGHC+NL  ++    LQP  
Sbjct  2    SLDVA---SEHVCYVHCNFCNTILAVSVPSTSLYNVVTVRCGHCANLLSVNMGALLQPLP  58

Query  557  ----QCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNR  390
                Q  +H++++   +       + +  S   +  +       ++PPEK+ R+PSAYNR
Sbjct  59   LQDIQLQNHNSSSEDSTKGSGSSSKCNKVSMLDTAENDQPRMLPMRPPEKRQRVPSAYNR  118

Query  389  FMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            F+KEEIQRIKA+NPEI HREAFS AAKNWA +
Sbjct  119  FIKEEIQRIKASNPEISHREAFSTAAKNWAHF  150



>gb|EYU31966.1| hypothetical protein MIMGU_mgv1a013346mg [Erythranthe guttata]
Length=219

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 111/193 (58%), Gaps = 25/193 (13%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP-----QCHDH  543
            SE LCYV+C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P     Q H  
Sbjct  24   SEQLCYVQCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPAAAPNQLHLG  83

Query  542  HANNFPVSCNGFKRGQsssssptsse-------------pssPKAPFVVKPPEKKHRLPS  402
            H+   P +     R   SS+   +                  PK P   +PPEK+ R+PS
Sbjct  84   HSFFSPQNLLEEIRSSPSSNMLMNQANPNESSLMNIRGIEELPKPPVANRPPEKRQRVPS  143

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY-------IPNTPSRSTSESNSNA*  243
            AYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +       +P+ P +  +E +    
Sbjct  144  AYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKPNEGDDVLM  203

Query  242  RMEDEATQASLGL  204
            +    A  A++G+
Sbjct  204  KDGFLAAAANVGI  216



>ref|XP_010247861.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Nelumbo 
nucifera]
Length=182

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 96/151 (64%), Gaps = 9/151 (6%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL-----SFLSTRPP  567
            S+D+A   SEH+CYV C+FCNT+LAV +P   +   VTV+CGHC+NL       L    P
Sbjct  2    SLDVA---SEHVCYVNCNFCNTILAVSVPSTSLYNIVTVRCGHCANLLSVNMGALIQSLP  58

Query  566  LQPQCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRF  387
            LQ    +H+++   +S +     + +      +  +       ++PPEK+ R+PSAYNRF
Sbjct  59   LQ-DIQNHNSSTGDLSKDSGSSSKCNKVPMLDTAENEQPRMLPIRPPEKRQRVPSAYNRF  117

Query  386  MKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            +KEEIQRIKA+NP+I HREAFS AAKNWA +
Sbjct  118  IKEEIQRIKASNPDISHREAFSTAAKNWAHF  148



>gb|KHG22928.1| Axial regulator YABBY 1 -like protein [Gossypium arboreum]
Length=220

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 105/172 (61%), Gaps = 24/172 (14%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHH-ANN  531
            S+ LCYV C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++    L P  + HH  ++
Sbjct  16   SDQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMLGLLLPTTNQHHVGHS  75

Query  530  FPVSCNGFKRGQssssspts----------------sepssPKAPFVVKPPEKKHRLPSA  399
            F    N  +  +SS+++                        PK P V +PPEK+ R+PSA
Sbjct  76   FFTPHNLLEEIRSSATTNMVINQPNPNNSLMPPIHGGAEDIPKPPVVNRPPEKRQRVPSA  135

Query  398  YNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY-------IPNTPSRSTS  264
            YNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +       +P+ P + T+
Sbjct  136  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKTN  187



>gb|KDO48952.1| hypothetical protein CISIN_1g029862mg [Citrus sinensis]
Length=184

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 101/153 (66%), Gaps = 11/153 (7%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL------SFLSTRP  570
            S+DLA   SE +CYV C++CNT+LAV +PC  +   VTV+CGHC+NL      S L   P
Sbjct  2    SLDLA---SERVCYVHCNYCNTILAVSVPCSSLFNIVTVRCGHCANLLNVNMVSALQAVP  58

Query  569  PLQPQ-CHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYN  393
               PQ  H +  ++    C    +    SS+  ++E  +P+ P  ++PPEK+ R+PSAYN
Sbjct  59   LQDPQKQHINLEDSITKDCGSSSKCNKFSSAFETAEHETPRMP-PIRPPEKRQRVPSAYN  117

Query  392  RFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            RF+KEEIQRIKA+NP+I HREAFS AAKNWA +
Sbjct  118  RFIKEEIQRIKASNPDISHREAFSTAAKNWAHF  150



>ref|XP_006487833.1| PREDICTED: putative axial regulator YABBY 2-like isoform X2 [Citrus 
sinensis]
Length=184

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 75/153 (49%), Positives = 101/153 (66%), Gaps = 11/153 (7%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL------SFLSTRP  570
            S+DL   SSE +CYV C++CNT+LAV +PC  +   VTV+CGHC+NL      S L   P
Sbjct  2    SLDL---SSERVCYVHCNYCNTILAVSVPCSSLFNIVTVRCGHCANLLNVNMVSALQAVP  58

Query  569  PLQPQ-CHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYN  393
               PQ  H +  ++    C    +    SS+  ++E  +P+ P  ++PPEK+ R+PSAYN
Sbjct  59   LQDPQKQHINLEDSITKDCGSSSKCNKFSSAFETAEHETPRMP-PIRPPEKRQRVPSAYN  117

Query  392  RFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            RF+KEEIQRIKA+NP+I HREAFS AAKNWA +
Sbjct  118  RFIKEEIQRIKASNPDISHREAFSTAAKNWAHF  150



>ref|XP_009792036.1| PREDICTED: axial regulator YABBY 5-like isoform X4 [Nicotiana 
sylvestris]
Length=186

 Score =   132 bits (332),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 111/185 (60%), Gaps = 10/185 (5%)
 Frame = -1

Query  731  SMDLA-QPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQ  555
            S+D+    SSE +CYV C+FCNT+LAV +PC  ++  VTV+CGHC+NL  ++    LQ  
Sbjct  2    SLDITYSSSSERVCYVHCNFCNTILAVSVPCSGIMTIVTVRCGHCANLLSVNIGSLLQSL  61

Query  554  -CHDHHANNFPVSCNGFKRGQsssssptssepssPKAP----FVVKPPEKKHRLPSAYNR  390
               D   +N   +   F    S++    S+  +SP+        ++PPEK+ R+PSAYNR
Sbjct  62   PLQDLQRSNIEDASKAFGSSSSTNYHRFSAIGTSPEDDQPRTMPIRPPEKRQRVPSAYNR  121

Query  389  FMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA---*RMEDEATQ  219
            F+KEEIQRIKA+NP+I HREAFS AAKNWA + P+       E N  A     +  E  Q
Sbjct  122  FIKEEIQRIKASNPDITHREAFSTAAKNWAHF-PHIHFGLKLEGNKQAKLDHAVAGEGPQ  180

Query  218  ASLGL  204
             S+GL
Sbjct  181  KSIGL  185



>dbj|BAQ19377.1| filamentous flower [Sarracenia purpurea]
Length=213

 Score =   133 bits (334),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 76/153 (50%), Positives = 96/153 (63%), Gaps = 14/153 (9%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP---QCHDHH  540
            SSE LCYV C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P   Q H  H
Sbjct  18   SSEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPATNQLHLGH  77

Query  539  ANNFPVSCNGFKRGQsssssptssepssP-----------KAPFVVKPPEKKHRLPSAYN  393
            +   P +     R  SS+       P+             K P   +PPEK+ R+PSAYN
Sbjct  78   SFFSPQNLLEEIRSSSSNLLINQPNPTESVTPVRGVDELPKPPAANRPPEKRQRVPSAYN  137

Query  392  RFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            RF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  138  RFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  170



>gb|KDO48375.1| hypothetical protein CISIN_1g028144mg [Citrus sinensis]
Length=213

 Score =   133 bits (334),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 97/156 (62%), Gaps = 16/156 (10%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHH-A  537
            P+SE LCYV C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P  +  H  
Sbjct  14   PTSEQLCYVHCNLCDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSANQFHLG  73

Query  536  NNF-----------PVSCNGFKRGQsssss----ptssepssPKAPFVVKPPEKKHRLPS  402
            +NF           P     F   Q++++             P+ P   +PPEK+ R+PS
Sbjct  74   HNFFSPSHNLREEIPNPSPNFLINQTNTNDFIVPTRGVVDELPRPPATSRPPEKRQRVPS  133

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            AYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  134  AYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  169



>dbj|BAD83708.1| filamentous flower like protein [Nuphar japonica]
Length=246

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 98/166 (59%), Gaps = 20/166 (12%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQC  552
             +DL     E LCYV C+FCNTVLAV +PC  + + VTV+CGHC+NL  ++ R  LQP  
Sbjct  5    GLDLDHLQPEQLCYVHCNFCNTVLAVSVPCSSLFKMVTVRCGHCTNLLSVNMRALLQPPP  64

Query  551  ---HDHH----ANNFPVSCNGF-------------KRGQsssssptssepssPKAPFVVK  432
                +HH    ++N P   N                 G S  S   +   ++ +   V K
Sbjct  65   PPPQNHHFFPPSDNLPTDENQVAAAAMFLNPSIIKDSGASPVSCAANHTTTTARTTTVNK  124

Query  431  PPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            PPEK+ R+PSAYNRF+K+EIQRIKA NP+I HREAFS AAKNWA +
Sbjct  125  PPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREAFSTAAKNWAHF  170



>ref|XP_006477249.1| PREDICTED: axial regulator YABBY 3-like isoform X2 [Citrus sinensis]
Length=215

 Score =   133 bits (334),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 97/156 (62%), Gaps = 16/156 (10%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHH-A  537
            P+SE LCYV C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P  +  H  
Sbjct  16   PTSEQLCYVHCNLCDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSANQFHLG  75

Query  536  NNF-----------PVSCNGFKRGQsssss----ptssepssPKAPFVVKPPEKKHRLPS  402
            +NF           P     F   Q++++             P+ P   +PPEK+ R+PS
Sbjct  76   HNFFSPSHNLREEIPNPSPNFLINQTNTNDFIVPTRGVVDELPRPPATSRPPEKRQRVPS  135

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            AYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  136  AYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHF  171



>ref|XP_006440374.1| hypothetical protein CICLE_v10021834mg [Citrus clementina]
 gb|ESR53614.1| hypothetical protein CICLE_v10021834mg [Citrus clementina]
Length=215

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 97/156 (62%), Gaps = 16/156 (10%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHH-A  537
            P+SE LCYV C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P  +  H  
Sbjct  16   PTSEQLCYVHCNLCDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSANQFHLG  75

Query  536  NNF-----------PVSCNGFKRGQsssss----ptssepssPKAPFVVKPPEKKHRLPS  402
            +NF           P     F   Q++++             P+ P   +PPEK+ R+PS
Sbjct  76   HNFFSPSHNLREEIPNPSPNFLINQTNTNDFIVPTRGVVDELPRPPATSRPPEKRQRVPS  135

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            AYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  136  AYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  171



>ref|XP_011090395.1| PREDICTED: axial regulator YABBY 1 [Sesamum indicum]
Length=212

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 95/152 (63%), Gaps = 14/152 (9%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP---QCHDHHA  537
            SE LCYV C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P   Q H  H+
Sbjct  18   SEQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPAANQLHLGHS  77

Query  536  -----------NNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNR  390
                        N P +    +   + S  P       PK P   +PPEK+ R+PSAYNR
Sbjct  78   FFSPQNLLEEIRNSPSNLLINQPSPNESLMPVRGIDELPKPPVANRPPEKRQRVPSAYNR  137

Query  389  FMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            F+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  138  FIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  169



>ref|NP_850080.1| axial regulator YABBY 5 [Arabidopsis thaliana]
 ref|NP_850081.1| axial regulator YABBY 5 [Arabidopsis thaliana]
 sp|Q8GW46.1|YAB5_ARATH RecName: Full=Axial regulator YABBY 5 [Arabidopsis thaliana]
 dbj|BAC43665.1| unknown protein [Arabidopsis thaliana]
 gb|AAO39962.1| At2g26580 [Arabidopsis thaliana]
 gb|AEC07860.1| axial regulator YABBY 5 [Arabidopsis thaliana]
 gb|AEC07861.1| axial regulator YABBY 5 [Arabidopsis thaliana]
Length=164

 Score =   131 bits (329),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 89/140 (64%), Gaps = 1/140 (1%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH-DHHAN  534
            ++E LCY+ C+FCN +LAV +PC  + + VTV+CGHC+NL  ++    LQ     +  A 
Sbjct  7    ATEQLCYIPCNFCNIILAVNVPCSSLFDIVTVRCGHCTNLWSVNMAAALQSLSRPNFQAT  66

Query  533  NFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAA  354
            N+ V   G      +      S  +  +   V +PPEK+ R+PSAYN+F+KEEIQRIKA 
Sbjct  67   NYAVPEYGSSSRSHTKIPSRISTRTITEQRIVNRPPEKRQRVPSAYNQFIKEEIQRIKAN  126

Query  353  NPEIPHREAFSAAAKNWARY  294
            NP+I HREAFS AAKNWA +
Sbjct  127  NPDISHREAFSTAAKNWAHF  146



>gb|KDP25628.1| hypothetical protein JCGZ_20784 [Jatropha curcas]
Length=213

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 92/167 (55%), Gaps = 41/167 (25%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHH----  540
            SE LCYV+C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  + P  +  H    
Sbjct  15   SEQLCYVQCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRALILPSANQFHLGHS  74

Query  539  -------------------------ANNFPVSCNGFKRGQsssssptssepssPKAPFVV  435
                                      NNF V   G    +              + P + 
Sbjct  75   FYSPSHNLLDEIPNQTPNFLINQTNVNNFSVPSRGVTHDELP------------RPPVIN  122

Query  434  KPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            +PPEK+ R+PSAYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  123  RPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  169



>ref|XP_002324648.2| hypothetical protein POPTR_0018s12990g [Populus trichocarpa]
 gb|EEF03213.2| hypothetical protein POPTR_0018s12990g [Populus trichocarpa]
Length=188

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/165 (42%), Positives = 102/165 (62%), Gaps = 9/165 (5%)
 Frame = -1

Query  704  EHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP-------QCHD  546
            E LCY+ C+FCN VLAV +PC  + + VTV+CGHC+NL  ++     Q        Q  +
Sbjct  11   EQLCYIPCNFCNIVLAVSVPCSNLFDIVTVRCGHCTNLWSVNMAAAFQSLSWQDHVQASN  70

Query  545  HHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQR  366
            H ++++ +      +  +  S+ T +     +   V +PPEK+ R+PSAYN+F+KEEIQR
Sbjct  71   HISHDYRIDMGSSSKFNNKISTRTPATNIVTQERVVNRPPEKRQRVPSAYNQFIKEEIQR  130

Query  365  IKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA*RMED  231
            IKA NPEI HREAFS AAKNWA + P+       E+N+ A +++D
Sbjct  131  IKANNPEISHREAFSTAAKNWAHF-PHIQFGLMLETNNQA-KLDD  173



>ref|XP_007015607.1| Plant-specific transcription factor YABBY family protein isoform 
1 [Theobroma cacao]
 gb|EOY33226.1| Plant-specific transcription factor YABBY family protein isoform 
1 [Theobroma cacao]
Length=182

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 97/162 (60%), Gaps = 29/162 (18%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQ---  561
            S+DL   SSE +CYV C+FCNT+LAV +PC  +   VTV+CGHC+NL  ++    LQ   
Sbjct  2    SLDL---SSERVCYVHCNFCNTILAVSVPCTSLFNIVTVRCGHCANLLSVNMGTSLQTVP  58

Query  560  -----------PQCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFV--VKPPEK  420
                        Q H +        CN F           + + +  +AP +  ++PPEK
Sbjct  59   IQDAQKEQINTDQDHSNKECGSSSKCNKFS----------AFDSAEHEAPRMPPIRPPEK  108

Query  419  KHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            + R+PSAYNRF+KEEIQRIKA+NP+I HREAFS AAKNWA +
Sbjct  109  RQRVPSAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHF  150



>ref|XP_010053914.1| PREDICTED: axial regulator YABBY 1 [Eucalyptus grandis]
 gb|KCW78296.1| hypothetical protein EUGRSUZ_D02474 [Eucalyptus grandis]
Length=222

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 98/175 (56%), Gaps = 32/175 (18%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHANNF  528
            +E LCYV C++C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P      AN  
Sbjct  26   TEQLCYVHCNYCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGMLLPS-----ANQL  80

Query  527  PVSCNGFKRGQ--------------------sssssptssepssPKAPFVVKPPEKKHRL  408
             +  N F                         S           PK P V +PPEK+ R+
Sbjct  81   QLGHNYFTPQNLLEEIRNAPPSLLINQLSPADSIMQLRGGAEQIPKPPVVNRPPEKRQRV  140

Query  407  PSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY-------IPNTPSRSTS  264
            PSAYNRF+KEEIQRIKA NP+I HREAFSAAAKNWA +       +P+ P + T+
Sbjct  141  PSAYNRFIKEEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKTN  195



>ref|XP_009611999.1| PREDICTED: putative axial regulator YABBY 2 isoform X3 [Nicotiana 
tomentosiformis]
Length=190

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 108/190 (57%), Gaps = 16/190 (8%)
 Frame = -1

Query  731  SMDLA-QPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL------SFLSTR  573
            S+D+   PSSE +CYV C+FCNT+LAV +PC  ++  VTV+CGHC+NL      S L + 
Sbjct  2    SLDITYSPSSERVCYVHCNFCNTMLAVSVPCNSMMTIVTVRCGHCANLLSVNIGSLLQSL  61

Query  572  P--PLQPQCHDHHANNFPVSCNGFKRGQsssssptssepssPKAP--FVVKPPEKKHRLP  405
            P   LQ +       +   +C G     +       +       P    ++PPEK+ R+P
Sbjct  62   PLQDLQQRQQSSIIEDASKAC-GSSSSTNYHRFSAIATTPEDDQPRTMPIRPPEKRQRVP  120

Query  404  SAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA---*RME  234
            SAYNRF+KEEIQRIKA+NP+I HREAFS AAKNWA + P+       E N  A     + 
Sbjct  121  SAYNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHF-PHIHFGLKLEGNKQAKLDHAVA  179

Query  233  DEATQASLGL  204
             E  Q S+GL
Sbjct  180  GEGPQKSIGL  189



>gb|ABW80974.1| YABBY2 [Triticum aestivum]
Length=185

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 91/145 (63%), Gaps = 8/145 (6%)
 Frame = -1

Query  704  EHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQ-PQCHDHHANNF  528
            EH+CYVRC+FCNT+LAV +P   +L  VTV+CGHC++L  ++ R  +Q P   DH   NF
Sbjct  9    EHVCYVRCNFCNTILAVSVPSNSMLNIVTVRCGHCTSLLSVNLRGLIQSPPVQDHSQENF  68

Query  527  P---VSCNG----FKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQ  369
                +S  G    +            S  S  +    ++PPEK+ R+PSAYNRF+KEEI+
Sbjct  69   KAHNISFRGNYPDYGTSSKYRMPMMFSTKSDQEHMLHMRPPEKRQRVPSAYNRFIKEEIR  128

Query  368  RIKAANPEIPHREAFSAAAKNWARY  294
            RIK  NP+I HREAFS AAKNWA +
Sbjct  129  RIKTNNPDISHREAFSTAAKNWAHF  153



>ref|XP_009792035.1| PREDICTED: axial regulator YABBY 5-like isoform X3 [Nicotiana 
sylvestris]
Length=187

 Score =   131 bits (329),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 111/188 (59%), Gaps = 15/188 (8%)
 Frame = -1

Query  731  SMDLA-QPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL------SFLSTR  573
            S+D+    SSE +CYV C+FCNT+LAV +PC  ++  VTV+CGHC+NL      S L + 
Sbjct  2    SLDITYSSSSERVCYVHCNFCNTILAVSVPCSGIMTIVTVRCGHCANLLSVNIGSLLQSL  61

Query  572  P--PLQPQCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSA  399
            P   LQ + +   A+    S +     + S+   +  +      P  ++PPEK+ R+PSA
Sbjct  62   PLQDLQQRSNIEDASKAFGSSSSTNYHRFSAIGTSPEDDQPRTMP--IRPPEKRQRVPSA  119

Query  398  YNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA---*RMEDE  228
            YNRF+KEEIQRIKA+NP+I HREAFS AAKNWA + P+       E N  A     +  E
Sbjct  120  YNRFIKEEIQRIKASNPDITHREAFSTAAKNWAHF-PHIHFGLKLEGNKQAKLDHAVAGE  178

Query  227  ATQASLGL  204
              Q S+GL
Sbjct  179  GPQKSIGL  186



>dbj|BAD72170.1| filamentous flower like protein [Amborella trichopoda]
Length=201

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 95/159 (60%), Gaps = 21/159 (13%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP----QCHDH  543
            +SE LCYV C+FC+TVLAV +PC  + + VTV+CGHC+N+  + TR  L P    Q H  
Sbjct  3    ASEQLCYVHCNFCDTVLAVSVPCSSLFKMVTVRCGHCTNVLSVDTRGLLHPTAATQLHLG  62

Query  542  HANNFPVSCNGFKR----------------GQsssssptssepssPKAPFVVKPPEKKHR  411
            HA   P   N                      + S+S    E  +  +P V +PPEK+ R
Sbjct  63   HAFFSPTPHNLLDECSPPSSLLLDHPLMTPSNTGSASTRLQENEALHSP-VSRPPEKRQR  121

Query  410  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            +PSAYNRF+KEEIQRIKA NP+I HREAFS AAKNWA +
Sbjct  122  VPSAYNRFIKEEIQRIKAGNPDITHREAFSTAAKNWAHF  160



>dbj|BAD72169.1| YABBY5 like protein [Cabomba caroliniana]
Length=170

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 93/139 (67%), Gaps = 6/139 (4%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHANN  531
            +SE +CYV C+FCNT+LAV +PC  +   VTV+CGHC+NL  ++    LQPQ    +  +
Sbjct  4    ASEQVCYVHCNFCNTILAVSVPCTSLFNIVTVRCGHCTNLLPVNMAAMLQPQTFAPY--D  61

Query  530  FPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAAN  351
            +P+  +   +    S     +E S      + +PPEK+ R+PSAYN+F+KEEIQRIKA+N
Sbjct  62   YPLDLSSSSKSNKISQMVKPNEASIA----INRPPEKRQRVPSAYNQFIKEEIQRIKASN  117

Query  350  PEIPHREAFSAAAKNWARY  294
            PEI HREAFS AAKNWA +
Sbjct  118  PEINHREAFSTAAKNWAHF  136



>dbj|BAJ83624.1| YAB5-like YABBY protein [Cabomba caroliniana]
Length=174

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 98/149 (66%), Gaps = 9/149 (6%)
 Frame = -1

Query  740  IKTSMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQ  561
            + + +D+A   SE +CYV C+FCNT+LAV +PC  +   VTV+CGHC+NL  ++    LQ
Sbjct  1    MSSCIDMA---SEQVCYVHCNFCNTILAVSVPCTSLFNIVTVRCGHCTNLLPVNMAAMLQ  57

Query  560  PQCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMK  381
            PQ    +  ++P+  +   +    S     +E S      + +PPEK+ R+PSAYN+F+K
Sbjct  58   PQTFVPY--DYPLDLSSSSKSNKISQMVKPNEASIA----INRPPEKRQRVPSAYNQFIK  111

Query  380  EEIQRIKAANPEIPHREAFSAAAKNWARY  294
            EEIQRIKA+NPEI HREAFS AAKNWA +
Sbjct  112  EEIQRIKASNPEISHREAFSTAAKNWAHF  140



>ref|XP_007039924.1| Plant-specific transcription factor YABBY family protein [Theobroma 
cacao]
 gb|EOY24425.1| Plant-specific transcription factor YABBY family protein [Theobroma 
cacao]
Length=211

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 97/156 (62%), Gaps = 16/156 (10%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHAN  534
            P SE LCYV C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P  +  H  
Sbjct  13   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSANQLHLA  72

Query  533  N--FPVSCN----------GFKRGQsssss----ptssepssPKAPFVVKPPEKKHRLPS  402
            +  F  S N           F   Q++++             P+ P + +PPEK+ R+PS
Sbjct  73   HSFFSPSHNLLEEISNPSQNFLLNQTNTNDFALPTRGVADELPRPPVINRPPEKRQRVPS  132

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            AYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  133  AYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHF  168



>ref|XP_008787013.1| PREDICTED: protein YABBY 4-like [Phoenix dactylifera]
Length=229

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 102/176 (58%), Gaps = 30/176 (17%)
 Frame = -1

Query  731  SMD-LAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQ  555
            S+D L+ P SE LCYV C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P 
Sbjct  9    SLDHLSSPPSEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPA  68

Query  554  CH-----------DHHANNFPVSC------------------NGFKRGQsssssptssep  462
             +            HH     ++C                         ++ +    +E 
Sbjct  69   ANQLGLGHPFLAPSHHNILDEITCPPPSLLMDQPILHNNSSNGNHNHNHNAMAPVKGTEE  128

Query  461  ssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
              P+ P V +PPEK+ R+PSAYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  129  ELPQTPVVNRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHF  184



>gb|EYU31965.1| hypothetical protein MIMGU_mgv1a013346mg [Erythranthe guttata]
Length=223

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 96/156 (62%), Gaps = 18/156 (12%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP-----QCHDH  543
            SE LCYV+C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P     Q H  
Sbjct  24   SEQLCYVQCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPAAAPNQLHLG  83

Query  542  HANNFPVSCNGFKRGQsssssptssepssP-------------KAPFVVKPPEKKHRLPS  402
            H+   P +     R   SS+   +    +              K P   +PPEK+ R+PS
Sbjct  84   HSFFSPQNLLEEIRSSPSSNMLMNQANPNESSLMNIRGIEELPKPPVANRPPEKRQRVPS  143

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            AYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  144  AYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  179



>ref|XP_009792034.1| PREDICTED: axial regulator YABBY 5-like isoform X2 [Nicotiana 
sylvestris]
Length=188

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 111/187 (59%), Gaps = 12/187 (6%)
 Frame = -1

Query  731  SMDLA-QPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP-  558
            S+D+    SSE +CYV C+FCNT+LAV +PC  ++  VTV+CGHC+NL  ++    LQ  
Sbjct  2    SLDITYSSSSERVCYVHCNFCNTILAVSVPCSGIMTIVTVRCGHCANLLSVNIGSLLQSL  61

Query  557  --QCHDHHANNFPVSCNGFKRGQsssssptssepssPKAP----FVVKPPEKKHRLPSAY  396
              Q      +N   +   F    S++    S+  +SP+        ++PPEK+ R+PSAY
Sbjct  62   PLQDLQQQRSNIEDASKAFGSSSSTNYHRFSAIGTSPEDDQPRTMPIRPPEKRQRVPSAY  121

Query  395  NRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA---*RMEDEA  225
            NRF+KEEIQRIKA+NP+I HREAFS AAKNWA + P+       E N  A     +  E 
Sbjct  122  NRFIKEEIQRIKASNPDITHREAFSTAAKNWAHF-PHIHFGLKLEGNKQAKLDHAVAGEG  180

Query  224  TQASLGL  204
             Q S+GL
Sbjct  181  PQKSIGL  187



>ref|XP_009612000.1| PREDICTED: axial regulator YABBY 5-like isoform X4 [Nicotiana 
tomentosiformis]
Length=189

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 109/188 (58%), Gaps = 13/188 (7%)
 Frame = -1

Query  731  SMDLA-QPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQ  555
            S+D+   PSSE +CYV C+FCNT+LAV +PC  ++  VTV+CGHC+NL  ++    LQ  
Sbjct  2    SLDITYSPSSERVCYVHCNFCNTMLAVSVPCNSMMTIVTVRCGHCANLLSVNIGSLLQSL  61

Query  554  -CHDHHANNFPVSCNGFKRGQsssssptssepssPKAP-------FVVKPPEKKHRLPSA  399
               D       +  +  K   SSSS+      +    P         ++PPEK+ R+PSA
Sbjct  62   PLQDLQRQQSSIIEDASKACGSSSSTNYHRFSAIATTPEDDQPRTMPIRPPEKRQRVPSA  121

Query  398  YNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA---*RMEDE  228
            YNRF+KEEIQRIKA+NP+I HREAFS AAKNWA + P+       E N  A     +  E
Sbjct  122  YNRFIKEEIQRIKASNPDISHREAFSTAAKNWAHF-PHIHFGLKLEGNKQAKLDHAVAGE  180

Query  227  ATQASLGL  204
              Q S+GL
Sbjct  181  GPQKSIGL  188



>ref|XP_002308074.1| plant-specific transcription factor YABBY family protein [Populus 
trichocarpa]
 gb|EEE91597.1| plant-specific transcription factor YABBY family protein [Populus 
trichocarpa]
Length=188

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 93/145 (64%), Gaps = 7/145 (5%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL-------SFLSTRPPLQPQCH  549
            +E LCY+ C+FCN VLAV +PC  + + VTV+CGHC+N+       +F S     Q Q  
Sbjct  10   NEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNIWSVNMAAAFQSLSWQDQVQAS  69

Query  548  DHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQ  369
            +++++++ +      +  +  S  T +     +   V +PPEK+ R+PSAYN+F+KEEIQ
Sbjct  70   NYNSHDYRIDLGSSSKCNNKISMRTPAANIVTQERVVNRPPEKRQRVPSAYNQFIKEEIQ  129

Query  368  RIKAANPEIPHREAFSAAAKNWARY  294
            RIKA NP+I HREAFS AAKNWA +
Sbjct  130  RIKANNPDISHREAFSTAAKNWAHF  154



>ref|XP_004487438.1| PREDICTED: putative axial regulator YABBY 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004487439.1| PREDICTED: putative axial regulator YABBY 2-like isoform X2 [Cicer 
arietinum]
Length=184

 Score =   130 bits (327),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 99/152 (65%), Gaps = 7/152 (5%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQ--PQ  555
            M +   ++E +CYV C+FCNT LAV +PC  +L  VTV+CGHC+NL  ++    LQ  P 
Sbjct  1    MSMEMMANERVCYVHCNFCNTTLAVSVPCSSLLTIVTVRCGHCANLLSVNMGASLQSFPP  60

Query  554  CHDHHANNFPVSCN---GFKRGQsssssptssepssPKAPFV--VKPPEKKHRLPSAYNR  390
              DH      +SC+     +   SSSS   + E  + + P    ++PPEK+ R+PSAYNR
Sbjct  61   QQDHPQKQQLLSCHQETSRREVGSSSSKCKAFETVAHEQPRTPPIRPPEKRQRVPSAYNR  120

Query  389  FMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            F+KEEIQRIKA+NP+I HREAFS AAKNWA +
Sbjct  121  FIKEEIQRIKASNPDISHREAFSTAAKNWAHF  152



>ref|XP_011033940.1| PREDICTED: axial regulator YABBY 1 [Populus euphratica]
Length=212

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 100/172 (58%), Gaps = 23/172 (13%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHANN  531
            SS+ LCYV C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L      +  + 
Sbjct  15   SSDQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLFSVTMRSLLPAANQFYLGHG  74

Query  530  F----------------PVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSA  399
            F                P S    +   + S  P       PK P V +PPEK+ R+PSA
Sbjct  75   FFNPQINILEGMRSTGAPPSLMINQPNPNESLMPIRGVEEIPKPPVVNRPPEKRQRVPSA  134

Query  398  YNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY-------IPNTPSRSTS  264
            YNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +       +P+ P + T 
Sbjct  135  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKTD  186



>gb|AAS10179.1| YABBY2-like transcription factor YAB2 [Antirrhinum majus]
Length=186

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 108/181 (60%), Gaps = 15/181 (8%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQC  552
            S+D+   +SE +CYV C+FCNT+LAV +PC  +   VTV+CGHC+NL  ++    LQ   
Sbjct  2    SLDM---TSECVCYVHCNFCNTILAVSVPCSNMFTIVTVRCGHCANLLSVNMGALLQSV-  57

Query  551  HDHHANNFP----VSCNGFKRGQsssssptssepssPKAPFV--VKPPEKKHRLPSAYNR  390
               H  +F             G SS S+  +   +  + P +  ++PPEK+ R+PSAYNR
Sbjct  58   ---HLQDFQKQQHAEAAAKDNGSSSKSNRYAPLQAEHEQPKMPPIRPPEKRQRVPSAYNR  114

Query  389  FMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA*RMEDEATQASL  210
            F+KEEIQRIKA NPEI HREAFS AAKNWA + P+       +SN  A +++D +     
Sbjct  115  FIKEEIQRIKAGNPEISHREAFSTAAKNWAHF-PHIHFGLKLDSNKQA-KLQDHSVAGGS  172

Query  209  G  207
            G
Sbjct  173  G  173



>ref|XP_006840962.1| hypothetical protein AMTR_s00085p00032940 [Amborella trichopoda]
 gb|ERN02637.1| hypothetical protein AMTR_s00085p00032940 [Amborella trichopoda]
Length=211

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 94/158 (59%), Gaps = 21/158 (13%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP----QCHDHH  540
            SE LCYV C+FC+TVLAV +PC  + + VTV+CGHC+N+  + TR  L P    Q H  H
Sbjct  14   SEQLCYVHCNFCDTVLAVSVPCSSLFKMVTVRCGHCTNVLSVDTRGLLHPTAATQLHLGH  73

Query  539  ANNFPVSCNGFKR----------------GQsssssptssepssPKAPFVVKPPEKKHRL  408
            A   P   N                      + S+S    E  +  +P V +PPEK+ R+
Sbjct  74   AFFSPTPHNLLDECSPPSSLLLDHPLMTPSNTGSASTRLQENEALHSP-VSRPPEKRQRV  132

Query  407  PSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            PSAYNRF+KEEIQRIKA NP+I HREAFS AAKNWA +
Sbjct  133  PSAYNRFIKEEIQRIKAGNPDITHREAFSTAAKNWAHF  170



>ref|XP_010056343.1| PREDICTED: axial regulator YABBY 1-like [Eucalyptus grandis]
Length=214

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 93/156 (60%), Gaps = 18/156 (12%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP-----QCHDH  543
            +E LCYV C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P     Q H  
Sbjct  15   NEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRSLLLPPAPANQLHLG  74

Query  542  HA-----------NNFP--VSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPS  402
            H+            N P  +  N     +         E      P V +PPEK+ R+PS
Sbjct  75   HSYFTPQNLLEEIRNVPSNMLMNQTIPNEPMMQLRGGIEDIPKPPPVVNRPPEKRQRVPS  134

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            AYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  135  AYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  170



>ref|XP_002320712.1| abnormal floral organs family protein [Populus trichocarpa]
 gb|EEE99027.1| abnormal floral organs family protein [Populus trichocarpa]
Length=212

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 101/172 (59%), Gaps = 23/172 (13%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHANN  531
            SS+ LCYV C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L      +  + 
Sbjct  15   SSDQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLFSVNMRSLLPAANQFYLGHG  74

Query  530  F----------------PVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSA  399
            F                P S    +   + S  P       PK P V +PPEK+ R+PSA
Sbjct  75   FFNPQINILEGMRSTGAPPSLMINQPNPNESVMPIRGVEEIPKPPVVNRPPEKRQRVPSA  134

Query  398  YNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY-------IPNTPSRSTS  264
            YNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +       +P+ P + T+
Sbjct  135  YNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHFPHIHFGLMPDQPVKKTN  186



>ref|XP_011017779.1| PREDICTED: axial regulator YABBY 5-like [Populus euphratica]
Length=188

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 92/144 (64%), Gaps = 7/144 (5%)
 Frame = -1

Query  704  EHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP-------QCHD  546
            E LCY+ C+FCN VLAV +PC  + + VTV+CGHC+NL  ++     Q        Q  +
Sbjct  11   EQLCYIPCNFCNIVLAVSVPCSNLYDVVTVRCGHCTNLLSVNMAAAFQSLSWQDHVQASN  70

Query  545  HHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQR  366
            H ++++ +      +  +  S+ T +   + +   V +PPEK+ R+PSAYN+F+KEEIQR
Sbjct  71   HISHDYRIDMGSSSKFINKISTRTPATNIATQERVVNRPPEKRQRVPSAYNQFIKEEIQR  130

Query  365  IKAANPEIPHREAFSAAAKNWARY  294
            IKA NPEI HREAFS AAKNWA +
Sbjct  131  IKANNPEISHREAFSTAAKNWAHF  154



>gb|AEK35321.1| YABBY3-like protein [Eschscholzia californica subsp. californica]
Length=219

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 99/167 (59%), Gaps = 21/167 (13%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP--  558
            S+D     SE LCYV C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P  
Sbjct  9    SLDHLSLPSEQLCYVHCNLCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRGLLLPST  68

Query  557  -QCHDHHANNFPVSC----------------NGF--KRGQsssssptssepssPKAPFVV  435
             Q    H+   P +                 N F  ++ Q++S      +    K P   
Sbjct  69   DQLQLTHSFFSPTTTTTTTHNLREEIPSQAPNMFIDQQSQNNSRMQIRGQDELHKPPVAN  128

Query  434  KPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            +PPEK+ R+PSAYNRF+KEEIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  129  RPPEKRQRVPSAYNRFIKEEIQRIKAGNPDITHREAFSAAAKNWAHF  175



>dbj|BAF56419.1| YABBY2 like protein [Ruscus aculeatus]
Length=183

 Score =   130 bits (326),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 101/177 (57%), Gaps = 11/177 (6%)
 Frame = -1

Query  719  AQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL------SFLSTRPPLQP  558
            AQ S EH+CYV C+FCNT+L V +P   +   VT++CGHC+NL      + L   P    
Sbjct  3    AQLSPEHVCYVHCNFCNTILVVNVPGNNLFNIVTIRCGHCANLLSVNMGALLQALPLQDF  62

Query  557  QCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKE  378
            Q H   + +    C+       ++   T       + P  ++ PEK+ R+PSAYNRF+KE
Sbjct  63   QNHQVASQDNRGDCSSSSNCNRTALMFTQEHDQQQRLP--IRSPEKRQRVPSAYNRFIKE  120

Query  377  EIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA*RMEDEATQASLG  207
            EIQRIKA NP+I HREAFSAAAKNWA + P+     T + N  +    DEA  A+ G
Sbjct  121  EIQRIKANNPDISHREAFSAAAKNWAHF-PHIHFGLTLDGNKQS--TLDEAIAAAHG  174



>ref|XP_010685467.1| PREDICTED: putative axial regulator YABBY 2 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=185

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/154 (47%), Positives = 94/154 (61%), Gaps = 11/154 (7%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL--SFLSTRPPLQPQ  555
            MD +  +SE +CYV C+FCNT+LAV +PC      VTV+CGHC+NL    +   PP  P 
Sbjct  1    MDFS--TSERVCYVHCTFCNTILAVSVPCCSTYNLVTVRCGHCANLLSVNIGLSPPSVPH  58

Query  554  C----HDHHANNFPVSCN---GFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAY  396
                 H +H +    S N   G      ++      +      P  ++PPEK+ R+PSAY
Sbjct  59   QDNFQHYNHQDESKDSSNITAGSSSSTITTVGSDQHDDHQQLRPPPIRPPEKRQRVPSAY  118

Query  395  NRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            N+F+KEEIQRIKA+NPEI HREAFSAAAKNWA +
Sbjct  119  NKFIKEEIQRIKASNPEISHREAFSAAAKNWAHF  152



>ref|XP_009792033.1| PREDICTED: axial regulator YABBY 5-like isoform X1 [Nicotiana 
sylvestris]
Length=189

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 84/192 (44%), Positives = 113/192 (59%), Gaps = 21/192 (11%)
 Frame = -1

Query  731  SMDLA-QPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL------SFLSTR  573
            S+D+    SSE +CYV C+FCNT+LAV +PC  ++  VTV+CGHC+NL      S L + 
Sbjct  2    SLDITYSSSSERVCYVHCNFCNTILAVSVPCSGIMTIVTVRCGHCANLLSVNIGSLLQSL  61

Query  572  P--PLQPQCHDHHANNFPVSCNGFKRGQsssssptssepssPKAP----FVVKPPEKKHR  411
            P   LQ Q      +N   +   F    S++    S+  +SP+        ++PPEK+ R
Sbjct  62   PLQDLQKQ----QRSNIEDASKAFGSSSSTNYHRFSAIGTSPEDDQPRTMPIRPPEKRQR  117

Query  410  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA---*R  240
            +PSAYNRF+KEEIQRIKA+NP+I HREAFS AAKNWA + P+       E N  A     
Sbjct  118  VPSAYNRFIKEEIQRIKASNPDITHREAFSTAAKNWAHF-PHIHFGLKLEGNKQAKLDHA  176

Query  239  MEDEATQASLGL  204
            +  E  Q S+GL
Sbjct  177  VAGEGPQKSIGL  188



>ref|XP_004508482.1| PREDICTED: axial regulator YABBY 5-like [Cicer arietinum]
Length=191

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 109/177 (62%), Gaps = 15/177 (8%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP-Q  555
            S+D+A   +E LCY+ C+FCN VLAV +PC  + + VTV+CGHCSNL  ++     Q   
Sbjct  5    SIDVA---TEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCSNLWSVNMAAAFQSLS  61

Query  554  CHDHHANNFPVSC-NGFKRGQsssssptssepssPKAP--------FVVKPPEKKHRLPS  402
              +HH    P  C N   R +S S+S  +   +   AP         V +PPEK+ R+PS
Sbjct  62   WQEHHHLQAPSHCMNPEYRIRSGSTSKCNDRIAMRTAPTTHLTEERVVNRPPEKRQRVPS  121

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPNTPSRSTSESNSNA*RMED  231
            AYN+F+KEEIQRIKA NP+I HREAFS AAKNWA + P+       E+N+ A +ME+
Sbjct  122  AYNQFIKEEIQRIKANNPDISHREAFSTAAKNWAHF-PHIHFGLMLETNNQA-KMEN  176



>ref|XP_006477248.1| PREDICTED: axial regulator YABBY 3-like isoform X1 [Citrus sinensis]
Length=243

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 97/156 (62%), Gaps = 16/156 (10%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHH-A  537
            P+SE LCYV C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P  +  H  
Sbjct  16   PTSEQLCYVHCNLCDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSANQFHLG  75

Query  536  NNF-----------PVSCNGFKRGQsssss----ptssepssPKAPFVVKPPEKKHRLPS  402
            +NF           P     F   Q++++             P+ P   +PPEK+ R+PS
Sbjct  76   HNFFSPSHNLREEIPNPSPNFLINQTNTNDFIVPTRGVVDELPRPPATSRPPEKRQRVPS  135

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            AYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  136  AYNRFIKDEIQRIKAGNPDITHREAFSAAAKNWAHF  171



>ref|XP_011018257.1| PREDICTED: protein YABBY 4-like [Populus euphratica]
Length=214

 Score =   130 bits (327),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 92/170 (54%), Gaps = 42/170 (25%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQC------  552
            P SE LCYV C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R    P        
Sbjct  13   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLYLPSASQFPLG  72

Query  551  ------------------------HDHHANNFPVSCNGFKRGQsssssptssepssPKAP  444
                                    +  H N+F V+  G    +              + P
Sbjct  73   HNFYSPSHNLLDDQIPNPTPSFLMNQTHVNDFSVTVRGMADRELP------------RPP  120

Query  443  FVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
             + +PPEK+ R+PSAYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  121  VINRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  170



>ref|XP_006368172.1| hypothetical protein POPTR_0001s00240g [Populus trichocarpa]
 gb|ERP64741.1| hypothetical protein POPTR_0001s00240g [Populus trichocarpa]
Length=214

 Score =   130 bits (327),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 92/170 (54%), Gaps = 42/170 (25%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQC------  552
            P SE LCYV C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R    P        
Sbjct  13   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLFLPSASQFPLG  72

Query  551  ------------------------HDHHANNFPVSCNGFKRGQsssssptssepssPKAP  444
                                    +  H N+F V+  G    +              + P
Sbjct  73   HNLYSPSHNLLDDQIPNPTPNFLINQTHVNDFSVTVRGMADHELP------------RPP  120

Query  443  FVVKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
             + +PPEK+ R+PSAYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  121  VIHRPPEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  170



>ref|XP_010105229.1| hypothetical protein L484_012344 [Morus notabilis]
 gb|EXC04107.1| hypothetical protein L484_012344 [Morus notabilis]
Length=195

 Score =   130 bits (326),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 96/152 (63%), Gaps = 16/152 (11%)
 Frame = -1

Query  704  EHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP----QCHDHH-  540
            E LCY+ C+FCN VLAV +PC  +L+ VTV+CGHC+NL  ++     Q     Q H HH 
Sbjct  10   EQLCYIPCNFCNIVLAVSVPCSSLLDIVTVRCGHCTNLWSVNMAAAFQSLSWQQDHHHHL  69

Query  539  -ANNFPVSCNGFKRGQsssssptssepssPKAP---------FVVKPPEKKHRLPSAYNR  390
             A N+  +   + R  S SSS  +    + +AP          V +PPEK+ R+PSAYN+
Sbjct  70   QAQNYNYNVPDY-RIDSGSSSRCNVNKLAMRAPNANNVSEERVVNRPPEKRQRVPSAYNQ  128

Query  389  FMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            F+KEEIQRIKA NPEI HREAFS AAKNWA +
Sbjct  129  FIKEEIQRIKANNPEISHREAFSTAAKNWAHF  160



>ref|XP_003525801.1| PREDICTED: protein YABBY 4-like isoform X1 [Glycine max]
 gb|KHN04335.1| Protein YABBY 5 [Glycine soja]
Length=214

 Score =   130 bits (327),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 96/158 (61%), Gaps = 18/158 (11%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP---QCHDH  543
            P SE LCYV C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P   Q H  
Sbjct  14   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLMPSPTQFHLG  73

Query  542  HA---------NNFPVSCNGFKRGQsssssptssepssPKA------PFVVKPPEKKHRL  408
            H+            P     F   Q++ S+       +  A      P + +PPEK+ R+
Sbjct  74   HSFFSPSHNLLEEIPNPSPNFLMNQTNLSASNEFSMPARIAADELPRPIMNRPPEKRQRV  133

Query  407  PSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            PSAYNRF+K+EIQRIK+ NP+I HREAFSAAAKNWA +
Sbjct  134  PSAYNRFIKDEIQRIKSVNPDITHREAFSAAAKNWAHF  171



>gb|KFK43154.1| hypothetical protein AALP_AA1G086900 [Arabis alpina]
Length=184

 Score =   129 bits (325),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 100/160 (63%), Gaps = 22/160 (14%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFL--------ST  576
            SMDL   SSE +CYV C+FC T+LAV +P   +   VTV+CGHC+NL  L        S+
Sbjct  2    SMDL---SSERVCYVHCNFCTTILAVSVPYASLFTLVTVRCGHCTNLLSLNIGVSLHQSS  58

Query  575  RPP----LQPQCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFV--VKPPEKKH  414
             PP    LQP     H  +   S +    G SS ++   SE    +AP +  ++PPEK+ 
Sbjct  59   TPPIHQDLQP-----HKQHITSSVSRKDCGSSSRNTNNFSENIDREAPRMPPIRPPEKRQ  113

Query  413  RLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            R+PSAYNRF+KEEIQRIKA NPEI HREAFS AAKNWA +
Sbjct  114  RVPSAYNRFIKEEIQRIKACNPEISHREAFSTAAKNWAHF  153



>gb|AAS10178.1| YABBY-like transcription factor PROLONGATA [Antirrhinum majus]
Length=186

 Score =   129 bits (325),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 91/148 (61%), Gaps = 11/148 (7%)
 Frame = -1

Query  704  EHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL-----SFLSTRPPLQPQCHD--  546
            E LCY+ C+FC+ VLAV +PC  + + VTV+CGHC+NL     +  +T   LQP   D  
Sbjct  5    EQLCYISCNFCSIVLAVSVPCSSLFDVVTVRCGHCTNLWSVNMAAAATFQSLQPHWQDAV  64

Query  545  -HHANNFPVSCNGFKRGQsssssptssepssPKAP---FVVKPPEKKHRLPSAYNRFMKE  378
             H A N   +      G SS  +   +   S   P    V +PPEK+ R+PSAYN+F+KE
Sbjct  65   VHQAPNHASTEYNVDLGSSSRWNNKMAVQPSITKPEQRIVNRPPEKRQRVPSAYNQFIKE  124

Query  377  EIQRIKAANPEIPHREAFSAAAKNWARY  294
            EIQRIKA NPEI HREAFS AAKNWA +
Sbjct  125  EIQRIKANNPEISHREAFSTAAKNWAHF  152



>gb|AFY26892.1| YABBY2-like transcription factor YAB2 [Morella rubra]
Length=181

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 92/148 (62%), Gaps = 5/148 (3%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQ--P  558
            S+D+   +SE +CYV C+FCNT+LAV +PC  +   VTV+CGHC+NL  ++    LQ  P
Sbjct  2    SLDMMM-ASERVCYVHCNFCNTILAVSVPCSSLFTIVTVRCGHCANLLSVNMGASLQAVP  60

Query  557  QCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKE  378
                   +     C    +    S+  T         P  ++PPEK+ R+PSAYNRF+KE
Sbjct  61   PQDSQKQHVISEDCGSSSKCNKFSAFETVEHEQPRMPP--IRPPEKRQRVPSAYNRFIKE  118

Query  377  EIQRIKAANPEIPHREAFSAAAKNWARY  294
            EIQRIKA+NP+I HREAFS AAKNWA +
Sbjct  119  EIQRIKASNPDISHREAFSTAAKNWAHF  146



>ref|XP_006440375.1| hypothetical protein CICLE_v10021834mg [Citrus clementina]
 gb|ESR53615.1| hypothetical protein CICLE_v10021834mg [Citrus clementina]
Length=252

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 97/156 (62%), Gaps = 16/156 (10%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHH-A  537
            P+SE LCYV C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P  +  H  
Sbjct  16   PTSEQLCYVHCNLCDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSANQFHLG  75

Query  536  NNF-----------PVSCNGFKRGQsssss----ptssepssPKAPFVVKPPEKKHRLPS  402
            +NF           P     F   Q++++             P+ P   +PPEK+ R+PS
Sbjct  76   HNFFSPSHNLREEIPNPSPNFLINQTNTNDFIVPTRGVVDELPRPPATSRPPEKRQRVPS  135

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            AYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  136  AYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  171



>ref|XP_010093672.1| hypothetical protein L484_019011 [Morus notabilis]
 gb|EXB54452.1| hypothetical protein L484_019011 [Morus notabilis]
Length=218

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 95/159 (60%), Gaps = 19/159 (12%)
 Frame = -1

Query  713  PSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHAN  534
            P SE LCYV C+ C+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P  +  H  
Sbjct  15   PPSEQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCTNLLPVNMRGLLLPSANQFHLG  74

Query  533  N-------------FPVSCNGFKRGQsssss------ptssepssPKAPFVVKPPEKKHR  411
            +              P     F   Q++ +         + +    + P + +PPEK+ R
Sbjct  75   HSFFTPSHHNLLEEIPNPTPNFLMNQTNMTDFAVPPRGVAHDHELSRPPVINRPPEKRQR  134

Query  410  LPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            +PSAYNRF+K+EIQRIK+ NP+I HREAFSAAAKNWA +
Sbjct  135  VPSAYNRFIKDEIQRIKSVNPDISHREAFSAAAKNWAHF  173



>ref|XP_011017468.1| PREDICTED: axial regulator YABBY 1 [Populus euphratica]
 ref|XP_011017469.1| PREDICTED: axial regulator YABBY 1 [Populus euphratica]
Length=210

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 92/153 (60%), Gaps = 14/153 (9%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRP--PLQPQCHDHHA  537
            SSE LCYV C+FC+TVLAV +PC  +  TV V+CGHC+NL  +S     P   Q +  H 
Sbjct  15   SSEQLCYVHCNFCDTVLAVSVPCNSLCNTVAVRCGHCTNLLSVSMHGLLPAANQFYLGHG  74

Query  536  ------------NNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYN  393
                        N  P +    +   +    P       PK P V +PPEK+HR+PSAYN
Sbjct  75   FFNPQNILEEIRNGAPPNLLINQPNPNELLIPIRGVEEIPKPPMVNRPPEKRHRVPSAYN  134

Query  392  RFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            RF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  135  RFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  167



>ref|XP_003577247.1| PREDICTED: protein YABBY 6-like isoform X2 [Brachypodium distachyon]
Length=185

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/161 (48%), Positives = 98/161 (61%), Gaps = 23/161 (14%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQ-----PQCHDH  543
            +E +CYV C+FCNTVLAV +P   +L  VTV+CGHC+NL  ++ R  +      P   DH
Sbjct  10   AEQVCYVHCNFCNTVLAVSVPGNSMLSIVTVRCGHCTNLLSVNLRGLMHSSAVVPAAQDH  69

Query  542  HANNFPVSCNGFKRGQsssssptssepssPKAPFVV---------------KPPEKKHRL  408
            H     V  +GF+      SS +SS  S  + P V+               +PPEK+ R+
Sbjct  70   HLQVHGV--DGFRDHPEFGSSSSSSSSSKFRLPMVMFSPQNDLLQEHTLHSRPPEKRQRV  127

Query  407  PSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARYIPN  285
            PSAYNRF+KEEI+RIKA NP+I HREAFS AAKNWA Y PN
Sbjct  128  PSAYNRFIKEEIRRIKANNPDISHREAFSTAAKNWAHY-PN  167



>ref|XP_006409724.1| hypothetical protein EUTSA_v10017320mg [Eutrema salsugineum]
 ref|XP_006409725.1| hypothetical protein EUTSA_v10017320mg [Eutrema salsugineum]
 dbj|BAJ34377.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51177.1| hypothetical protein EUTSA_v10017320mg [Eutrema salsugineum]
 gb|ESQ51178.1| hypothetical protein EUTSA_v10017320mg [Eutrema salsugineum]
Length=164

 Score =   128 bits (322),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 91/146 (62%), Gaps = 1/146 (1%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCH  549
            M  +  ++E LCY+ C+FCN VLAV +PC  + + VTV+CGHC+NL  ++    LQ    
Sbjct  1    MANSATATEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMVAALQSLSR  60

Query  548  -DHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEI  372
             +  A N+ +S +G      +      S  +  +   V +PPEK+ R+ SAYN+F+KEEI
Sbjct  61   PNFQATNYAMSEHGSSSRGHTKIPSRISTRTITEQRVVNRPPEKRQRVRSAYNQFIKEEI  120

Query  371  QRIKAANPEIPHREAFSAAAKNWARY  294
            QRIKA NP I HREAFS AAKNWA +
Sbjct  121  QRIKANNPNISHREAFSTAAKNWAHF  146



>ref|XP_006591839.1| PREDICTED: uncharacterized protein LOC100500091 isoform X1 [Glycine 
max]
Length=185

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/153 (46%), Positives = 95/153 (62%), Gaps = 9/153 (6%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL------SFLSTRPP  567
            M +   ++E +CYV C+FCNT+LAV +P   +L  VTV+CGHC+NL      + L   PP
Sbjct  1    MSMEMMATERVCYVHCNFCNTILAVSVPYSSLLTIVTVRCGHCANLLSVNMGASLQAFPP  60

Query  566  LQPQCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFV--VKPPEKKHRLPSAYN  393
              PQ    H + F    +      S  S     E    + P +  ++P EK+HR+PSAYN
Sbjct  61   QDPQSQKQHLS-FQEPSSKELGSSSKCSKIAPFEAVEHELPRIPPIRPTEKRHRVPSAYN  119

Query  392  RFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            RF+KEEIQRIKA+NP+I HREAFS+AAKNWA +
Sbjct  120  RFIKEEIQRIKASNPDISHREAFSSAAKNWAHF  152



>ref|XP_003517025.1| PREDICTED: axial regulator YABBY 1-like [Glycine max]
 gb|KHN47898.1| Axial regulator YABBY 1 [Glycine soja]
Length=215

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 95/156 (61%), Gaps = 18/156 (12%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP---QCHDHHA  537
            S+ LCYV C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P   Q H  H+
Sbjct  17   SDQLCYVHCNFCDTVLAVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPSANQLHLGHS  76

Query  536  -----------NNFPVSCNGFKR----GQsssssptssepssPKAPFVVKPPEKKHRLPS  402
                        N P +     +         S+       +PK P   +PPEK+ R+PS
Sbjct  77   FFTPQNLLEEIRNAPSTNMMMNQLPNPNDLVMSTMRGGPEETPKPPSANRPPEKRQRVPS  136

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            AYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  137  AYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  172



>ref|XP_009364015.1| PREDICTED: axial regulator YABBY 5-like [Pyrus x bretschneideri]
Length=188

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 96/147 (65%), Gaps = 8/147 (5%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL-------SFLS-TRPPLQPQ  555
            ++E LCY+ C+FC+ VLAV +PC  + + VTV+CGHC+NL       +F S +   +Q Q
Sbjct  8    ATEQLCYIPCNFCSIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSLSWQDVQAQ  67

Query  554  CHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEE  375
             +++++ N+ +      +    +++   +     +   V +PPEK+ R+PSAYN+F+KEE
Sbjct  68   NYNYNSQNYRIDSGSSSKCNKKNATKDPTSDHVTEERGVNRPPEKRQRVPSAYNQFIKEE  127

Query  374  IQRIKAANPEIPHREAFSAAAKNWARY  294
            IQRIKA NP+I HREAFS AAKNWA +
Sbjct  128  IQRIKANNPDISHREAFSTAAKNWAHF  154



>ref|XP_011033925.1| PREDICTED: protein YABBY 4-like [Populus euphratica]
Length=213

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 92/154 (60%), Gaps = 17/154 (11%)
 Frame = -1

Query  704  EHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHA----  537
            E LCYV C+ C+TVLAV +PC  + +TVTV+CGHCSNL  ++ R  L P  +  H     
Sbjct  16   EQLCYVHCNICDTVLAVSVPCTSLFKTVTVRCGHCSNLLPVNMRGLLLPSANQFHLGHSF  75

Query  536  --------NNFPVSCNGFKRGQsssssptssepssP-----KAPFVVKPPEKKHRLPSAY  396
                    +  P     F   Q++ +  +            + P + +PPEK+ R+PSAY
Sbjct  76   FSPSHNLLDEIPNPTPNFLINQTNVNDFSVPVRGMADHELPRPPVINRPPEKRQRVPSAY  135

Query  395  NRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            NRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  136  NRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  169



>ref|NP_001281031.1| axial regulator YABBY 5 [Malus domestica]
 gb|ADL36869.1| YABBY domain class transcription factor [Malus domestica]
Length=188

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 96/147 (65%), Gaps = 8/147 (5%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL-------SFLS-TRPPLQPQ  555
            ++E LCY+ C+FC+ VLAV +PC  + + VTV+CGHC+NL       +F S +   +Q Q
Sbjct  8    ATEQLCYIPCNFCSIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSPSWQDVQAQ  67

Query  554  CHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEE  375
             +++++ N+ +      +    +++   +     +   V +PPEK+ R+PSAYN+F+KEE
Sbjct  68   NYNYNSQNYRIDLGSSSKCNKKNATRDPTSDHVTEERGVNRPPEKRQRVPSAYNQFIKEE  127

Query  374  IQRIKAANPEIPHREAFSAAAKNWARY  294
            IQRIKA NP+I HREAFS AAKNWA +
Sbjct  128  IQRIKANNPDISHREAFSTAAKNWAHF  154



>gb|KDO85746.1| hypothetical protein CISIN_1g027215mg [Citrus sinensis]
Length=226

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 94/165 (57%), Gaps = 26/165 (16%)
 Frame = -1

Query  710  SSEHLCYVRCSFCNTVLAV--------GIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQ  555
            SSE LCYV C+FC+TVLAV         +PC  + +TVTV+CGHC+NL  ++ R  L P 
Sbjct  16   SSEQLCYVHCTFCDTVLAVPYHFIFSVSVPCTSLFKTVTVRCGHCTNLLSVNMRGLLLPA  75

Query  554  CHDHHAN--------------NFPVSCNGFK----RGQsssssptssepssPKAPFVVKP  429
             +  H                N P +           QS            PK+P V +P
Sbjct  76   ANQLHLGHPFFTPQNLLEEIRNVPANMLMINPPNPADQSVMPVRVVDHQEIPKSPVVNRP  135

Query  428  PEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            PEK+ R+PSAYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  136  PEKRQRVPSAYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  180



>ref|XP_010048072.1| PREDICTED: axial regulator YABBY 5 [Eucalyptus grandis]
 ref|XP_010048073.1| PREDICTED: axial regulator YABBY 5 [Eucalyptus grandis]
 gb|KCW80166.1| hypothetical protein EUGRSUZ_C01515 [Eucalyptus grandis]
 gb|KCW80167.1| hypothetical protein EUGRSUZ_C01515 [Eucalyptus grandis]
Length=184

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 89/141 (63%), Gaps = 3/141 (2%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQPQCHDHHANNF  528
            +E LCY+ C+FCN VLAV +PC  +L+ VT++CGHCSNL  ++     Q   +   A   
Sbjct  10   TEQLCYIPCNFCNIVLAVSVPCSSLLDIVTIRCGHCSNLWSVNMAAAFQSLANWQDAQAP  69

Query  527  PVSCN---GFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRIKA  357
               C    G     +S  +  +   +  +   V +PPEK+ R+PSAYN+F+KEEIQRIKA
Sbjct  70   KQDCRMDMGSSSKYNSRITMRAPSTNVTEQRVVNRPPEKRQRVPSAYNQFIKEEIQRIKA  129

Query  356  ANPEIPHREAFSAAAKNWARY  294
            +NP+I HREAFS AAKNWA +
Sbjct  130  SNPDISHREAFSTAAKNWAHF  150



>gb|KCW73030.1| hypothetical protein EUGRSUZ_E01474 [Eucalyptus grandis]
Length=290

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 93/156 (60%), Gaps = 18/156 (12%)
 Frame = -1

Query  707  SEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP-----QCHDH  543
            +E LCYV C+FC+TVLAV +PC  + +TVTV+CGHC+NL  ++ R  L P     Q H  
Sbjct  91   NEQLCYVHCNFCDTVLAVSVPCSSLFKTVTVRCGHCTNLLSVNMRSLLLPPAPANQLHLG  150

Query  542  HA-----------NNFP--VSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPS  402
            H+            N P  +  N     +         E      P V +PPEK+ R+PS
Sbjct  151  HSYFTPQNLLEEIRNVPSNMLMNQTIPNEPMMQLRGGIEDIPKPPPVVNRPPEKRQRVPS  210

Query  401  AYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            AYNRF+K+EIQRIKA NP+I HREAFSAAAKNWA +
Sbjct  211  AYNRFIKDEIQRIKAGNPDISHREAFSAAAKNWAHF  246



>ref|XP_010685466.1| PREDICTED: putative axial regulator YABBY 2 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=189

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 95/158 (60%), Gaps = 15/158 (9%)
 Frame = -1

Query  728  MDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNL--SFLSTRPPLQP-  558
            MD +  +SE +CYV C+FCNT+LAV +PC      VTV+CGHC+NL    +   PP  P 
Sbjct  1    MDFS--TSERVCYVHCTFCNTILAVSVPCCSTYNLVTVRCGHCANLLSVNIGLSPPSVPH  58

Query  557  -------QCHDHHANNFPVSCN---GFKRGQsssssptssepssPKAPFVVKPPEKKHRL  408
                   + H +H +    S N   G      ++      +      P  ++PPEK+ R+
Sbjct  59   QDNFQLVRQHYNHQDESKDSSNITAGSSSSTITTVGSDQHDDHQQLRPPPIRPPEKRQRV  118

Query  407  PSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            PSAYN+F+KEEIQRIKA+NPEI HREAFSAAAKNWA +
Sbjct  119  PSAYNKFIKEEIQRIKASNPEISHREAFSAAAKNWAHF  156



>ref|XP_010263069.1| PREDICTED: putative axial regulator YABBY 2 isoform X1 [Nelumbo 
nucifera]
Length=184

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 98/153 (64%), Gaps = 10/153 (7%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP--  558
            S+D+A   SEH+CYV C+FCNT+LAV +P   +   VTV+CGHC+NL  ++    LQP  
Sbjct  2    SLDVA---SEHVCYVHCNFCNTILAVSVPSTSLYNVVTVRCGHCANLLSVNMGALLQPLP  58

Query  557  ----QCHDHHANNFPVSCNGFKRGQsssssptssepssPKAPFVVKP-PEKKHRLPSAYN  393
                Q  +H++++   +       + +  S   +  +       ++P PEK+ R+PSAYN
Sbjct  59   LQDIQLQNHNSSSEDSTKGSGSSSKCNKVSMLDTAENDQPRMLPMRPAPEKRQRVPSAYN  118

Query  392  RFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            RF+KEEIQRIKA+NPEI HREAFS AAKNWA +
Sbjct  119  RFIKEEIQRIKASNPEISHREAFSTAAKNWAHF  151



>ref|XP_003609353.1| YABBY protein [Medicago truncatula]
 gb|AES91550.1| plant-specific transcription factor YABBY family protein [Medicago 
truncatula]
Length=191

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 94/153 (61%), Gaps = 7/153 (5%)
 Frame = -1

Query  731  SMDLAQPSSEHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP--  558
            S+D+A  ++E LCY+ C+FCN VLAV +PC  + + VTV+CGHC+NL  ++     Q   
Sbjct  5    SIDVAPAAAEQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSLS  64

Query  557  ----QCHDHHAN-NFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYN  393
                Q   H  N  + +  +   +     +  ++      +   V +PPEK+ R+PSAYN
Sbjct  65   WQDVQAPSHCMNPEYRIRTSSTPKCNDRIAMRSAPTTHVTEERVVNRPPEKRQRVPSAYN  124

Query  392  RFMKEEIQRIKAANPEIPHREAFSAAAKNWARY  294
            +F+KEEIQRIKA NP+I HREAFS AAKNWA +
Sbjct  125  QFIKEEIQRIKANNPDISHREAFSTAAKNWAHF  157



>ref|XP_002527201.1| Axial regulator YABBY5, putative [Ricinus communis]
 gb|EEF35214.1| Axial regulator YABBY5, putative [Ricinus communis]
Length=185

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 89/143 (62%), Gaps = 6/143 (4%)
 Frame = -1

Query  704  EHLCYVRCSFCNTVLAVGIPCKRVLETVTVKCGHCSNLSFLSTRPPLQP------QCHDH  543
            E LCY+ C+FCN VLAV +PC  + + VTV+CGHC+NL  ++     Q       Q   H
Sbjct  10   EQLCYIPCNFCNIVLAVSVPCSSLFDIVTVRCGHCTNLWSVNMAAAFQSLSWQDFQAPSH  69

Query  542  HANNFPVSCNGFKRGQsssssptssepssPKAPFVVKPPEKKHRLPSAYNRFMKEEIQRI  363
            ++ ++ +      +  +  S    +  +  +   V +PPEK+ R+PSAYN+F+KEEIQRI
Sbjct  70   NSPDYRIELGSSSKCNNRISMRAPAPHNIAEERVVNRPPEKRQRVPSAYNQFIKEEIQRI  129

Query  362  KAANPEIPHREAFSAAAKNWARY  294
            KA NPEI HREAFS AAKNWA Y
Sbjct  130  KANNPEISHREAFSTAAKNWAHY  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1553959698018