BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c16389_g1_i1 len=692 path=[819:0-119 @118@!:120-643 25:644-691]

Length=692
                                                                      Score     E

gb|AFR60863.1|  sporamin B                                              164   4e-46   
gb|AFR60865.1|  sporamin B                                              162   2e-45   
gb|AFR60859.1|  sporamin B                                              161   3e-45   
sp|P14716.1|SPOR2_IPOBA  RecName: Full=Sporamin B; AltName: Full=...    161   3e-45   Ipomoea batatas [batate]
gb|AFR60862.1|  sporamin B                                              159   2e-44   
gb|ABB90968.1|  sporamin B precursor                                    159   3e-44   Ipomoea batatas [batate]
sp|P10965.1|SPORB_IPOBA  RecName: Full=Sporamin B; Flags: Precursor     159   3e-44   Ipomoea batatas [batate]
gb|AFR60858.1|  sporamin A                                              159   3e-44   
gb|AAA33390.1|  sporamin B                                              158   5e-44   Ipomoea batatas [batate]
gb|AFR60867.1|  sporamin B                                              158   6e-44   
gb|AFR60860.1|  sporamin B                                              156   3e-43   
gb|AFR60864.1|  sporamin B                                              155   5e-43   
gb|ABG26235.1|  sporamin A                                              149   2e-40   Ipomoea trifida
gb|ABG26232.1|  sporamin A                                              146   3e-39   Ipomoea trifida
gb|ABG26230.1|  sporamin A                                              145   6e-39   Ipomoea trifida
gb|AAL55800.1|AF289060_1  sporamin                                      145   7e-39   Ipomoea batatas [batate]
gb|AAB52548.1|  sporamin precursor                                      145   7e-39   Ipomoea batatas [batate]
sp|P10917.1|SPORA_IPOBA  RecName: Full=Sporamin A; Flags: Precursor     145   8e-39   Ipomoea batatas [batate]
gb|ABG26222.1|  sporamin A                                              145   8e-39   Ipomoea leucantha
gb|AAA33391.1|  sporamin A precursor                                    144   1e-38   Ipomoea batatas [batate]
gb|ABB97547.1|  sporamin A precursor                                    144   1e-38   Ipomoea batatas [batate]
gb|ABB97545.1|  sporamin A precursor                                    144   2e-38   Ipomoea batatas [batate]
gb|ABB97549.1|  sporamin A precursor                                    144   2e-38   Ipomoea batatas [batate]
sp|P14715.1|SPOR1_IPOBA  RecName: Full=Sporamin A; AltName: Full=...    144   2e-38   Ipomoea batatas [batate]
gb|ABB97542.1|  sporamin A precursor                                    143   3e-38   Ipomoea batatas [batate]
gb|ABY19576.1|  sporamin A precursor                                    143   3e-38   Ipomoea batatas [batate]
gb|ABG26238.1|  sporamin A                                              143   3e-38   Ipomoea trifida
gb|AFR60855.1|  sporamin A                                              143   3e-38   
gb|AFR60856.1|  sporamin A                                              143   3e-38   
gb|ABG26224.1|  sporamin A                                              143   4e-38   Ipomoea leucantha
gb|ABG26236.1|  sporamin A                                              143   4e-38   Ipomoea trifida
gb|ABG26227.1|  sporamin A                                              142   7e-38   Ipomoea leucantha
gb|AAB52547.1|  sporamin precursor                                      142   7e-38   Ipomoea batatas [batate]
gb|AAA86670.1|  preprosporamin                                          142   1e-37   Ipomoea batatas [batate]
gb|AFR60852.1|  sporamin                                                141   1e-37   
gb|AAD40288.1|  sporamin A precursor                                    141   2e-37   Ipomoea batatas [batate]
gb|ABG26231.1|  sporamin A                                              141   3e-37   Ipomoea trifida
gb|ABB97544.1|  sporamin A precursor                                    140   5e-37   Ipomoea batatas [batate]
gb|AAD05567.1|  sporamin A                                              139   2e-36   Ipomoea batatas [batate]
gb|ABG26229.1|  sporamin A                                              139   2e-36   Ipomoea trifida
gb|ABB97543.1|  sporamin A precursor                                    137   5e-36   Ipomoea batatas [batate]
gb|AFR60853.1|  truncated sporamin                                    90.5    6e-19   
gb|AAB52549.1|  sporamin                                              87.8    3e-18   Ipomoea batatas [batate]
gb|AAB52550.1|  sporamin                                              83.2    4e-16   Ipomoea batatas [batate]
ref|XP_007036746.1|  21 kDa seed protein                              65.9    7e-10   
ref|XP_007036750.1|  21 kDa seed protein                              65.5    9e-10   
ref|XP_002265965.1|  PREDICTED: miraculin                             64.7    2e-09   Vitis vinifera
ref|XP_011072079.1|  PREDICTED: miraculin                             62.8    7e-09   
emb|CDP16462.1|  unnamed protein product                              63.2    7e-09   
gb|EYU22302.1|  hypothetical protein MIMGU_mgv1a013790mg              62.4    1e-08   
ref|XP_008778295.1|  PREDICTED: miraculin                             60.5    3e-08   
gb|AAV41234.1|  putative 21 kDa trypsin inhibitor                     61.2    4e-08   Theobroma microcarpum
ref|XP_010416122.1|  PREDICTED: trypsin inhibitor BvTI-like           60.8    4e-08   
ref|XP_010918417.1|  PREDICTED: miraculin-like                        60.5    5e-08   
emb|CAN65022.1|  hypothetical protein VITISV_027379                   58.5    2e-07   Vitis vinifera
ref|XP_010428240.1|  PREDICTED: trypsin inhibitor BvTI-like           58.5    3e-07   
emb|CAN75396.1|  hypothetical protein VITISV_028636                   58.5    3e-07   Vitis vinifera
ref|XP_010428249.1|  PREDICTED: trypsin inhibitor BvTI-like           58.5    3e-07   
gb|AAV41231.1|  putative 21 kDa trypsin inhibitor                     58.5    3e-07   Theobroma cacao [chocolate]
emb|CDP19136.1|  unnamed protein product                              58.5    3e-07   
emb|CBI35464.3|  unnamed protein product                              58.5    3e-07   
gb|AIT42186.1|  Kunitz-type inhibitor B                               58.5    3e-07   
prf||1802409A  albumin                                                58.5    3e-07
ref|XP_007036743.1|  21 kDa seed protein                              58.2    4e-07   
gb|ADD51186.1|  tumor-related protein                                 58.2    4e-07   Vitis cinerea var. helleri x Vitis riparia
gb|AAV41233.1|  putative 21 kDa trypsin inhibitor                     58.2    5e-07   Theobroma bicolor
emb|CAN81015.1|  hypothetical protein VITISV_025776                   57.8    5e-07   Vitis vinifera
ref|XP_002266430.1|  PREDICTED: miraculin                             57.8    5e-07   Vitis vinifera
gb|KCW48670.1|  hypothetical protein EUGRSUZ_K02326                   57.4    7e-07   
sp|Q41484.1|SPI5_SOLTU  RecName: Full=Serine protease inhibitor 5...  57.0    1e-06   Solanum tuberosum [potatoes]
ref|XP_010428238.1|  PREDICTED: trypsin inhibitor BvTI-like           56.6    2e-06   
ref|XP_010037029.1|  PREDICTED: miraculin-like                        57.0    2e-06   
ref|XP_006441456.1|  hypothetical protein CICLE_v10023572mg           55.8    2e-06   
ref|XP_010539167.1|  PREDICTED: bark lectin isoform 2-like            55.8    2e-06   
gb|ABB72793.1|  Kunitz-type protease inhibitor-like protein           56.2    2e-06   Solanum tuberosum [potatoes]
ref|XP_006441432.1|  hypothetical protein CICLE_v10022276mg           55.8    3e-06   
ref|XP_010042449.1|  PREDICTED: miraculin-like                        56.6    3e-06   
ref|XP_003534101.1|  PREDICTED: 21 kDa seed protein-like              55.5    3e-06   
ref|XP_008437082.1|  PREDICTED: miraculin                             55.1    4e-06   
ref|XP_006495064.1|  PREDICTED: miraculin-like                        54.7    6e-06   
ref|XP_006441435.1|  hypothetical protein CICLE_v10023257mg           54.7    7e-06   
ref|XP_006441446.1|  hypothetical protein CICLE_v10023371mg           54.7    8e-06   
ref|XP_002270111.1|  PREDICTED: miraculin                             54.3    8e-06   Vitis vinifera
ref|XP_006441438.1|  hypothetical protein CICLE_v10023465mg           54.3    9e-06   
ref|XP_006493430.1|  PREDICTED: miraculin-like                        54.3    1e-05   
ref|XP_006441459.1|  hypothetical protein CICLE_v10022284mg           53.9    1e-05   
sp|P13087.3|MIRA_SYNDU  RecName: Full=Miraculin; Short=MIR; Flags...  53.9    1e-05   Synsepalum dulcificum [miracle fruit]
ref|XP_010536414.1|  PREDICTED: miraculin-like                        53.9    1e-05   
ref|XP_010041215.1|  PREDICTED: miraculin-like                        53.5    2e-05   
gb|KFK41765.1|  hypothetical protein AALP_AA2G169300                  53.5    2e-05   
ref|XP_006441441.1|  hypothetical protein CICLE_v10023320mg           53.1    2e-05   
emb|CAA43267.1|  sporamin                                             53.5    2e-05   Ipomoea batatas [batate]
ref|XP_006441447.1|  hypothetical protein CICLE_v10021858mg           53.5    3e-05   
emb|CDP19138.1|  unnamed protein product                              52.8    3e-05   
ref|XP_006441439.1|  hypothetical protein CICLE_v10022282mg           52.8    4e-05   
emb|CAC40756.1|  putative miraculin                                   52.0    5e-05   Atropa belladonna [deadly nightshade]
ref|XP_008437058.1|  PREDICTED: miraculin-like                        52.0    6e-05   
emb|CAI77782.1|  kunitz trypsin inhibitor                             52.0    6e-05   Populus tremula [European aspen]
ref|XP_007036748.1|  21 kDa seed protein, putative                    52.0    7e-05   
ref|NP_001233769.1|  uncharacterized protein LOC544001 precursor      52.0    7e-05   
ref|NP_001237597.1|  uncharacterized protein LOC100527288 precursor   52.0    7e-05   
emb|CAN63617.1|  hypothetical protein VITISV_041430                   52.0    9e-05   Vitis vinifera
gb|KHN24496.1|  Miraculin                                             51.6    1e-04   
ref|XP_010471390.1|  PREDICTED: bark lectin isoform 2-like            51.6    1e-04   
emb|CDX72972.1|  BnaC06g34200D                                        51.2    1e-04   
ref|XP_010416131.1|  PREDICTED: bark lectin isoform 2-like isofor...  51.2    1e-04   
emb|CAI77774.1|  kunitz trypsin inhibitor                             51.2    1e-04   Populus tremula [European aspen]
ref|XP_003534083.1|  PREDICTED: miraculin-like                        51.2    1e-04   
emb|CAI77764.1|  kunitz trypsin inhibitor                             51.2    1e-04   Populus tremula [European aspen]
emb|CAI77777.1|  kunitz trypsin inhibitor                             51.2    1e-04   Populus tremula [European aspen]
emb|CAI77775.1|  kunitz trypsin inhibitor                             51.2    1e-04   Populus tremula [European aspen]
ref|XP_010416130.1|  PREDICTED: bark lectin isoform 2-like isofor...  51.2    1e-04   
emb|CAI77798.1|  kunitz trypsin inhibitor                             51.2    2e-04   Populus tremula [European aspen]
emb|CAI77765.1|  kunitz trypsin inhibitor                             50.8    2e-04   Populus tremula [European aspen]
emb|CAI77770.1|  kunitz trypsin inhibitor                             50.8    2e-04   Populus tremula [European aspen]
emb|CAI77793.1|  kunitz trypsin inhibitor                             50.8    2e-04   Populus tremula [European aspen]
emb|CAI77803.1|  kunitz trypsin inhibitor                             50.8    2e-04   Populus tremula [European aspen]
emb|CAI77766.1|  kunitz trypsin inhibitor                             50.8    2e-04   Populus tremula [European aspen]
ref|XP_010416116.1|  PREDICTED: miraculin-like                        50.4    2e-04   
emb|CDP21779.1|  unnamed protein product                              50.4    2e-04   
ref|XP_010428252.1|  PREDICTED: bark lectin isoform 2 isoform X1      50.8    2e-04   
ref|NP_001237333.1|  uncharacterized protein LOC100500648 precursor   50.4    2e-04   
ref|XP_010428253.1|  PREDICTED: bark lectin isoform 2 isoform X2      50.8    2e-04   
emb|CAI77768.1|  kunitz trypsin inhibitor                             50.4    2e-04   Populus tremula [European aspen]
ref|XP_006493432.1|  PREDICTED: miraculin-like                        51.2    2e-04   
emb|CAI77783.1|  kunitz trypsin inhibitor                             50.1    3e-04   Populus tremula [European aspen]
ref|XP_006493433.1|  PREDICTED: miraculin-like                        50.4    3e-04   
ref|XP_006495063.1|  PREDICTED: miraculin-like                        50.1    3e-04   
ref|XP_004235413.1|  PREDICTED: aspartic protease inhibitor 1-like    50.1    4e-04   
ref|XP_004137534.1|  PREDICTED: miraculin-like                        49.7    4e-04   
emb|CAI77772.1|  kunitz trypsin inhibitor                             49.7    4e-04   Populus tremula [European aspen]
ref|XP_003532237.1|  PREDICTED: trypsin inhibitor A-like              49.7    5e-04   
emb|CDY11118.1|  BnaC06g23700D                                        49.3    5e-04   
ref|XP_002888920.1|  hypothetical protein ARALYDRAFT_476458           49.3    6e-04   
ref|XP_007152537.1|  hypothetical protein PHAVU_004G138500g           49.3    7e-04   
emb|CAI77769.1|  kunitz trypsin inhibitor                             49.3    7e-04   Populus tremula [European aspen]
sp|P83594.1|IFXA_BAUUN  RecName: Full=Factor Xa inhibitor BuXI        48.5    8e-04   Bauhinia ungulata
ref|XP_003532236.1|  PREDICTED: trypsin inhibitor A-like              48.9    0.001   



>gb|AFR60863.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   164 bits (414),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 122/199 (61%), Gaps = 6/199 (3%)
 Frame = -1

Query  692  LLPNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVR  519
            LLPNP HS FNPIRL  A    +S TPVLD +GDE+RAGE YYI S   G  G  +  VR
Sbjct  14   LLPNPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVR  73

Query  518  VDWPVSATCQTRLLLSRP-LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNV  342
            +D   S  C + +++SR    +G PI IRPADP + VV+ S  Q+F   +   ++C+ NV
Sbjct  74   LD-SSSNECASDVIVSRSDFDNGDPITIRPADPESTVVMPSTFQTFRFSIPTNKLCVNNV  132

Query  341  YWAIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFG  165
             W I++++ SG Y +   +FV   S+QF IEVV ++  AYK +YC FG  KC+NVG  + 
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  164  PF-RNLRLALSENSFFSIV  111
            P  R  RLALS   F  ++
Sbjct  193  PLTRATRLALSNTPFVFVI  211



>gb|AFR60865.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   162 bits (409),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 122/199 (61%), Gaps = 6/199 (3%)
 Frame = -1

Query  692  LLPNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVR  519
            LLPNPTHS FNPIRL  A    +S TPVLD +GDE+RAGE YY+ S   G  G  +  VR
Sbjct  14   LLPNPTHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYMVSAIWGAGGGGLRLVR  73

Query  518  VDWPVSATCQTRLLLSRP-LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNV  342
            +D   S  C + +++SR    +G PI I PADP + VV+ S  Q+F   +   ++C+ NV
Sbjct  74   LD-SSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTYQTFRFNIATNKLCVNNV  132

Query  341  YWAIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFG  165
             W I++++ SG Y +   +FV   S+QF IEVV ++  AYK +YC FG  KC+NVG  + 
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  164  PF-RNLRLALSENSFFSIV  111
            P  R  RLALS   F  ++
Sbjct  193  PLTRATRLALSNTPFVFVI  211



>gb|AFR60859.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   161 bits (408),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 121/199 (61%), Gaps = 6/199 (3%)
 Frame = -1

Query  692  LLPNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVR  519
            LLPNP HS FNPIRL  A    +S TPVLD +GDE+RAGE YYI S   G  G  +  VR
Sbjct  14   LLPNPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVR  73

Query  518  VDWPVSATCQTRLLLSRP-LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNV  342
            +D   S  C + +++SR    +G PI I PADP + VV+ S  Q+F   +   ++C+ NV
Sbjct  74   LD-SSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNV  132

Query  341  YWAIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFG  165
             W I++++ SG Y +   +FV   S+QF IEVV ++  AYK +YC FG  KC+NVG  + 
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  164  PF-RNLRLALSENSFFSIV  111
            P  R  RLALS   F  ++
Sbjct  193  PLTRATRLALSNTPFVFVI  211



>sp|P14716.1|SPOR2_IPOBA RecName: Full=Sporamin B; AltName: Full=Clone PIM0535; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33198.1| unnamed protein product [Ipomoea batatas]
Length=216

 Score =   161 bits (408),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 122/199 (61%), Gaps = 6/199 (3%)
 Frame = -1

Query  692  LLPNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVR  519
            LLPNPTHS FNPIRL  A    +S TPVLD +GDE+RAGE YY+ S   G  G  +  VR
Sbjct  14   LLPNPTHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYMVSAIWGAGGGGLRLVR  73

Query  518  VDWPVSATCQTRLLLSRP-LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNV  342
            +D   S  C + +++SR    +G PI I PADP A VV+ S  Q+F   +   ++C+ NV
Sbjct  74   LD-SSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNIATNKLCVNNV  132

Query  341  YWAIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFG  165
             W I++++ SG Y +   +FV   S+QF IEVV ++  AYK +YC FG  KC+NVG  + 
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  164  PF-RNLRLALSENSFFSIV  111
            P  R  RLALS   F  ++
Sbjct  193  PLTRATRLALSNIPFVFVI  211



>gb|AFR60862.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 120/199 (60%), Gaps = 6/199 (3%)
 Frame = -1

Query  692  LLPNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVR  519
            LL NP HS FNPIRL  A    +S TPVLD +GDE+RAGE YYI S   G  G  +  VR
Sbjct  14   LLANPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVR  73

Query  518  VDWPVSATCQTRLLLSRP-LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNV  342
            +D   S  C + +++SR    +G PI I PADP + VV+ S  Q+F   +   ++C+ NV
Sbjct  74   LD-SSSNECASDVMVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNV  132

Query  341  YWAIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFG  165
             W I++++ SG Y +   +FV   S+QF IEVV ++  AYK +YC FG  KC+NVG  + 
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  164  PF-RNLRLALSENSFFSIV  111
            P  R  RLALS   F  ++
Sbjct  193  PLTRATRLALSNTPFVFVI  211



>gb|ABB90968.1| sporamin B precursor [Ipomoea batatas]
Length=216

 Score =   159 bits (401),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/199 (45%), Positives = 120/199 (60%), Gaps = 6/199 (3%)
 Frame = -1

Query  692  LLPNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVR  519
            LL NP HS FNPIRL  A    +S TPVLD +GDE+RAGE YYI S   G  G  +  VR
Sbjct  14   LLANPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVR  73

Query  518  VDWPVSATCQTRLLLSRP-LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNV  342
            +D   S  C + +++SR    +G PI I PADP + VV+ S  Q+F   +   ++C+ NV
Sbjct  74   LD-SSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNV  132

Query  341  YWAIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFG  165
             W I++++ SG Y +   +FV   S+QF IEVV ++  AYK +YC FG  KC+NVG  + 
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  164  PF-RNLRLALSENSFFSIV  111
            P  R  RLALS   F  ++
Sbjct  193  PLTRATRLALSNTPFVFVI  211



>sp|P10965.1|SPORB_IPOBA RecName: Full=Sporamin B; Flags: Precursor [Ipomoea batatas]
 emb|CAA31863.1| unnamed protein product [Ipomoea batatas]
 gb|AFR60861.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   159 bits (401),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 119/197 (60%), Gaps = 6/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVD  513
            PNP HS FNPIRL  A    +S TPVLD +GDE+RAGE YYI S   G  G  +  VR+D
Sbjct  16   PNPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLD  75

Query  512  WPVSATCQTRLLLSRP-LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
               S  C + +++SR    +G PI I PADP A VV+ S  Q+F   +   ++C+ NV W
Sbjct  76   -SSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNIATNKLCVNNVNW  134

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGPF  159
             I++++ SG Y +   +FV   S+QF IEVV ++  AYK +YC FG  KC+NVG  + P 
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  158  -RNLRLALSENSFFSIV  111
             R  RLALS   F  ++
Sbjct  195  TRATRLALSNTPFVFVI  211



>gb|AFR60858.1| sporamin A [Ipomoea batatas]
Length=216

 Score =   159 bits (401),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 119/197 (60%), Gaps = 6/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVD  513
            PNP HS FNPIRL  A    +S TPVLD +GDE+RAGE YYI S   G  G  +  VR+D
Sbjct  16   PNPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLD  75

Query  512  WPVSATCQTRLLLSRP-LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
               S  C + +++SR    +G PI I PADP A VV+ S  Q+F   +   ++C+ NV W
Sbjct  76   -SSSNECASDVIVSRSDFDNGDPITITPADPEATVVMPSTYQTFRFNIATNKLCVNNVNW  134

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGPF  159
             I++++ SG Y +   +FV   S+QF IEVV ++  AYK +YC FG  KC+NVG  + P 
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  158  -RNLRLALSENSFFSIV  111
             R  RLALS   F  ++
Sbjct  195  TRATRLALSNTPFVFVI  211



>gb|AAA33390.1| sporamin B [Ipomoea batatas]
 gb|AFR60866.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 119/197 (60%), Gaps = 6/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVD  513
            PNP HS FNPIRL  A    +S TPVLD +GDE+RAGE YYI S   G  G  +  VR+D
Sbjct  16   PNPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLD  75

Query  512  WPVSATCQTRLLLSRP-LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
               S  C + +++SR    +G PI I PADP + VV+ S  Q+F   +   ++C+ NV W
Sbjct  76   -SSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNVNW  134

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGPF  159
             I++++ SG Y +   +FV   S+QF IEVV ++  AYK +YC FG  KC+NVG  + P 
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  158  -RNLRLALSENSFFSIV  111
             R  RLALS   F  ++
Sbjct  195  TRATRLALSNTPFVFVI  211



>gb|AFR60867.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   158 bits (399),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 119/197 (60%), Gaps = 6/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVD  513
            PNP HS FNPIRL  A    +S TPVLD +GDE+RAGE YYI S   G  G  +  VR+D
Sbjct  16   PNPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLD  75

Query  512  WPVSATCQTRLLLSRP-LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
               S  C + +++SR    +G PI I PADP + VV+ S  Q+F   +   ++C+ NV W
Sbjct  76   -SSSNECASDVVVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNVNW  134

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGPF  159
             I++++ SG Y +   +FV   S+QF IEVV ++  AYK +YC FG  KC+NVG  + P 
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  158  -RNLRLALSENSFFSIV  111
             R  RLALS   F  ++
Sbjct  195  TRATRLALSNTPFVFVI  211



>gb|AFR60860.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/199 (44%), Positives = 120/199 (60%), Gaps = 6/199 (3%)
 Frame = -1

Query  692  LLPNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVR  519
            LL NP +S FNPIRL  A    +S TPVLD +GDE+RAGE YYI S   G  G  +  VR
Sbjct  14   LLANPAYSKFNPIRLRPARETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVR  73

Query  518  VDWPVSATCQTRLLLSRP-LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNV  342
            +D   S  C + +++SR    +G PI I PADP + VV+ S  Q+F   +   ++C+ NV
Sbjct  74   LD-SSSNECASDVIVSRSDFDNGDPITITPADPESTVVMPSTFQTFRFNIATNKLCVNNV  132

Query  341  YWAIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFG  165
             W I++++ SG Y +   +FV   S+QF IEVV ++  AYK +YC FG  KC+NVG  + 
Sbjct  133  NWGIKHDSESGQYFVKAGEFVSDNSNQFKIEVVNDNLNAYKISYCQFGTEKCFNVGRYYD  192

Query  164  PF-RNLRLALSENSFFSIV  111
            P  R  RLALS   F  ++
Sbjct  193  PLTRATRLALSNTPFVFVI  211



>gb|AFR60864.1| sporamin B [Ipomoea batatas]
Length=216

 Score =   155 bits (393),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 117/197 (59%), Gaps = 6/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVD  513
            PNP HS FNPIRL  A    +S TPVLD +GDE+RAGE YYI S   G  G  +  VR+D
Sbjct  16   PNPAHSKFNPIRLRPAHETASSETPVLDINGDEVRAGENYYIVSAIWGAGGGGLRLVRLD  75

Query  512  WPVSATCQTRLLLSRP-LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
               S  C + +++SR    +G P  I PADP A VV+ S  Q+F   +   ++C+ NV W
Sbjct  76   -SSSNECASDVIVSRSDFDNGDPTTITPADPEATVVMPSTYQTFRFNIATNKLCVNNVNW  134

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGPF  159
             I++++ SG Y +   +FV   S+QF IE V ++  AYK +YC FG  KC+NVG  + P 
Sbjct  135  GIKHDSESGQYFVKAGEFVSDNSNQFKIEAVNDNLNAYKISYCQFGTEKCFNVGRYYDPL  194

Query  158  -RNLRLALSENSFFSIV  111
             R  RLALS   F  ++
Sbjct  195  TRATRLALSNTPFVFVI  211



>gb|ABG26235.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 114/197 (58%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPSSSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
            + + C + +++S   L +G PI I P  ADP + V++TS  Q+F   +   ++C+ NV W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESSVIMTSTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             IR++++SG Y L   +FV   S+QF IEVV  +  +YK TYC FG  KCYNVG    P 
Sbjct  138  GIRHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNSYKLTYCQFGSDKCYNVGRFHDPM  197

Query  161  FRNLRLALSENSFFSIV  111
             R  RLALS + F  ++
Sbjct  198  MRTTRLALSNSPFVFVI  214



>gb|ABG26232.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 112/197 (57%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
              + C + +++S   L +G PI I P  ADP + VVL S  Q+F   +   ++C+ NV W
Sbjct  78   TMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IEVV  +   YK TYC FG  KCYNVG    P 
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  161  FRNLRLALSENSFFSIV  111
             R  RLALS++ F  ++
Sbjct  198  LRTTRLALSDSPFVFVI  214



>gb|ABG26230.1| sporamin A [Ipomoea trifida]
 gb|AFR60857.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   145 bits (366),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 111/197 (56%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
              + C + +++S   L +G PI I P  ADP + VVL S  Q+F   +   ++C+ NV W
Sbjct  78   TMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IEVV  +   YK TYC FG  KCYNVG    P 
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  161  FRNLRLALSENSFFSIV  111
             R  RLALS + F  ++
Sbjct  198  LRTTRLALSNSPFVFVI  214



>gb|AAL55800.1|AF289060_1 sporamin [Ipomoea batatas]
Length=219

 Score =   145 bits (365),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 112/197 (57%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
            + + C + +++S   L +G PI I P  ADP + VV+ S  Q+F   +   ++C+ NV W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGPF  159
             I+++++SG Y L   +FV   S+QF IEVV  +   YK TYC FG  KCYNVG    P 
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPL  197

Query  158  -RNLRLALSENSFFSIV  111
             R  RLALS + F  ++
Sbjct  198  MRTTRLALSNSPFVFVI  214



>gb|AAB52548.1| sporamin precursor [Ipomoea batatas]
Length=219

 Score =   145 bits (365),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 112/197 (57%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
            + + C + +++S   L +G PI I P  ADP + VV+ S  Q+F   +   ++C+ NV W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IEVV  +   YK TYC FG  KCYNVG    P 
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  161  FRNLRLALSENSFFSIV  111
             R  RLALS + F  ++
Sbjct  198  LRTTRLALSNSPFVFVI  214



>sp|P10917.1|SPORA_IPOBA RecName: Full=Sporamin A; Flags: Precursor [Ipomoea batatas]
 emb|CAA31862.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score =   145 bits (365),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 88/198 (44%), Positives = 116/198 (59%), Gaps = 7/198 (4%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRV-DW  510
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+      GA   G+R+   
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYM-VYAILGACGGGLRLAHL  76

Query  509  PVSATCQTRLLLS-RPLSDGHPIRIRPA--DPNAPVVLTSRLQSFESIVDMPQVCLGNVY  339
             +   C + +++S   L +G  I I PA  DP A VV+TS  Q+F   +   ++C+ NV 
Sbjct  77   DLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVNNVN  136

Query  338  WAIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP  162
            W I+Y+++SG  +L   +FV   S+QF IEVV  +   YK TYC FG  KCYNVG    P
Sbjct  137  WGIQYDSASGQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFKDP  196

Query  161  -FRNLRLALSENSFFSIV  111
              R  RLALS   FF ++
Sbjct  197  MLRTTRLALSYYPFFFVI  214



>gb|ABG26222.1| sporamin A [Ipomoea leucantha]
 gb|ABG26223.1| sporamin A [Ipomoea leucantha]
 gb|ABG26225.1| sporamin A [Ipomoea leucantha]
 gb|ABG26234.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   145 bits (365),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 113/197 (57%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPPSSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
            + + C + +++S   L +G PI I P  ADP + V++TS  Q+F   +   ++C+ NV W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IEVV  +   YK TYC FG  KCYNVG    P 
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  161  FRNLRLALSENSFFSIV  111
             R  RLALS + F  ++
Sbjct  198  LRTTRLALSNSPFVFVI  214



>gb|AAA33391.1| sporamin A precursor [Ipomoea batatas]
 gb|ABG26237.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 111/197 (56%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
              + C + +++S   L +G PI I P  ADP + VV+ S  Q+F   +   ++C+ NV W
Sbjct  78   TMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IEVV  +   YK TYC FG  KCYNVG    P 
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  161  FRNLRLALSENSFFSIV  111
             R  RLALS + F  ++
Sbjct  198  LRTTRLALSNSPFVFVI  214



>gb|ABB97547.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97548.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 118/203 (58%), Gaps = 14/203 (7%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINS----IGNPGALIVGVR  519
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S    +G  G  +  + 
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEIRAGGNYYMVSAIWGVGGGGPRLAHLD  77

Query  518  VDWPVSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLG  348
                + + C + +++S   L +G PI I P  ADP + VV+ S  Q+F   +   ++C+ 
Sbjct  78   ----MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVN  133

Query  347  NVYWAIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLV  171
            NV W I+++++SG Y L   +FV   S+QF IE+V  +  +YK TYC FG  KCYNVG  
Sbjct  134  NVNWGIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRF  193

Query  170  FGP-FRNLRLALSENSFFSIVFK  105
                 R  RLALS NS F  V K
Sbjct  194  HDHMLRTTRLALS-NSPFVFVIK  215



>gb|ABB97545.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 112/197 (57%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
            + + C + +++S   L +G PI I P  ADP + VV+ S  Q+F   +   ++C+ NV W
Sbjct  78   MMSKCASDVIISPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IE+V  +   YK TYC FG  KCYNVG    P 
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  161  FRNLRLALSENSFFSIV  111
             R  RLALS + F  ++
Sbjct  198  LRTTRLALSNSPFVFVI  214



>gb|ABB97549.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97550.1| sporamin A precursor [Ipomoea batatas]
 gb|AFR60854.1| sporamin [Ipomoea batatas]
Length=219

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 112/197 (57%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
            + + C + +++S   L +G PI I P  ADP + VV+ S  Q+F   +   ++C+ NV W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IE+V  +   YK TYC FG  KCYNVG    P 
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  161  FRNLRLALSENSFFSIV  111
             R  RLALS + F  ++
Sbjct  198  LRTTRLALSNSPFVFVI  214



>sp|P14715.1|SPOR1_IPOBA RecName: Full=Sporamin A; AltName: Full=Clone PIM0335; Flags: 
Precursor [Ipomoea batatas]
 emb|CAA33197.1| unnamed protein product [Ipomoea batatas]
Length=219

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 113/199 (57%), Gaps = 6/199 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
            + + C T +++S   L +G PI I P  ADP + VV+ S  Q+F   +   ++C+ NV W
Sbjct  78   MMSKCATDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IE+V  +  +YK TYC FG  KCYNVG      
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHDHM  197

Query  161  FRNLRLALSENSFFSIVFK  105
             R  RLALS NS F  V K
Sbjct  198  LRTTRLALS-NSPFVFVIK  215



>gb|ABB97542.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 113/199 (57%), Gaps = 6/199 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLGHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
            + + C + +++S   L +G PI I P  ADP + VV+ S  Q+F   +   ++C+ NV W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IE+V  +  +YK TYC FG  KCYNVG      
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGADKCYNVGRFHDHM  197

Query  161  FRNLRLALSENSFFSIVFK  105
             R  RLALS NS F  V K
Sbjct  198  LRTTRLALS-NSPFVFVIK  215



>gb|ABY19576.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 113/199 (57%), Gaps = 5/199 (3%)
 Frame = -1

Query  692  LLPNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVD  513
            LLPNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S              
Sbjct  16   LLPNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAH  75

Query  512  WPVSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNV  342
              + + C + +++S   L +G PI I P  ADP + VV+ S  Q+F   +   ++C+ NV
Sbjct  76   LDMMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNV  135

Query  341  YWAIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFG  165
             W I+ +++SG Y L   +FV   S+QF IE+V  +  +YK TYC FG  KCYNVG    
Sbjct  136  NWGIQQDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHD  195

Query  164  P-FRNLRLALSENSFFSIV  111
               R  R+ALS + F  ++
Sbjct  196  HMLRTTRIALSNSPFVFVI  214



>gb|ABG26238.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 110/197 (56%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
              + C + +++S   L DG PI I P  ADP + VV+    Q+F   +   ++C+ NV W
Sbjct  78   TMSKCASDVIVSPNDLDDGDPITITPAAADPESTVVMALTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IEVV  +   YK TYC FG  KCYNVG    P 
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCRFGSDKCYNVGRFHDPM  197

Query  161  FRNLRLALSENSFFSIV  111
             R  RLALS + F  ++
Sbjct  198  LRTTRLALSNSPFVFVI  214



>gb|AFR60855.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 86/199 (43%), Positives = 113/199 (57%), Gaps = 6/199 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
            + + C + +++S   L +G PI I P  ADP + VV+ S  Q+F   +   ++C+ NV W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGPF  159
             I+++++SG Y L   +FV   S+QF IEVV  +  +YK TYC FG  KCYNVG      
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNSYKLTYCQFGSDKCYNVGRFHDHM  197

Query  158  -RNLRLALSENSFFSIVFK  105
             R  RLALS NS F  V K
Sbjct  198  SRTTRLALS-NSPFVFVIK  215



>gb|AFR60856.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   143 bits (361),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 111/197 (56%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
            + + C + +++S   L +G PI I P  ADP + VV+ S  Q+F   +   ++C+ NV W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+ +++SG Y L   +FV   S+QF IEVV  +   YK TYC FG  KCYNVG    P 
Sbjct  138  GIQQDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFKDPM  197

Query  161  FRNLRLALSENSFFSIV  111
             R  RLALS   FF ++
Sbjct  198  LRTTRLALSYYPFFFVI  214



>gb|ABG26224.1| sporamin A [Ipomoea leucantha]
 gb|ABG26226.1| sporamin A [Ipomoea leucantha]
 gb|ABG26228.1| sporamin A [Ipomoea leucantha]
 gb|ABG26233.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 111/197 (56%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPPSSQTPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
              + C + +++S   L +G PI I P  ADP + VV+ S  Q+F   +   ++C+ NV W
Sbjct  78   TMSKCASDVIVSPNDLDNGDPITITPAAADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IEVV  +   YK TYC FG  KCYNVG    P 
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  161  FRNLRLALSENSFFSIV  111
             R  RLALS + F  ++
Sbjct  198  LRTTRLALSNSPFVFVI  214



>gb|ABG26236.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 111/197 (56%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP H  FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHPRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
              + C + +++S   L +G PI I P  ADP + VVL S  Q+F   +   ++C+ NV W
Sbjct  78   TMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IEVV  +   YK TYC FG  KCYNVG    P 
Sbjct  138  RIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  161  FRNLRLALSENSFFSIV  111
             R  RLALS++ F  ++
Sbjct  198  LRTTRLALSDSPFVFVI  214



>gb|ABG26227.1| sporamin A [Ipomoea leucantha]
Length=219

 Score =   142 bits (358),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 111/197 (56%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT      S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPPPSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
            + + C + + +S   L +G PI I P  ADP + V++TS  Q+F   +   ++C+ NV W
Sbjct  78   MMSKCASDVTVSPNDLDNGDPITITPSTADPESSVIMTSTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IEVV  +   YK TYC FG  KCYNVG    P 
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  161  FRNLRLALSENSFFSIV  111
             R  RLALS + F  ++
Sbjct  198  LRTTRLALSNSPFVFVI  214



>gb|AAB52547.1| sporamin precursor [Ipomoea batatas]
 gb|ABB97540.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97541.1| sporamin A precursor [Ipomoea batatas]
 gb|ABB97546.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   142 bits (358),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 85/199 (43%), Positives = 113/199 (57%), Gaps = 6/199 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
            + + C + +++S   L +G PI I P  ADP + VV+ S  Q+F   +   ++C+ NV W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IE+V  +  +YK TYC FG  KCYNVG      
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHDHM  197

Query  161  FRNLRLALSENSFFSIVFK  105
             R  RLALS NS F  V K
Sbjct  198  LRTTRLALS-NSPFVFVIK  215



>gb|AAA86670.1| preprosporamin [Ipomoea batatas]
Length=219

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 110/197 (56%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
              + C + +++S   L +G PI I P  ADP + VV+ S  Q+F   +   ++C+ NV W
Sbjct  78   TMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIANNKLCVKNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IEVV  +   YK TYC FG  KCYN G    P 
Sbjct  138  GIQHDSASGQYFLKDGEFVSDNSNQFKIEVVDANLNFYKLTYCQFGSDKCYNCGRFHDPM  197

Query  161  FRNLRLALSENSFFSIV  111
             R  RLALS + F  ++
Sbjct  198  LRTTRLALSNSPFVFVI  214



>gb|AFR60852.1| sporamin [Ipomoea batatas]
Length=219

 Score =   141 bits (356),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 112/197 (57%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPPSSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
            + + C + +++S   L +G PI I P  ADP A VV+TS  Q+F   +   ++C+ NV W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPEATVVMTSTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+Y+++S   +L   +FV   S+QF IEVV  +   YK TYC FG  KCYNVG    P 
Sbjct  138  GIQYDSASVQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFNDPM  197

Query  161  FRNLRLALSENSFFSIV  111
             R  RLALS   FF ++
Sbjct  198  LRTTRLALSYYPFFFVI  214



>gb|AAD40288.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/198 (44%), Positives = 116/198 (59%), Gaps = 7/198 (4%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRV-DW  510
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S    GA   G+R+   
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVS-AILGACGGGLRLAHL  76

Query  509  PVSATCQTRLLLS-RPLSDGHPIRIRPA--DPNAPVVLTSRLQSFESIVDMPQVCLGNVY  339
             +   C + +++S   L +G  I I PA  DP A VV+TS  Q+F   +   ++C+ NV 
Sbjct  77   DLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVNNVN  136

Query  338  WAIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP  162
            W I+Y+++S   +L   +FV   S+QF IEVV  +   YK TYC FG  KCYNVG    P
Sbjct  137  WGIQYDSASVQSLLKAGEFVSDNSNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFNDP  196

Query  161  -FRNLRLALSENSFFSIV  111
              R  RLA+S   FF ++
Sbjct  197  MLRTTRLAISYYPFFFVI  214



>gb|ABG26231.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 110/197 (56%), Gaps = 5/197 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
              + C + +++S   L +G PI I P  ADP + VVL S  Q+F   +   ++C+ NV W
Sbjct  78   TMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IEV   +   YK TYC FG  KC+NVG    P 
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIEVDDANLNFYKLTYCQFGSDKCHNVGRFHDPM  197

Query  161  FRNLRLALSENSFFSIV  111
             R  RLALS + F  ++
Sbjct  198  LRTTRLALSNSPFVFVI  214



>gb|ABB97544.1| sporamin A precursor [Ipomoea batatas]
Length=219

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 112/199 (56%), Gaps = 6/199 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
            + + C + +++S   L +G PI I P  ADP + VV+ S  Q+F   +   ++C+ NV W
Sbjct  78   MMSKCASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+ +++SG Y L   +FV   S+QF IE+V  +  +YK TYC FG  KCYNVG      
Sbjct  138  GIQQDSASGQYFLKAGEFVSDNSNQFKIELVDANLNSYKLTYCQFGSDKCYNVGRFHDHM  197

Query  161  FRNLRLALSENSFFSIVFK  105
             R  R+ALS NS F  V K
Sbjct  198  LRTTRIALS-NSPFVFVIK  215



>gb|AAD05567.1| sporamin A [Ipomoea batatas]
Length=219

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 115/198 (58%), Gaps = 7/198 (4%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRV-DW  510
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S    GA   G+R+   
Sbjct  18   PNPAHSGFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYLVS-AILGACGGGLRLAHL  76

Query  509  PVSATCQTRLLLS-RPLSDGHPIRIRPA--DPNAPVVLTSRLQSFESIVDMPQVCLGNVY  339
             +   C + +++S   L +G  I I PA  DP A VV+TS  Q+F   +   ++C+ NV 
Sbjct  77   DLMNNCASDVIVSPNDLDNGDLITITPATVDPEATVVMTSTYQTFRFNIATNKLCVNNVN  136

Query  338  WAIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP  162
            W I+Y+++S   +L   + V   ++QF IEVV  +   YK TYC FG  KCYNVG    P
Sbjct  137  WGIQYDSASVQSLLKAGESVSDKTNQFKIEVVDANLNFYKLTYCLFGSDKCYNVGRFNDP  196

Query  161  -FRNLRLALSENSFFSIV  111
              R  RLALS   FF ++
Sbjct  197  MLRTTRLALSYYPFFFVI  214



>gb|ABG26229.1| sporamin A [Ipomoea trifida]
Length=219

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 113/199 (57%), Gaps = 6/199 (3%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
            + + C + +++S   L +G PI I P  ADP + VV+ S  Q+F   +   ++ + NV W
Sbjct  78   MMSKCASDVIVSPNGLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLRVNNVNW  137

Query  335  AIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-  162
             I+++++SG Y L   +FV   S+QF IE+V  +   YK TYC FG  KCYNVG    P 
Sbjct  138  GIQHDSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDPM  197

Query  161  FRNLRLALSENSFFSIVFK  105
             R  RLALS NS F+ V +
Sbjct  198  LRTTRLALS-NSPFAFVIR  215



>gb|ABB97543.1| sporamin A precursor [Ipomoea batatas]
Length=199

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/193 (41%), Positives = 109/193 (56%), Gaps = 5/193 (3%)
 Frame = -1

Query  674  HSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSAT  495
            HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                + + 
Sbjct  2    HSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLDMMSK  61

Query  494  CQTRLLLS-RPLSDGHPIRIRPA--DPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRY  324
            C + +++S   L +G PI I PA  DP + VV+ S  Q+F   +   ++C+ NV W I++
Sbjct  62   CASDVIVSPNDLDNGDPITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNWGIQH  121

Query  323  EASSGDYILNTTQFVPSLSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-FRNL  150
            +++SG Y L   +FV   S+QF IE+V  +   YK TYC FG  KCYNVG    P  R  
Sbjct  122  DSASGQYFLKAGEFVSDNSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDPMLRTT  181

Query  149  RLALSENSFFSIV  111
            RLALS + F  ++
Sbjct  182  RLALSNSPFVFVI  194



>gb|AFR60853.1| truncated sporamin [Ipomoea batatas]
Length=146

 Score = 90.5 bits (223),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 73/129 (57%), Gaps = 3/129 (2%)
 Frame = -1

Query  686  PNPTHSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWP  507
            PNP HS FNPIRLPT     +S TPVLD +GDE+RAG  YY+ S                
Sbjct  18   PNPAHSRFNPIRLPTTHEPASSETPVLDINGDEVRAGGNYYMVSAIWGAGGGGLRLAHLD  77

Query  506  VSATCQTRLLLS-RPLSDGHPIRIRP--ADPNAPVVLTSRLQSFESIVDMPQVCLGNVYW  336
              + C + +++S   L +G PI I P  ADP + VVL S  Q+F   +   ++C+ NV W
Sbjct  78   TMSKCASDVIVSPNDLDNGDPITITPATADPESTVVLASTYQTFRFNIATNKLCVNNVNW  137

Query  335  AIRYEASSG  309
             I+++++SG
Sbjct  138  GIQHDSASG  146



>gb|AAB52549.1| sporamin [Ipomoea batatas]
Length=121

 Score = 87.8 bits (216),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 67/116 (58%), Gaps = 4/116 (3%)
 Frame = -1

Query  446  IRIRPA--DPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQFVPS  273
            I I PA  DP + VV+ S  Q+F   +   ++C+ NV W I+++++SG Y L   +FV  
Sbjct  1    ITITPATADPESTVVMASTYQTFRFNIATNKLCVNNVNWGIQHDSASGQYFLKAGEFVSD  60

Query  272  LSSQFMIEVVPEH-KAYKFTYCPFGGHKCYNVGLVFGP-FRNLRLALSENSFFSIV  111
             S+QF IE+V  +   YK TYC FG  KCYNVG       R  RLALS + F  ++
Sbjct  61   NSNQFKIELVDANLNFYKLTYCQFGSDKCYNVGRFHDHMLRTTRLALSNSPFVFVI  116



>gb|AAB52550.1| sporamin [Ipomoea batatas]
Length=171

 Score = 83.2 bits (204),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 62/107 (58%), Gaps = 2/107 (2%)
 Frame = -1

Query  425  PNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQFVPSLSSQFMIEV  246
            P + VV+ S  Q+F   +   ++C+ NV W I+Y+++S   +L   +FV   S+QF IEV
Sbjct  60   PESTVVMASTYQTFRFNIATNKLCVNNVNWGIQYDSASVQSLLKAGEFVSDNSNQFKIEV  119

Query  245  VPEH-KAYKFTYCPFGGHKCYNVGLVFGP-FRNLRLALSENSFFSIV  111
            V  +   YK TYC FG  KCYNVG    P  R  RLALS   FF ++
Sbjct  120  VDANLNFYKLTYCLFGSDKCYNVGRFKDPMLRTTRLALSSYPFFFVI  166



>ref|XP_007036746.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21247.1| 21 kDa seed protein [Theobroma cacao]
Length=219

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 90/191 (47%), Gaps = 16/191 (8%)
 Frame = -1

Query  635  VAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSRPL  462
            VA A  +PVLD+DGDELR G  YY+ S   G  G  +   RV      +C   ++     
Sbjct  23   VARADESPVLDSDGDELRTGVEYYVVSAIWGAGGGGLALGRV---TGQSCPEIVVQRGSD  79

Query  461  SDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQ  285
             DG P+    AD    VV  S   + E +    ++CL +  W +  Y+ S+G + + T  
Sbjct  80   DDGLPVIFSNADGKDGVVRLSTDVNIEFVPIRDRLCLTSTVWKLDDYDPSTGKWWVTTDG  139

Query  284  FVP-----SLSSQFMIEVVPEHKAYKFTYCPFGGHKCYNVGLVFGPFRN---LRLALSEN  129
                    +L+S F IE       YKF +CP     C ++   FG   +   +RLALSEN
Sbjct  140  VKGDPGHNTLTSWFKIEDAGA-LGYKFRFCPSVCDSCIHLCNDFGRHGHDGQVRLALSEN  198

Query  128  SFFSIVFKKAR  96
              +  +FKKAR
Sbjct  199  G-WPWIFKKAR  208



>ref|XP_007036750.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21251.1| 21 kDa seed protein [Theobroma cacao]
Length=219

 Score = 65.5 bits (158),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 63/191 (33%), Positives = 90/191 (47%), Gaps = 16/191 (8%)
 Frame = -1

Query  635  VAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSRPL  462
            VA A  +PVLD+DGDELR G  YY+ S   G  G  +   RV      +C   ++     
Sbjct  23   VARADESPVLDSDGDELRTGVEYYVVSAIWGAGGGGLALGRV---TGQSCPEIVVQRGSD  79

Query  461  SDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQ  285
             DG P+    AD    VV  S   + E +    ++CL +  W +  Y+ S+G + + T  
Sbjct  80   DDGLPVIFSNADGKDGVVRLSTDVNIEFVPIRDRLCLTSTVWKLDDYDPSTGKWWVTTDG  139

Query  284  FVP-----SLSSQFMIEVVPEHKAYKFTYCPFGGHKCYNVGLVFGPFRN---LRLALSEN  129
                    +L+S F IE       YKF +CP     C ++   FG   +   +RLALSEN
Sbjct  140  VKGDPGHNTLTSWFKIENAGA-LGYKFRFCPSVCDSCIHLCNDFGRHGHDGQVRLALSEN  198

Query  128  SFFSIVFKKAR  96
              +  +FKKAR
Sbjct  199  G-WPWIFKKAR  208



>ref|XP_002265965.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35463.3| unnamed protein product [Vitis vinifera]
Length=205

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 98/204 (48%), Gaps = 29/204 (14%)
 Frame = -1

Query  668  SFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVG-VRVDWPVSA  498
            +FNP  LP A  A A+  PVLD +G +LR+G  YYI  +  G  G L V  VR     + 
Sbjct  17   AFNP--LPGA--AEAAPDPVLDIEGKQLRSGVDYYILPVIRGRGGGLTVASVR-----NK  67

Query  497  TCQTRLLLSR-PLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYE  321
            TC   ++  +  +S G P+   P +P   V+  S   + +       +C  +  W + Y+
Sbjct  68   TCPLDVVQDKLEVSHGLPLTFTPVNPKQDVIRVSTDHNIK--FSAATICAQSTVWKLEYD  125

Query  320  ASSGDYILNTTQFV-----PSLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-V  171
             S+G   + T          +LS+ F IE   +   YK  +CP    F    C +VG+ +
Sbjct  126  ESTGQRFITTGGVEGNPGRGTLSNWFKIEKYGDD--YKLVFCPTVCNFCKVICRDVGVYI  183

Query  170  FGPFRNLRLALSENSFFSIVFKKA  99
               +R  RLAL+ ++ F ++FKKA
Sbjct  184  QKGYR--RLALTTDAPFRVMFKKA  205



>ref|XP_011072079.1| PREDICTED: miraculin [Sesamum indicum]
Length=206

 Score = 62.8 bits (151),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 89/185 (48%), Gaps = 22/185 (12%)
 Frame = -1

Query  614  PVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PLSDGHPI  444
            PVLDTD + +RAG  YYI  +  G  G L +    +     TC   ++  +  + +G P+
Sbjct  31   PVLDTDRNLVRAGVDYYILPVIRGRGGGLTLASTGN----ETCPLDVVQEQLEVRNGLPL  86

Query  443  RIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFV----  279
              RP +P   VV  S  Q+ +       +C+ +  W +  Y+AS+G Y + T        
Sbjct  87   TFRPVNPKKGVVRVSTDQNIK--FSGATICVQSTVWKLDNYDASTGKYFITTGGVEGKPG  144

Query  278  -PSLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGLVFGPFRNLRLALSENSFFSI  114
              ++S+ F IE   +   YK  +CP    +    C +VG +F      RLAL+E++ F +
Sbjct  145  RETISNWFKIETYGDD--YKLVFCPTVCNYCKVICKDVG-IFMQDGKRRLALTEDAPFRV  201

Query  113  VFKKA  99
            + KKA
Sbjct  202  MLKKA  206



>emb|CDP16462.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 59/199 (30%), Positives = 85/199 (43%), Gaps = 36/199 (18%)
 Frame = -1

Query  632  AVASGTPVLDTDGDELRAGETYYI---------------NSIGNPGALIVGVRVDWPVSA  498
            A     PVLD DGDE+RAG  YYI                SIGN    +       PV  
Sbjct  20   AAEKPNPVLDHDGDEIRAGVEYYIVSSIRGAGGGGVTYGRSIGNESCPL-------PV--  70

Query  497  TCQTRLLLSRPLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEA  318
              Q +L L R    GHP+   P +    VV  S   + +     P VC  +  W + ++ 
Sbjct  71   -VQEKLDLLR----GHPVTFTPVNSKEGVVRVSTDLNIKFSKAAP-VCNESNVWKLDFDE  124

Query  317  SSGDYIL--NTTQFVP---SLSSQFMIEVVPEHKAYKFTYCPFGGHKCYNVGLVFGPFRN  153
              G + +  N  +  P   ++ + F IE  P HK+Y+  +CP   + C  +    G F +
Sbjct  125  ELGQHFILTNGVEGNPGCGTIHNWFKIEG-PYHKSYRLVFCPTVCNICNVICKDVGVFSD  183

Query  152  LRLALSENSFFSIVFKKAR  96
             RLAL     F++  +KAR
Sbjct  184  RRLALGGTRSFTVFIQKAR  202



>gb|EYU22302.1| hypothetical protein MIMGU_mgv1a013790mg [Erythranthe guttata]
Length=210

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/199 (31%), Positives = 91/199 (46%), Gaps = 23/199 (12%)
 Frame = -1

Query  650  LPTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLL  477
            +P    A  +  PVLD  G ELRAG  YYI  +  G  G    G+ +    + TC   ++
Sbjct  20   IPLLSSAAEAPPPVLDISGKELRAGVNYYILPVIRGRGG----GLSLASTGNNTCPLSVV  75

Query  476  LSR-PLSDGHPIRIRPADPNAPVVLTSRLQSFESI-VDMPQVCLGNVYWAIRYEASSGDY  303
              +  L  G P+   P DP   VV   RL +  +I      +C+ +  W +  + S+G Y
Sbjct  76   QEQSELKKGLPLTFHPVDPKKGVV---RLSTDHNIKFSASTICVQSTVWRLDNDESTGKY  132

Query  302  ILNTTQF-----VPSLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGLVFGP-FRN  153
             +NT          S+S+ F IE       YK  +CP    F    C +VG+V     R 
Sbjct  133  FVNTGGVEGNPGSGSISNWFKIEAYGSSD-YKLLFCPTVCNFCKVICRDVGIVVQDGKRR  191

Query  152  LRLALSEN-SFFSIVFKKA  99
            L L L+++ + F I+FKKA
Sbjct  192  LGLTLTDDVTPFPIMFKKA  210



>ref|XP_008778295.1| PREDICTED: miraculin, partial [Phoenix dactylifera]
Length=184

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 85/192 (44%), Gaps = 23/192 (12%)
 Frame = -1

Query  689  LPNPTHSS------FNPIRLPTADVAVASGTPVLDTDGDELRAGETYYI--NSIGNPGAL  534
            +PNPT S+      F+   L ++   +A+   VLD DG+ELR G  YYI        G L
Sbjct  1    MPNPTTSTMKLILLFSAFFLLSSLTTLAAAEVVLDRDGNELRRGVEYYIYPGITDVAGGL  60

Query  533  IVGVRVDWPVSATCQTRLLLS-RPLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQV  357
             +  R     + +C   + L+  P S+G P+   PADP    + TS       +     +
Sbjct  61   TLASR-----NHSCPLDVTLAISPTSNGLPLTFLPADPEEDTINTS--TDLNIVFSAVTI  113

Query  356  CLGNVYWAIRYEASSGDYILNTTQFV-----PSLSSQFMIEVVPEHKAYKFTYCPFGGHK  192
            C+ +  W + ++ ++G + + T          +L++ F IE   +  AYK  +CP     
Sbjct  114  CVQSTVWKLDFDDAAGRFYVTTGGVAGNPGRETLANWFKIE--NDRGAYKLVFCPTVCDI  171

Query  191  CYNVGLVFGPFR  156
            C  V    G +R
Sbjct  172  CKPVCGNLGVYR  183



>gb|AAV41234.1| putative 21 kDa trypsin inhibitor [Theobroma microcarpum]
Length=221

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 87/194 (45%), Gaps = 22/194 (11%)
 Frame = -1

Query  635  VAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQT--RLLLSR--  468
            VA A+ +PVLD DGDELR G  YY+ S                  AT Q+   +++ R  
Sbjct  23   VANAANSPVLDIDGDELRTGVQYYVVSALWGAGGGGLA----LGRATGQSCPEIVVQRRS  78

Query  467  PLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNT  291
             L DG P+    AD    VV  S   + E +    ++C  +  W +  Y+ S+G + + T
Sbjct  79   DLDDGTPVIFSNADSKDGVVRVSTDINIEFVPIRDRLCTTSTVWKLDNYDNSAGKWWVTT  138

Query  290  TQF-----VPSLSSQFMIEVVPEHK-AYKFTYCPFGGHKCYNVGLVFGPFRN----LRLA  141
                      ++SS F IE  P     YKF +CP     C  +    G   +    +RLA
Sbjct  139  DGVKGDPGASTMSSWFKIE--PAGGIGYKFRFCPSVCDSCTKLCSDIGKHSDDDGQIRLA  196

Query  140  LSENSFFSIVFKKA  99
            LS+ S +  +FKKA
Sbjct  197  LSD-SGWPWIFKKA  209



>ref|XP_010416122.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=207

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 88/188 (47%), Gaps = 20/188 (11%)
 Frame = -1

Query  629  VASGTPVLDTDGDELRAGETYYINSI-GNPGALIVGVRVDWPVSATCQTRLLL-SRPLSD  456
            +A+  PVLD DGD +  G  Y +  I G  G L +  R D P    C   ++  S  + +
Sbjct  19   IANAQPVLDIDGDIIFDGSYYVLPVIRGQGGGLTLAGRGDQP----CPLDIVQESSEVDE  74

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI----RYEASSGDYILNTT  288
            G P++          V  S   + E+ V    +C+ + YW +    ++  ++G       
Sbjct  75   GIPVKFSNWRSRVGFVPESENLNIETDV-AATICVQSTYWWVDTKAKFRVTAGPKPEEE-  132

Query  287  QFVPSLSSQFMIEVVPEHKAYKFTYCPFGGHKCYNVGLVFGPFRNLRLAL---SENSFFS  117
                SL S F I+ V +H  Y+F +CP G   CY+VG+        RLAL   S+N+ F 
Sbjct  133  ----SLLSFFQIQNVYDH-YYQFAFCPSGPKGCYDVGIFVDENGVRRLALTKRSDNTPFL  187

Query  116  IVFKKARL  93
            ++FKKA +
Sbjct  188  VMFKKANV  195



>ref|XP_010918417.1| PREDICTED: miraculin-like [Elaeis guineensis]
Length=199

 Score = 60.5 bits (145),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 49/188 (26%), Positives = 82/188 (44%), Gaps = 18/188 (10%)
 Frame = -1

Query  629  VASGTPVLDTDGDELRAGETYYI--NSIGNPGALIVGVRVDWPVSATCQTRLLLS-RPLS  459
            +A+G  VLDTDG+ELR G  YYI        G L +  R     + +C   + L+  P +
Sbjct  19   LAAGEVVLDTDGNELRRGVEYYIYPGITDVAGGLTLASR-----NHSCPLDVTLAISPTN  73

Query  458  DGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQFV  279
            +G P+   PADP    + TS       +     +CL +  W + ++ ++  + + T    
Sbjct  74   NGLPVTFLPADPEEDTINTS--TDLNIVFSAFTICLQSTAWKLDFDNTTRRFYVTTGGVT  131

Query  278  -----PSLSSQFMIEVVPEHKAYKFTYCPFGGHKCYNVGLVFGPFRN---LRLALSENSF  123
                  +L + F I+       Y   +CP   + C  V    G  R    LRL +S ++ 
Sbjct  132  GNPGRETLDNWFKIQSASGRSGYNLVFCPSVCNICRPVCGSLGVVREDGRLRLGISSDAP  191

Query  122  FSIVFKKA  99
              + F++A
Sbjct  192  LPVEFRRA  199



>emb|CAN65022.1| hypothetical protein VITISV_027379 [Vitis vinifera]
Length=203

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/196 (28%), Positives = 93/196 (47%), Gaps = 24/196 (12%)
 Frame = -1

Query  647  PTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLL  474
            P +  A ++  PVLDT+G +LR+G  YYI  +  G  G L +    +     +C   ++ 
Sbjct  19   PFSVAAESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGN----ESCPLDVVQ  74

Query  473  S-RPLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYIL  297
              + +S+G P+   P +P   V+  S   + +       +C+ +  W + Y+ SSG + +
Sbjct  75   EQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIK--FSASTICVQSTLWKLEYDESSGQWFV  132

Query  296  NTTQFV-----PSLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLR  147
             T          +L + F IE   +   YK  +CP    F    C ++G+ +   +R  R
Sbjct  133  TTGGVEGNPGRETLDNWFKIEKYEDD--YKLVFCPTVCDFCKPVCGDIGIYIQNGYR--R  188

Query  146  LALSENSFFSIVFKKA  99
            LALS+   F ++FKKA
Sbjct  189  LALSDVP-FKVMFKKA  203



>ref|XP_010428240.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=210

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 90/191 (47%), Gaps = 23/191 (12%)
 Frame = -1

Query  629  VASGTPVLDTDGDELRAGETYYINSI-GNPGALIVGVRVDWPVSATCQTRLLL-SRPLSD  456
            +A+  PVLDTDGD +  G  Y +  I G  G L +  R D P    C   ++  S  + +
Sbjct  20   IANAQPVLDTDGDIIFGGSYYVLPVIRGQGGGLTLAGRGDQP----CPLDIVQESSEVDE  75

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI----RYEASSG---DYIL  297
            G P++          V  S   + E+ V    +C+ + YW +    ++  ++G   D ++
Sbjct  76   GIPVKFSNWRSKVGFVPESANLNIETEV-AATICVQSAYWWVDENAKFRVTAGPKPDELV  134

Query  296  NTTQFVPSLSSQFMIEVVPEHKAYKFTYCPFGGHKCYNVGLVFGPFRNLRLALS---ENS  126
                   S  S F I+ V +H  Y+F +CP G   C +VG+        RLAL+   +N+
Sbjct  135  KE-----SYLSFFQIQNVYDH-FYQFAFCPTGPKSCSDVGVFVDENGVRRLALTKRADNT  188

Query  125  FFSIVFKKARL  93
             F ++FKKA +
Sbjct  189  PFLVMFKKANV  199



>emb|CAN75396.1| hypothetical protein VITISV_028636 [Vitis vinifera]
Length=203

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 92/196 (47%), Gaps = 24/196 (12%)
 Frame = -1

Query  647  PTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLL  474
            P +  A ++  PVLDT+G +LR+G  YYI  +  G  G L +    +     TC   ++ 
Sbjct  19   PFSVAAESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGN----ETCPLDVVQ  74

Query  473  S-RPLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYIL  297
              + +S+G P+   P +P   V+  S   + +       +C+ +  W + Y+ SSG   +
Sbjct  75   EQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIK--FSASTICVQSTLWKLEYDESSGQRFV  132

Query  296  NTTQFV-----PSLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLR  147
             T          +L + F IE   +   YK  +CP    F    C ++G+ +   +R  R
Sbjct  133  TTGGVEGNPGRETLDNWFKIEKYEDD--YKLVFCPTVCDFCKPVCGDIGIYIQNXYR--R  188

Query  146  LALSENSFFSIVFKKA  99
            LALS+   F ++FKKA
Sbjct  189  LALSDVP-FKVMFKKA  203



>ref|XP_010428249.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
 ref|XP_010428250.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=208

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 88/188 (47%), Gaps = 20/188 (11%)
 Frame = -1

Query  629  VASGTPVLDTDGDELRAGETYYINSI-GNPGALIVGVRVDWPVSATCQTRLLL-SRPLSD  456
            +A+  PVLD DGD +  G  Y +  I G  G L +  R D P    C   ++  S  + +
Sbjct  20   IANAQPVLDIDGDIIFRGSYYVLPVISGQGGGLTLAGRGDQP----CPLDIVQESSEVDE  75

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI----RYEASSGDYILNTT  288
            G P++          V  S   + E+ V    +C+ + YW +    ++  ++G       
Sbjct  76   GIPVKFSNWRSRVGFVPESENLNIETDVKA-TICVQSTYWWVDTKAKFRVTAGPKPEEE-  133

Query  287  QFVPSLSSQFMIEVVPEHKAYKFTYCPFGGHKCYNVGLVFGPFRNLRLAL---SENSFFS  117
                SL S F I+ V +H  Y+F +CP G   CY+VG+        RLAL   ++++ F 
Sbjct  134  ----SLLSFFQIQHVYDH-FYQFAFCPSGPKGCYDVGIFVDENGVRRLALTKRTDDTPFL  188

Query  116  IVFKKARL  93
            ++FKKA +
Sbjct  189  VMFKKANV  196



>gb|AAV41231.1| putative 21 kDa trypsin inhibitor [Theobroma cacao]
Length=221

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 83/189 (44%), Gaps = 12/189 (6%)
 Frame = -1

Query  635  VAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQTRLLLSRPLSD  456
            VA A+ +P+LDTDGDEL+ G  YY+ S  +             V +  +  +     L +
Sbjct  23   VANAANSPLLDTDGDELQTGVQYYVLSSISGAGGGGLALEGVQVQSCPEIVVQRRSELDN  82

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFV  279
            G P+    AD    VV  S   + E +    ++C  +  W +  Y+ S+G + L T    
Sbjct  83   GTPVIFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWLATDGVK  142

Query  278  -----PSLSSQFMIEVVPEHKAYKFTYCPFGGHKCYNVGLVFGPFRN----LRLALSENS  126
                  +L S F IE       YKF +CP     C  +    G   +    +RLA S+N 
Sbjct  143  GETGPNTLCSWFKIE-KSGVLGYKFRFCPSACDSCTTLCSDIGRHSDDDGQIRLAFSDNG  201

Query  125  FFSIVFKKA  99
             ++ +FKKA
Sbjct  202  -WAWMFKKA  209



>emb|CDP19136.1| unnamed protein product [Coffea canephora]
Length=216

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 54/193 (28%), Positives = 85/193 (44%), Gaps = 15/193 (8%)
 Frame = -1

Query  632  AVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRV-DWPVSATCQTRLLLSRP-LS  459
            A     PV+D +G+E+R G  YY+ S+  PG    GV     P +  C   ++ +RP  +
Sbjct  20   ATEKPNPVVDFNGEEIRPGVDYYVVSV-FPGGRGSGVTYGKGPGNEICPLAVVQARPDFN  78

Query  458  DGHPIRIRPADPNAPVV-LTSRLQSFESIVDMPQVCLGNVYWAIRY-EASSGDYILNT--  291
             GHP+   P +P   VV +++ L    S       C G+  W + + EA    ++L    
Sbjct  79   RGHPVTFTPVNPEESVVRVSTDLNIKFSEPPFINFCRGSNVWKVHFNEALKQHFVLTDGV  138

Query  290  --TQFVPSLSSQFMIEVVPEHKAYKFTYCPFGGHK-----CYNVGLVFGPFRNLRLALSE  132
                   + ++ F IE+   +  YKF +CP          C +VG+ +      RLALS+
Sbjct  139  EGNSGCETEANWFKIELT-GNVGYKFVFCPAVCDSSSEAICKDVGIYYDDDGTRRLALSD  197

Query  131  NSFFSIVFKKARL  93
              F     KK  L
Sbjct  198  QPFVVFFIKKMDL  210



>emb|CBI35464.3| unnamed protein product [Vitis vinifera]
Length=225

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 92/196 (47%), Gaps = 24/196 (12%)
 Frame = -1

Query  647  PTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLL  474
            P +  A ++  PVLDT+G +LR+G  YYI  +  G  G L +    +     TC   ++ 
Sbjct  41   PFSVAAESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGN----ETCPLDVVQ  96

Query  473  S-RPLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYIL  297
              + +S+G P+   P +P   V+  S   + +       +C+ +  W + Y+ SSG   +
Sbjct  97   EQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIK--FSASTICVQSTLWKLEYDESSGQRFV  154

Query  296  NTTQFV-----PSLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLR  147
             T          +L + F IE   +   YK  +CP    F    C ++G+ +   +R  R
Sbjct  155  TTGGVEGNPGRETLDNWFKIEKYEDD--YKLVFCPTVCDFCKPVCGDIGIYIQNEYR--R  210

Query  146  LALSENSFFSIVFKKA  99
            LALS+   F ++FKKA
Sbjct  211  LALSDVP-FKVMFKKA  225



>gb|AIT42186.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=213

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 87/202 (43%), Gaps = 16/202 (8%)
 Frame = -1

Query  677  THSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSA  498
            T +S NPI LP+        TPVLD  G EL    +Y I SIG  GAL   V +    ++
Sbjct  20   TFTSQNPINLPS------DATPVLDVTGKELDPRLSYRIISIGR-GALGGDVYLGKSPNS  72

Query  497  TCQTRLLLSRPLSD----GHPIR-IRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWA  333
                   + R  SD    G P+R I  +    P +    L + +  +   ++C+    W 
Sbjct  73   DAPCANGVFRYNSDVGPSGTPVRFIGSSSHFGPHIFEDELLNIQFAISTSKLCVSYTIWK  132

Query  332  I-RYEASSGDYILNTTQFVPSLSSQFMIEVVPEHKAYKFTYCPFGGHK--CYNVGLVFGP  162
            +  Y+AS G  +L T   +    S +   V      Y   YCPF      C  VG+V   
Sbjct  133  VGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLGYNLLYCPFSSDDQFCLKVGVVHQN  192

Query  161  FRNLRLALSENSFFSIVFKKAR  96
             +  RLAL +++   + FK+ +
Sbjct  193  GKR-RLALVKDNPLDVSFKQVQ  213



>prf||1802409A albumin
Length=221

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 85/190 (45%), Gaps = 14/190 (7%)
 Frame = -1

Query  635  VAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQTRLLLSRP-LS  459
            VA A+ +PVLDTDGDEL+ G  YY+ S  +                +C   ++  R  L 
Sbjct  23   VANAANSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGR-ATGQSCPEIVVQRRSDLD  81

Query  458  DGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQF  282
            +G P+    AD    VV  S   + E +    ++C  +  W +  Y+ S+G + + T   
Sbjct  82   NGTPVIFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGV  141

Query  281  V-----PSLSSQFMIEVVPEHKAYKFTYCPFGGHKCYNVGLVFGPFRN----LRLALSEN  129
                   +L S F IE       YKF +CP     C  +    G   +    +RLALS+N
Sbjct  142  KGEPGPNTLCSWFKIEKAGVL-GYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLALSDN  200

Query  128  SFFSIVFKKA  99
              ++ +FKKA
Sbjct  201  E-WAWMFKKA  209



>ref|XP_007036743.1| 21 kDa seed protein [Theobroma cacao]
 sp|P32765.1|ASP_THECC RecName: Full=21 kDa seed protein; Flags: Precursor [Theobroma 
cacao]
 pir||S16252 trypsin inhibitor homolog - soybean
 emb|CAA39860.1| 21 kDa seed protein [Theobroma cacao]
 gb|EOY21244.1| 21 kDa seed protein [Theobroma cacao]
Length=221

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 85/190 (45%), Gaps = 14/190 (7%)
 Frame = -1

Query  635  VAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQTRLLLSRP-LS  459
            VA A+ +PVLDTDGDEL+ G  YY+ S  +                +C   ++  R  L 
Sbjct  23   VANAANSPVLDTDGDELQTGVQYYVLSSISGAGGGGLALGR-ATGQSCPEIVVQRRSDLD  81

Query  458  DGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQF  282
            +G P+    AD    VV  S   + E +    ++C  +  W +  Y+ S+G + + T   
Sbjct  82   NGTPVIFSNADSKDDVVRVSTDVNIEFVPIRDRLCSTSTVWRLDNYDNSAGKWWVTTDGV  141

Query  281  V-----PSLSSQFMIEVVPEHKAYKFTYCPFGGHKCYNVGLVFGPFRN----LRLALSEN  129
                   +L S F IE       YKF +CP     C  +    G   +    +RLALS+N
Sbjct  142  KGEPGPNTLCSWFKIEKAGVL-GYKFRFCPSVCDSCTTLCSDIGRHSDDDGQIRLALSDN  200

Query  128  SFFSIVFKKA  99
              ++ +FKKA
Sbjct  201  E-WAWMFKKA  209



>gb|ADD51186.1| tumor-related protein [Vitis cinerea var. helleri x Vitis riparia]
Length=203

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 92/196 (47%), Gaps = 24/196 (12%)
 Frame = -1

Query  647  PTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLL  474
            P +  A ++  PVLDT+G +LR+G  YYI  +  G  G L +    +     TC   ++ 
Sbjct  19   PFSVAAESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGN----ETCPLDVVQ  74

Query  473  S-RPLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYIL  297
              + +S+G P+   P +P   V+  S   + +       +C+ +  W + Y+ SSG   +
Sbjct  75   EQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIK--FSASTICVQSTLWKLEYDESSGQRFV  132

Query  296  NTTQFV-----PSLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLR  147
             T          +L + F IE   +   YK  +CP    F    C ++G+ +   +R  R
Sbjct  133  TTGGVEGNPGRETLDNWFKIEKYDDD--YKLVFCPTVCDFCKPVCGDIGIYIQNGYR--R  188

Query  146  LALSENSFFSIVFKKA  99
            LALS+   F ++FKKA
Sbjct  189  LALSDVP-FKVMFKKA  203



>gb|AAV41233.1| putative 21 kDa trypsin inhibitor [Theobroma bicolor]
Length=221

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 61/194 (31%), Positives = 92/194 (47%), Gaps = 22/194 (11%)
 Frame = -1

Query  635  VAVASGTPVLDTDGDELRAGETYY-INSIGNPGALIVGVRVDWPVSATCQT--RLLLSR-  468
            VA A+ +PVLDTDGDELR G  YY ++SI   G   + +       AT Q+   +++ R 
Sbjct  23   VANAANSPVLDTDGDELRTGVRYYVVSSIWGAGGGGLAL-----GRATGQSCPEIVVQRR  77

Query  467  -PLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILN  294
              L +G P+    AD    VV  S   + E +    ++C  +  W +  Y+ S+G + + 
Sbjct  78   SDLDNGTPVIFSNADSKDGVVRLSTDINIEFVPIRDRLCSTSTVWKLDNYDNSAGKWWVT  137

Query  293  TTQFVP-----SLSSQFMIEVVPEHKAYKFTYCPFGGHKCYNVGLVFGPFRN----LRLA  141
            T          +L+S F IE       YKF +CP     C  +    G   +    +RLA
Sbjct  138  TDGVRGQPGPNTLTSWFKIERAGVL-GYKFRFCPSVCDSCKTLCSDIGRHSDDDGQIRLA  196

Query  140  LSENSFFSIVFKKA  99
            LS+N  +  +FKKA
Sbjct  197  LSDNG-WPWMFKKA  209



>emb|CAN81015.1| hypothetical protein VITISV_025776 [Vitis vinifera]
Length=203

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 89/191 (47%), Gaps = 24/191 (13%)
 Frame = -1

Query  632  AVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PL  462
            A +S  PVLDT+G +LR+G  YYI  +  G  G L +    +      C   ++  +  +
Sbjct  24   AESSPDPVLDTEGKQLRSGVDYYILPVIRGRGGGLTLASTGN----ENCPLDVVQEQHEV  79

Query  461  SDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQF  282
            S+G P+   P +P   V+  S   + +       +C+ +  W + Y+ SSG   + T   
Sbjct  80   SNGLPLTFTPVNPKKGVIRVSTDHNIK--FSASTICVQSTLWKLEYDESSGQRFVTTGGV  137

Query  281  -----VPSLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLRLALSE  132
                   +L + F IE   +   YK  +CP    F    C ++G+ +   +R  RLALS+
Sbjct  138  EGNPGXETLDNWFKIEKYEDD--YKLVFCPTVCDFCKPVCGDIGIYIQNGYR--RLALSD  193

Query  131  NSFFSIVFKKA  99
               F ++FKKA
Sbjct  194  VP-FKVMFKKA  203



>ref|XP_002266430.1| PREDICTED: miraculin [Vitis vinifera]
Length=203

 Score = 57.8 bits (138),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 91/196 (46%), Gaps = 24/196 (12%)
 Frame = -1

Query  647  PTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLL  474
            P +  A ++  PVLDT+G +LR+G  YYI  +  G  G L +    +     TC   ++ 
Sbjct  19   PFSVAAESAPDPVLDTEGKKLRSGVDYYILPVFRGRGGGLTLASTGN----ETCPLDVVQ  74

Query  473  S-RPLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYIL  297
              + +S+G P+   P +P   V+  S   + +       +C+ +  W + Y+ SSG   +
Sbjct  75   EQQEVSNGLPLTFTPVNPKKGVIRVSTDHNIK--FSASTICVQSTLWKLEYDESSGQRFV  132

Query  296  NTTQFV-----PSLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLR  147
             T          +L + F IE   +   YK  +CP    F    C ++G+ +   +R  R
Sbjct  133  TTGGVEGNPGRETLDNWFKIEKYEDD--YKLVFCPTVCDFCKPVCGDIGIYIQNEYR--R  188

Query  146  LALSENSFFSIVFKKA  99
            LALS+   F + FKKA
Sbjct  189  LALSDVP-FKVKFKKA  203



>gb|KCW48670.1| hypothetical protein EUGRSUZ_K02326 [Eucalyptus grandis]
Length=203

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 89/188 (47%), Gaps = 22/188 (12%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQTRLLLS-RPLSDGH  450
            A+ +PVLDTDG EL+ G  Y+I  +       + +      S  C   ++   + LSDG 
Sbjct  26   AASSPVLDTDGHELQTGVNYHILPVLRGRGGGLTLGA--SRSGNCPLAVVQEQQELSDGL  83

Query  449  PIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI--------RYEASSGDYILN  294
            P +  P D N+ + L++ L  +    D   +C+ +  W +        +Y   SG  + N
Sbjct  84   PAKFSPVDGNSTIRLSTDLNVW---FDAATICVQSTVWRLAAFDEEVKQYFVESGGVLGN  140

Query  293  TTQFVPSLSSQFMIEVVPEHKAYKF--TYCPFGGHKCYNVGL-VFGPFRNLRLALSENSF  123
              +   ++S+ F IE V E   ++F  T C      C +VG+ V G  R  RLALS+   
Sbjct  141  PGR--ETVSNWFKIEKVDEDYNFRFCPTVCDTCRVICRDVGIYVDGSTR--RLALSDEP-  195

Query  122  FSIVFKKA  99
            F + F+KA
Sbjct  196  FRVKFRKA  203



>sp|Q41484.1|SPI5_SOLTU RecName: Full=Serine protease inhibitor 5; AltName: Full=gCDI-B1; 
Flags: Precursor [Solanum tuberosum]
 dbj|BAA04152.1| proteinase inhibitor [Solanum tuberosum]
 gb|ABB72795.1| Kunitz-type protease inhibitor-like protein [Solanum tuberosum]
 gb|AIT42169.1| Kunitz-type inhibitor B [Solanum tuberosum]
Length=213

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 87/202 (43%), Gaps = 16/202 (8%)
 Frame = -1

Query  677  THSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSA  498
            T +S NPI LP+        TPVLD  G EL    +Y I SIG  GAL   V +    ++
Sbjct  20   TFTSQNPINLPS------DATPVLDVTGKELDPRLSYRIISIGR-GALGGDVYLGKSPNS  72

Query  497  TCQTRLLLSRPLSD----GHPIR-IRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWA  333
                   + R  SD    G P+R I  +    P +    L + +  +   ++C+    W 
Sbjct  73   DAPCANGVFRFNSDVGPSGTPVRFIGSSSHFGPHIFEGELLNIQFDISTVKLCVSYTIWK  132

Query  332  I-RYEASSGDYILNTTQFVPSLSSQFMIEVVPEHKAYKFTYCPFGGHK--CYNVGLVFGP  162
            +  Y+AS G  +L T   +    S +   V      Y   YCPF      C  VG+V   
Sbjct  133  VGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLGYNLLYCPFSSDDQFCLKVGVVHQN  192

Query  161  FRNLRLALSENSFFSIVFKKAR  96
             +  RLAL +++   + FK+ +
Sbjct  193  GKR-RLALVKDNPLDVSFKQVQ  213



>ref|XP_010428238.1| PREDICTED: trypsin inhibitor BvTI-like [Camelina sativa]
Length=209

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 88/191 (46%), Gaps = 23/191 (12%)
 Frame = -1

Query  629  VASGTPVLDTDGDELRAGETYYINSI-GNPGALIVGVRVDWPVSATCQTRLLL-SRPLSD  456
            +A+  PVLDTDGD +  G  Y +  I G  G L +  R D P    C   ++  S  + +
Sbjct  19   IANAQPVLDTDGDIIFDGSYYVLPVIRGQGGGLTLAGRGDQP----CPLDIVQESSEVDE  74

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI----RYEASSG---DYIL  297
            G P++          V  S   + E+ V    +C+   YW +    ++  ++G   D ++
Sbjct  75   GIPVKFSNWRSKVGFVPESENLNIETEV-AATICVQLAYWWVDENAKFRVTAGPKPDELV  133

Query  296  NTTQFVPSLSSQFMIEVVPEHKAYKFTYCPFGGHKCYNVGLVFGPFRNLRLAL---SENS  126
                   S  S F I+ V +H  Y+F +CP G   C +VG+        RL L   S+N+
Sbjct  134  KE-----SYLSFFQIQNVYDH-FYQFAFCPTGPKSCSDVGVFVDENGVRRLVLTKRSDNT  187

Query  125  FFSIVFKKARL  93
             F ++FKKA +
Sbjct  188  PFLVMFKKANV  198



>ref|XP_010037029.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=262

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 89/188 (47%), Gaps = 22/188 (12%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQTRLLLS-RPLSDGH  450
            A+ +PVLDTDG EL+ G  Y+I  +       + +      S  C   ++   + LSDG 
Sbjct  85   AASSPVLDTDGHELQTGVNYHILPVLRGRGGGLTLGAS--RSGNCPLAVVQEQQELSDGL  142

Query  449  PIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI--------RYEASSGDYILN  294
            P +  P D N+ + L++ L  +    D   +C+ +  W +        +Y   SG  + N
Sbjct  143  PAKFSPVDGNSTIRLSTDLNVW---FDAATICVQSTVWRLAAFDEEVKQYFVESGGVLGN  199

Query  293  TTQFVPSLSSQFMIEVVPEHKAYKF--TYCPFGGHKCYNVGL-VFGPFRNLRLALSENSF  123
              +   ++S+ F IE V E   ++F  T C      C +VG+ V G  R  RLALS+   
Sbjct  200  PGR--ETVSNWFKIEKVDEDYNFRFCPTVCDTCRVICRDVGIYVDGSTR--RLALSDEP-  254

Query  122  FSIVFKKA  99
            F + F+KA
Sbjct  255  FRVKFRKA  262



>ref|XP_006441456.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
 gb|ESR54696.1| hypothetical protein CICLE_v10023572mg [Citrus clementina]
Length=206

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 86/189 (46%), Gaps = 24/189 (13%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PLSD  456
            AS  PVLD  G +LRAG  YYI  +  G  G L +  R +   + TC   ++  +  L +
Sbjct  27   ASPDPVLDIAGKQLRAGSKYYILPVTKGQGGGLTLAGRSN---NKTCPLDVVQEQHSLRN  83

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFV  279
            G P+   P +P   VV  S         D    C  +  W +  ++A+ G +++ T    
Sbjct  84   GFPVTFSPVNPKKGVVRES--TDLNIKFDAATSCAQSTVWKLDNFDAALGQWLVTTGGVE  141

Query  278  P-----SLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLRLALSEN  129
                  ++ + F IE    +  YK  +CP    F    C +VG+ + G  R  RLALS+ 
Sbjct  142  GNPGPRTMRNWFKIEKF--YGDYKLVFCPSVCNFCRGLCRDVGIFINGGVR--RLALSDV  197

Query  128  SFFSIVFKK  102
              F +VFKK
Sbjct  198  P-FKVVFKK  205



>ref|XP_010539167.1| PREDICTED: bark lectin isoform 2-like [Tarenaya hassleriana]
Length=205

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 82/184 (45%), Gaps = 11/184 (6%)
 Frame = -1

Query  641  ADVAVASGTPVLDTDGDELRAGETYYI--NSIGNPGALIVGVRVDWPVSATCQTRLLLSR  468
            A  AV     V DT+G+ LR G  Y+I  +S GN G L+   R  + +      + LL  
Sbjct  14   ATCAVCQNDAVSDTNGEPLRPGAEYFIVPDSGGNFGGLVPQSRDVFHICTLDVVQTLL--  71

Query  467  PLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTT  288
            P   G P+    ++    +     +Q FES +    +C  +  W + Y  S+ + ++ T 
Sbjct  72   PFQPGLPVSFVLSEETVRLSTDISIQ-FESPI---WICRSSKVWKVDY--STSEDLITTD  125

Query  287  QFVPSLSSQFMIEVVPEHKAYKFTYCPFGGHKCYNVGLVFGPFRNLRLALSENSFFSIVF  108
                S  S F IE +     YK  +      K  NVGL+ G F   RLAL++ +  S+ F
Sbjct  126  GKTGSEESLFRIEKLESGNDYKLVHLDSRSSKIRNVGLIMGEFGIPRLALTDEA-LSVKF  184

Query  107  KKAR  96
            +  +
Sbjct  185  RPVK  188



>gb|ABB72793.1| Kunitz-type protease inhibitor-like protein [Solanum tuberosum]
Length=213

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 86/202 (43%), Gaps = 16/202 (8%)
 Frame = -1

Query  677  THSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSA  498
            T +S NPI LP+        TPVLD  G EL    +Y I SIG  GAL   V +    ++
Sbjct  20   TFTSQNPINLPS------DATPVLDVTGKELDPRLSYRIISIGR-GALGGDVYLGKSPNS  72

Query  497  TCQTRLLLSRPLSD----GHPIR-IRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWA  333
                   + R  SD    G P+R I  +    P +    L + +  +   ++C     W 
Sbjct  73   DAPCANGVFRFNSDVGPSGTPVRFIGSSSHFGPHIFEGELLNIQFDISTVKLCASYTIWK  132

Query  332  I-RYEASSGDYILNTTQFVPSLSSQFMIEVVPEHKAYKFTYCPFGGHK--CYNVGLVFGP  162
            +  Y+AS G  +L T   +    S +   V      Y   YCPF      C  VG+V   
Sbjct  133  VGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQLGYNLLYCPFSSDDQFCLKVGVVHQN  192

Query  161  FRNLRLALSENSFFSIVFKKAR  96
             +  RLAL +++   + FK+ +
Sbjct  193  GKR-RLALVKDNPLDVSFKQVQ  213



>ref|XP_006441432.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
 gb|ESR54672.1| hypothetical protein CICLE_v10022276mg [Citrus clementina]
Length=206

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 84/189 (44%), Gaps = 24/189 (13%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PLSD  456
            AS  PVLD  G +LRAG  YYI  +  G  G L +  R +   + TC   ++  +    +
Sbjct  27   ASADPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSN---NKTCPVDVVQEQHSFRN  83

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFV  279
            G P+   P +P   VV  S         D    C  +  W +  ++A+ G +++ T    
Sbjct  84   GLPVTFSPVNPKKGVVRES--TDINIKFDAATSCAQSTVWKLDNFDAAIGQWLVTTGGVE  141

Query  278  P-----SLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLRLALSEN  129
                  ++ + F IE       YK  YCP    F    C +VG+ + G  R  RLALS+ 
Sbjct  142  GNPGPRTMRNWFKIEKF--FGDYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDV  197

Query  128  SFFSIVFKK  102
              F +VFKK
Sbjct  198  P-FKVVFKK  205



>ref|XP_010042449.1| PREDICTED: miraculin-like [Eucalyptus grandis]
Length=262

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 56/188 (30%), Positives = 89/188 (47%), Gaps = 22/188 (12%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQTRLLLS-RPLSDGH  450
            A+ +PVLDTDG EL+ G  Y+I  +       + +      S  C   ++   + LSDG 
Sbjct  85   AASSPVLDTDGHELQTGVNYHILPVLRGRGGGLTLGAS--RSGNCPLAVVQEQQELSDGL  142

Query  449  PIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI--------RYEASSGDYILN  294
            P +  P D N+ + L++ L  +    D   +C+ +  W +        +Y   SG  + N
Sbjct  143  PAKFSPVDGNSTIRLSTDLNVW---FDAATICVQSTVWRLAAFDEEVKQYFIESGGVLGN  199

Query  293  TTQFVPSLSSQFMIEVVPEHKAYKF--TYCPFGGHKCYNVGL-VFGPFRNLRLALSENSF  123
              +   ++S+ F IE V E   ++F  T C      C +VG+ V G  R  RLALS+   
Sbjct  200  PGR--ETVSNWFKIEKVDEDYNFRFCPTVCDTCRVICRDVGIYVDGSTR--RLALSDEP-  254

Query  122  FSIVFKKA  99
            F + F+KA
Sbjct  255  FRVKFRKA  262



>ref|XP_003534101.1| PREDICTED: 21 kDa seed protein-like [Glycine max]
 gb|KHM99730.1| Miraculin [Glycine soja]
Length=203

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 87/189 (46%), Gaps = 18/189 (10%)
 Frame = -1

Query  635  VAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-P  465
            +A A+  PVLDT G +LR G  YYI  +  G  G L V    +     TC   ++  +  
Sbjct  23   IASAAQEPVLDTSGQKLRTGVKYYILPVFRGRGGGLTVSSSGN----NTCPLFVVQEKLE  78

Query  464  LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQ  285
            +S G P+   P +  + V+LTS   + +S V     C     W +  +  +G + L+T  
Sbjct  79   VSKGTPVTFTPYNAESGVILTSTDLNIKSYVK-STTCDKPPVWKL-LKVLTGVWFLSTGG  136

Query  284  F-----VPSLSSQFMIEVVPEHKAYKFTYCP-FGGHKCYNVGLVFGPFRNLRLALSENS-  126
                  V ++ + F IE     K Y  ++CP F    C  +GL  G   N  L+LS+   
Sbjct  137  VEGNPGVNTVVNWFKIE--KAEKDYVLSFCPSFAQTLCRELGLYVGDDGNKHLSLSDKVP  194

Query  125  FFSIVFKKA  99
             F ++FK+A
Sbjct  195  SFRVIFKRA  203



>ref|XP_008437082.1| PREDICTED: miraculin [Cucumis melo]
Length=207

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 89/200 (45%), Gaps = 25/200 (13%)
 Frame = -1

Query  656  IRLPTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTR  483
            +R   AD   AS   VLDTDG +LRAG+ YYI S+   N G L +G    +     C   
Sbjct  19   VRFCRAD---ASPDAVLDTDGKKLRAGDQYYILSVYSRNSGGLSIGGIYGY---EKCPIN  72

Query  482  LL-LSRPLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSG  309
            +L  S    DG P    P +P   VV  S   + E   +    C  +  W + +++    
Sbjct  73   ILPESYDYLDGLPATFSPVNPKKGVVRVSTDLNIE--FEASTRCGISTVWKVGKFDQYLK  130

Query  308  DYI--LNTTQFVP---SLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGLVFGPFR  156
             Y   +  T+  P   ++ + F +E     K YKF YCP    +    C +VGL +   R
Sbjct  131  QYFVTMGGTKGNPGRETIGNWFKVE--KHGKNYKFVYCPTVCKYCKVMCKDVGLFYKNGR  188

Query  155  NLRLALSENSFFSIVFKKAR  96
              R+    ++ F ++FKK R
Sbjct  189  --RIFALNDAPFPVMFKKVR  206



>ref|XP_006495064.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 84/185 (45%), Gaps = 24/185 (13%)
 Frame = -1

Query  614  PVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PLSDGHPI  444
            PVLD  G +LRAG  YYI  +  G  G L +  R +   + TC   ++  +    +G P+
Sbjct  31   PVLDISGKQLRAGSKYYILPVTKGRGGGLTLAGRSN---NKTCPVDVVQEQHSFKNGFPV  87

Query  443  RIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFVP---  276
               P +P   VV  S   + +   D    C  +  W +  ++A+ G +++ T        
Sbjct  88   TFSPVNPKKGVVRESTDLNIK--FDAATSCAQSTVWKLDNFDAAFGQWLVTTGGVEGNPG  145

Query  275  --SLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLRLALSENSFFS  117
              ++ + F IE       YK  YCP    F    C +VG+ + G  R  RLALS+   F 
Sbjct  146  PRTMRNWFKIEKF--FGDYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDVP-FK  200

Query  116  IVFKK  102
            +VFKK
Sbjct  201  VVFKK  205



>ref|XP_006441435.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
 gb|ESR54675.1| hypothetical protein CICLE_v10023257mg [Citrus clementina]
Length=206

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 57/189 (30%), Positives = 84/189 (44%), Gaps = 24/189 (13%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PLSD  456
            AS  PVLD  G +LRAG  YYI  +  G  G L +  R +   + TC   ++  +    +
Sbjct  27   ASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSN---NKTCPVDVVQEQHSFRN  83

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFV  279
            G P+   P +P   VV  S         D    C  +  W +  ++A+ G +++ T    
Sbjct  84   GLPVTFSPVNPKKGVVRES--TDLNIKFDAATSCAQSTVWKLDNFDAALGQWLVTTGGVE  141

Query  278  P-----SLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLRLALSEN  129
                  ++ + F IE       YK  YCP    F    C +VG+ + G  R  RLALS+ 
Sbjct  142  GNPGPRTMRNWFKIEKF--FGNYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDV  197

Query  128  SFFSIVFKK  102
              F +VFKK
Sbjct  198  P-FKVVFKK  205



>ref|XP_006441446.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
 gb|ESR54686.1| hypothetical protein CICLE_v10023371mg [Citrus clementina]
Length=206

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 83/189 (44%), Gaps = 24/189 (13%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PLSD  456
            AS  PVLD  G +LRAG  YYI  +  G  G L +  R +   + TC   ++  +    +
Sbjct  27   ASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSN---NKTCLLDVVQEQHSFRN  83

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFV  279
            G P+   P +P   VV  S         D    C  +  W +  ++A  G ++L T    
Sbjct  84   GLPVTFSPVNPKKGVVRES--TDLNIKFDAATSCAQSTVWKLDNFDAVLGQWLLTTGGVE  141

Query  278  P-----SLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLRLALSEN  129
                  ++ + F IE       YK  YCP    F    C +VG+ + G  R  RLALS+ 
Sbjct  142  GNPGPRTMRNWFKIEKF--FGDYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDV  197

Query  128  SFFSIVFKK  102
              F +VFKK
Sbjct  198  P-FKVVFKK  205



>ref|XP_002270111.1| PREDICTED: miraculin [Vitis vinifera]
 emb|CBI35474.3| unnamed protein product [Vitis vinifera]
Length=203

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 53/191 (28%), Positives = 88/191 (46%), Gaps = 24/191 (13%)
 Frame = -1

Query  632  AVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PL  462
            A +S  PVLDT+G +L +G  YYI  +  G  G L +    +      C   ++  +  +
Sbjct  24   AESSPDPVLDTEGKQLWSGVDYYILPVIRGRGGGLTLASTGN----ENCPLDVVQEQHEV  79

Query  461  SDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQF  282
            S+G P+   P +P   V+  S   + +       +C+ +  W + Y+ SSG   + T   
Sbjct  80   SNGLPLTFTPVNPKKGVIRVSTDHNIK--FSASTICVQSTLWKLEYDESSGQRFVTTGGV  137

Query  281  V-----PSLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLRLALSE  132
                   +L + F IE   +   YK  +CP    F    C ++G+ +   +R  RLALS+
Sbjct  138  EGNPGHETLDNWFKIEKYEDD--YKLVFCPTVCDFCKPVCGDIGIYIQNGYR--RLALSD  193

Query  131  NSFFSIVFKKA  99
               F ++FKKA
Sbjct  194  VP-FKVMFKKA  203



>ref|XP_006441438.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
 gb|ESR54678.1| hypothetical protein CICLE_v10023465mg [Citrus clementina]
Length=206

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 87/191 (46%), Gaps = 26/191 (14%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PLSD  456
            AS  PVLD  G +LRAG  YYI  +  G  G L +  R +   + TC   ++  +    +
Sbjct  27   ASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSN---NKTCPLDVVQEQHSFRN  83

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFV  279
            G P+   P +P   VV  S         D    C  +  W +  ++A+ G +++ T    
Sbjct  84   GLPVTFSPVNPKKGVVRES--TDINIKFDAATSCAQSTVWKLDNFDAALGQWLVTTGGVE  141

Query  278  P-----SLSSQFMIEVVPEHKAYKFTYCP-----FGGHKCYNVGL-VFGPFRNLRLALSE  132
                  ++ + F IE    +  YK  +CP     F G  C +VG+ + G  R  RLALS+
Sbjct  142  GNPGPRTMRNWFKIEKF--YGDYKLVFCPSVCNIFRGL-CRDVGIFINGGVR--RLALSD  196

Query  131  NSFFSIVFKKA  99
               F +VFKKA
Sbjct  197  VP-FKVVFKKA  206



>ref|XP_006493430.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 84/185 (45%), Gaps = 24/185 (13%)
 Frame = -1

Query  614  PVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PLSDGHPI  444
            PVLD  G +LRAG  YYI  +  G  G L +  R +   + TC   ++  +    +G P+
Sbjct  31   PVLDISGKQLRAGSKYYILPVTKGRGGGLTLAGRSN---NKTCPVDVVQEQHSFRNGLPV  87

Query  443  RIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFVP---  276
               P +P   VV  S   + +   D    C  +  W +  ++A+ G +++ T        
Sbjct  88   TFSPVNPKKGVVRESTDLNIK--FDAATSCAQSTVWKLDNFDAAFGQWVVTTGGVEGNPG  145

Query  275  --SLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLRLALSENSFFS  117
              ++ + F IE       YK  YCP    F    C +VG+ + G  R  RLALS+   F 
Sbjct  146  PRTMRNWFKIEKF--FGDYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDVP-FK  200

Query  116  IVFKK  102
            +VFKK
Sbjct  201  VVFKK  205



>ref|XP_006441459.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
 gb|ESR54699.1| hypothetical protein CICLE_v10022284mg [Citrus clementina]
Length=206

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 85/189 (45%), Gaps = 24/189 (13%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PLSD  456
            AS  PVLD  G +LRAG  YYI  +  G  G L +  R +   + TC   ++  +    +
Sbjct  27   ASPDPVLDVAGKKLRAGSKYYILPVTKGQGGGLTLAGRSN---NKTCPLDVVQEQHSFRN  83

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFV  279
            G P+   P +P   VV  S    F    D    C  +  W +  ++A+ G +++ T    
Sbjct  84   GLPVTFSPVNPKKGVVRES--TDFNIKFDAATSCAQSTVWKLDNFDAALGQWLVTTGGVE  141

Query  278  P-----SLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLRLALSEN  129
                  ++ + F IE    +  YK  +CP    F    C +VG+ + G  R  RLALS+ 
Sbjct  142  GNPGPRTMRNWFKIEKF--YGDYKLVFCPSVCNFCRGLCRDVGIFINGGVR--RLALSDV  197

Query  128  SFFSIVFKK  102
                +VFKK
Sbjct  198  P-LKVVFKK  205



>sp|P13087.3|MIRA_SYNDU RecName: Full=Miraculin; Short=MIR; Flags: Precursor [Synsepalum 
dulcificum]
 dbj|BAA07603.1| miraculin precursor [Synsepalum dulcificum]
 dbj|BAH84844.1| miraculin [Synsepalum dulcificum]
Length=220

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 74/177 (42%), Gaps = 14/177 (8%)
 Frame = -1

Query  614  PVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSRPLSD-GHPI  444
            PVLD DG++LR G  YYI  +   + G L V        +  C  R++ +R   D   P+
Sbjct  35   PVLDIDGEKLRTGTNYYIVPVLRDHGGGLTVSATTP-NGTFVCPPRVVQTRKEVDHDRPL  93

Query  443  RIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFV----  279
               P +P   VV  S   +      MP     +  W + +Y+ S+G Y +          
Sbjct  94   AFFPENPKEDVVRVSTDLNINFSAFMPCRWTSSTVWRLDKYDESTGQYFVTIGGVKGNPG  153

Query  278  -PSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLALSENSF  123
              ++SS F IE       YK  +CP        KC +VG+        RLALS+  F
Sbjct  154  PETISSWFKIEEFCGSGFYKLVFCPTVCGSCKVKCGDVGIYIDQKGRRRLALSDKPF  210



>ref|XP_010536414.1| PREDICTED: miraculin-like [Tarenaya hassleriana]
Length=212

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 85/192 (44%), Gaps = 21/192 (11%)
 Frame = -1

Query  635  VAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-P  465
            +A A+GT V D DGD LR G  YY+  +  G+ G L +  R     S  C   ++     
Sbjct  18   IAHATGTAVRDVDGDLLRPGVGYYVLPVLRGHGGGLTLAGR----GSELCPLDIVQENSE  73

Query  464  LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTT  288
            + DG P++          V  S   + ++ V    +C+ + YW I  ++     + + T 
Sbjct  74   VDDGIPVKFSGWTSRVGFVPESEDLNIKTDV-AATICIQSTYWWIDEFDKQRKQWFVTTG  132

Query  287  QFV-----PSLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGLVFGPFRNLRLALS  135
              +      SL S F  ++V     YKF +CP    F    C +VG+        RLALS
Sbjct  133  NALRRSGKESLRSFF--KIVKSRNDYKFVFCPRDCEFCRPICGDVGIFVDENGIRRLALS  190

Query  134  ENSFFSIVFKKA  99
            +  F  ++FKKA
Sbjct  191  DQPFV-VMFKKA  201



>ref|XP_010041215.1| PREDICTED: miraculin-like [Eucalyptus grandis]
 gb|KCW44534.1| hypothetical protein EUGRSUZ_L01961 [Eucalyptus grandis]
Length=203

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 88/188 (47%), Gaps = 22/188 (12%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQTRLLLS-RPLSDGH  450
            A+ +PVLDTDG +L+ G  Y+I  +       + +      S  C   ++   + LSDG 
Sbjct  26   AASSPVLDTDGHKLQTGVNYHILPVLRGRGGGLTLGAS--RSGNCPLAVVQEQQELSDGL  83

Query  449  PIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI--------RYEASSGDYILN  294
            P +  P D  + + L++ L  +    D   +C+ +  W +        +Y   SG  + N
Sbjct  84   PAKFSPVDGRSTIRLSTDLNVW---FDAATICVQSTVWRLAAFDEEVKQYFVESGGVLGN  140

Query  293  TTQFVPSLSSQFMIEVVPEHKAYKF--TYCPFGGHKCYNVGL-VFGPFRNLRLALSENSF  123
              +   ++S+ F IE + E   ++F  T C      C +VG+ V G  R  RLALS+   
Sbjct  141  PGR--ETVSNWFKIEKMDEDYNFRFCPTVCDTCKVICRDVGIYVDGATR--RLALSDEP-  195

Query  122  FSIVFKKA  99
            F + FKKA
Sbjct  196  FRVKFKKA  203



>gb|KFK41765.1| hypothetical protein AALP_AA2G169300 [Arabis alpina]
Length=208

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 93/203 (46%), Gaps = 33/203 (16%)
 Frame = -1

Query  644  TADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLL-  474
            TA +A  +   VLD +G+ +  G++YY+  +  G  G L +  R D P    C   ++  
Sbjct  12   TAVLASTAYGAVLDINGEPI-FGDSYYVLPVIRGRGGGLTLAGRGDQP----CPYDIVQE  66

Query  473  SRPLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILN  294
            S  + +G P++          V  S+  + E+IV  P +C+ + YW +      G++   
Sbjct  67   SSEVDEGIPVKFSNWRIRVAFVPESQNLNIETIVG-PTICIQSTYWRV------GEFDHE  119

Query  293  TTQFV------------PSLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGLVFGP  162
              Q+              S+ S F IE   +  AY+FT+CP      G KC +VG+    
Sbjct  120  RKQYFVVAGPKPEGFGGDSVKSFFKIEKSGDD-AYRFTFCPRTCRSNGPKCNDVGIFVDE  178

Query  161  FRNLRLALSENSFFSIVFKKARL  93
                RLAL++  F  +VFKKA +
Sbjct  179  KGVRRLALTDEPFL-VVFKKANV  200



>ref|XP_006441441.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
 gb|ESR54681.1| hypothetical protein CICLE_v10023320mg [Citrus clementina]
Length=206

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 83/185 (45%), Gaps = 24/185 (13%)
 Frame = -1

Query  614  PVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PLSDGHPI  444
            PVLD  G +LRAG  YYI  +  G  G L +  R +   + TC   ++  +    +G P+
Sbjct  31   PVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRGN---NKTCPLDVVQEQHSFKNGLPV  87

Query  443  RIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFVP---  276
               P +P   VV  S        +D    C  +  W +  ++A+ G +++ T        
Sbjct  88   TFSPVNPKKGVVRES--TDINIKLDAATSCAQSTVWKLDNFDAAFGQWLVTTGGVEGNPG  145

Query  275  --SLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLRLALSENSFFS  117
              ++ + F IE       YK  YCP    F    C +VG+ + G  R  RLALS+   F 
Sbjct  146  PRTMRNWFKIEKF--FGDYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDIP-FK  200

Query  116  IVFKK  102
            +VFKK
Sbjct  201  VVFKK  205



>emb|CAA43267.1| sporamin [Ipomoea batatas]
Length=236

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 2/101 (2%)
 Frame = +3

Query  138  QSQTQIPE-GPED*ANVVAFVAAKGTISEFVSLMLR-HHFNHELAAKAGDELGGVQDVIA  311
            +SQT+ P+ G  + AN+VAFV A+ T+SEFV + +  H  N EL A  G +L G Q+++ 
Sbjct  46   ESQTRGPQHGVMESANIVAFVGAELTVSEFVEVKVGIHQLNLELVAIVGHKLAGFQEILP  105

Query  312  A*RLVPDRPIDITQTNLGHINDGFEALQPRRQDDWGVGVRR  434
               +V D P+ +    L   +   E+L  RR D  G  V R
Sbjct  106  GRAVVLDSPVHVVHAELVGGDVEPESLVRRRHDHGGFRVGR  146



>ref|XP_006441447.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
 gb|ESR54687.1| hypothetical protein CICLE_v10021858mg [Citrus clementina]
Length=249

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/189 (31%), Positives = 82/189 (43%), Gaps = 24/189 (13%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PLSD  456
            AS  PVLD  G +LR G  YYI  +  G  G L +  R +   + TC   ++  +    +
Sbjct  70   ASPDPVLDIAGKQLRTGSKYYILPVTKGRGGGLTLAGRSN---NKTCPLDVVQEQHSFKN  126

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFV  279
            G P+   P +P   VV  S         D    C  +  W +  ++A  G ++L T    
Sbjct  127  GLPVTFSPVNPKKGVVRES--TDLNIKFDAATSCAQSTVWKLDNFDAVLGQWLLTTGGVE  184

Query  278  P-----SLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLRLALSEN  129
                  ++ + F IE       YK  YCP    F    C +VG+ + G  R  RLALS+ 
Sbjct  185  GNPGPRTMRNWFKIEKF--FGDYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDV  240

Query  128  SFFSIVFKK  102
              F IVFKK
Sbjct  241  P-FKIVFKK  248



>emb|CDP19138.1| unnamed protein product [Coffea canephora]
Length=218

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/194 (26%), Positives = 81/194 (42%), Gaps = 19/194 (10%)
 Frame = -1

Query  632  AVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQTRLLLSRPLSD-  456
            A     PVLD +G+E+R G  Y++ S+              P +  C   L + +  SD 
Sbjct  20   AAEEPNPVLDINGEEIRPGVEYHVVSLFWGAGGGGVTYGKGPGNEICP--LAVVQEPSDR  77

Query  455  --GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQV--CLGNVYWAIRY-EASSGDYILNT  291
              GHP+   P +P   VV  S   + +   + P +  C G+  W + + EA    ++L  
Sbjct  78   NRGHPVTFTPVNPEEGVVRVSTDLNIK-FAEPPIINFCRGSNVWKVHFNEALEQHFVLTD  136

Query  290  ----TQFVPSLSSQFMIEVVPEHKAYKFTYCPF-----GGHKCYNVGLVFGPFRNLRLAL  138
                     + ++ F IE +     YK  YCP          C +VG+ +   R  RLAL
Sbjct  137  GVEGNSGCETEANWFKIEAIG-SLGYKLVYCPAVCDSSSEAICKDVGIYYDDDRTRRLAL  195

Query  137  SENSFFSIVFKKAR  96
            S+  F  +  KK+ 
Sbjct  196  SDQPFLVVFIKKSE  209



>ref|XP_006441439.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
 gb|ESR54679.1| hypothetical protein CICLE_v10022282mg [Citrus clementina]
Length=206

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 82/185 (44%), Gaps = 24/185 (13%)
 Frame = -1

Query  614  PVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PLSDGHPI  444
            PVLD  G +LRAG  YYI  +  G  G L +  R +   + TC   ++  +    +G P+
Sbjct  31   PVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRGN---NKTCPLDVVQEQHSFKNGLPV  87

Query  443  RIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFVP---  276
               P +P   VV  S         D    C  +  W +  ++A+ G +++ T        
Sbjct  88   TFSPVNPKKGVVRES--TDLNIKFDAATSCAQSTVWKLDNFDAAFGQWLVTTGGVEGNPG  145

Query  275  --SLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLRLALSENSFFS  117
              ++ + F IE       YK  YCP    F    C +VG+ + G  R  RLALS+   F 
Sbjct  146  PRTMRNWFKIEKF--FGDYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDIP-FK  200

Query  116  IVFKK  102
            +VFKK
Sbjct  201  VVFKK  205



>emb|CAC40756.1| putative miraculin [Atropa belladonna]
Length=204

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/178 (25%), Positives = 84/178 (47%), Gaps = 11/178 (6%)
 Frame = -1

Query  611  VLDTDGDELRAGETYYINS--IGNPGALIVGVRVDWP---VSATCQTRLLLSRPLSDGHP  447
            V D +G+ LR+   Y++ S  IG  G +  G  V+      +  C ++++ + P   G  
Sbjct  20   VRDINGEILRSDTRYFVVSGLIGGSGGVTQGPTVNGACHDANFVCPSQVVHT-PQDMGTS  78

Query  446  IRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQFVPS--  273
            +  +P  P    +      + E  +D P +C  NV+    +  +     L+T     +  
Sbjct  79   VYFKPKAPKQEEITEFTSLNIEFYLDNPTICKNNVWKVDGFPGNEIPMFLSTNGVAGNPL  138

Query  272  -LSSQFMIEVVPEHKAYKFTYCPFGGHKCYNVGLVFGPFRNLRLALSENSFFSIVFKK  102
             +SS F IE V ++ +YK  +CP+  H C ++G+     ++  LA+  ++ F++VF K
Sbjct  139  NVSSWFQIEKVHDN-SYKLVFCPYEEHICSDIGIKVVDGQD-HLAIRTDNTFAVVFVK  194



>ref|XP_008437058.1| PREDICTED: miraculin-like [Cucumis melo]
Length=205

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 54/197 (27%), Positives = 87/197 (44%), Gaps = 22/197 (11%)
 Frame = -1

Query  656  IRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQTRLL  477
            +R  TAD   AS   VLD DG +LRAG  YYI  +       + +      S  C   ++
Sbjct  20   LRFSTAD---ASPEAVLDIDGKKLRAGVNYYILPVFRGRGGGLTLGN--LQSEICPVNVV  74

Query  476  LSR-PLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDY  303
              +  L +G P    P +P   VV  S   + +   D   +C+ +  W + +++ S+G +
Sbjct  75   QEQFELMNGFPTTFHPVNPKKGVVRVSTDLNVQ--FDASTICVTSTVWKLDKFDESTGQW  132

Query  302  ILNT-----TQFVPSLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGLVFGPFRNL  150
             +          V ++ + F IE     K YK  +CP    F    C ++G+ F   +  
Sbjct  133  FVTIGGSRGNPGVETVDNWFKIE--KHGKDYKLVFCPTVCNFCKVMCRDIGIFFKNGKR-  189

Query  149  RLALSENSFFSIVFKKA  99
             LALS+   F ++FKK 
Sbjct  190  ALALSDTP-FPVMFKKV  205



>emb|CAI77782.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77794.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 81/189 (43%), Gaps = 22/189 (12%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLL-LSRPLSD  456
            AS  PVLD  G+EL+AG  Y I+SI  G  G  +         + TC   ++  S  L  
Sbjct  25   ASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA------TNKTCPDDVIQYSLDLLQ  78

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQ---  285
            G P+   PA     V+  S   + +    + + C  +  W I+  ++S    L TT    
Sbjct  79   GLPVTFSPASSEDDVIRVSTDLNIK--FSIKKACDRSSVWKIQKSSNSEVQWLVTTGGEE  136

Query  284  ---FVPSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLALSEN-  129
                  + ++ F IE       YK  YCP         C +VG+ F   R   L+LS+  
Sbjct  137  GNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGRILSLSDKL  196

Query  128  SFFSIVFKK  102
            S F +VFKK
Sbjct  197  SPFLVVFKK  205



>ref|XP_007036748.1| 21 kDa seed protein, putative [Theobroma cacao]
 gb|EOY21249.1| 21 kDa seed protein, putative [Theobroma cacao]
Length=219

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 78/189 (41%), Gaps = 13/189 (7%)
 Frame = -1

Query  635  VAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQTRLLLSRPLSD  456
            VA A+  PVLDTDG+ELR G  YY+ S                 + +C   ++  R   D
Sbjct  23   VANATNKPVLDTDGEELRTGVEYYVVSALWAAGGGGLALGR-SRNQSCPDIVVQRRSELD  81

Query  455  -GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQF  282
             G P+   P  PN   +  S     E +     +CL    W +  Y+ S+G + +   + 
Sbjct  82   YGIPVIFSPVKPNDVFIRVSTDLIIEFVPLRDSLCLTTAVWKLDDYDQSTGKWWVIAGRV  141

Query  281  VP-----SLSSQFMIEVVPEHKAYKFTYCPFGGHKCYNVGLVFGPFRN---LRLALSENS  126
                   +  + F IE       YKFTYCP     C  +    G + +   +RL LS+  
Sbjct  142  AGDAGPHTFPNWFKIEKNGVF-GYKFTYCPSVCDSCTTLCSDIGRYEDNGQIRLGLSDQG  200

Query  125  FFSIVFKKA  99
             +  VF KA
Sbjct  201  -WPFVFTKA  208



>ref|NP_001233769.1| uncharacterized protein LOC544001 precursor [Solanum lycopersicum]
 gb|AAA80497.1| unknown [Solanum lycopersicum]
Length=225

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 56/216 (26%), Positives = 96/216 (44%), Gaps = 25/216 (12%)
 Frame = -1

Query  689  LPNPTHSSFNPIRLPTADVAVASG---TPVLDTDGDELRAGETYYI--NSIGNPGALIVG  525
            +P    S+F+   L  +D  V +G     V+D+DG+ ++AG  Y++  +  G+ G L++ 
Sbjct  15   VPLALSSTFSSDLLLPSDEVVPNGKTYASVVDSDGNPVKAGAKYFVLPSLRGSGGGLVLS  74

Query  524  VRVDWPVSATCQTRLLLSRPLSDGHPIRIRPADPNAPVVLTSRLQ----SFESIVDMPQV  357
              VD  V    Q  +   + L+ G P+   PA PN    +         +F S+    + 
Sbjct  75   RVVDKNVKVCPQDIVQEPQELNTGRPVEFFPAYPNKTGEIIKVNNPINVNFFSLSKTSR-  133

Query  356  CLGNVYWAI--RYEASSGDYILNTTQFVPSLSSQFMIEVVPEHKAYKFTYCPF----GGH  195
            C     W +  +Y+   G   L     + +        +VP  K Y+F YCP        
Sbjct  134  CANFTVWKMDKKYKYVVGRGTLGALNRIRN-----WFRIVPYGKGYRFVYCPSLCVPCKI  188

Query  194  KCYNVGLVFGPFRNL---RLALSENSF-FSIVFKKA  99
            +C+++ + +    N+   RLA S+N   FS+ FKKA
Sbjct  189  RCFDLFISYEERENVQVRRLAASDNELPFSVYFKKA  224



>ref|NP_001237597.1| uncharacterized protein LOC100527288 precursor [Glycine max]
 gb|ACU16359.1| unknown [Glycine max]
Length=204

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 90/198 (45%), Gaps = 28/198 (14%)
 Frame = -1

Query  647  PTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLL  474
            P   +A A+   VLDT G +LR G  YYI  +  G  G L V    +     TC   ++ 
Sbjct  20   PFIGIAAAAPEAVLDTSGQKLRTGVKYYILPVFRGKGGGLTVSSSGN----NTCPLFVVQ  75

Query  473  SR-PLSDGHPIRIRPADPNAPVVLTS---RLQSF--ESIVDMPQVCLGNVYWAIRYEASS  312
             +  +S G P+   P +  + V+LTS    ++S+   +  D P V      W +  +  +
Sbjct  76   EKLEVSKGTPVTFTPYNAKSGVILTSTDLNIKSYGKTTTCDKPPV------WKL-LKVLT  128

Query  311  GDYILNTTQF-----VPSLSSQFMIEVVPEHKAYKFTYCP-FGGHKCYNVGLVFGPFRNL  150
            G + L+T        V ++ + F IE     K Y  ++CP F    C  +GL  G   N 
Sbjct  129  GVWFLSTGGVEGNPGVNTVVNWFKIE--KAEKDYVLSFCPSFAQTLCRELGLYVGDDGNK  186

Query  149  RLALSENS-FFSIVFKKA  99
             L+LS+    F ++FK+A
Sbjct  187  HLSLSDKVPSFKVMFKRA  204



>emb|CAN63617.1| hypothetical protein VITISV_041430 [Vitis vinifera]
Length=220

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 48/178 (27%), Positives = 82/178 (46%), Gaps = 22/178 (12%)
 Frame = -1

Query  632  AVASGTPVLDTDGDELRAGETYYINSI----GNPGALIVGVRVDWPVSATCQTRLLLSR-  468
            A A+  PVLDT+G +L++   YYI S+    G  G  +         + TC   ++  + 
Sbjct  24   AEAAPDPVLDTEGKKLQSEVDYYILSVIRRRGGGGLTLASTG-----NKTCPLDVVQEQN  78

Query  467  PLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTT  288
             +S+G  +   P +P   V+  S   + E       +C+ +  W + Y+ SSG +   TT
Sbjct  79   EVSNGLTLMFSPVNPKKGVIRVSTDHNIE--FSAATICVQSTVWKLEYDESSGQWFF-TT  135

Query  287  QFVP------SLSSQFMIEVVPEHKAYKF--TYCPFGGHKCYNVGL-VFGPFRNLRLA  141
             +V       +LS+QF IE   +     F  T C F    C ++G+ +   +R+L L+
Sbjct  136  GWVEGNLGRGTLSNQFKIEKYEDDNNLVFCPTVCDFCKPVCGDIGIYIQDGYRHLALS  193



>gb|KHN24496.1| Miraculin [Glycine soja]
Length=204

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 57/198 (29%), Positives = 90/198 (45%), Gaps = 28/198 (14%)
 Frame = -1

Query  647  PTADVAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLL  474
            P   +A A+   VLDT G +LR G  YYI  +  G  G L V    +     TC   ++ 
Sbjct  20   PFIGIAAAAPEAVLDTSGQKLRTGVKYYILPVFRGKGGGLTVSSSGN----NTCPLFVVQ  75

Query  473  SR-PLSDGHPIRIRPADPNAPVVLTS---RLQSF--ESIVDMPQVCLGNVYWAIRYEASS  312
             +  +S G P+   P +  + V+LTS    ++S+   +  D P V      W +  +  +
Sbjct  76   EKLEVSKGTPVTFTPYNAKSGVILTSTDLNIKSYGKTTTCDKPPV------WKL-LKVLT  128

Query  311  GDYILNTTQF-----VPSLSSQFMIEVVPEHKAYKFTYCP-FGGHKCYNVGLVFGPFRNL  150
            G + L+T        V ++ + F IE     K Y  ++CP F    C  +GL  G   N 
Sbjct  129  GVWFLSTGGVEGNPGVNTVVNWFKIE--KAEKDYVLSFCPSFARTLCRELGLYVGDDGNK  186

Query  149  RLALSENS-FFSIVFKKA  99
             L+LS+    F ++FK+A
Sbjct  187  HLSLSDKVPSFKVMFKRA  204



>ref|XP_010471390.1| PREDICTED: bark lectin isoform 2-like [Camelina sativa]
Length=223

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 87/210 (41%), Gaps = 19/210 (9%)
 Frame = -1

Query  689  LPNPTHSS-----FNPIRLPTADVAVA-SGTPVLDTDGDELRAGETYYI--NSIGNPGAL  534
            + NPT S       + + L TA  A A S   VLD  G  +++ + YYI    IG  G L
Sbjct  1    MKNPTLSVITLTVLSAVILTTAPAADAVSSQVVLDISGHPVQSNDQYYIIPAKIGTGGGL  60

Query  533  IVGVRVDWPVSATCQTRLLL--SRPLSDGHPIRIRPADPNAPVV-LTSRLQ-SFESIVDM  366
            I   R D      C    ++  S P   G P+   P D    +V L++ L   F+S V  
Sbjct  61   IPSSR-DLNTQDLCLNLDIVQSSSPFVSGLPVTFSPLDTKTKLVQLSTSLNLEFDSTV--  117

Query  365  PQVCLGNVYWAIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEHKAYKFTYCPFGGH-KC  189
              +C  +  W I +        ++        +S F I+   +  AYK  YCP      C
Sbjct  118  -WLCPESKIWRIDHSVQLRKSFVSIGGEKSKGNSWFQIQ--EDGDAYKLMYCPSSSIVAC  174

Query  188  YNVGLVFGPFRNLRLALSENSFFSIVFKKA  99
             NV L        RL LS +  F++ F+KA
Sbjct  175  INVSLEIDDLGARRLVLSNDQSFAVKFQKA  204



>emb|CDX72972.1| BnaC06g34200D [Brassica napus]
Length=205

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/184 (29%), Positives = 80/184 (43%), Gaps = 18/184 (10%)
 Frame = -1

Query  623  SGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQTRLLLSRPLSD---G  453
            +G PVLDTDGD +  G +YY+  I + G L +  R         Q  L + +  SD   G
Sbjct  21   AGGPVLDTDGDFILDGGSYYVLPIFSGGGLTLTPR------GGNQCPLYIGQEYSDVNRG  74

Query  452  HPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYE--ASSGDYILNTTQFV  279
             P+R          VL S   + E  V    +C+ + YW +     A    +++   +  
Sbjct  75   IPVRFSNCKSKFGFVLESVNLNIEMDVKA-TICVQSTYWWVAESDMAIKKFFVVAGPKPE  133

Query  278  P---SLSSQFMIEVVPE-HKAYKFTYCPFGGHKCYNVGLVFGPFRNLRLALSENSFFSIV  111
            P   SL S F I+     H  Y   +CP   + C +VG+    +   RLALS    F ++
Sbjct  134  PGEESLKSFFQIKKTKYFHNGYTIAFCP-NDNDCIDVGIFVDEYGVWRLALSPTP-FPVM  191

Query  110  FKKA  99
            F KA
Sbjct  192  FVKA  195



>ref|XP_010416131.1| PREDICTED: bark lectin isoform 2-like isoform X2 [Camelina sativa]
Length=223

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 88/210 (42%), Gaps = 19/210 (9%)
 Frame = -1

Query  689  LPNPTHS-----SFNPIRLPTADVAVA-SGTPVLDTDGDELRAGETYYI--NSIGNPGAL  534
            + NPT S       + + L TA  A A S   VLD  G  +++ + YYI    IG  G L
Sbjct  1    MKNPTLSFIVLTVLSAVILTTAPAADAVSSQVVLDIAGHPVQSNDQYYIIPAKIGTGGGL  60

Query  533  IVGVRVDWPVSATCQTRLLL--SRPLSDGHPIRIRPADPNAPVV-LTSRLQ-SFESIVDM  366
            I   R D      C    ++  S P   G P+   P +    +V L++ L   F+S V  
Sbjct  61   IPSSR-DLNTQDLCLNLDIVQSSSPFVSGLPVTFSPLNTKTKLVQLSTSLNLEFDSTV--  117

Query  365  PQVCLGNVYWAIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEHKAYKFTYCPFGGH-KC  189
              +C  +  W I +        ++T       +S F I+   +  AYK  YCP      C
Sbjct  118  -WLCPESKIWRIDHSVQLRKSFVSTGGEKGKGNSWFQIK--EDGDAYKLMYCPSSSIVAC  174

Query  188  YNVGLVFGPFRNLRLALSENSFFSIVFKKA  99
             NV L        RL LS +  F++ F+KA
Sbjct  175  INVSLEIDDLEARRLVLSNDQSFAVKFQKA  204



>emb|CAI77774.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 22/189 (12%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLL-LSRPLSD  456
            AS  PVLD  G+EL+AG  Y I+SI  G  G  +         + TC   ++  S  L  
Sbjct  25   ASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA------TNKTCPDDVIQYSLDLLQ  78

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQ---  285
            G P+   PA     V+  S   + +    + + C  +  W I+  ++S    L TT    
Sbjct  79   GLPVTFSPASSEDDVIRVSTDLNIK--FSIKKACDHSSVWKIQKSSNSEVQWLVTTGGEE  136

Query  284  ---FVPSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLALSEN-  129
                  + ++ F IE       YK  YCP         C +VG+ F   R   L+LS+  
Sbjct  137  GNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGRILSLSDKL  196

Query  128  SFFSIVFKK  102
            S F ++FKK
Sbjct  197  SPFLVLFKK  205



>ref|XP_003534083.1| PREDICTED: miraculin-like [Glycine max]
Length=215

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 84/208 (40%), Gaps = 35/208 (17%)
 Frame = -1

Query  647  PTADVAVASGTPVLDTDGDELRAGETYYI-------------NSIGNPGALIVGVRVDWP  507
            P   VA AS   V+DT G +LRAG +YYI               +G  G  +  +    P
Sbjct  18   PLLGVADASPEQVVDTSGKKLRAGLSYYIVPAVPLTRCGRYERCMGGGGLSLASIGESCP  77

Query  506  VSATCQTRLLLSRPLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-  330
            +        ++  P S G P++  P DP   VV  S   +     D       +  W + 
Sbjct  78   LD-------VVVVPRSHGLPLQFSPVDPKKGVVRVSTDLNIMFSTDHTSCAEYSPVWKLD  130

Query  329  RYEASSGDYILNTTQFV-----PSLSSQFMIEVVPEHKAYKFTYCP------FGGHKCYN  183
             ++ S G + ++T   +      ++ + F IE      AYK  YCP         H C +
Sbjct  131  HFDVSKGKWFVSTGGSMGNPSWETIRNWFKIEKC--DGAYKIVYCPSVFPSSSSKHMCKD  188

Query  182  VGLVFGPFRNLRLALSENSFFSIVFKKA  99
            +G+        RLALS N  F + F++A
Sbjct  189  IGVFVDENGFRRLALS-NVPFKVKFQRA  215



>emb|CAI77764.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 22/189 (12%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLL-LSRPLSD  456
            AS  PVLD  G+EL+AG  Y I+SI  G  G  +         + TC   ++  S  L  
Sbjct  25   ASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA------TNKTCPDDVIQYSLDLLQ  78

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQ---  285
            G P+   PA     V+  S   + +    + + C  +  W I+  ++S    L TT    
Sbjct  79   GLPVTFSPASSEDDVIRVSTDLNIK--FSIKKACDHSSVWKIQKSSNSEVQWLVTTGGEE  136

Query  284  ---FVPSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLALSEN-  129
                  + ++ F IE       YK  YCP         C +VG+ F   R   L+LS+  
Sbjct  137  GNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGRILSLSDKL  196

Query  128  SFFSIVFKK  102
            S F ++FKK
Sbjct  197  SPFLVLFKK  205



>emb|CAI77777.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 22/189 (12%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLL-LSRPLSD  456
            AS  PVLD  G+EL+AG  Y I+SI  G  G  +         + TC   ++  S  L  
Sbjct  25   ASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA------TNKTCPDDVIQYSLDLLQ  78

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQ---  285
            G P+   PA     V+  S   + +    + + C  +  W I+  ++S    L TT    
Sbjct  79   GLPVTFSPASSEDDVIRVSTDLNIK--FSIKKACDRSSVWKIQKSSNSEVQWLVTTGGEE  136

Query  284  ---FVPSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLALSEN-  129
                  + ++ F IE       YK  YCP         C +VG+ F   R   L+LS+  
Sbjct  137  GNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGRILSLSDKL  196

Query  128  SFFSIVFKK  102
            S F ++FKK
Sbjct  197  SPFLVLFKK  205



>emb|CAI77775.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 22/189 (12%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLL-LSRPLSD  456
            AS  PVLD  G+EL+AG  Y I+SI  G  G  +         + TC   ++  S  L  
Sbjct  25   ASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA------TNKTCPDDVIQYSLDLLQ  78

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQ---  285
            G P+   PA     V+  S   + +    + + C  +  W I+  ++S    L TT    
Sbjct  79   GLPVTFSPASSEDDVIRVSTDLNIK--FSIKKACDRSSVWKIQKSSNSEVQWLVTTGGEE  136

Query  284  ---FVPSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLALSEN-  129
                  + ++ F IE       YK  YCP         C +VG+ F   R   L+LS+  
Sbjct  137  GNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGRILSLSDKL  196

Query  128  SFFSIVFKK  102
            S F ++FKK
Sbjct  197  SPFLVLFKK  205



>ref|XP_010416130.1| PREDICTED: bark lectin isoform 2-like isoform X1 [Camelina sativa]
Length=231

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 88/210 (42%), Gaps = 19/210 (9%)
 Frame = -1

Query  689  LPNPTHS-----SFNPIRLPTADVAVA-SGTPVLDTDGDELRAGETYYI--NSIGNPGAL  534
            + NPT S       + + L TA  A A S   VLD  G  +++ + YYI    IG  G L
Sbjct  1    MKNPTLSFIVLTVLSAVILTTAPAADAVSSQVVLDIAGHPVQSNDQYYIIPAKIGTGGGL  60

Query  533  IVGVRVDWPVSATCQTRLLL--SRPLSDGHPIRIRPADPNAPVV-LTSRLQ-SFESIVDM  366
            I   R D      C    ++  S P   G P+   P +    +V L++ L   F+S V  
Sbjct  61   IPSSR-DLNTQDLCLNLDIVQSSSPFVSGLPVTFSPLNTKTKLVQLSTSLNLEFDSTV--  117

Query  365  PQVCLGNVYWAIRYEASSGDYILNTTQFVPSLSSQFMIEVVPEHKAYKFTYCPFGGH-KC  189
              +C  +  W I +        ++T       +S F I+   +  AYK  YCP      C
Sbjct  118  -WLCPESKIWRIDHSVQLRKSFVSTGGEKGKGNSWFQIK--EDGDAYKLMYCPSSSIVAC  174

Query  188  YNVGLVFGPFRNLRLALSENSFFSIVFKKA  99
             NV L        RL LS +  F++ F+KA
Sbjct  175  INVSLEIDDLEARRLVLSNDQSFAVKFQKA  204



>emb|CAI77798.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77799.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77806.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77807.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 82/192 (43%), Gaps = 28/192 (15%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQT----RLLLSRP  465
            AS  PVLD  G+EL+AG  Y I+SI  G  G           VSAT +T     +  S  
Sbjct  25   ASTEPVLDIQGEELKAGTEYIISSIFWGAGGG---------DVSATNKTCPDDVIQYSLD  75

Query  464  LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQ  285
            L  G P+   PA     V+  S   + +    + + C  +  W I+  ++S    L TT 
Sbjct  76   LLQGLPVTFSPASSEDDVIRVSTDLNIK--FSIKKACDRSSVWKIQKSSNSEVQWLVTTG  133

Query  284  ------FVPSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLALS  135
                     + ++ F IE       YK  YCP         C +VG+ F   R   L+LS
Sbjct  134  GEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGRILSLS  193

Query  134  EN-SFFSIVFKK  102
            +  S F ++FKK
Sbjct  194  DKLSPFLVLFKK  205



>emb|CAI77765.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77792.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77796.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77797.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77801.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 22/189 (12%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLL-LSRPLSD  456
            AS  PVLD  G+EL+AG  Y I+SI  G  G  +         + TC   ++  S  L  
Sbjct  25   ASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA------TNKTCPDDVIQYSLDLLQ  78

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQ---  285
            G P+   PA     V+  S   + +    + + C  +  W I+  ++S    L TT    
Sbjct  79   GLPVTFSPASSEDDVIRVSTDLNIK--FSIKKACDRSSVWKIQKSSNSEVQWLVTTGGEE  136

Query  284  ---FVPSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLALSEN-  129
                  + ++ F IE       YK  YCP         C +VG+ F   R   L+LS+  
Sbjct  137  GNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGRILSLSDKL  196

Query  128  SFFSIVFKK  102
            S F ++FKK
Sbjct  197  SPFLVLFKK  205



>emb|CAI77770.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 22/189 (12%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLL-LSRPLSD  456
            AS  PVLD  G+EL+AG  Y I+SI  G  G  +         + TC   ++  S  L  
Sbjct  25   ASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA------TNKTCPDDVIQYSLDLLQ  78

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQ---  285
            G P+   PA     V+  S   + +    + + C  +  W I+  ++S    L TT    
Sbjct  79   GLPVTFSPASSEDDVIRVSTDLNIK--FSIKKACDRSSVWKIQKSSNSEVQWLVTTGGEE  136

Query  284  ---FVPSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLALSEN-  129
                  + ++ F IE       YK  YCP         C +VG+ F   R   L+LS+  
Sbjct  137  GNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFETNRGRILSLSDKL  196

Query  128  SFFSIVFKK  102
            S F ++FKK
Sbjct  197  SPFLVLFKK  205



>emb|CAI77793.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 81/189 (43%), Gaps = 22/189 (12%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLL-LSRPLSD  456
            AS  PVLD  G+EL+AG  Y I+SI  G  G  +         + TC   ++  S  L  
Sbjct  25   ASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA------TNKTCPDDVIQYSLDLLQ  78

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQ---  285
            G P+   PA     V+  S   + +    + + C  +  W I+  ++S    L TT    
Sbjct  79   GLPVTFSPASSEDDVIRVSTDLNIK--FSIKKACDRSSVWKIQKSSNSEVQWLVTTGGEE  136

Query  284  ---FVPSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLALSEN-  129
                  + ++ F IE       YK  YCP         C +VG+ F   R   L+LS+  
Sbjct  137  GNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGRILSLSDKL  196

Query  128  SFFSIVFKK  102
            S F ++FKK
Sbjct  197  SPFLVLFKK  205



>emb|CAI77803.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 82/192 (43%), Gaps = 28/192 (15%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQT----RLLLSRP  465
            A+  PVLD  G+EL+AG  Y I+SI  G  G           VSAT +T     +  S  
Sbjct  25   ANTEPVLDIQGEELKAGTEYIISSIFWGAGGG---------DVSATNKTCPDDVIQYSLD  75

Query  464  LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQ  285
            L  G P+   PA     V+  S   + +    + + C  +  W I+  ++S    L TT 
Sbjct  76   LLQGLPVTFSPASSEDDVIRVSTDLNIK--FSIKKACDRSSVWKIQKSSNSEVQWLVTTG  133

Query  284  ------FVPSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLALS  135
                     + ++ F IE       YK  YCP         C +VG+ F   R   L+LS
Sbjct  134  GEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGRILSLS  193

Query  134  EN-SFFSIVFKK  102
            +  S F +VFKK
Sbjct  194  DKLSPFLVVFKK  205



>emb|CAI77766.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 80/189 (42%), Gaps = 22/189 (12%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLL-LSRPLSD  456
            AS  PVLD  G+EL+AG  Y I+SI  G  G  +         + TC   ++  S  L  
Sbjct  25   ASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA------TNKTCPDDVIQYSLDLLQ  78

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQ---  285
            G P+   PA     V+  S   + +    + + C  +  W I+  ++S    L TT    
Sbjct  79   GLPVTFSPASSEDDVIRVSTDLNIK--FSIKKACDRSSVWKIQKSSNSEVQWLVTTGGEE  136

Query  284  ---FVPSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLALSEN-  129
                  +  + F IE       YK  YCP         C +VG+ F   R   L+LS+  
Sbjct  137  GNPGCDTFINWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFETNRGRILSLSDKL  196

Query  128  SFFSIVFKK  102
            S F +VFKK
Sbjct  197  SPFLVVFKK  205



>ref|XP_010416116.1| PREDICTED: miraculin-like [Camelina sativa]
Length=208

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 83/195 (43%), Gaps = 17/195 (9%)
 Frame = -1

Query  644  TADVAVASGTPVLDTDGDELRAGETYYINSI-GNPGALIVGVRVDWPVSATCQTRLLL-S  471
            TA +A  +   VLD DG+ +  G  Y +  I G  G L +  R        C   ++  S
Sbjct  12   TAVLATNAYGAVLDIDGNIIFRGSYYVLPVIRGRGGGLTLSGRG----GELCPLDIVQES  67

Query  470  RPLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYI--  300
            + L +G+P++     P    V  S+  + ++ V+   +C  + YW +  ++     Y   
Sbjct  68   QELDEGNPVKFSNWRPRVAFVPESQDLNIQTDVE-ATICFQSTYWRVGEFDEERKQYFIV  126

Query  299  --LNTTQFVPSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLAL  138
              L    F    S  F         AYKF +CP     G  KC +VG+        RLAL
Sbjct  127  AGLKPEGFGQDSSKSFFKIEKSGDDAYKFVFCPSTCDSGCPKCSDVGIFEDELGVRRLAL  186

Query  137  SENSFFSIVFKKARL  93
            S+  F  ++FKKA +
Sbjct  187  SDEPFL-VMFKKANV  200



>emb|CDP21779.1| unnamed protein product [Coffea canephora]
Length=213

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 82/189 (43%), Gaps = 18/189 (10%)
 Frame = -1

Query  632  AVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQTRLLLSRPLSDG  453
            A     PVLDT+G+E+R G  YY+ +I  PG  +   +   P +  C   ++ +  L  G
Sbjct  20   AAEEPNPVLDTNGEEIRPGVEYYMGTIFRPGGGVTYGK--GPGNEICPLAVVQAW-LQRG  76

Query  452  HPIRIRPADPNAPVVLTSRLQSFESIVDMPQV--CLGNVYWAIRY-EASSGDYILNT---  291
             P+   P +P   VV  S   + +   + P +  C G+  W + + EA    ++L     
Sbjct  77   DPVTFTPVNPEEGVVRVSTDLNIK-FAEPPIINFCRGSNVWKVHFNEALKQHFVLTDGVE  135

Query  290  -TQFVPSLSSQFMIEVVPEHKAYKFTYCPF-----GGHKCYNVGLVFGPFRNLRLALSEN  129
                  + ++ F IE V + + YKF +CP          C +VG+        RLAL   
Sbjct  136  GNSGCETTANWFKIEAVSD-RDYKFVFCPTVCDSSSEAICKDVGIYMDD-GTRRLALGGQ  193

Query  128  SFFSIVFKK  102
             +  +  KK
Sbjct  194  PYAVVFIKK  202



>ref|XP_010428252.1| PREDICTED: bark lectin isoform 2 isoform X1 [Camelina sativa]
Length=231

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 81/190 (43%), Gaps = 15/190 (8%)
 Frame = -1

Query  647  PTADVAVASGTPVLDTDGDELRAGETYYI--NSIGNPGALIVGVRVDWPVSATCQTRLLL  474
            P AD AV+S   VLD  G  +++ + YYI    IG  G LI   R D      C    ++
Sbjct  23   PAAD-AVSSQV-VLDIAGHPVQSNDQYYIIPAKIGTGGGLIPSSR-DLNTQDLCLNLDIV  79

Query  473  --SRPLSDGHPIRIRPADPNAPVV-LTSRLQ-SFESIVDMPQVCLGNVYWAIRYEASSGD  306
              S P   G P+   P D    +V L++ L   F+S V    +C  +  W I +      
Sbjct  80   QSSSPFVSGLPVTFSPLDTKTKLVQLSTSLNLEFDSTV---WLCPESKIWRIDHSVQLRK  136

Query  305  YILNTTQFVPSLSSQFMIEVVPEHKAYKFTYCPFGGH-KCYNVGLVFGPFRNLRLALSEN  129
              ++        +S F I+   +  AYK  YCP      C NV L        RL LS +
Sbjct  137  SFVSIGGEKGKGNSWFQIQ--EDGDAYKLMYCPSSSTVACINVSLEIDDLGARRLVLSND  194

Query  128  SFFSIVFKKA  99
              F++ F+KA
Sbjct  195  QSFTVEFQKA  204



>ref|NP_001237333.1| uncharacterized protein LOC100500648 precursor [Glycine max]
 gb|ACU15788.1| unknown [Glycine max]
Length=213

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/192 (26%), Positives = 84/192 (44%), Gaps = 16/192 (8%)
 Frame = -1

Query  632  AVASGTPVLDTDGDELRAGETYYI------NSIGNPGALIVGVRVDWPVSATCQTRLLLS  471
            A A+  PV+DT G +LRA   Y+I         G       G      +  +C   +++ 
Sbjct  24   AGAAPEPVIDTSGKKLRADANYHIIPAVPFTICGFVSCFTGGGLSLDSIDESCPLDVIIE  83

Query  470  RPLSDGHPIRIRPADPNAPVV-LTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILN  294
            +  ++G P+R  P +    V+ +++ L  F S  D        V+   +++AS G   + 
Sbjct  84   KA-NEGLPLRFSPVNTKKGVIRVSTDLNIFFSDSDERCPHHSTVWMLDQFDASIGQTYVT  142

Query  293  TTQFVPSLSSQFMI---EVVPEHKAYKFTYCP----FGGHKCYNVGLVFGPFRNLRLALS  135
            T   V +     ++   ++     AYK  YCP       H C ++G+     R + LALS
Sbjct  143  TGGVVGNPGEHTILNWFKIQKYEDAYKLVYCPRVCPSCHHLCKDIGMFVDANRRMHLALS  202

Query  134  ENSFFSIVFKKA  99
            ++  F I FK+A
Sbjct  203  DDP-FKIKFKEA  213



>ref|XP_010428253.1| PREDICTED: bark lectin isoform 2 isoform X2 [Camelina sativa]
Length=223

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 57/190 (30%), Positives = 81/190 (43%), Gaps = 15/190 (8%)
 Frame = -1

Query  647  PTADVAVASGTPVLDTDGDELRAGETYYI--NSIGNPGALIVGVRVDWPVSATCQTRLLL  474
            P AD AV+S   VLD  G  +++ + YYI    IG  G LI   R D      C    ++
Sbjct  23   PAAD-AVSSQV-VLDIAGHPVQSNDQYYIIPAKIGTGGGLIPSSR-DLNTQDLCLNLDIV  79

Query  473  --SRPLSDGHPIRIRPADPNAPVV-LTSRLQ-SFESIVDMPQVCLGNVYWAIRYEASSGD  306
              S P   G P+   P D    +V L++ L   F+S V    +C  +  W I +      
Sbjct  80   QSSSPFVSGLPVTFSPLDTKTKLVQLSTSLNLEFDSTV---WLCPESKIWRIDHSVQLRK  136

Query  305  YILNTTQFVPSLSSQFMIEVVPEHKAYKFTYCPFGGH-KCYNVGLVFGPFRNLRLALSEN  129
              ++        +S F I+   +  AYK  YCP      C NV L        RL LS +
Sbjct  137  SFVSIGGEKGKGNSWFQIQ--EDGDAYKLMYCPSSSTVACINVSLEIDDLGARRLVLSND  194

Query  128  SFFSIVFKKA  99
              F++ F+KA
Sbjct  195  QSFTVEFQKA  204



>emb|CAI77768.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 82/192 (43%), Gaps = 28/192 (15%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQT----RLLLSRP  465
            AS  PVLD  G+EL+AG  Y I+SI  G  G           VSAT +T     +  S  
Sbjct  25   ASTEPVLDIQGEELKAGTEYIISSIFWGAGGG---------DVSATNKTCPDDVIQYSLD  75

Query  464  LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQ  285
            L  G P+   PA     V+  S   + +    + + C  +  W I+  ++S    L TT 
Sbjct  76   LLQGLPVTFSPASSEDDVIRVSTDLNIK--FSIKKACDHSSVWKIQKSSNSEVQRLVTTG  133

Query  284  ------FVPSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLALS  135
                     + ++ F IE       YK  YCP         C +VG+ F   R   L+LS
Sbjct  134  GEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGRILSLS  193

Query  134  EN-SFFSIVFKK  102
            +  S F ++FKK
Sbjct  194  DKLSPFLVLFKK  205



>ref|XP_006493432.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=342

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 55/192 (29%), Positives = 87/192 (45%), Gaps = 24/192 (13%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PLSD  456
            AS  PV+D  G +LRAG  YYI  +  G  G L +  R +   + TC   ++  +    +
Sbjct  27   ASPDPVVDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSN---NKTCPLDVVQEQHSFRN  83

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFV  279
            G P+   P +P   VV  S   + +   D    C  +  W +  ++A  G +++ T    
Sbjct  84   GLPVTFSPVNPKKGVVRESTDLNIK--FDAATSCAQSTVWKLDNFDAVLGQWLVTTGGVE  141

Query  278  P-----SLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLRLALSEN  129
                  ++ + F IE    +  YK  +CP    F    C +VG+ + G  R  RLALS+ 
Sbjct  142  GNPGPRTMRNWFKIEKF--YGDYKLVFCPSVCNFCRGLCRDVGIFINGGVR--RLALSDV  197

Query  128  SFFSIVFKKARL  93
                +VFKK R+
Sbjct  198  P-LKVVFKKLRV  208



>emb|CAI77783.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77784.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77788.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77789.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77804.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77805.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 55/189 (29%), Positives = 80/189 (42%), Gaps = 22/189 (12%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLL-LSRPLSD  456
            AS  PVLD  G+EL+AG  Y I+SI  G  G  +         + TC   ++  S  L  
Sbjct  25   ASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA------TNKTCPDDVIQYSLDLLQ  78

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQ---  285
            G P+   PA     V+  S   + +    + + C  +  W I+  ++S    L TT    
Sbjct  79   GLPVTFSPASSEDDVIRVSTDLNIK--FSIKKACDRSSVWKIQKSSNSEVQWLVTTGGEE  136

Query  284  ---FVPSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLALSEN-  129
                  + ++ F IE       YK  YCP         C +VG+ F   R   L+LS+  
Sbjct  137  GNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGRILSLSDKL  196

Query  128  SFFSIVFKK  102
            S F + FKK
Sbjct  197  SPFLVFFKK  205



>ref|XP_006493433.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=221

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 80/185 (43%), Gaps = 23/185 (12%)
 Frame = -1

Query  614  PVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PLSDGHPI  444
            PVLD  G +LRAG  YYI  +  G  G L +  R +   + TC   ++  +    +G P+
Sbjct  31   PVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRRN---NKTCPLDVVQEQHSFKNGLPV  87

Query  443  RIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFVP---  276
               P +P   VV  S         D    C  +  W +  ++A+ G +++ T        
Sbjct  88   TFSPVNPKKGVVRES--TDLNIKFDAATSCAQSTVWKLDNFDAAFGQWLVTTGGVEGNPG  145

Query  275  --SLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLRLALSENSFFS  117
              ++ + F IE       YK  YCP    F    C +VG+ + G  R  RLALS+  F  
Sbjct  146  PRTMRNWFKIEKF--FGDYKLVYCPSVCNFCRGLCRDVGIFINGGVR--RLALSDVPFKV  201

Query  116  IVFKK  102
            +  KK
Sbjct  202  VSSKK  206



>ref|XP_006495063.1| PREDICTED: miraculin-like [Citrus sinensis]
Length=206

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 54/189 (29%), Positives = 83/189 (44%), Gaps = 24/189 (13%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSR-PLSD  456
            AS  PVLD  G +LRAG  YYI  +  G  G L +  R +   + TC   ++  +    +
Sbjct  27   ASPDPVLDIAGKQLRAGSKYYILPVTKGRGGGLTLAGRSN---NKTCPLDVVQEQHSFRN  83

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFV  279
            G P+   P +P   VV  S         D    C  +  W +  ++ + G +++ T    
Sbjct  84   GLPVTFSPVNPKKGVVRES--TDLNIKFDAATSCAQSTVWKLDNFDTAFGQWLVTTGGVE  141

Query  278  P-----SLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGL-VFGPFRNLRLALSEN  129
                  ++ + F IE    +  YK  +CP    F    C +VG+ + G  R  RLALS+ 
Sbjct  142  GNPGPRTMRNWFKIEKF--YGDYKLVFCPSVCNFCRGLCRDVGIFINGGVR--RLALSDV  197

Query  128  SFFSIVFKK  102
                +VFKK
Sbjct  198  P-LKVVFKK  205



>ref|XP_004235413.1| PREDICTED: aspartic protease inhibitor 1-like [Solanum lycopersicum]
Length=221

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 58/210 (28%), Positives = 91/210 (43%), Gaps = 27/210 (13%)
 Frame = -1

Query  677  THSSFNPIRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSA  498
            + +S NPI LP       SG PVLDT G E+ +  +Y I S    GAL   V +    ++
Sbjct  23   SFTSQNPIELPNDS---TSGKPVLDTSGKEVTSHSSYRIIS-AFWGALGGDVYLGESPNS  78

Query  497  TCQTRLLLSRPLSD----GHPIRIRPADPNAPVVLTSRLQSFESIVDMP--QVCLGNVYW  336
                   + R  SD    G P++  P          S  + F    D+P  ++C+    W
Sbjct  79   DAPCPNGVFRYNSDRGPRGTPVKFIPHSEGM-----SENKLFNIQFDIPTFRLCVKYTIW  133

Query  335  AI-RYEASSGDYILNTTQFVPSLSSQFMIEVVPEHKAYKFT-------YCPF--GGHKCY  186
             +  Y  + G  +L T   +    S +  ++VP    Y          +CPF   G  C 
Sbjct  134  KVGDYNETLGGVLLETGGSIGQRDSSYF-KIVPSKLGYNLVLCDPTPIFCPFCRKGQLCV  192

Query  185  NVGLVFGPFRNLRLALSENSFFSIVFKKAR  96
            NVG+VF   R  RLAL+++    ++F++ +
Sbjct  193  NVGVVFQDGRR-RLALTKDQPLDVLFEEIK  221



>ref|XP_004137534.1| PREDICTED: miraculin-like [Cucumis sativus]
 ref|XP_004165460.1| PREDICTED: miraculin-like [Cucumis sativus]
 gb|KGN64217.1| Tumor-related protein [Cucumis sativus]
Length=206

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 53/197 (27%), Positives = 87/197 (44%), Gaps = 22/197 (11%)
 Frame = -1

Query  656  IRLPTADVAVASGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQTRLL  477
            IR  TAD   AS   VLD DG +LRAG  YYI  +       + +      S  C   ++
Sbjct  21   IRFSTAD---ASPEAVLDIDGKKLRAGVNYYILPVFRGRGGGLTLGN--LQSEKCPLNVV  75

Query  476  LSR-PLSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDY  303
              +  + +G P    P +P   VV  S   + +   +   +C+ +  W + +++ S+G +
Sbjct  76   QEQLEVMNGFPTTFHPVNPKKGVVRVSTDLNVQ--FEASTICVTSTVWKLDKFDESTGQW  133

Query  302  ILNT-----TQFVPSLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGLVFGPFRNL  150
            ++          V ++ + F IE     K YK  +CP    F    C ++G+ F      
Sbjct  134  LVTIGGSRGNPGVETVDNWFKIE--KHGKDYKLVFCPTVCNFCKVMCRDIGIFFKNGER-  190

Query  149  RLALSENSFFSIVFKKA  99
             LALS+   F ++FKK 
Sbjct  191  ALALSDTP-FPVMFKKV  206



>emb|CAI77772.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77776.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77780.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77781.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77791.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77802.1| kunitz trypsin inhibitor [Populus tremula]
Length=213

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/192 (30%), Positives = 82/192 (43%), Gaps = 28/192 (15%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQT----RLLLSRP  465
            A+  PVLD  G+EL+AG  Y I+SI  G  G           VSAT +T     +  S  
Sbjct  25   ANTEPVLDIQGEELKAGTEYIISSIFWGAGGG---------DVSATNKTCPDDVIQYSLD  75

Query  464  LSDGHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQ  285
            L  G P+   PA     V+  S   + +    + + C  +  W I+  ++S    L TT 
Sbjct  76   LLQGLPVTFSPASSEDDVIRVSTDLNIK--FSIKKACDRSSVWKIQKSSNSEVQWLVTTG  133

Query  284  ------FVPSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLALS  135
                     + ++ F IE       YK  YCP         C +VG+ F   R   L+LS
Sbjct  134  GEEGNPGCDTFTNWFKIEKGAGILGYKLVYCPEDICPSVGLCRDVGIYFESNRGRILSLS  193

Query  134  EN-SFFSIVFKK  102
            +  S F ++FKK
Sbjct  194  DKLSPFLVLFKK  205



>ref|XP_003532237.1| PREDICTED: trypsin inhibitor A-like [Glycine max]
Length=213

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 78/185 (42%), Gaps = 27/185 (15%)
 Frame = -1

Query  623  SGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQTRLLLSRPLSDGHPI  444
            S T V+DTDGD L+   TY+I S+  PG    GV      + TC        PL+    +
Sbjct  22   STTAVVDTDGDILQNPGTYFILSVFRPGG---GVEFAATGNETC--------PLTVVQTL  70

Query  443  RIRPADPNAPVVLTSRL--------QSFESIVDMPQVCLGN-VYWAIRYEASSGDYILNT  291
              R      P +L+SRL        Q F  +  +   C      W I  E       +  
Sbjct  71   FGR----GFPAILSSRLRIPFIGEGQLFSILFRIVPWCATTPSKWTI-VEGLPESPAVKL  125

Query  290  TQFVPSLSSQFMIEVV-PEHKAYKFTYCPFGGH-KCYNVGLVFGPFRNLRLALSENSFFS  117
            T +  ++  +F IE   P H  Y   +CP G   KC ++G+ F    N RL +SE +   
Sbjct  126  TGYDNTVPGEFKIEKANPFHNDYTLLFCPAGEESKCGHIGIHFDDDGNRRLVVSEENILR  185

Query  116  IVFKK  102
            + F+K
Sbjct  186  VQFQK  190



>emb|CDY11118.1| BnaC06g23700D [Brassica napus]
Length=201

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/179 (28%), Positives = 78/179 (44%), Gaps = 14/179 (8%)
 Frame = -1

Query  611  VLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQTRLLL-SRPLSDGHPIRIR  435
            VLD DGD +  G  Y +  I   G    GV +       C   ++  S  + +G P++  
Sbjct  23   VLDIDGDIIFRGSYYVLPVIRGRGG---GVTLQGRGGELCPYDIVQESSEVDEGIPVKFS  79

Query  434  PADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAI-RYEASSGDYILNTTQFVPSLSSQF  258
               P    V  S+  + E  V++  +C+ + YW +  ++    +Y +   +   S  S F
Sbjct  80   NWRPRVAFVPESQDLNIEMDVEV-TICIQSTYWRVGEFDEERKEYFVVAGR-QDSPKSFF  137

Query  257  MIEVVPEHKAYKFTYCP----FGGHKCYNVGLVFGPFRNLRLALSENSFFSIVFKKARL  93
             IE       YKF +CP     G  +C NVG+        RLALS   F  ++FKKA +
Sbjct  138  QIE--KSGDDYKFVFCPPACDSGRPRCRNVGIFVDEIGVRRLALSSEPFL-VMFKKANV  193



>ref|XP_002888920.1| hypothetical protein ARALYDRAFT_476458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65179.1| hypothetical protein ARALYDRAFT_476458 [Arabidopsis lyrata subsp. 
lyrata]
Length=209

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 53/192 (28%), Positives = 81/192 (42%), Gaps = 32/192 (17%)
 Frame = -1

Query  611  VLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLL-SRPLSDGHPIR  441
            VLD DG+ +   E+YY+  +  G  G L +  R        C   ++  S  L +G P++
Sbjct  23   VLDIDGNTIFH-ESYYVLPVIRGRGGGLTLAGRG----GELCPLDIVQESSELEEGIPVK  77

Query  440  IRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQFV------  279
                      V  S   + E+ +    +C+ + YW +      GD+     Q+       
Sbjct  78   FSNWRLKVAFVPESENLNIETDIG-ATICVQSTYWWV------GDFDHERKQYFVVAGPK  130

Query  278  ------PSLSSQFMIEVVPEHKAYKFTYCP----FGGHKCYNVGLVFGPFRNLRLALSEN  129
                   SL S F IE   +  AYKF +CP     G  KC +VG+        RLALS+ 
Sbjct  131  PEGFGQDSLKSFFKIEKSGDLGAYKFVFCPRTCDSGSPKCSDVGIFVDELGVRRLALSDE  190

Query  128  SFFSIVFKKARL  93
             F  ++FKKA +
Sbjct  191  PFL-VMFKKANV  201



>ref|XP_007152537.1| hypothetical protein PHAVU_004G138500g [Phaseolus vulgaris]
 gb|ESW24531.1| hypothetical protein PHAVU_004G138500g [Phaseolus vulgaris]
Length=205

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 55/196 (28%), Positives = 91/196 (46%), Gaps = 30/196 (15%)
 Frame = -1

Query  635  VAVASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLLLSRP-  465
            +AVA+  PV+DT G +LR G  YYI  +  G  G L V    +     TC   ++  +P 
Sbjct  23   IAVAAPEPVVDTSGQKLRTGVKYYILPVFRGRGGGLTVSSSGN----NTCPLFVVQEKPE  78

Query  464  LSDGHPIRIRPADPNAPVVLTS---RLQSFESIV--DMPQVCLGNVYWAIRYEASSGDYI  300
            + +G P+   P +  + V+LTS    ++S+ +    D P V      W +  +  +G + 
Sbjct  79   VLNGTPVTFTPYNAKSGVILTSTDLNIKSYGTTTSCDKPPV------WKL-LKVLTGVWF  131

Query  299  LNTTQF-----VPSLSSQFMIEVVPEHKAYKFTYCPF---GGHKCYNVGLVFGPFRNLRL  144
            L+T        + ++ + F IE     K Y  ++CP        C  +GL  G   N  L
Sbjct  132  LSTGGVEGNPGIDTIVNWFKIE--KAEKDYVISFCPSVCKCQTLCRELGLYVGDDGNKHL  189

Query  143  ALSENS-FFSIVFKKA  99
            +LS+    F ++FK+A
Sbjct  190  SLSDKVPSFRVMFKRA  205



>emb|CAI77769.1| kunitz trypsin inhibitor [Populus tremula]
 emb|CAI77787.1| kunitz trypsin inhibitor [Populus tremula]
Length=212

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 81/189 (43%), Gaps = 23/189 (12%)
 Frame = -1

Query  626  ASGTPVLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATCQTRLL-LSRPLSD  456
            AS  PVLD  G+EL+AG  Y I+SI  G  G  +         + TC   ++  S  L  
Sbjct  25   ASTEPVLDIQGEELKAGTEYIISSIFWGAGGGDVAA------TNKTCPDDVIQYSLDLLQ  78

Query  455  GHPIRIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQ---  285
            G P+   PA     V+  S   + +    + + C  +  W I+  ++S    L TT    
Sbjct  79   GLPVTFSPASSEDDVIRVSTDLNIK--FSIKKACDRSSVWKIQKSSNSEVQWLVTTGGEE  136

Query  284  ---FVPSLSSQFMIEVVPEHKAYKFTYCPF----GGHKCYNVGLVFGPFRNLRLALSEN-  129
                  + ++ F IE       YK  YCP         C +VG+ F   R   L+LS+  
Sbjct  137  GNPGCDTFTNWFKIEKAGVL-GYKLVYCPEDICPSVGLCRDVGIYFESNRGRILSLSDKL  195

Query  128  SFFSIVFKK  102
            S F +VFKK
Sbjct  196  SPFLVVFKK  204



>sp|P83594.1|IFXA_BAUUN RecName: Full=Factor Xa inhibitor BuXI [Bauhinia ungulata]
Length=172

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 52/175 (30%), Positives = 76/175 (43%), Gaps = 14/175 (8%)
 Frame = -1

Query  611  VLDTDGDELRAGETYYINSI--GNPGALIVGVRVDWPVSATC-QTRLLLSRPLSDGHPIR  441
            VLDTDG  +  G  YYI     GN G L +  RV      TC  T +  S  +S+G P+ 
Sbjct  3    VLDTDGKPVNNGGQYYIIPAFRGNGGGLEL-TRVG---RETCPHTVVQASSEISNGLPVM  58

Query  440  IRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEAS-SGDYILNTTQFVPSLSS  264
            I  A P    + T+   S +  + +P       YW I  ++   G   +   +  P    
Sbjct  59   I-AALPRTMFISTAWRVSIQ-FLKVPTCTPKPSYWHIPQDSDMEGSVEVRVDERFPL---  113

Query  263  QFMIEVVPEHKAYKFTYCPFGGHKCYNVGLVFGPFRNLRLALSENSFFSIVFKKA  99
            +F IE V E  AYK  +CP     C ++G+      N RL + +     + FK+A
Sbjct  114  EFRIEKVSE-DAYKLMHCPSSSDSCRDLGIAIDEENNRRLVVRDGKPLLVRFKEA  167



>ref|XP_003532236.1| PREDICTED: trypsin inhibitor A-like [Glycine max]
 gb|KHN01862.1| Trypsin inhibitor A [Glycine soja]
Length=213

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 49/176 (28%), Positives = 78/176 (44%), Gaps = 9/176 (5%)
 Frame = -1

Query  623  SGTPVLDTDGDELRAGETYYINSIGNPGALIVGVRVDWPVSATCQTRLLLSRPLSDGHPI  444
            S T V+DT+GD L+   TY+I S+  PG    GV      + TC   ++ +     G P+
Sbjct  22   STTAVVDTNGDILQNPGTYFILSVFRPGG---GVEFAATGNETCPLTVVQTL-FGRGFPV  77

Query  443  RIRPADPNAPVVLTSRLQSFESIVDMPQVCLGNVYWAIRYEASSGDYILNTTQFVPSLSS  264
             I  +    P++   +L S    + +P        W I  E       +  T +  ++  
Sbjct  78   -ILSSQLRIPIIGEGQLFSILFRI-VPWCATTPSKWTI-VEGLPESPAVKLTGYDNTVPG  134

Query  263  QFMIEVV-PEHKAYKFTYCPFGGH-KCYNVGLVFGPFRNLRLALSENSFFSIVFKK  102
            +F IE   P H  Y   +CP G   KC ++G+ F    N RL +SE +   + F+K
Sbjct  135  EFKIEKANPFHNDYTLLFCPAGEESKCGHIGIHFDDDGNRRLVVSEENILRVQFQK  190



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1067213240424